3GYPA

Rtt106p
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
237
structure length
225
Chain Sequence
EISETNTIFKLEGVSVLSPLRKKLDLVFYLSNVDGSPVITLLKGNDRELSIYQLNKNIKMASFLPVPEKPNLIYLFMTYTSCEDNKFSEPVVMTLNKENTLNQFKNLGLLDSNVTDFEKCVEYIRKQAILTGFKISNPFVNSFHLQCHRGTKEGTLYFLPDHIIFGFKKPILLFDASDIESITYSSITRLTFNASLVTKDGEKYEFSMTDQTEYAKIDDYVKRKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone chaperone RTT106
publication title Structural analysis of Rtt106p reveals a DNA-binding role required for heterochromatin silencing
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Chaperone
total genus 43
structure length 225
sequence length 237
ec nomenclature
pdb deposition date 2009-04-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08512 Rtt106 Histone chaperone Rttp106-like
A PF18469 PH_18 Pleckstrin homology domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 3gypA02
2.30.29.120 Mainly Beta Roll PH-domain like PH-domain like 3gypA01
2DLWA 4K2OA 4WSFA 3WYFB 1H4RA 2I5FA 1ZC3B 1P3RA 2COCA 5FI0A 4NY0A 1WG7A 2COAA 5FI1A 4CHMA 1EGXA 2DFKA 1UNQA 2OQBA 1XODA 5DIFB 1QQGA 1MK7B 3FSSA 4CYEA 1ISNA 2Y7BA 1V5MA 2ROZB 2W2WA 4DXAB 2N0YA 3CIKA 2D10A 3PSCA 3U8ZA 3SNHA 2ROVA 2K00A 2VRWB 4HAZB 1MIZB 2K2JA 2J0JA 1XCGA 1X1GA 2X18A 3U7DA 3ML4A 3ODOA 2P8VA 2CY4A 4F7UP 2CY5A 1WGUA 5D27A 2DA0A 1WGQA 1WJMA 1BTKA 2YSZA 3TCAA 5D3WA 2DX1A 3AU4A 1XKEA 3ODXA 4TYZA 3A8PA 3A98B 4ZRIA 2YS5A 2VSZA 2YVCA 5CLQB 4MT7A 4HDQA 3WA0A 5L81A 1U5FA 3ZVRA 2D9VA 5DHAB 3PEGA 1U5GA 1FOEA 2P0HA 4DBBA 3HK0A 3HW2B 1NI2A 4A6FB 2DX5A 3RCPA 5GOWB 3KRWA 1V5PA 1X1FA 5C5BB 1KI1B 4HDOA 1M7EA 5LONB 1J19A 3DXCA 1X05A 1MAIA 4A6HA 4Y94A 1DBHA 4IFSA 2GCLA 4YL8A 2H7DA 1U5DA 4EJNA 2L1CA 1ZSQA 3A8QA 1DROA 2EMSA 3KZ1A 1B55A 3D8DA 4DX8A 2DKPA 1AQCA 2M38A 4F7GA 4D0NB 2Q13A 3SUZA 2MDXA 3P7ZA 4IOYX 4TKNA 2I1KA 4PNKA 2Y8FA 1SHCA 2COFA 1XR0B 2NZ8B 4HATB 5KQ4A 3MDBC 3IVFA 1PLSA 1TQZA 1U5EA 5C6RA 3CXBB 5HE0A 1U27A 1H10A 1UEFA 2FJLA 3N7CA 1LW3A 2YT1A 5HE3A 3GYOA 2DHJA 2P0FA 2V76A 1LB1A 5CLLB 1V88A 2MFQA 1XD4A 4P7IA 1BAKA 2E2XA 1Q67A 4KAXB 4NSWA 2AEHA 2YS1A 3QIJA 5KCVA 4GXBA 2D9ZA 2I5CA 2W2XC 3OANA 2RGNB 2IFSA 4DX90 1TXDA 1RRPB 1WJ1A 3TO1A 1W1DA 3PZDA 4GMVA 3ZDTA 4L6EA 1GC7A 1XX0A 1PFJA 2PZ1A 3PVLA 2IYBA 1KZ7A 2D9XA 3LJUX 1I2HA 5D3XA 1P6SA 4A6FA 5LOPB 2DN6A 5C5BA 1Z87A 3GYPA 3ULCA 5J3TA 1W1GA 4K2PA 4EKUA 3NSUA 5DI9B 1X86A 1N3HA 2XQNM 3HQCA 5KQ1A 1OQNA 4GN1A 1FGYA 1J0WA 1ZM0A 1K5GB 4GZUA 4HHVA 5DHFB 1NTYA 1M7RA 2K2UA 1KZGA 1QC6A 5HE1A 1FHOA 4GMXB 2Z0PA 3M1IB 1GC6A 1DDWA 4GPTB 3F5RA 2MKRA 1OY2A 1X11A 4Z2MB 3FM8C 1OMWA 1I7AA 5HE2A 2LULA 2DTCA 2HE7A 1DDVA 2LOZA 1UPQA 3PVUA 4HAWB 1FAOA 3DXDA 2R0DA 1Y19B 4HAYB 2P0DA 1UPRA 2UZSA 2D9YA 2I1JA 4HB0B 3MPXA 1P5TA 2CAYA 1V89A 4HB4B 2HTHB 4KVGB 2MWNB 4H8SA 2D2QA 2GJYA 4HB2B 2J0MA 3VOQA 1FHXA 1MPHA 1NU2A 2UVMA 5JLJB 1WI1A 1UNRA 2YS3A 1DYNA 3QBVB 4B6HA 5D3YA 2RUKB 1MIXA 2LYDA 2Z0OA 3AU5A 3BJIA 3F0WA 3VIAA 4K17A 2LG1A 2LKOA 3PP2A 5C16A 3SO6A 2GCJA 2QKMA 2ELBA 3QWMA 1GG3A 2Z0QA 3TW1A 1UNPA 3ODWA 1MK9B 2R09A 2BCJA 