3GYPA

Rtt106p
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
237
structure length
225
Chain Sequence
EISETNTIFKLEGVSVLSPLRKKLDLVFYLSNVDGSPVITLLKGNDRELSIYQLNKNIKMASFLPVPEKPNLIYLFMTYTSCEDNKFSEPVVMTLNKENTLNQFKNLGLLDSNVTDFEKCVEYIRKQAILTGFKISNPFVNSFHLQCHRGTKEGTLYFLPDHIIFGFKKPILLFDASDIESITYSSITRLTFNASLVTKDGEKYEFSMTDQTEYAKIDDYVKRKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural analysis of Rtt106p reveals a DNA-binding role required for heterochromatin silencing
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Chaperone
molecule keywords Histone chaperone RTT106
total genus 43
structure length 225
sequence length 237
ec nomenclature
pdb deposition date 2009-04-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08512 Rtt106 Histone chaperone Rttp106-like
A PF18469 PH_18 Pleckstrin homology domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 3gypA02
2.30.29.120 Mainly Beta Roll PH-domain like PH-domain like 3gypA01
3QWMA 3FSSA 1NU2A 3D8DA 1RJ2A 1KZGA 1Y19B 3OANA 1X11A 1ZSQA 5HE1A 2YS3A 2DX5A 2Y8FA 4ZRIA 4HDQA 2BCJA 3G9WA 3KY9A 3A8QA 1X1GA 5HE2A 5LONB 4PNKA 2RVBB 2MDXA 4PQ0A 1V5MA 2VRWB 2D9YA 1B55A 2P8VA 2D11A 4HB0B 4GN1A 5GOWB 2MFQA 3A8PA 1M7EA 2FJLA 5KQ1A 4D0NB 1LW3A 4DXAB 3MPXA 1H4RA 1FB8A 2J0MA 2I5CA 1FAOA 2Z0PA 5FI0A 3TCAA 3V5WA 1PFJA 1LB1A 2ZPYA 2GCLA 1WVHA 2EC1A 4NY0A 3TFMA 2OQBA 1TJ6A 5DI9B 2Y7BA 2DLWA 1DDMA 3HK0A 1I2HA 3ML4A 4EJNA 2YS5A 2K00A 1NI2A 2DA0A 1NTYA 2LULA 1BAKA 2YT0A 2DYNA 1U27A 2LYDA 3QBVB 3FEHA 2CY5A 1WJMA 2YF0A 1X86A 4HHVA 1WGQA 4TYZA 1V89A 4A6FB 2LKOA 2DKQA 1W1GA 3PZDA 1U5EA 2I1KA 1J0WA 2GJYA 1E5WA 2COFA 3AU5A 4KHOA 4EKUA 1MPHA 5D3XA 2RSGA 3BINA 2P0FA 2LG1A 3A98B 1MIXA 2D9VA 1U5FA 3DXDA 2VSZA 3AU4A 3RCPA 1Y5OA 1X1FA 3ODWA 4HB3B 3GYPA 2QKMA 2D9WA 2YSZA 1DROA 3SUZA 1OY2A 1FGZA 2N0YA 5JLJB 1KI1B 2ADZA 1P6SA 2I1JA 1BWNA 4Z2NA 2K2UA 1QQGA 4K2PA 1Z87A 3PVWA 5D27A 2W2XD 1QC6A 1MIZB 1V5PA 5KCVA 1UNPA 2RNRB 1DDVA 1MKEA 1IRSA 2GS0A 2RUKB 2AEHA 1P5TA 4C0AA 5DHFB 4F7HA 1MAIA 2K2JA 4Y94A 4GMVA 2ROZB 4HAYB 4GMXB 2YRYA 3D8FA 3SNHA 2J59M 3SV1A 1J19A 1W1HA 1ZVRA 3TVVA 3ZVRA 4IFSA 1P3RA 1DDWA 1BTNA 2XQNM 4HATB 2CRFA 4F7GA 2COCA 1PMSA 1V88A 2H7EA 4K17A 4XWXA 4B6HA 1U2BA 3IVFA 2G35A 4IAPA 4KVGB 1FHOA 1PLSA 5DIFB 4A6KA 3ODOA 1X05A 2P0DA 4ZRJA 1U5DA 2MKRA 2DHKA 3PVLA 2ELAA 2DKPA 2VKIA 2CY4A 2YT1A 3KRXA 4L6EA 4NSWA 3PP2A 5KQ4A 4F7UP 3TW1A 1SGHA 4YL8A 3QIJA 3U7DA 1AQCA 4CHJA 3P6AA 3ULBA 5C5BA 2PZ1A 5J3YA 2R0DA 2M38A 5J3TA 3HW2B 1XR0B 1EVHA 4MK0A 1GC6A 1U29A 4KAXB 5D3VA 2D10A 2D9ZA 5JP4A 1UEFA 5C6RA 1MK9B 2QKLA 4IOYX 1XKEA 3AJ4A 2RGNB 3PG7A 3FM8C 2HE7A 5D3WA 3X23A 2N23A 3KSYA 3M1IB 4A5KA 5HE0A 1V5UA 2DHJA 2EJ8A 3UZTA 4A6FA 2J0KA 3U8ZA 5HE3A 4HAZB 2R09A 4WVFB 3KZ1A 1W1DA 2MWNB 4HAXB 3N7CA 2DX1A 4HAVB 1FHWA 1Q67A 3LJUX 1SHCA 1RRPB 3PVUA 2KUPA 1UPRA 2D9XA 1ISNA 4HB4B 1EAZA 3PSCA 1K5DB 2YVCA 1GC7A 5FI1A 4EMOA 4TKNA 2I5FA 1ZC3B 5JHGA 3BJIA 2NZ8B 1UPQA 2E2XA 2UZSA 2OTXA 2CODA 2DN6A 4CHMA 4Z2MB 4WSFA 2EMSA 1NTVA 3F0WA 3VOQA 1EF1A 2KGXB 5D3YA 2D2QA 1V61A 3VIAA 