3GYPA

Rtt106p
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
237
structure length
225
Chain Sequence
EISETNTIFKLEGVSVLSPLRKKLDLVFYLSNVDGSPVITLLKGNDRELSIYQLNKNIKMASFLPVPEKPNLIYLFMTYTSCEDNKFSEPVVMTLNKENTLNQFKNLGLLDSNVTDFEKCVEYIRKQAILTGFKISNPFVNSFHLQCHRGTKEGTLYFLPDHIIFGFKKPILLFDASDIESITYSSITRLTFNASLVTKDGEKYEFSMTDQTEYAKIDDYVKRKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone chaperone RTT106
publication title Structural analysis of Rtt106p reveals a DNA-binding role required for heterochromatin silencing
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Chaperone
total genus 43
structure length 225
sequence length 237
ec nomenclature
pdb deposition date 2009-04-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08512 Rtt106 Histone chaperone Rttp106-like
A PF18469 PH_18 Pleckstrin homology domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 3gypA02
2.30.29.120 Mainly Beta Roll PH-domain like PH-domain like 3gypA01
3A98B 1BAKA 2R09A 4A5KA 1ZSQA 2VRWB 3FEHA 2P0DA 5C5BA 4Z2NA 4H8SA 2GCJA 3TCAA 2BCJA 4MT7A 4P7IA 1WVHA 1ZVRA 5J3YA 5C5BB 2I5FA 4HHVA 1UPRA 5J3TA 3KSYA 2E2XA 1ISNA 4IOYX 5L81A 1TQZA 1W1HA 2Z0PA 2J0JA 4KVGB 2D4QA 2GJYA 4HAVB 3P6AA 2Y7BA 1DROA 2EC1A 2DKPA 5DI9B 1FAOA 2I1KA 2Z0OA 2OTXA 4A6HA 1TJ6A 1WGUA 2HTHB 4DBBA 4HAZB 2DHKA 3DXEA 1Y5OA 2ROZB 4Y94A 3TO1A 1XKEA 2AL6A 1UNRA 2PZ1A 2R0DA 3VOQA 1U5EA 2Z0QA 5D3WA 4ZRIA 5HE1A 1KZGA 3QIJA 3RCPA 3BINA 3PVWA 1V61A 2IYBA 2P0HA 2D2QA 2MWNB 1I2HA 1U5FA 3KZ1A 2KGXB 4KAXB 3GYPA 3PSCA 3MPXA 4C0AA 2DKQA 3PG7A 1GG3A 3D8EA 3WA0A 3KRXA 5CLQB 2H7EA 1MIZB 5D3VA 3SYXA 3G9WA 2DX1A 1IRSA 4IAPA 3ZVRA 3QBVB 2P8VA 3U7DA 2D9WA 1DYNA 2ZPYA 4PNKA 1NU2A 5DH9B 3LJUX 2QKLA 4A6KA 2DN6A 1XX0A 1V5PA 4HDOA 2D9ZA 1X1GA 1XCGA 1XODA 2Q13A 3X23A 2DYQA 1TXDA 4YONA 4DXAB 1H10A 1Z87A 2YT0A 1NTVA 3KRWA 1U2BA 2MDXA 3SUZA 4EJNA 2CAYA 4GN1A 2UVMA 1LB1A 2QKMA 1DDMA 2J0KA 5C79A 4DX8A 1M7RA 4HAXB 1U5DA 3F5RA 5JLJB 2RUKB 4K81A 1W1GA 1PLSA 1ZM0A 1E5WA 2IFSA 4GMVA 2LG1A 3ULBA 1AWEA 4YL8A 1FHOA 2M38A 1BTNA 3AJ4A 2LKOA 2MFQA 2VSZA 3VIAA 4F7GA 4EMOA 2N0YA 4BBKA 2OQBA 1NI2A 1FGZA 2X18A 1V89A 2UZRA 2COFA 2CY5A 1QC6A 2L2IA 4HAWB 1X05A 3WYFB 3DXCA 3ULCA 2YT1A 2H7DA 1Y19B 2K2UA 1M7EA 4XWXA 3DXDA 5JHGA 5JP4A 4WJ7A 4CYEA 4HAYB 4GXBA 1X1FA 5D27A 3N7CA 2NMBA 2RGNB 2MKRA 1UNPA 