2DHKA 2QKLA 2EMTA 2J59M 1TJ6A 2EC1A 2NMBA 4HAUB 2KCJA 2RNRB 2DYNA 1DDMA 4KHOA 3KRXA 1EAZA 4ZRKA 3O96A 3D8FA 4EMOA 1MKEA 1V61A 2LOXA 3TFMA 2CRFA 4KHBB 2YF0A 2KUPA 3SYXA 2AL6A 1EVHA 5EFXA 1PMSA 2YT0A 2OTXA 4WVFB 3KSYA 4BBKA 2RSGA 4A6KA 1BTNA 2DKQA 1WVHA 4K81A 2G35A 3PVWA 3KY9A 5JHGA 4YONA 3P6AA 5J3YA 5J3QA 1IRSA 1ZVRA 2W2XD 2RVBB 5D3VA 3T06A 4MK0A 3X23A 2CODA 1FGZA 1Y5OA 1SGHA 2KGXB 3SV1A 4KHAA 1NTVA 2ZPYA 4MY6A 2GS0A 1FHWA 3BINA 3TVVA 1V5UA 2RLOA 2ELAA 2D9WA 4Z2NA 1W1HA 4PQ0A 2JP2A 2N23A 4HAVB 2D4QA 3D8EA 2EJ8A 2J0KA 2M14A 4C0AA 2UZRA 5JHHA 4F7HA 3V5WA 3ULBA 2D11A 4HAXB 3FEHA 2ADZA 4A5KA 5DH9B 1RJ2A 2VKIA 4ZRJA 1ZC4B 1U29A 2DHIA 3AJ4A 1FB8A 4IAPA 1BWNA 4HB3B 2H7EA 5JP4A 2Y8GA 4XWXA 1AWEA 1U2BA 4WJ7A 3UZTA 2YRYA 5C79A 1K5DB 1EF1A 3PG7A 3DXEA 3G9WA 1E5WA 4CHJA 2DYQA 2L2IA
chains in the Genus database with same CATH superfamily
2DLWA 4K2OA 4WSFA 3WYFB 1H4RA 2I5FA 1ZC3B 2Z14A 1P3RA 2COCA 5FI0A 4NY0A 1WG7A 2COAA 5FI1A 4CHMA 1EGXA 2DFKA 1UNQA 2OQBA 1XODA 5DIFB 1QQGA 1MK7B 3FSSA 4CYEA 1ISNA 2Y7BA 1V5MA 3NWDA 2ROZB 2KIEA 2W2WA 4DXAB 2N0YA 3CIKA 2D10A 3PSCA 3U8ZA 3SNHA 2ROVA 2K00A 2VRWB 4HAZB 1MIZB 4GNKB 2K2JA 2J0JA 4HSIA 1XCGA 1X1GA 4QXAB 2X18A 3U7DA 3ML4A 4KHBA 3ODOA 2P8VA 2CY4A 4F7UP 2CY5A 1WGUA 1T77A 5D27A 2DA0A 1WGQA 1WJMA 1BTKA 2YSZA 3TCAA 5D3WA 2DX1A 3AU4A 1XKEA 3ODXA 4TYZA 3A8PA 3A98B 4ZRIA 2YS5A 2VSZA 2YVCA 5CLQB 4MT7A 4HDQA 3WA0A 5L81A 1U5FA 3ZVRA 2D9VA 5DHAB 3PEGA 2KR0A 1U5GA 1FOEA 2P0HA 4DBBA 3HK0A 5M4YB 3HW2B 1NI2A 4A6FB 2DX5A 3RCPA 5GOWB 3KRWA 1V5PA 1X1FA 5C5BB 1KI1B 4HDOA 2Z59A 4D6WA 1M7EA 2YT2A 5LONB 5LG4B 1J19A 3DXCA 1X05A 1MAIA 3NW8A 3HSAA 4A6HA 4Y94A 1DBHA 4IFSA 2Z4DA 2GCLA 4YL8A 2H7DA 1U5DA 4EJNA 2L1CA 1ZSQA 1MI1A 3A8QA 1DROA 2EMSA 3KZ1A 1B55A 3D8DA 4DX8A 2DKPA 4CSQA 1AQCA 2M38A 4F7GA 4D0NB 2Q13A 3SUZA 2MDXA 3P7ZA 4IOYX 4TKNA 2I1KA 2K8EA 4PNKA 2Y8FA 1SHCA 2COFA 1XR0B 2NZ8B 4HATB 5KQ4A 3MDBC 3IVFA 3HIEA 1PLSA 1TQZA 3B77A 1U5EA 5C6RA 3CXBB 5HE0A 1U27A 1H10A 4L1RA 1UEFA 2FJLA 3N7CA 1LW3A 2YT1A 5HE3A 2ZKMX 3GYOA 2DHJA 2P0FA 2Z13A 3FVCA 2V76A 1LB1A 5CLLB 1V88A 5IRSA 2MFQA 1XD4A 3DCXA 4P7IA 1BAKA 2E2XA 3NWAA 1Q67A 4KAXB 4NSWA 2AEHA 2YS1A 3QIJA 5KCVA 4GXBA 2D9ZA 2I5CA 2W2XC 3OANA 2RGNB 2K49A 2IFSA 4DX90 1TXDA 1RRPB 1WJ1A 3TO1A 1W1DA 3PZDA 4GMVA 3ZDTA 2KIGA 4L6EA 1GC7A 1XX0A 1PFJA 2PZ1A 3PVLA 2IYBA 1KZ7A 2D9XA 3LJUX 1I2HA 5D3XA 1P6SA 4A6FA 5LOPB 2DN6A 5C5BA 1Z87A 2R2YA 3GYPA 4QJ5B 3ULCA 5J3TA 1W1GA 4K2PA 4EKUA 3NSUA 5DI9B 1X86A 1N3HA 2XQNM 3HQCA 5I2SA 5KQ1A 1OQNA 4GN1A 1FGYA 1J0WA 1ZM0A 1K5GB 4GZUA 4HHVA 5DHFB 1NTYA 1M7RA 2K2UA 1KZGA 1QC6A 5HE1A 1FHOA 4GMXB 2Z0PA 3M1IB 1GC6A 1DDWA 4GPTB 3F5RA 2MKRA 1OY2A 1X11A 4Z2MB 3FM8C 1OMWA 1ZYIA 1I7AA 5HE2A 2LULA 2DTCA 2HE7A 1DDVA 4GOUA 2LOZA 1UPQA 3PVUA 4HAWB 1FAOA 3DXDA 2R0DA 3U12A 1Y19B 4HAYB 2P0DA 1UPRA 2UZSA 2D9YA 2I1JA 4QJ4B 4HB0B 3MPXA 1P5TA 2CAYA 2RRFA 1V89A 4HB4B 2HTHB 4KVGB 3A58A 2MWNB 4H8SA 2D2QA 2GJYA 3OHMB 4HB2B 2J0MA 3VOQA 1FHXA 1MPHA 1NU2A 2UVMA 5JLJB 1WI1A 1UNRA 2YS3A 1DYNA 3QBVB 4B6HA 5D3YA 2RUKB 1MIXA 2LYDA 