2UZRA 2Y8GA 3F5RA 5J3QA 2DFKA 4HB2B 3CXBB 1WJ1A 2J0JA 2DYQA 2UVMA 2W2XC 5C16A 1DBHA 2L2IA 1EGXA 4GXBA 2X18A 4GPTB 4HAUB 2ELBA 2CAYA 1OQNA 4K2OA 2IFSA 3PEGA 3D8EA 1XCGA 3SO6A 2RLOA 1H10A 5JHHA 1DYNA 3GYOA 1FGYA 1TXDA 4KHBB 3WYFB 4HDOA 2NMBA 2M14A 4GZUA 1K5GB 1ZC4B 4DX8A 2GCJA 2JP2A 4K81A 2COAA 4P7IA 1ZM0A 3DXEA 2KCJA 4KHAA 4MT7A 2D4QA 3SYXA 1WG7A 1TQZA 1M7RA 5L81A 1BTKA 5DH9B 2H7DA 3ULCA 3ZDTA 1I7AA 3T06A 5C5BB 2EMTA 2V76A 1UNRA 4DBBA 3HQCA 3DXCA 2Z0QA 4CYEA 2YS1A 3ODXA 3O96A 2Z0OA 4H8SA 1XODA 2W2WA 2Q13A 1XX0A 5LOPB 1UNQA 4WJ7A 1U5GA 1AWEA 5EFXA 2AL6A 1N3HA 1XD4A 4MY6A 4ZRKA 1KZ7A 2HTHB 1WGUA 3P7ZA 4BBKA 3KRWA 2DTCA 2IYBA 2L1CA 3MDBC 4YONA 2P0HA 5CLLB 1OMWA 1WI1A 5C79A 1FHXA 2DHIA 3WA0A 1MK7B 2ROVA 4HAWB 2LOXA 1GG3A 1FOEA 5DHAB 5CLQB 3CIKA 3TO1A 2LOZA 4DX90 3NSUA 4A6HA
chains in the Genus database with same CATH superfamily
3QWMA 3FSSA 4QJ4B 1NU2A 3D8DA 1RJ2A 1KZGA 1Y19B 3OANA 2Z14A 1X11A 1ZSQA 5HE1A 4OSNA 2KUQA 2YS3A 2DX5A 2Z59A 2Y8FA 4ZRIA 4HDQA 2BCJA 3G9WA 3KY9A 3A8QA 1X1GA 5HE2A 5LONB 4PNKA 2RVBB 2MDXA 4PQ0A 1V5MA 2VRWB 5I2MA 2D9YA 2Z4DA 1B55A 2RRFA 2P8VA 2D11A 4HB0B 4GN1A 5GOWB 2MFQA 3A8PA 1M7EA 2FJLA 4QXAB 5KQ1A 4D0NB 1LW3A 4DXAB 3MPXA 1H4RA 1FB8A 2J0MA 2I5CA 1FAOA 2Z0PA 5FI0A 3TCAA 3V5WA 1PFJA 1LB1A 2ZPYA 2GCLA 1WVHA 2EC1A 4NY0A 3TFMA 2OQBA 1TJ6A 5DI9B 2Y7BA 2DLWA 1DDMA 3HK0A 1I2HA 3ML4A 4EJNA 2YS5A 2K00A 1NI2A 2DA0A 1NTYA 2LULA 1BAKA 2YT0A 4KHBA 2DYNA 2NBVA 1U27A 3QBVB 2LYDA 3NW8A 3FEHA 1T77A 2CY5A 3HSAA 1WJMA 2YF0A 1X86A 4HHVA 1WGQA 4TYZA 1V89A 4A6FB 2LKOA 2DKQA 1W1GA 3PZDA 1U5EA 2I1KA 1J0WA 2GJYA 1E5WA 2COFA 3AU5A 4KHOA 4EKUA 1MPHA 5D3XA 2RSGA 3BINA 2P0FA 2LG1A 3A98B 1MIXA 2D9VA 1U5FA 3DXDA 2VSZA 3AU4A 3RCPA 1Y5OA 1X1FA 3ODWA 4HB3B 3GYPA 3NWFA 2QKMA 2D9WA 2YSZA 1DROA 3SUZA 1OY2A 1FGZA 2N0YA 5JLJB 1KI1B 2ADZA 1P6SA 2I1JA 1BWNA 4Z2NA 2K2UA 1QQGA 4K2PA 1Z87A 3PVWA 5D27A 2W2XD 4QJ5B 1QC6A 1MIZB 2FJUB 2KIEA 1V5PA 5KCVA 1UNPA 2RNRB 1DDVA 5IRSA 1MKEA 1IRSA 2GS0A 2RUKB 2AEHA 1P5TA 3DCXA 4C0AA 5DHFB 4F7HA 1MAIA 2K2JA 4Y94A 4GMVA 2ROZB 4HAYB 2ZKMX 4GMXB 4OT1A 2YRYA 2K8EA 3D8FA 3SNHA 2J59M 3SV1A 1J19A 1W1HA 1ZVRA 3TVVA 3ZVRA 4IFSA 4HSIA 1P3RA 1DDWA 1BTNA 2XQNM 4HATB 2CRFA 4F7GA 2COCA 1PMSA 1V88A 2H7EA 4K17A 4XWXA 4B6HA 1U2BA 3IVFA 2G35A 3NWAA 4IAPA 5LG4B 4KVGB 1FHOA 1PLSA 5DIFB 4A6KA 3ODOA 1X05A 2P0DA 2R2YA 4ZRJA 1U5DA 2MKRA 2DHKA 3PVLA 2ELAA 2DKPA 2VKIA 2CY4A 2YT1A 4QJ3B 3KRXA 4L6EA 4L1RA 4NSWA 2KIGA 3PP2A 5KQ4A 4F7UP 3TW1A 1SGHA 4YL8A 3QIJA 4GNKB 1AQCA 3U7DA 3P6AA 2K49A 3ULBA 4CHJA 5C5BA 2PZ1A 5J3YA 2R0DA 2M38A 5J3TA 3HW2B 1XR0B 1EVHA 4MK0A 1GC6A 1U29A 4KAXB 5D3VA 2D10A 2D9ZA 5JP4A 4CSQA 1UEFA 5C6RA 1MK9B 2QKLA 4IOYX 1XKEA 3AJ4A 2YT2A 2RGNB 3PG7A 3FM8C 2HE7A 5D3WA 3X23A 2N23A 3KSYA 3M1IB 4A5KA 5HE0A 1V5UA 2DHJA 2EJ8A 3UZTA 3B77A 4A6FA 2J0KA 3U8ZA 5HE3A 4HAZB 2R09A 4WVFB 3KZ1A 1W1DA 2MWNB 4HAXB 3N7CA 2DX1A 4HAVB 1FHWA 3A58A 1Q67A 3LJUX 1SHCA 1RRPB 3PVUA 2Z13A 2KUPA 1UPRA 2D9XA 1ISNA 4HB4B 1EAZA 3PSCA 1K5DB 2YVCA 1GC7A 5FI1A 4EMOA 4TKNA 2I5FA 1MI1A 1ZC3B 5JHGA 3BJIA 2NZ8B 