5DHFB 2COCA 5DIFB 2CY4A 2DYNA 3PP2A 1DDVA 1UNQA 3NSUA 1FOEA 5HE3A 3KY9A 4A6FA 1XR0B 4PQ0A 1OQNA 4D0NB 4A6FB 2D9VA 1LW3A 1FB8A 1EVHA 1Q67A 2YSZA 2D11A 2VKIA 1J19A 3TVVA 2GCLA 1BTKA 1W1DA 2W2XD 2L1CA 4HB4B 1WJMA 1X86A 5C6RA 4L6EA 4KHBB 1I7AA 2DX5A 4NY0A 3PZDA 3MDBC 3SNHA 1MK7B 1MAIA 4WSFA 1EAZA 3QWMA 4EKUA 4HATB 3IVFA 4MY6A 3AU4A 5CLLB 3M1IB 2DHIA 3TW1A 2XQNM 1SGHA 1EF1A 4NSWA 1MIXA 5LOPB 2J59M 5J3QA 2P0FA 4HB2B 1WG7A 1MKEA 2GS0A 1ZC4B 2CODA 3PEGA 1UEFA 2ELAA 3V5WA 3P7ZA 4KHAA 4MK0A 1OY2A 1N3HA 1RRPB 2RNRB 5EFXA 4TKNA 4HB3B 1PFJA 2RLOA 4B6HA 1FGYA 1NTYA 2KUPA 3ODWA 1B55A 4GZUA 2N23A 3SV1A 1BWNA 4TYZA 3CXBB 3OANA 5FI1A 2YS5A 4KHOA 3A8PA 3O96A 1SHCA 4CHJA 2J0MA 2M14A 5KQ1A 2K00A 5FI0A 1RJ2A 1UPQA 4IFSA 2JP2A 1P5TA 4F7HA 5DHAB 3A8QA 1U5GA 5GOWB 1P3RA 2YF0A 2AEHA 3PVLA 1J0WA 2D9XA 5JHHA 1GC6A 2ADZA 3UZTA 4Z2MB 4K2PA 5D3YA 3D8FA 2DLWA 1XD4A 3U8ZA 5D3XA 1DBHA 1KI1B 2LULA 2LOZA 1MK9B 1QQGA 1ZC3B 2W2WA 3HK0A 2KCJA 4HDQA 3BJIA 2DHJA 1V88A 4HAUB 4CHMA 2DA0A 3F0WA 1H4RA 2D10A 4F7UP 2Y8GA 1WGQA 5HE2A 1P6SA 1KZ7A 2DTCA 3PVUA 4GMXB 2YS3A 2ROVA 1PMSA 3D8DA 2K2JA 2LOXA 2W2XC 4WVFB 2Y8FA 3ODXA 2YS1A 2YRYA 1FHXA 5LONB 2COAA 2ELBA 4K2OA 3ZDTA 3GYOA 2DFKA 4K17A 2EMTA 2YVCA 2FJLA 2LYDA 5HE0A 2RVBB 3AU5A 3CIKA 1EGXA 2EJ8A 2V76A 3HQCA 3TFMA 1V5MA 5KCVA 4HB0B 3FSSA 3SO6A 1OMWA 1U27A 2RSGA 2EMSA 1WI1A 1MPHA 1U29A 1DDWA 1V5UA 2CRFA 1K5GB 3ODOA 3ML4A 2HE7A 2I5CA 4ZRKA 1FHWA 4ZRJA 1WJ1A 2I1JA 5C16A 1X11A 2D9YA 2G35A 3HW2B 3T06A 4DX90 1AQCA 1K5DB 2UZSA 5KQ4A 4GPTB 2NZ8B 3FM8C 1GC7A
chains in the Genus database with same CATH superfamily
3A98B 1BAKA 2R09A 4A5KA 1ZSQA 2VRWB 3FEHA 2P0DA 5C5BA 4Z2NA 4H8SA 2GCJA 3TCAA 2BCJA 4MT7A 4P7IA 3NWAA 1WVHA 1ZVRA 5J3YA 5C5BB 2I5FA 4HHVA 1UPRA 5J3TA 3KSYA 2E2XA 1ISNA 4IOYX 5L81A 1TQZA 2K8EA 1W1HA 2Z0PA 2J0JA 4KVGB 2D4QA 2GJYA 4HAVB 4CSQA 3P6AA 2Y7BA 1DROA 2EC1A 2DKPA 5DI9B 1FAOA 2I1KA 2Z0OA 2OTXA 4A6HA 1TJ6A 1WGUA 2HTHB 4DBBA 4HAZB 2DHKA 3DXEA 1Y5OA 2KR0A 2ROZB 4Y94A 3TO1A 1XKEA 2AL6A 3DCXA 1UNRA 2PZ1A 2R0DA 3VOQA 1U5EA 2Z0QA 5D3WA 4ZRIA 5HE1A 1KZGA 3QIJA 3RCPA 3BINA 3PVWA 1V61A 2IYBA 2P0HA 2D2QA 2MWNB 4L1RA 1I2HA 1U5FA 3KZ1A 2KGXB 4KAXB 3GYPA 3PSCA 5LG4B 3MPXA 4D6WA 4C0AA 2DKQA 3PG7A 1GG3A 3D8EA 3WA0A 3KRXA 5CLQB 2H7EA 1MIZB 3A58A 5D3VA 3SYXA 5IRSA 3NW8A 3G9WA 2DX1A 1IRSA 4IAPA 3ZVRA 3QBVB 