2Z0OA 3AU5A 3BJIA 3F0WA 2GUMA 3VIAA 4K17A 2LG1A 2LKOA 3PP2A 5C16A 3SO6A 2GCJA 2QKMA 2ELBA 2NBVA 3QWMA 1GG3A 2Z0QA 3TW1A 1UNPA 3ODWA 1MK9B 2R09A 4OSNA 2BCJA 2DHKA 2QKLA 2EMTA 2J59M 1TJ6A 2EC1A 2NMBA 4HAUB 4DIXA 2KCJA 2RNRB 2DYNA 1DDMA 4KHOA 2FJUB 3KRXA 1EAZA 4ZRKA 3O96A 3D8FA 4EMOA 1MKEA 1V61A 2LOXA 3TFMA 2CRFA 4KHBB 5I2MA 2YF0A 2KUPA 3SYXA 2AL6A 1EVHA 5EFXA 1PMSA 2YT0A 2OTXA 4WVFB 3KSYA 4BBKA 2RSGA 4A6KA 1BTNA 4QJ3B 2DKQA 1WVHA 4K81A 2G35A 3PVWA 3KY9A 5JHGA 4YONA 3P6AA 5J3YA 5J3QA 1IRSA 1ZVRA 2W2XD 2RVBB 5D3VA 3T06A 4MK0A 3X23A 2CODA 1FGZA 1Y5OA 1SGHA 2KGXB 3SV1A 4KHAA 1NTVA 2ZPYA 4MY6A 2GS0A 1FHWA 3BINA 3TVVA 1V5UA 2RLOA 2ELAA 4OT1A 2D9WA 4Z2NA 1W1HA 4PQ0A 2JP2A 2N23A 4HAVB 2D4QA 3D8EA 2EJ8A 2J0KA 2M14A 4C0AA 2UZRA 5JHHA 4F7HA 3V5WA 3ULBA 2D11A 4HAXB 3FEHA 2ADZA 4A5KA 5DH9B 1RJ2A 2VKIA 4ZRJA 1ZC4B 1U29A 2DHIA 3AJ4A 1FB8A 3NWFA 4IAPA 1BWNA 4HB3B 2H7EA 5JP4A 2Y8GA 4XWXA 1AWEA 1U2BA 4WJ7A 3UZTA 2KUQA 2YRYA 5C79A 1K5DB 1EF1A 3PG7A 3DXEA 3G9WA 1E5WA 4CHJA 2DYQA 2L2IA
chains in the Genus database with same CATH topology
2DLWA 4K2OA 4WSFA 3WYFB 1H4RA 2I5FA 1ZC3B 2Z14A 1P3RA 2COCA 5FI0A 4NY0A 1WG7A 2COAA 5FI1A 4CHMA 1EGXA 2DFKA 1UNQA 2OQBA 1XODA 5DIFB 1QQGA 1MK7B 3FSSA 4CYEA 1ISNA 2Y7BA 1V5MA 3NWDA 2ROZB 2W2WA 2KIEA 4DXAB 2N0YA 3CIKA 2D10A 3PSCA 3U8ZA 3SNHA 2ROVA 2K00A 2VRWB 4HAZB 1MIZB 4GNKB 2K2JA 2J0JA 4HSIA 1XCGA 1X1GA 4QXAB 2X18A 3U7DA 3ML4A 4KHBA 3ODOA 2P8VA 2CY4A 4F7UP 2CY5A 1WGUA 5D27A 2DA0A 1WGQA 1WJMA 1BTKA 2YSZA 3TCAA 5D3WA 2DX1A 3AU4A 1XKEA 3ODXA 4TYZA 3A8PA 3A98B 4ZRIA 2YS5A 2VSZA 2YVCA 5CLQB 4MT7A 4HDQA 3WA0A 5L81A 1U5FA 3ZVRA 2D9VA 5DHAB 3PEGA 2KR0A 1U5GA 1FOEA 2P0HA 4DBBA 3HK0A 5M4YB 3HW2B 1NI2A 4A6FB 2DX5A 3RCPA 5GOWB 3KRWA 1V5PA 1X1FA 5C5BB 1KI1B 4HDOA 2Z59A 4D6WA 1M7EA 2YT2A 5LONB 5LG4B 1J19A 3DXCA 1X05A 1MAIA 3NW8A 4A6HA 4Y94A 1DBHA 4IFSA 2Z4DA 2GCLA 4YL8A 2H7DA 1U5DA 4EJNA 2L1CA 1ZSQA 3A8QA 1DROA 2EMSA 3KZ1A 1B55A 3D8DA 4DX8A 2DKPA 4CSQA 1AQCA 2M38A 4F7GA 4D0NB 2Q13A 3SUZA 2MDXA 3P7ZA 4IOYX 4TKNA 2I1KA 2K8EA 4PNKA 2Y8FA 1SHCA 2COFA 1XR0B 2NZ8B 4HATB 5KQ4A 3MDBC 3IVFA 3HIEA 1PLSA 1TQZA 1U5EA 5C6RA 3CXBB 5HE0A 1U27A 1H10A 4L1RA 1UEFA 2FJLA 3N7CA 1LW3A 2YT1A 5HE3A 3GYOA 2ZKMX 2DHJA 2P0FA 2Z13A 3FVCA 2V76A 1LB1A 5CLLB 1V88A 5IRSA 2MFQA 1XD4A 4P7IA 1BAKA 2E2XA 3NWAA 1Q67A 4KAXB 4NSWA 2AEHA 2YS1A 3QIJA 5KCVA 4GXBA 2D9ZA 2I5CA 2W2XC 3OANA 2RGNB 2K49A 2IFSA 4DX90 1TXDA 1RRPB 1WJ1A 3TO1A 1W1DA 3PZDA 4GMVA 3ZDTA 2KIGA 4L6EA 1GC7A 1XX0A 1PFJA 2PZ1A 3PVLA 2IYBA 1KZ7A 2D9XA 3LJUX 1I2HA 5D3XA 1P6SA 4A6FA 5LOPB 2DN6A 5C5BA 1Z87A 3GYPA 2R2YA 4QJ5B 3ULCA 5J3TA 1W1GA 4K2PA 4EKUA 3NSUA 5DI9B 1X86A 1N3HA 2XQNM 3HQCA 5KQ1A 5I2SA 1OQNA 4GN1A 1FGYA 1J0WA 1ZM0A 1K5GB 4GZUA 4HHVA 5DHFB 1NTYA 1M7RA 2K2UA 1KZGA 1QC6A 5HE1A 1FHOA 4GMXB 2Z0PA 3M1IB 1GC6A 1DDWA 4GPTB 3F5RA 2MKRA 1OY2A 1X11A 4Z2MB 3FM8C 1OMWA 1ZYIA 1I7AA 5HE2A 2LULA 2DTCA 2HE7A 1DDVA 4GOUA 2LOZA 1UPQA 3PVUA 4HAWB 1FAOA 3DXDA 2R0DA 3U12A 1Y19B 4HAYB 2P0DA 1UPRA 2UZSA 2D9YA 2I1JA 4QJ4B 4HB0B 3MPXA 1P5TA 2CAYA 2RRFA 1V89A 4HB4B 