3OHMB 1UPQA 2E2XA 2UZSA 2OTXA 2CODA 2DN6A 4GOUA 4CHMA 4Z2MB 4WSFA 2EMSA 1NTVA 3F0WA 3VOQA 1EF1A 2KGXB 5D3YA 2D2QA 2GUMA 1V61A 3VIAA 2UZRA 2Y8GA 3F5RA 5J3QA 2DFKA 4HB2B 3CXBB 1WJ1A 2J0JA 5I2SA 1ZYIA 2DYQA 2UVMA 2W2XC 5C16A 1DBHA 5M4YB 2L2IA 1EGXA 3U12A 4GXBA 2X18A 4GPTB 4HAUB 2ELBA 2CAYA 1OQNA 4K2OA 2IFSA 3PEGA 3D8EA 1XCGA 3SO6A 2RLOA 1H10A 5JHHA 1DYNA 3GYOA 3NWDA 1FGYA 1TXDA 4KHBB 3WYFB 4D6WA 4HDOA 2NMBA 2M14A 4GZUA 1K5GB 1ZC4B 4DX8A 4DIXA 2GCJA 2JP2A 4K81A 2COAA 4P7IA 1ZM0A 3DXEA 2KCJA 4KHAA 4MT7A 2D4QA 3SYXA 1WG7A 1TQZA 1M7RA 5L81A 1BTKA 2KR0A 5DH9B 2H7DA 3ULCA 3ZDTA 1I7AA 3T06A 5C5BB 2EMTA 2V76A 1UNRA 4DBBA 3HQCA 3DXCA 2Z0QA 4CYEA 2YS1A 3ODXA 3O96A 2Z0OA 3FVCA 4H8SA 1XODA 2W2WA 2Q13A 1XX0A 5LOPB 1UNQA 4WJ7A 1U5GA 1AWEA 5EFXA 2AL6A 1N3HA 1XD4A 4MY6A 4ZRKA 1KZ7A 3HIEA 2HTHB 1WGUA 3P7ZA 4BBKA 3KRWA 2DTCA 2IYBA 2L1CA 3MDBC 4YONA 2P0HA 5CLLB 1OMWA 1WI1A 5C79A 1FHXA 2DHIA 3WA0A 1MK7B 2ROVA 4HAWB 2LOXA 1GG3A 1FOEA 5DHAB 5CLQB 3CIKA 3TO1A 2LOZA 4DX90 3NSUA 4A6HA
chains in the Genus database with same CATH topology
3QWMA 3FSSA 4QJ4B 1NU2A 3D8DA 1RJ2A 1KZGA 1Y19B 3OANA 2Z14A 1X11A 1ZSQA 5HE1A 4OSNA 2KUQA 2YS3A 2DX5A 2Z59A 2Y8FA 4ZRIA 4HDQA 2BCJA 3G9WA 3KY9A 3A8QA 1X1GA 5HE2A 5LONB 4PNKA 2RVBB 2MDXA 4PQ0A 1V5MA 2VRWB 5I2MA 2D9YA 2Z4DA 1B55A 2RRFA 2P8VA 2D11A 4HB0B 4GN1A 5GOWB 2MFQA 3A8PA 1M7EA 2FJLA 4QXAB 5KQ1A 4D0NB 1LW3A 4DXAB 3MPXA 1H4RA 1FB8A 2J0MA 2I5CA 1FAOA 2Z0PA 5FI0A 3TCAA 3V5WA 1PFJA 1LB1A 2ZPYA 2GCLA 1WVHA 2EC1A 4NY0A 3TFMA 2OQBA 1TJ6A 5DI9B 2Y7BA 2DLWA 1DDMA 3HK0A 1I2HA 3ML4A 4EJNA 2YS5A 2K00A 1NI2A 2DA0A 1NTYA 2LULA 1BAKA 2YT0A 4KHBA 2DYNA 2NBVA 1U27A 2LYDA 3QBVB 3NW8A 3FEHA 2CY5A 1WJMA 2YF0A 1X86A 4HHVA 1WGQA 4TYZA 1V89A 4A6FB 2LKOA 2DKQA 1W1GA 3PZDA 1U5EA 2I1KA 1J0WA 2GJYA 1E5WA 2COFA 3AU5A 4KHOA 4EKUA 1MPHA 5D3XA 2RSGA 3BINA 2P0FA 2LG1A 3A98B 1MIXA 2D9VA 1U5FA 3DXDA 2VSZA 3AU4A 3RCPA 1Y5OA 1X1FA 3ODWA 4HB3B 3GYPA 3NWFA 2QKMA 2D9WA 2YSZA 1DROA 3SUZA 1OY2A 1FGZA 2N0YA 5JLJB 1KI1B 2ADZA 1P6SA 2I1JA 1BWNA 4Z2NA 2K2UA 1QQGA 4K2PA 1Z87A 3PVWA 5D27A 2W2XD 4QJ5B 1QC6A 1MIZB 2FJUB 2KIEA 1V5PA 5KCVA 1UNPA 2RNRB 1DDVA 5IRSA 1MKEA 1IRSA 2GS0A 2RUKB 2AEHA 1P5TA 4C0AA 5DHFB 4F7HA 1MAIA 2K2JA 4Y94A 4GMVA 2ROZB 4HAYB 2ZKMX 4GMXB 4OT1A 2YRYA 3D8FA 2K8EA 3SNHA 2J59M 3SV1A 1J19A 1W1HA 1ZVRA 3TVVA 3ZVRA 4IFSA 4HSIA 1P3RA 1DDWA 1BTNA 2XQNM 4HATB 2CRFA 4F7GA 2COCA 1PMSA 1V88A 2H7EA 4K17A 4XWXA 4B6HA 1U2BA 3IVFA 2G35A 3NWAA 4IAPA 5LG4B 4KVGB 1FHOA 1PLSA 5DIFB 4A6KA 3ODOA 1X05A 2P0DA 4ZRJA 2R2YA 1U5DA 2MKRA 2DHKA 3PVLA 2ELAA 2DKPA 2VKIA 2CY4A 2YT1A 4QJ3B 3KRXA 4L6EA 4L1RA 4NSWA 3PP2A 2KIGA 5KQ4A 4F7UP 3TW1A 1SGHA 4YL8A 3QIJA 3U7DA 1AQCA 4CHJA 3P6AA 3ULBA 5C5BA 2K49A 4GNKB 2PZ1A 5J3YA 2R0DA 2M38A 5J3TA 3HW2B 1XR0B 1EVHA 4MK0A 1GC6A 1U29A 4KAXB 5D3VA 2D10A 2D9ZA 5JP4A 4CSQA 1UEFA 5C6RA 1MK9B 2QKLA 4IOYX 1XKEA 3AJ4A 2YT2A 2RGNB 3PG7A 3FM8C 2HE7A 5D3WA 3X23A 2N23A 3KSYA 3M1IB 4A5KA 5HE0A 1V5UA 2DHJA 2EJ8A 3UZTA 4A6FA 2J0KA 3U8ZA 5HE3A 4HAZB 2R09A 4WVFB 3KZ1A 1W1DA 2MWNB 4HAXB 3N7CA 2DX1A 