2HTHB 4KVGB 3A58A 2MWNB 4H8SA 2D2QA 2GJYA 3OHMB 4HB2B 2J0MA 3VOQA 1FHXA 1MPHA 1NU2A 2UVMA 5JLJB 1WI1A 1UNRA 2YS3A 1DYNA 3QBVB 4B6HA 5D3YA 2RUKB 1MIXA 2LYDA 2Z0OA 3AU5A 3BJIA 3F0WA 2GUMA 3VIAA 4K17A 2LG1A 2LKOA 3PP2A 5C16A 3SO6A 2GCJA 2QKMA 2ELBA 2NBVA 3QWMA 1GG3A 2Z0QA 3TW1A 1UNPA 3ODWA 1MK9B 2R09A 4OSNA 2BCJA 2DHKA 2QKLA 2EMTA 2J59M 1TJ6A 2EC1A 2NMBA 4HAUB 4DIXA 2KCJA 2RNRB 2DYNA 1DDMA 4KHOA 2FJUB 3KRXA 1EAZA 4ZRKA 3O96A 3D8FA 4EMOA 1MKEA 1V61A 2LOXA 3TFMA 2CRFA 4KHBB 5I2MA 2YF0A 2KUPA 3SYXA 2AL6A 1EVHA 5EFXA 1PMSA 2YT0A 2OTXA 4WVFB 3KSYA 4BBKA 2RSGA 4A6KA 1BTNA 4QJ3B 2DKQA 1WVHA 4K81A 2G35A 3PVWA 3KY9A 5JHGA 4YONA 3P6AA 5J3YA 5J3QA 1IRSA 1ZVRA 2W2XD 2RVBB 5D3VA 3T06A 4MK0A 3X23A 2CODA 1FGZA 1Y5OA 1SGHA 2KGXB 3SV1A 4KHAA 1NTVA 2ZPYA 4MY6A 2GS0A 1FHWA 3BINA 3TVVA 1V5UA 2RLOA 2ELAA 4OT1A 2D9WA 4Z2NA 1W1HA 4PQ0A 2JP2A 2N23A 4HAVB 2D4QA 3D8EA 2EJ8A 2J0KA 2M14A 4C0AA 2UZRA 5JHHA 4F7HA 3V5WA 3ULBA 2D11A 4HAXB 3FEHA 2ADZA 4A5KA 5DH9B 1RJ2A 2VKIA 4ZRJA 1ZC4B 1U29A 2DHIA 3AJ4A 1FB8A 4IAPA 3NWFA 1BWNA 4HB3B 2H7EA 5JP4A 2Y8GA 4XWXA 1AWEA 1U2BA 4WJ7A 3UZTA 2YRYA 2KUQA 5C79A 1K5DB 1EF1A 3PG7A 3DXEA 3G9WA 1E5WA 4CHJA 2DYQA 2L2IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DLW A;  4K2O A;  4WSF A;  3WYF B;  1H4R A;  2I5F A;  1ZC3 B;  1P3R A;  2COC A;  5FI0 A;  4NY0 A;  1WG7 A;  2COA A;  5FI1 A;  4CHM A;  1EGX A;  2DFK A;  1UNQ A;  2OQB A;  1XOD A;  5DIF B;  1QQG A;  1MK7 B;  3FSS A;  4CYE A;  1ISN A;  2Y7B A;  1V5M A;  2ROZ B;  2W2W A;  4DXA B;  2N0Y A;  3CIK A;  2D10 A;  3PSC A;  3U8Z A;  3SNH A;  2ROV A;  2K00 A;  2VRW B;  4HAZ B;  1MIZ B;  2K2J A;  2J0J A;  1XCG A;  1X1G A;  2X18 A;  3U7D A;  3ML4 A;  3ODO A;  2P8V A;  2CY4 A;  4F7U P;  2CY5 A;  1WGU A;  5D27 A;  2DA0 A;  1WGQ A;  1WJM A;  1BTK A;  2YSZ A;  3TCA A;  5D3W A;  2DX1 A;  3AU4 A;  1XKE A;  3ODX A;  4TYZ A;  3A8P A;  3A98 B;  4ZRI A;  2YS5 A;  2VSZ A;  2YVC A;  5CLQ B;  4MT7 A;  4HDQ A;  3WA0 A;  5L81 A;  1U5F A;  3ZVR A;  2D9V A;  5DHA B;  3PEG A;  1U5G A;  1FOE A;  2P0H A;  4DBB A;  3HK0 A;  3HW2 B;  1NI2 A;  4A6F B;  2DX5 A;  3RCP A;  5GOW B;  3KRW A;  1V5P A;  1X1F A;  5C5B B;  1KI1 B;  4HDO A;  1M7E A;  5LON B;  1J19 A;  3DXC A;  1X05 A;  1MAI A;  4A6H A;  4Y94 A;  1DBH A;  4IFS A;  2GCL A;  4YL8 A;  2H7D A;  1U5D A;  4EJN A;  2L1C A;  1ZSQ A;  3A8Q A;  1DRO A;  2EMS A;  3KZ1 A;  1B55 A;  3D8D A;  4DX8 A;  2DKP A;  1AQC A;  2M38 A;  4F7G A;  4D0N B;  2Q13 A;  3SUZ A;  2MDX A;  3P7Z A;  4IOY X;  4TKN A;  2I1K A;  4PNK A;  2Y8F A;  1SHC A;  2COF A;  1XR0 B;  2NZ8 B;  4HAT B;  5KQ4 A;  3MDB C;  3IVF A;  1PLS A;  1TQZ A;  1U5E A;  5C6R A;  3CXB B;  5HE0 A;  1U27 A;  1H10 A;  1UEF A;  2FJL A;  3N7C A;  1LW3 A;  2YT1 A;  5HE3 A;  3GYO A;  2DHJ A;  2P0F A;  2V76 A;  1LB1 A;  5CLL B;  1V88 A;  2MFQ A;  1XD4 A;  4P7I A;  1BAK A;  2E2X A;  1Q67 A;  4KAX B;  4NSW A;  2AEH A;  2YS1 A;  3QIJ A;  5KCV A;  4GXB A;  2D9Z A;  2I5C A;  2W2X C;  3OAN A;  2RGN B;  2IFS A;  4DX9 0;  1TXD A;  1RRP B;  1WJ1 A;  3TO1 A;  1W1D A;  3PZD A;  4GMV A;  3ZDT A;  4L6E A;  1GC7 A;  1XX0 A;  1PFJ A;  2PZ1 A;  3PVL A;  2IYB A;  1KZ7 A;  2D9X A;  3LJU X;  1I2H A;  5D3X A;  1P6S A;  4A6F A;  5LOP B;  2DN6 A;  5C5B A;  1Z87 A;  3GYP A;  3ULC A;  5J3T A;  1W1G A;  4K2P A;  4EKU A;  3NSU A;  5DI9 B;  1X86 A;  1N3H A;  2XQN M;  3HQC A;  5KQ1 A;  1OQN A;  4GN1 A;  1FGY A;  1J0W A;  1ZM0 A;  1K5G B;  4GZU A;  4HHV A;  5DHF B;  1NTY A;  1M7R A;  2K2U A;  1KZG A;  1QC6 A;  5HE1 A;  1FHO A;  4GMX B;  2Z0P A;  3M1I B;  1GC6 A;  1DDW A;  4GPT B;  3F5R A;  2MKR A;  1OY2 A;  1X11 A;  4Z2M B;  3FM8 C;  1OMW A;  1I7A A;  5HE2 A;  2LUL A;  2DTC A;  2HE7 A;  1DDV A;  2LOZ A;  1UPQ A;  3PVU A;  4HAW B;  1FAO A;  3DXD A;  2R0D A;  1Y19 B;  4HAY B;  2P0D A;  1UPR A;  2UZS A;  2D9Y A;  2I1J A;  4HB0 B;  3MPX A;  1P5T A;  2CAY A;  1V89 A;  4HB4 B;  2HTH B;  4KVG B;  2MWN B;  4H8S A;  2D2Q A;  2GJY A;  4HB2 B;  2J0M A;  3VOQ A;  1FHX A;  1MPH A;  1NU2 A;  2UVM A;  5JLJ B;  1WI1 A;  1UNR A;  2YS3 A;  1DYN A;  3QBV B;  4B6H A;  5D3Y A;  2RUK B;  1MIX A;  2LYD A;  2Z0O A;  3AU5 A;  3BJI A;  3F0W A;  3VIA A;  4K17 A;  2LG1 A;  2LKO A;  3PP2 A;  5C16 A;  3SO6 A;  2GCJ A;  2QKM A;  2ELB A;  3QWM A;  1GG3 A;  2Z0Q A;  3TW1 A;  1UNP A;  3ODW A;  1MK9 B;  2R09 A;  2BCJ A;  2DHK A;  2QKL A;  2EMT A;  2J59 M;  1TJ6 A;  2EC1 A;  2NMB A;  4HAU B;  2KCJ A;  2RNR B;  2DYN A;  1DDM A;  4KHO A;  3KRX A;  1EAZ A;  4ZRK A;  3O96 A;  3D8F A;  4EMO A;  1MKE A;  1V61 A;  2LOX A;  3TFM A;  2CRF A;  4KHB B;  2YF0 A;  2KUP A;  3SYX A;  2AL6 A;  1EVH A;  5EFX A;  1PMS A;  2YT0 A;  2OTX A;  4WVF B;  3KSY A;  4BBK A;  2RSG A;  4A6K A;  1BTN A;  2DKQ A;  1WVH A;  4K81 A;  2G35 A;  3PVW A;  3KY9 A;  5JHG A;  4YON A;  3P6A A;  5J3Y A;  5J3Q A;  1IRS A;  1ZVR A;  2W2X D;  2RVB B;  5D3V A;  3T06 A;  4MK0 A;  3X23 A;  2COD A;  1FGZ A;  1Y5O A;  1SGH A;  2KGX B;  3SV1 A;  4KHA A;  1NTV A;  2ZPY A;  4MY6 A;  2GS0 A;  1FHW A;  3BIN A;  3TVV A;  1V5U A;  2RLO A;  2ELA A;  2D9W A;  4Z2N A;  1W1H A;  4PQ0 A;  2JP2 A;  2N23 A;  4HAV B;  2D4Q A;  3D8E A;  2EJ8 A;  2J0K A;  2M14 A;  4C0A A;  2UZR A;  5JHH A;  4F7H A;  3V5W A;  3ULB A;  2D11 A;  4HAX B;  3FEH A;  2ADZ A;  4A5K A;  5DH9 B;  1RJ2 A;  2VKI A;  4ZRJ A;  1ZC4 B;  1U29 A;  2DHI A;  3AJ4 A;  1FB8 A;  4IAP A;  1BWN A;  4HB3 B;  2H7E A;  5JP4 A;  2Y8G A;  4XWX A;  1AWE A;  1U2B A;  4WJ7 A;  3UZT A;  2YRY A;  5C79 A;  1K5D B;  1EF1 A;  3PG7 A;  3DXE A;  3G9W A;  1E5W A;  4CHJ A;  2DYQ A;  2L2I A; 
#chains in the Genus database with same CATH topology
 2DLW A;  4K2O A;  4WSF A;  3WYF B;  1H4R A;  2I5F A;  1ZC3 B;  2Z14 A;  1P3R A;  2COC A;  5FI0 A;  4NY0 A;  1WG7 A;  2COA A;  5FI1 A;  4CHM A;  1EGX A;  2DFK A;  1UNQ A;  2OQB A;  1XOD A;  5DIF B;  1QQG A;  1MK7 B;  3FSS A;  4CYE A;  1ISN A;  2Y7B A;  1V5M A;  3NWD A;  2ROZ B;  2KIE A;  2W2W A;  4DXA B;  2N0Y A;  3CIK A;  2D10 A;  3PSC A;  3U8Z A;  3SNH A;  2ROV A;  2K00 A;  2VRW B;  4HAZ B;  1MIZ B;  4GNK B;  2K2J A;  2J0J A;  4HSI A;  1XCG A;  1X1G A;  4QXA B;  2X18 