4HAVB 1FHWA 3A58A 1Q67A 3LJUX 1SHCA 1RRPB 3PVUA 2Z13A 2KUPA 1UPRA 2D9XA 1ISNA 4HB4B 1EAZA 3PSCA 1K5DB 2YVCA 1GC7A 5FI1A 4EMOA 4TKNA 2I5FA 1ZC3B 5JHGA 3BJIA 2NZ8B 3OHMB 1UPQA 2E2XA 2UZSA 2OTXA 2CODA 2DN6A 4CHMA 4GOUA 4Z2MB 4WSFA 2EMSA 1NTVA 3F0WA 3VOQA 1EF1A 2KGXB 5D3YA 2D2QA 2GUMA 1V61A 3VIAA 2UZRA 2Y8GA 3F5RA 5J3QA 2DFKA 4HB2B 3CXBB 1WJ1A 2J0JA 5I2SA 1ZYIA 2DYQA 2UVMA 2W2XC 5C16A 1DBHA 5M4YB 2L2IA 1EGXA 3U12A 4GXBA 2X18A 4GPTB 4HAUB 2ELBA 2CAYA 1OQNA 4K2OA 2IFSA 3PEGA 3D8EA 1XCGA 3SO6A 2RLOA 1H10A 5JHHA 1DYNA 3GYOA 3NWDA 1FGYA 1TXDA 4KHBB 3WYFB 4D6WA 4HDOA 2NMBA 2M14A 4GZUA 1K5GB 1ZC4B 4DX8A 4DIXA 2GCJA 2JP2A 4K81A 2COAA 4P7IA 1ZM0A 3DXEA 2KCJA 4KHAA 4MT7A 2D4QA 3SYXA 1WG7A 1TQZA 1M7RA 5L81A 1BTKA 2KR0A 5DH9B 2H7DA 3ULCA 3ZDTA 1I7AA 3T06A 5C5BB 2EMTA 2V76A 1UNRA 4DBBA 3HQCA 3DXCA 2Z0QA 4CYEA 2YS1A 3ODXA 3O96A 2Z0OA 3FVCA 4H8SA 1XODA 2W2WA 2Q13A 1XX0A 5LOPB 1UNQA 4WJ7A 1U5GA 1AWEA 5EFXA 2AL6A 1N3HA 1XD4A 4MY6A 4ZRKA 1KZ7A 2HTHB 3HIEA 1WGUA 3P7ZA 4BBKA 3KRWA 2DTCA 2IYBA 2L1CA 3MDBC 4YONA 2P0HA 5CLLB 1OMWA 1WI1A 5C79A 1FHXA 2DHIA 3WA0A 1MK7B 2ROVA 4HAWB 2LOXA 1GG3A 1FOEA 5DHAB 5CLQB 3CIKA 3TO1A 2LOZA 4DX90 3NSUA 4A6HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QWM A;  3FSS A;  1NU2 A;  3D8D A;  1RJ2 A;  1KZG A;  1Y19 B;  3OAN A;  1X11 A;  1ZSQ A;  5HE1 A;  2YS3 A;  2DX5 A;  2Y8F A;  4ZRI A;  4HDQ A;  2BCJ A;  3G9W A;  3KY9 A;  3A8Q A;  1X1G A;  5HE2 A;  5LON B;  4PNK A;  2RVB B;  2MDX A;  4PQ0 A;  1V5M A;  2VRW B;  2D9Y A;  1B55 A;  2P8V A;  2D11 A;  4HB0 B;  4GN1 A;  5GOW B;  2MFQ A;  3A8P A;  1M7E A;  2FJL A;  5KQ1 A;  4D0N B;  1LW3 A;  4DXA B;  3MPX A;  1H4R A;  1FB8 A;  2J0M A;  2I5C A;  1FAO A;  2Z0P A;  5FI0 A;  3TCA A;  3V5W A;  1PFJ A;  1LB1 A;  2ZPY A;  2GCL A;  1WVH A;  2EC1 A;  4NY0 A;  3TFM A;  2OQB A;  1TJ6 A;  5DI9 B;  2Y7B A;  2DLW A;  1DDM A;  3HK0 A;  1I2H A;  3ML4 A;  4EJN A;  2YS5 A;  2K00 A;  1NI2 A;  2DA0 A;  1NTY A;  2LUL A;  1BAK A;  2YT0 A;  2DYN A;  1U27 A;  2LYD A;  3QBV B;  3FEH A;  2CY5 A;  1WJM A;  2YF0 A;  1X86 A;  4HHV A;  1WGQ A;  4TYZ A;  1V89 A;  4A6F B;  2LKO A;  2DKQ A;  1W1G A;  3PZD A;  1U5E A;  2I1K A;  1J0W A;  2GJY A;  1E5W A;  2COF A;  3AU5 A;  4KHO A;  4EKU A;  1MPH A;  5D3X A;  2RSG A;  3BIN A;  2P0F A;  2LG1 A;  3A98 B;  1MIX A;  2D9V A;  1U5F A;  3DXD A;  2VSZ A;  3AU4 A;  3RCP A;  1Y5O A;  1X1F A;  3ODW A;  4HB3 B;  3GYP A;  2QKM A;  2D9W A;  2YSZ A;  1DRO A;  3SUZ A;  1OY2 A;  1FGZ A;  2N0Y A;  5JLJ B;  1KI1 B;  2ADZ A;  1P6S A;  2I1J A;  1BWN A;  4Z2N A;  2K2U A;  1QQG A;  4K2P A;  1Z87 A;  3PVW A;  5D27 A;  2W2X D;  1QC6 A;  1MIZ B;  1V5P A;  5KCV A;  1UNP A;  2RNR B;  1DDV A;  1MKE A;  1IRS A;  2GS0 A;  2RUK B;  2AEH A;  1P5T A;  4C0A A;  5DHF B;  4F7H A;  1MAI A;  2K2J A;  4Y94 A;  4GMV A;  2ROZ B;  4HAY B;  4GMX B;  2YRY A;  3D8F A;  3SNH A;  2J59 M;  3SV1 A;  1J19 A;  1W1H A;  1ZVR A;  3TVV A;  3ZVR A;  4IFS A;  1P3R A;  1DDW A;  1BTN A;  2XQN M;  4HAT B;  2CRF A;  4F7G A;  2COC A;  1PMS A;  1V88 A;  2H7E A;  4K17 A;  4XWX A;  4B6H A;  1U2B A;  3IVF A;  2G35 A;  4IAP A;  4KVG B;  1FHO A;  1PLS A;  5DIF B;  4A6K A;  3ODO A;  1X05 A;  2P0D A;  4ZRJ A;  1U5D A;  2MKR A;  2DHK A;  3PVL A;  2ELA A;  2DKP A;  2VKI A;  2CY4 A;  2YT1 A;  3KRX A;  4L6E A;  4NSW A;  3PP2 A;  5KQ4 A;  4F7U P;  3TW1 A;  1SGH A;  4YL8 A;  3QIJ A;  3U7D A;  1AQC A;  4CHJ A;  3P6A A;  3ULB A;  5C5B A;  2PZ1 A;  5J3Y A;  2R0D A;  2M38 A;  5J3T A;  3HW2 B;  1XR0 B;  1EVH A;  4MK0 A;  1GC6 A;  1U29 A;  4KAX B;  5D3V A;  2D10 A;  2D9Z A;  5JP4 A;  1UEF A;  5C6R A;  1MK9 B;  2QKL A;  4IOY X;  1XKE A;  3AJ4 A;  2RGN B;  3PG7 A;  3FM8 C;  2HE7 A;  5D3W A;  3X23 A;  2N23 A;  3KSY A;  3M1I B;  4A5K A;  5HE0 A;  1V5U A;  2DHJ A;  2EJ8 A;  3UZT A;  4A6F A;  2J0K A;  3U8Z A;  5HE3 A;  4HAZ B;  2R09 A;  4WVF B;  3KZ1 A;  1W1D A;  2MWN B;  4HAX B;  3N7C A;  2DX1 A;  4HAV B;  1FHW A;  1Q67 A;  3LJU X;  1SHC A;  1RRP B;  3PVU A;  2KUP A;  1UPR A;  2D9X A;  1ISN A;  4HB4 B;  1EAZ A;  3PSC A;  1K5D B;  2YVC A;  1GC7 A;  5FI1 A;  4EMO A;  4TKN A;  2I5F A;  1ZC3 B;  5JHG A;  3BJI A;  2NZ8 B;  1UPQ A;  2E2X A;  2UZS A;  2OTX A;  2COD A;  2DN6 A;  4CHM A;  4Z2M B;  4WSF A;  2EMS A;  1NTV A;  3F0W A;  3VOQ A;  1EF1 A;  2KGX B;  5D3Y A;  2D2Q A;  1V61 A;  3VIA A;  2UZR A;  2Y8G A;  3F5R A;  5J3Q A;  2DFK A;  4HB2 B;  3CXB B;  1WJ1 A;  2J0J A;  2DYQ A;  2UVM A;  2W2X C;  5C16 A;  1DBH A;  2L2I A;  1EGX A;  4GXB A;  2X18 A;  4GPT B;  4HAU B;  2ELB A;  2CAY A;  1OQN A;  4K2O A;  2IFS A;  3PEG A;  3D8E A;  1XCG A;  3SO6 A;  2RLO A;  1H10 A;  5JHH A;  1DYN A;  3GYO A;  1FGY A;  1TXD A;  4KHB B;  3WYF B;  4HDO A;  2NMB A;  2M14 A;  4GZU A;  1K5G B;  1ZC4 B;  4DX8 A;  2GCJ A;  2JP2 A;  4K81 A;  2COA A;  4P7I A;  1ZM0 A;  3DXE A;  2KCJ A;  4KHA A;  4MT7 A;  2D4Q A;  3SYX A;  1WG7 A;  1TQZ A;  1M7R A;  5L81 A;  1BTK A;  5DH9 B;  2H7D A;  3ULC A;  3ZDT A;  1I7A A;  3T06 A;  5C5B B;  2EMT A;  2V76 A;  1UNR A;  4DBB A;  3HQC A;  3DXC A;  2Z0Q A;  4CYE A;  2YS1 A;  3ODX A;  3O96 A;  2Z0O A;  4H8S A;  1XOD A;  2W2W A;  2Q13 A;  1XX0 A;  5LOP B;  1UNQ A;  4WJ7 A;  1U5G A;  1AWE A;  5EFX A;  2AL6 A;  1N3H A;  1XD4 A;  4MY6 A;  4ZRK A;  1KZ7 A;  2HTH B;  1WGU A;  3P7Z A;  4BBK A;  3KRW A;  2DTC A;  2IYB A;  2L1C A;  3MDB C;  4YON A;  2P0H A;  5CLL B;  1OMW A;  1WI1 A;  5C79 A;  1FHX A;  2DHI A;  3WA0 A;  1MK7 B;  2ROV A;  4HAW B;  2LOX A;  1GG3 A;  1FOE A;  5DHA B;  5CLQ B;  3CIK A;  3TO1 A;  2LOZ A;  4DX9 0;  3NSU A;  4A6H A; 
#chains in the Genus database with same CATH topology
 3QWM A;  3FSS A;  4QJ4 B;  1NU2 A;  3D8D A;  1RJ2 A;  1KZG A;  1Y19 B;  3OAN A;  2Z14 A;  1X11 A;  1ZSQ A;  5HE1 A;  4OSN A;  2KUQ A;  2YS3 A;  2DX5 A;  2Z59 A;  2Y8F A;  4ZRI A;  4HDQ A;  2BCJ A;  3G9W A;  3KY9 A;  3A8Q A;  1X1G A;  5HE2 A;  5LON B;  4PNK A;  2RVB B;  2MDX A;  4PQ0 A;  1V5M A;  2VRW B;  5I2M A;  2D9Y A;  2Z4D A;  1B55 A;  2RRF A;  2P8V A;  2D11 A;  4HB0 B;  4GN1 A;  5GOW B;  2MFQ A;  3A8P A;  1M7E A;  2FJL A;  4QXA B;  5KQ1 A;  4D0N B;  1LW3 A;  4DXA