A;  3U7D A;  3ML4 A;  4KHB A;  3ODO A;  2P8V A;  2CY4 A;  4F7U P;  2CY5 A;  1WGU A;  1T77 A;  5D27 A;  2DA0 A;  1WGQ A;  1WJM A;  1BTK A;  2YSZ A;  3TCA A;  5D3W A;  2DX1 A;  3AU4 A;  1XKE A;  3ODX A;  4TYZ A;  3A8P A;  3A98 B;  4ZRI A;  2YS5 A;  2VSZ A;  2YVC A;  5CLQ B;  4MT7 A;  4HDQ A;  3WA0 A;  5L81 A;  1U5F A;  3ZVR A;  2D9V A;  5DHA B;  3PEG A;  2KR0 A;  1U5G A;  1FOE A;  2P0H A;  4DBB A;  3HK0 A;  5M4Y B;  3HW2 B;  1NI2 A;  4A6F B;  2DX5 A;  3RCP A;  5GOW B;  3KRW A;  1V5P A;  1X1F A;  5C5B B;  1KI1 B;  4HDO A;  2Z59 A;  4D6W A;  1M7E A;  2YT2 A;  5LON B;  5LG4 B;  1J19 A;  3DXC A;  1X05 A;  1MAI A;  3NW8 A;  3HSA A;  4A6H A;  4Y94 A;  1DBH A;  4IFS A;  2Z4D A;  2GCL A;  4YL8 A;  2H7D A;  1U5D A;  4EJN A;  2L1C A;  1ZSQ A;  1MI1 A;  3A8Q A;  1DRO A;  2EMS A;  3KZ1 A;  1B55 A;  3D8D A;  4DX8 A;  2DKP A;  4CSQ A;  1AQC A;  2M38 A;  4F7G A;  4D0N B;  2Q13 A;  3SUZ A;  2MDX A;  3P7Z A;  4IOY X;  4TKN A;  2I1K A;  2K8E A;  4PNK A;  2Y8F A;  1SHC A;  2COF A;  1XR0 B;  2NZ8 B;  4HAT B;  5KQ4 A;  3MDB C;  3IVF A;  3HIE A;  1PLS A;  1TQZ A;  3B77 A;  1U5E A;  5C6R A;  3CXB B;  5HE0 A;  1U27 A;  1H10 A;  4L1R A;  1UEF A;  2FJL A;  3N7C A;  1LW3 A;  2YT1 A;  5HE3 A;  2ZKM X;  3GYO A;  2DHJ A;  2P0F A;  2Z13 A;  3FVC A;  2V76 A;  1LB1 A;  5CLL B;  1V88 A;  5IRS A;  2MFQ A;  1XD4 A;  3DCX A;  4P7I A;  1BAK A;  2E2X A;  3NWA A;  1Q67 A;  4KAX B;  4NSW A;  2AEH A;  2YS1 A;  3QIJ A;  5KCV A;  4GXB A;  2D9Z A;  2I5C A;  2W2X C;  3OAN A;  2RGN B;  2K49 A;  2IFS A;  4DX9 0;  1TXD A;  1RRP B;  1WJ1 A;  3TO1 A;  1W1D A;  3PZD A;  4GMV A;  3ZDT A;  2KIG A;  4L6E A;  1GC7 A;  1XX0 A;  1PFJ A;  2PZ1 A;  3PVL A;  2IYB A;  1KZ7 A;  2D9X A;  3LJU X;  1I2H A;  5D3X A;  1P6S A;  4A6F A;  5LOP B;  2DN6 A;  5C5B A;  1Z87 A;  2R2Y A;  3GYP A;  4QJ5 B;  3ULC A;  5J3T A;  1W1G A;  4K2P A;  4EKU A;  3NSU A;  5DI9 B;  1X86 A;  1N3H A;  2XQN M;  3HQC A;  5I2S A;  5KQ1 A;  1OQN A;  4GN1 A;  1FGY A;  1J0W A;  1ZM0 A;  1K5G B;  4GZU A;  4HHV A;  5DHF B;  1NTY A;  1M7R A;  2K2U A;  1KZG A;  1QC6 A;  5HE1 A;  1FHO A;  4GMX B;  2Z0P A;  3M1I B;  1GC6 A;  1DDW A;  4GPT B;  3F5R A;  2MKR A;  1OY2 A;  1X11 A;  4Z2M B;  3FM8 C;  1OMW A;  1ZYI A;  1I7A A;  5HE2 A;  2LUL A;  2DTC A;  2HE7 A;  1DDV A;  4GOU A;  2LOZ A;  1UPQ A;  3PVU A;  4HAW B;  1FAO A;  3DXD A;  2R0D A;  3U12 A;  1Y19 B;  4HAY B;  2P0D A;  1UPR A;  2UZS A;  2D9Y A;  2I1J A;  4QJ4 B;  4HB0 B;  3MPX A;  1P5T A;  2CAY A;  2RRF A;  1V89 A;  4HB4 B;  2HTH B;  4KVG B;  3A58 A;  2MWN B;  4H8S A;  2D2Q A;  2GJY A;  3OHM B;  4HB2 B;  2J0M A;  3VOQ A;  1FHX A;  1MPH A;  1NU2 A;  2UVM A;  5JLJ B;  1WI1 A;  1UNR A;  2YS3 A;  1DYN A;  3QBV B;  4B6H A;  5D3Y A;  2RUK B;  1MIX A;  2LYD A;  2Z0O A;  3AU5 A;  3BJI A;  3F0W A;  2GUM A;  3VIA A;  4K17 A;  2LG1 A;  2LKO A;  3PP2 A;  5C16 A;  3SO6 A;  2GCJ A;  2QKM A;  2ELB A;  2NBV A;  3QWM A;  1GG3 A;  2Z0Q A;  3TW1 A;  1UNP A;  3ODW A;  1MK9 B;  2R09 A;  4OSN A;  2BCJ A;  2DHK A;  2QKL A;  2EMT A;  2J59 M;  1TJ6 