B;  3MPX A;  1H4R A;  1FB8 A;  2J0M A;  2I5C A;  1FAO A;  2Z0P A;  5FI0 A;  3TCA A;  3V5W A;  1PFJ A;  1LB1 A;  2ZPY A;  2GCL A;  1WVH A;  2EC1 A;  4NY0 A;  3TFM A;  2OQB A;  1TJ6 A;  5DI9 B;  2Y7B A;  2DLW A;  1DDM A;  3HK0 A;  1I2H A;  3ML4 A;  4EJN A;  2YS5 A;  2K00 A;  1NI2 A;  2DA0 A;  1NTY A;  2LUL A;  1BAK A;  2YT0 A;  4KHB A;  2DYN A;  2NBV A;  1U27 A;  3QBV B;  2LYD A;  3NW8 A;  3FEH A;  1T77 A;  2CY5 A;  3HSA A;  1WJM A;  2YF0 A;  1X86 A;  4HHV A;  1WGQ A;  4TYZ A;  1V89 A;  4A6F B;  2LKO A;  2DKQ A;  1W1G A;  3PZD A;  1U5E A;  2I1K A;  1J0W A;  2GJY A;  1E5W A;  2COF A;  3AU5 A;  4KHO A;  4EKU A;  1MPH A;  5D3X A;  2RSG A;  3BIN A;  2P0F A;  2LG1 A;  3A98 B;  1MIX A;  2D9V A;  1U5F A;  3DXD A;  2VSZ A;  3AU4 A;  3RCP A;  1Y5O A;  1X1F A;  3ODW A;  4HB3 B;  3GYP A;  3NWF A;  2QKM A;  2D9W A;  2YSZ A;  1DRO A;  3SUZ A;  1OY2 A;  1FGZ A;  2N0Y A;  5JLJ B;  1KI1 B;  2ADZ A;  1P6S A;  2I1J A;  1BWN A;  4Z2N A;  2K2U A;  1QQG A;  4K2P A;  1Z87 A;  3PVW A;  5D27 A;  2W2X D;  4QJ5 B;  1QC6 A;  1MIZ B;  2FJU B;  2KIE A;  1V5P A;  5KCV A;  1UNP A;  2RNR B;  1DDV A;  5IRS A;  1MKE A;  1IRS A;  2GS0 A;  2RUK B;  2AEH A;  1P5T A;  3DCX A;  4C0A A;  5DHF B;  4F7H A;  1MAI A;  2K2J A;  4Y94 A;  4GMV A;  2ROZ B;  4HAY B;  2ZKM X;  4GMX B;  4OT1 A;  2YRY A;  2K8E A;  3D8F A;  3SNH A;  2J59 M;  3SV1 A;  1J19 A;  1W1H A;  1ZVR A;  3TVV A;  3ZVR A;  4IFS A;  4HSI A;  1P3R A;  1DDW A;  1BTN A;  2XQN M;  4HAT B;  2CRF A;  4F7G A;  2COC A;  1PMS A;  1V88 A;  2H7E A;  4K17 A;  4XWX A;  4B6H A;  1U2B A;  3IVF A;  2G35 A;  3NWA A;  4IAP A;  5LG4 B;  4KVG B;  1FHO A;  1PLS A;  5DIF B;  4A6K A;  3ODO A;  1X05 A;  2P0D A;  2R2Y A;  4ZRJ A;  1U5D A;  2MKR A;  2DHK A;  3PVL A;  2ELA A;  2DKP A;  2VKI A;  2CY4 A;  2YT1 A;  4QJ3 B;  3KRX A;  4L6E A;  4L1R A;  4NSW A;  2KIG A;  3PP2 A;  5KQ4 A;  4F7U P;  3TW1 A;  1SGH A;  4YL8 A;  3QIJ A;  4GNK B;  1AQC A;  3U7D A;  3P6A A;  2K49 A;  3ULB A;  4CHJ A;  5C5B A;  2PZ1 A;  5J3Y A;  2R0D A;  2M38 A;  5J3T A;  3HW2 B;  1XR0 B;  1EVH A;  4MK0 A;  1GC6 A;  1U29 A;  4KAX B;  5D3V A;  2D10 A;  2D9Z A;  5JP4 A;  4CSQ A;  1UEF A;  5C6R A;  1MK9 B;  2QKL A;  4IOY X;  1XKE A;  3AJ4 A;  2YT2 A;  2RGN B;  3PG7 A;  3FM8 C;  2HE7 A;  5D3W A;  3X23 A;  2N23 A;  3KSY A;  3M1I B;  4A5K A;  5HE0 A;  1V5U A;  2DHJ A;  2EJ8 A;  3UZT A;  3B77 A;  4A6F A;  2J0K A;  3U8Z A;  5HE3 A;  4HAZ B;  2R09 A;  4WVF B;  3KZ1 A;  1W1D A;  2MWN B;  4HAX B;  3N7C A;  2DX1 A;  4HAV B;  1FHW A;  3A58 A;  1Q67 A;  3LJU X;  1SHC A;  1RRP B;  3PVU A;  2Z13 A;  2KUP A;  1UPR A;  2D9X A;  1ISN A;  4HB4 B;  1EAZ A;  3PSC A;  1K5D B;  2YVC A;  1GC7 A;  5FI1 A;  4EMO A;  4TKN A;  2I5F A;  1MI1 A;  1ZC3 B;  5JHG A;  3BJI A;  2NZ8 B;  3OHM B;  1UPQ A;  2E2X A;  2UZS A;  2OTX A;  2COD A;  2DN6 A;  4GOU A;  4CHM A;  4Z2M B;  4WSF A;  2EMS A;  1NTV A;  3F0W A;  3VOQ A;  1EF1 A;  2KGX B;  5D3Y A;  2D2Q A;  2GUM A;  1V61 A;  3VIA A;  2UZR A;  2Y8G A;  3F5R A;  5J3Q A;  2DFK A;  4HB2 B;  3CXB B;  1WJ1 A;  2J0J A;  5I2S A;  1ZYI A;  2DYQ A;  2UVM A;  2W2X C;  5C16 A;  1DBH A;  5M4Y B;  2L2I A;  1EGX A;  3U12 A;  4GXB A;  2X18 A;  4GPT B;  4HAU B;  2ELB A;  2CAY A;  1OQN A;  4K2O A;  2IFS A;  3PEG A;  3D8E A;  1XCG A;  3SO6 A;  2RLO A;  1H10 A;  5JHH A;  1DYN A;  3GYO A;  3NWD A;  1FGY A;  1TXD A;  4KHB B;  3WYF B;  4D6W A;  4HDO A;  2NMB A;  2M14 A;  4GZU A;  1K5G B;  1ZC4 B;  4DX8 A;  4DIX A;  2GCJ A;  2JP2 A;  4K81 A;  2COA A;  4P7I A;  1ZM0 A;  3DXE A;  2KCJ A;  4KHA A;  4MT7 A;  2D4Q A;  3SYX A;  1WG7 A;  1TQZ A;  1M7R A;  5L81 A;  1BTK A;  2KR0 A;  5DH9 B;  2H7D A;  3ULC A;  3ZDT A;  1I7A A;  3T06 A;  5C5B B;  2EMT A;  2V76 A;  1UNR A;  4DBB A;  3HQC A;  3DXC A;  2Z0Q A;  4CYE A;  2YS1 A;  3ODX A;  3O96 A;  2Z0O A;  3FVC A;  4H8S A;  1XOD A;  2W2W A;  2Q13 A;  1XX0 A;  5LOP B;  1UNQ A;  4WJ7 A;  1U5G A;  1AWE A;  5EFX A;  2AL6 A;  1N3H A;  1XD4 A;  4MY6 A;  4ZRK A;  1KZ7 A;  3HIE A;  2HTH B;  1WGU A;  3P7Z A;  4BBK A;  3KRW A;  2DTC A;  2IYB A;  2L1C A;  3MDB C;  4YON A;  2P0H A;  5CLL B;  1OMW A;  1WI1 A;  5C79 A;  1FHX A;  2DHI A;  3WA0 A;  1MK7 B;  2ROV A;  4HAW B;  2LOX A;  1GG3 A;  1FOE A;  5DHA B;  5CLQ B;  3CIK A;  3TO1 A;  2LOZ A;  4DX9 0;  3NSU A;  4A6H A; 
#chains in the Genus database with same CATH homology
 3QWM A;  3FSS A;  4QJ4 B;  1NU2 A;  3D8D A;  1RJ2 A;  1KZG A;  1Y19 B;  3OAN A;  2Z14 A;  1X11 A;  1ZSQ A;  5HE1 A;  4OSN A;  2KUQ A;  2YS3 A;  2DX5 A;  2Z59 A;  2Y8F A;  4ZRI A;  4HDQ A;  2BCJ A;  3G9W A;  3KY9 A;  3A8Q A;  1X1G A;  5HE2 A;  5LON B;  4PNK A;  2RVB B;  2MDX A;  4PQ0 A;  1V5M A;  2VRW B;  5I2M A;  2D9Y A;  2Z4D A;  1B55 A;  2RRF A;  2P8V A;  2D11 A;  4HB0 B;  4GN1 A;  5GOW B;  2MFQ A;  3A8P A;  1M7E A;  2FJL A;  4QXA B;  5KQ1 A;  4D0N B;  1LW3 A;  4DXA B;  3MPX A;  1H4R A;  1FB8 A;  2J0M A;  2I5C A;  1FAO A;  2Z0P A;  5FI0 A;  3TCA A;  3V5W A;  1PFJ A;  1LB1 A;  2ZPY A;  2GCL A;  1WVH A;  2EC1 A;  4NY0 A;  3TFM A;  2OQB A;  1TJ6 A;  5DI9 B;  2Y7B A;  2DLW A;  1DDM A;  3HK0 A;  1I2H A;  3ML4 A;  4EJN A;  2YS5 A;  2K00 A;  1NI2 A;  2DA0 A;  1NTY A;  2LUL A;  1BAK A;  2YT0 A;  4KHB A;  2DYN A;  2NBV A;  1U27 A;  2LYD A;  3QBV B;  3NW8 A;  3FEH A;  2CY5 A;  1WJM A;  2YF0 A;  1X86 A;  4HHV A;  1WGQ A;  4TYZ A;  1V89 A;  4A6F B;  2LKO A;  2DKQ A;  1W1G A;  3PZD A;  1U5E A;  2I1K A;  1J0W A;  2GJY A;  1E5W A;  2COF A;  3AU5 A;  4KHO A;  4EKU A;  1MPH A;  5D3X A;  2RSG A;  3BIN A;  2P0F A;  2LG1 A;  3A98 B;  1MIX A;  2D9V A;  1U5F A;  3DXD A;  2VSZ A;  3AU4 A;  3RCP A;  1Y5O A;  1X1F A;  3ODW A;  4HB3 B;  3GYP A;  3NWF A;  2QKM A;  2D9W A;  2YSZ A;  1DRO A;  3SUZ A;  1OY2 A;  1FGZ A;  2N0Y A;  5JLJ B;  1KI1 B;  2ADZ A;  1P6S A;  2I1J A;  1BWN A;  4Z2N A;  2K2U A;  1QQG A;  4K2P A;  1Z87 A;  3PVW A;  5D27 A;  2W2X D;  4QJ5 B;  1QC6 A;  1MIZ B;  2FJU B;  2KIE A;  1V5P A;  5KCV A;  1UNP A;  2RNR B;  1DDV A;  5IRS A;  1MKE A;  1IRS A;  2GS0 A;  2RUK B;  2AEH A;  1P5T A;  4C0A A;  5DHF B;  4F7H A;  1MAI A;  2K2J A;  4Y94 A;  4GMV A;  2ROZ B;  