A;  2EC1 A;  2NMB A;  4HAU B;  4DIX A;  2KCJ A;  2RNR B;  2DYN A;  1DDM A;  4KHO A;  2FJU B;  3KRX A;  1EAZ A;  4ZRK A;  3O96 A;  3D8F A;  4EMO A;  1MKE A;  1V61 A;  2LOX A;  3TFM A;  2CRF A;  4KHB B;  5I2M A;  2YF0 A;  2KUP A;  3SYX A;  2AL6 A;  1EVH A;  5EFX A;  1PMS A;  2YT0 A;  2OTX A;  4WVF B;  3KSY A;  4BBK A;  2RSG A;  4A6K A;  1BTN A;  4QJ3 B;  2DKQ A;  1WVH A;  4K81 A;  2G35 A;  3PVW A;  3KY9 A;  5JHG A;  4YON A;  3P6A A;  5J3Y A;  5J3Q A;  1IRS A;  1ZVR A;  2W2X D;  2RVB B;  5D3V A;  3T06 A;  4MK0 A;  3X23 A;  2COD A;  1FGZ A;  1Y5O A;  1SGH A;  2KGX B;  3SV1 A;  4KHA A;  1NTV A;  2ZPY A;  4MY6 A;  2GS0 A;  1FHW A;  3BIN A;  3TVV A;  1V5U A;  2RLO A;  2ELA A;  4OT1 A;  2D9W A;  4Z2N A;  1W1H A;  4PQ0 A;  2JP2 A;  2N23 A;  4HAV B;  2D4Q A;  3D8E A;  2EJ8 A;  2J0K A;  2M14 A;  4C0A A;  2UZR A;  5JHH A;  4F7H A;  3V5W A;  3ULB A;  2D11 A;  4HAX B;  3FEH A;  2ADZ A;  4A5K A;  5DH9 B;  1RJ2 A;  2VKI A;  4ZRJ A;  1ZC4 B;  1U29 A;  2DHI A;  3AJ4 A;  1FB8 A;  3NWF A;  4IAP A;  1BWN A;  4HB3 B;  2H7E A;  5JP4 A;  2Y8G A;  4XWX A;  1AWE A;  1U2B A;  4WJ7 A;  3UZT A;  2KUQ A;  2YRY A;  5C79 A;  1K5D B;  1EF1 A;  3PG7 A;  3DXE A;  3G9W A;  1E5W A;  4CHJ A;  2DYQ A;  2L2I A; 
#chains in the Genus database with same CATH homology
 2DLW A;  4K2O A;  4WSF A;  3WYF B;  1H4R A;  2I5F A;  1ZC3 B;  2Z14 A;  1P3R A;  2COC A;  5FI0 A;  4NY0 A;  1WG7 A;  2COA A;  5FI1 A;  4CHM A;  1EGX A;  2DFK A;  1UNQ A;  2OQB A;  1XOD A;  5DIF B;  1QQG A;  1MK7 B;  3FSS A;  4CYE A;  1ISN A;  2Y7B A;  1V5M A;  3NWD A;  2ROZ B;  2W2W A;  2KIE A;  4DXA B;  2N0Y A;  3CIK A;  2D10 A;  3PSC A;  3U8Z A;  3SNH A;  2ROV A;  2K00 A;  2VRW B;  4HAZ B;  1MIZ B;  4GNK B;  2K2J A;  2J0J A;  4HSI A;  1XCG A;  1X1G A;  4QXA B;  2X18 A;  3U7D A;  3ML4 A;  4KHB A;  3ODO A;  2P8V A;  2CY4 A;  4F7U P;  2CY5 A;  1WGU A;  5D27 A;  2DA0 A;  1WGQ A;  1WJM A;  1BTK A;  2YSZ A;  3TCA A;  5D3W A;  2DX1 A;  3AU4 A;  1XKE A;  3ODX A;  4TYZ A;  3A8P A;  3A98 B;  4ZRI A;  2YS5 A;  2VSZ A;  2YVC A;  5CLQ B;  4MT7 A;  4HDQ A;  3WA0 A;  5L81 A;  1U5F A;  3ZVR A;  2D9V A;  5DHA B;  3PEG A;  2KR0 A;  1U5G A;  1FOE A;  2P0H A;  4DBB A;  3HK0 A;  5M4Y B;  3HW2 B;  1NI2 A;  4A6F B;  2DX5 A;  3RCP A;  5GOW B;  3KRW A;  1V5P A;  1X1F A;  5C5B B;  1KI1 B;  4HDO A;  2Z59 A;  4D6W A;  1M7E A;  2YT2 A;  5LON B;  5LG4 B;  1J19 A;  3DXC A;  1X05 A;  1MAI A;  3NW8 A;  4A6H A;  4Y94 A;  1DBH A;  4IFS A;  2Z4D A;  2GCL A;  4YL8 A;  2H7D A;  1U5D A;  4EJN A;  2L1C A;  1ZSQ A;  3A8Q A;  1DRO A;  2EMS A;  3KZ1 A;  1B55 A;  3D8D A;  4DX8 A;  2DKP A;  4CSQ A;  1AQC A;  2M38 A;  4F7G A;  4D0N B;  2Q13 A;  3SUZ A;  2MDX A;  3P7Z A;  4IOY X;  4TKN A;  2I1K A;  2K8E A;  4PNK A;  2Y8F A;  1SHC A;  2COF A;  1XR0 B;  2NZ8 B;  4HAT B;  5KQ4 A;  3MDB C;  3IVF A;  3HIE A;  1PLS A;  1TQZ A;  1U5E A;  5C6R A;  3CXB B;  5HE0 A;  1U27 A;  1H10 A;  4L1R A;  1UEF A;  2FJL A;  3N7C A;  1LW3 A;  2YT1 A;  5HE3 A;  3GYO A;  2ZKM X;  2DHJ A;  2P0F A;  2Z13 A;  3FVC A;  