4HAY B;  2ZKM X;  4GMX B;  4OT1 A;  2YRY A;  3D8F A;  2K8E A;  3SNH A;  2J59 M;  3SV1 A;  1J19 A;  1W1H A;  1ZVR A;  3TVV A;  3ZVR A;  4IFS A;  4HSI A;  1P3R A;  1DDW A;  1BTN A;  2XQN M;  4HAT B;  2CRF A;  4F7G A;  2COC A;  1PMS A;  1V88 A;  2H7E A;  4K17 A;  4XWX A;  4B6H A;  1U2B A;  3IVF A;  2G35 A;  3NWA A;  4IAP A;  5LG4 B;  4KVG B;  1FHO A;  1PLS A;  5DIF B;  4A6K A;  3ODO A;  1X05 A;  2P0D A;  4ZRJ A;  2R2Y A;  1U5D A;  2MKR A;  2DHK A;  3PVL A;  2ELA A;  2DKP A;  2VKI A;  2CY4 A;  2YT1 A;  4QJ3 B;  3KRX A;  4L6E A;  4L1R A;  4NSW A;  3PP2 A;  2KIG A;  5KQ4 A;  4F7U P;  3TW1 A;  1SGH A;  4YL8 A;  3QIJ A;  3U7D A;  1AQC A;  4CHJ A;  3P6A A;  3ULB A;  5C5B A;  2K49 A;  4GNK B;  2PZ1 A;  5J3Y A;  2R0D A;  2M38 A;  5J3T A;  3HW2 B;  1XR0 B;  1EVH A;  4MK0 A;  1GC6 A;  1U29 A;  4KAX B;  5D3V A;  2D10 A;  2D9Z A;  5JP4 A;  4CSQ A;  1UEF A;  5C6R A;  1MK9 B;  2QKL A;  4IOY X;  1XKE A;  3AJ4 A;  2YT2 A;  2RGN B;  3PG7 A;  3FM8 C;  2HE7 A;  5D3W A;  3X23 A;  2N23 A;  3KSY A;  3M1I B;  4A5K A;  5HE0 A;  1V5U A;  2DHJ A;  2EJ8 A;  3UZT A;  4A6F A;  2J0K A;  3U8Z A;  5HE3 A;  4HAZ B;  2R09 A;  4WVF B;  3KZ1 A;  1W1D A;  2MWN B;  4HAX B;  3N7C A;  2DX1 A;  4HAV B;  1FHW A;  3A58 A;  1Q67 A;  3LJU X;  1SHC A;  1RRP B;  3PVU A;  2Z13 A;  2KUP A;  1UPR A;  2D9X A;  1ISN A;  4HB4 B;  1EAZ A;  3PSC A;  1K5D B;  2YVC A;  1GC7 A;  5FI1 A;  4EMO A;  4TKN A;  2I5F A;  1ZC3 B;  5JHG A;  3BJI A;  2NZ8 B;  3OHM B;  1UPQ A;  2E2X A;  2UZS A;  2OTX A;  2COD A;  2DN6 A;  4CHM A;  4GOU A;  4Z2M B;  4WSF A;  2EMS A;  1NTV A;  3F0W A;  3VOQ A;  1EF1 A;  2KGX B;  5D3Y A;  2D2Q A;  2GUM A;  1V61 A;  3VIA A;  2UZR A;  2Y8G A;  3F5R A;  5J3Q A;  2DFK A;  4HB2 B;  3CXB B;  1WJ1 A;  2J0J A;  5I2S A;  1ZYI A;  2DYQ A;  2UVM A;  2W2X C;  5C16 A;  1DBH A;  5M4Y B;  2L2I A;  1EGX A;  3U12 A;  4GXB A;  2X18 A;  4GPT B;  4HAU B;  2ELB A;  2CAY A;  1OQN A;  4K2O A;  2IFS A;  3PEG A;  3D8E A;  1XCG A;  3SO6 A;  2RLO A;  1H10 A;  5JHH A;  1DYN A;  3GYO A;  3NWD A;  1FGY A;  1TXD A;  4KHB B;  3WYF B;  4D6W A;  4HDO A;  2NMB A;  2M14 A;  4GZU A;  1K5G B;  1ZC4 B;  4DX8 A;  4DIX A;  2GCJ A;  2JP2 A;  4K81 A;  2COA A;  4P7I A;  1ZM0 A;  3DXE A;  2KCJ A;  4KHA A;  4MT7 A;  2D4Q A;  3SYX A;  1WG7 A;  1TQZ A;  1M7R A;  5L81 A;  1BTK A;  2KR0 A;  5DH9 B;  2H7D A;  3ULC A;  3ZDT A;  1I7A A;  3T06 A;  5C5B B;  2EMT A;  2V76 A;  1UNR A;  4DBB A;  3HQC A;  3DXC A;  2Z0Q A;  4CYE A;  2YS1 A;  3ODX A;  3O96 A;  2Z0O A;  3FVC A;  4H8S A;  1XOD A;  2W2W A;  2Q13 A;  1XX0 A;  5LOP B;  1UNQ A;  4WJ7 A;  1U5G A;  1AWE A;  5EFX A;  2AL6 A;  1N3H A;  1XD4 A;  4MY6 A;  4ZRK A;  1KZ7 A;  2HTH B;  3HIE A;  1WGU A;  3P7Z A;  4BBK A;  3KRW A;  2DTC A;  2IYB A;  2L1C A;  3MDB C;  4YON A;  2P0H A;  5CLL B;  1OMW A;  1WI1 A;  5C79 A;  1FHX A;  2DHI A;  3WA0 A;  1MK7 B;  2ROV A;  4HAW B;  2LOX A;  1GG3 A;  1FOE A;  5DHA B;  5CLQ B;  3CIK A;  3TO1 A;  2LOZ A;  4DX9 0;  3NSU A;  4A6H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...