2V76 A;  1LB1 A;  5CLL B;  1V88 A;  5IRS A;  2MFQ A;  1XD4 A;  4P7I A;  1BAK A;  2E2X A;  3NWA A;  1Q67 A;  4KAX B;  4NSW A;  2AEH A;  2YS1 A;  3QIJ A;  5KCV A;  4GXB A;  2D9Z A;  2I5C A;  2W2X C;  3OAN A;  2RGN B;  2K49 A;  2IFS A;  4DX9 0;  1TXD A;  1RRP B;  1WJ1 A;  3TO1 A;  1W1D A;  3PZD A;  4GMV A;  3ZDT A;  2KIG A;  4L6E A;  1GC7 A;  1XX0 A;  1PFJ A;  2PZ1 A;  3PVL A;  2IYB A;  1KZ7 A;  2D9X A;  3LJU X;  1I2H A;  5D3X A;  1P6S A;  4A6F A;  5LOP B;  2DN6 A;  5C5B A;  1Z87 A;  3GYP A;  2R2Y A;  4QJ5 B;  3ULC A;  5J3T A;  1W1G A;  4K2P A;  4EKU A;  3NSU A;  5DI9 B;  1X86 A;  1N3H A;  2XQN M;  3HQC A;  5KQ1 A;  5I2S A;  1OQN A;  4GN1 A;  1FGY A;  1J0W A;  1ZM0 A;  1K5G B;  4GZU A;  4HHV A;  5DHF B;  1NTY A;  1M7R A;  2K2U A;  1KZG A;  1QC6 A;  5HE1 A;  1FHO A;  4GMX B;  2Z0P A;  3M1I B;  1GC6 A;  1DDW A;  4GPT B;  3F5R A;  2MKR A;  1OY2 A;  1X11 A;  4Z2M B;  3FM8 C;  1OMW A;  1ZYI A;  1I7A A;  5HE2 A;  2LUL A;  2DTC A;  2HE7 A;  1DDV A;  4GOU A;  2LOZ A;  1UPQ A;  3PVU A;  4HAW B;  1FAO A;  3DXD A;  2R0D A;  3U12 A;  1Y19 B;  4HAY B;  2P0D A;  1UPR A;  2UZS A;  2D9Y A;  2I1J A;  4QJ4 B;  4HB0 B;  3MPX A;  1P5T A;  2CAY A;  2RRF A;  1V89 A;  4HB4 B;  2HTH B;  4KVG B;  3A58 A;  2MWN B;  4H8S A;  2D2Q A;  2GJY A;  3OHM B;  4HB2 B;  2J0M A;  3VOQ A;  1FHX A;  1MPH A;  1NU2 A;  2UVM A;  5JLJ B;  1WI1 A;  1UNR A;  2YS3 A;  1DYN A;  3QBV B;  4B6H A;  5D3Y A;  2RUK B;  1MIX A;  2LYD A;  2Z0O A;  3AU5 A;  3BJI A;  3F0W A;  2GUM A;  3VIA A;  4K17 A;  2LG1 A;  2LKO A;  3PP2 A;  5C16 A;  3SO6 A;  2GCJ A;  2QKM A;  2ELB A;  2NBV A;  3QWM A;  1GG3 A;  2Z0Q A;  3TW1 A;  1UNP A;  3ODW A;  1MK9 B;  2R09 A;  4OSN A;  2BCJ A;  2DHK A;  2QKL A;  2EMT A;  2J59 M;  1TJ6 A;  2EC1 A;  2NMB A;  4HAU B;  4DIX A;  2KCJ A;  2RNR B;  2DYN A;  1DDM A;  4KHO A;  2FJU B;  3KRX A;  1EAZ A;  4ZRK A;  3O96 A;  3D8F A;  4EMO A;  1MKE A;  1V61 A;  2LOX A;  3TFM A;  2CRF A;  4KHB B;  5I2M A;  2YF0 A;  2KUP A;  3SYX A;  2AL6 A;  1EVH A;  5EFX A;  1PMS A;  2YT0 A;  2OTX A;  4WVF B;  3KSY A;  4BBK A;  2RSG A;  4A6K A;  1BTN A;  4QJ3 B;  2DKQ A;  1WVH A;  4K81 A;  2G35 A;  3PVW A;  3KY9 A;  5JHG A;  4YON A;  3P6A A;  5J3Y A;  5J3Q A;  1IRS A;  1ZVR A;  2W2X D;  2RVB B;  5D3V A;  3T06 A;  4MK0 A;  3X23 A;  2COD A;  1FGZ A;  1Y5O A;  1SGH A;  2KGX B;  3SV1 A;  4KHA A;  1NTV A;  2ZPY A;  4MY6 A;  2GS0 A;  1FHW A;  3BIN A;  3TVV A;  1V5U A;  2RLO A;  2ELA A;  4OT1 A;  2D9W A;  4Z2N A;  1W1H A;  4PQ0 A;  2JP2 A;  2N23 A;  4HAV B;  2D4Q A;  3D8E A;  2EJ8 A;  2J0K A;  2M14 A;  4C0A A;  2UZR A;  5JHH A;  4F7H A;  3V5W A;  3ULB A;  2D11 A;  4HAX B;  3FEH A;  2ADZ A;  4A5K A;  5DH9 B;  1RJ2 A;  2VKI A;  4ZRJ A;  1ZC4 B;  1U29 A;  2DHI A;  3AJ4 A;  1FB8 A;  4IAP A;  3NWF A;  1BWN A;  4HB3 B;  2H7E A;  5JP4 A;  2Y8G A;  4XWX A;  1AWE A;  1U2B A;  4WJ7 A;  3UZT A;  2YRY A;  2KUQ A;  5C79 A;  1K5D B;  1EF1 A;  3PG7 A;  3DXE A;  3G9W A;  1E5W A;  4CHJ A;  2DYQ A;  2L2I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...