2P8VA 3U7DA 2D9WA 4QJ3B 1DYNA 2ZPYA 4PNKA 1NU2A 2Z4DA 5DH9B 3LJUX 2QKLA 4A6KA 2DN6A 1XX0A 1V5PA 4HDOA 2D9ZA 4QJ5B 1X1GA 1XCGA 1XODA 2Q13A 3X23A 2DYQA 1TXDA 4YONA 4DXAB 1H10A 1Z87A 2YT0A 1NTVA 3KRWA 1U2BA 2MDXA 3SUZA 4EJNA 2CAYA 4GN1A 2UVMA 1LB1A 2KIGA 2QKMA 1DDMA 2J0KA 5C79A 4DX8A 1M7RA 3NWDA 4HAXB 1U5DA 3F5RA 5JLJB 2RUKB 4K81A 1W1GA 1PLSA 1ZM0A 1E5WA 2IFSA 4GMVA 2LG1A 3ULBA 1AWEA 4YL8A 1FHOA 2M38A 1BTNA 3AJ4A 2LKOA 2K49A 2MFQA 2VSZA 3VIAA 4F7GA 4EMOA 2N0YA 4BBKA 2OQBA 4OSNA 1NI2A 1FGZA 3HIEA 2X18A 1V89A 2UZRA 2COFA 2CY5A 1QC6A 2L2IA 4HAWB 1X05A 3WYFB 3DXCA 3ULCA 2YT1A 2H7DA 1Y19B 2K2UA 1M7EA 4XWXA 3DXDA 5JHGA 5JP4A 4WJ7A 4CYEA 4HAYB 4GXBA 1X1FA 1T77A 5D27A 3N7CA 2NMBA 2RGNB 2MKRA 1UNPA 5DHFB 4OT1A 2COCA 5DIFB 2NBVA 2CY4A 2DYNA 3PP2A 1DDVA 2KIEA 1UNQA 3NSUA 1FOEA 5HE3A 3KY9A 4A6FA 1XR0B 4PQ0A 1OQNA 4D0NB 4A6FB 2D9VA 1LW3A 1FB8A 1EVHA 1Q67A 3U12A 2YSZA 2D11A 2VKIA 1J19A 3TVVA 2GCLA 1BTKA 1W1DA 2W2XD 2L1CA 4KHBA 4HB4B 1WJMA 1X86A 5C6RA 4L6EA 4KHBB 1I7AA 2DX5A 4NY0A 4QJ4B 3PZDA 3MDBC 3SNHA 1MK7B 1MAIA 4WSFA 1EAZA 3QWMA 4EKUA 4HATB 3IVFA 4MY6A 3AU4A 5CLLB 2DHIA 3M1IB 3TW1A 2XQNM 1SGHA 2ZKMX 1EF1A 4GOUA 4NSWA 1MIXA 5LOPB 2J59M 5J3QA 2P0FA 4HB2B 1WG7A 1MKEA 2GS0A 1ZC4B 2CODA 4GNKB 5I2MA 3PEGA 1UEFA 2ELAA 3V5WA 3P7ZA 4KHAA 4MK0A 4QXAB 1OY2A 1N3HA 3HSAA 1RRPB 2RNRB 5EFXA 4TKNA 4HB3B 1PFJA 2RLOA 4B6HA 1FGYA 1NTYA 2KUPA 3ODWA 1B55A 4GZUA 2N23A 3SV1A 1BWNA 4TYZA 2KUQA 3CXBB 2Z14A 3OANA 5I2SA 5FI1A 2YS5A 4KHOA 3A8PA 3O96A 3NWFA 1SHCA 4CHJA 2J0MA 2M14A 5KQ1A 2K00A 2FJUB 5FI0A 1RJ2A 1UPQA 4IFSA 3OHMB 1MI1A 2JP2A 1P5TA 4F7HA 3B77A 1ZYIA 5DHAB 3A8QA 1U5GA 5GOWB 1P3RA 5M4YB 2YF0A 2AEHA 3PVLA 1J0WA 2D9XA 5JHHA 1GC6A 2ADZA 3UZTA 4Z2MB 4K2PA 5D3YA 3D8FA 2DLWA 4DIXA 1XD4A 3U8ZA 5D3XA 1DBHA 1KI1B 2LULA 2LOZA 1MK9B 1QQGA 1ZC3B 2W2WA 3HK0A 2KCJA 4HDQA 3BJIA 2R2YA 2DHJA 1V88A 4HAUB 4CHMA 2DA0A 3F0WA 1H4RA 2D10A 4F7UP 2Y8GA 1WGQA 5HE2A 1P6SA 2Z13A 1KZ7A 2YT2A 2DTCA 3PVUA 4GMXB 2YS3A 2ROVA 1PMSA 3D8DA 2K2JA 2LOXA 2W2XC 4WVFB 2Y8FA 3ODXA 2YS1A 2YRYA 1FHXA 5LONB 2COAA 2ELBA 4K2OA 4HSIA 2Z59A 3ZDTA 3GYOA 2DFKA 4K17A 2EMTA 2YVCA 2FJLA 2LYDA 5HE0A 2RVBB 3AU5A 3CIKA 1EGXA 2EJ8A 2V76A 2GUMA 3HQCA 3TFMA 1V5MA 5KCVA 4HB0B 3FSSA 3SO6A 1OMWA 1U27A 2RSGA 2EMSA 1WI1A 1MPHA 1U29A 1DDWA 1V5UA 2CRFA 1K5GB 3ODOA 3ML4A 2HE7A 2I5CA 4ZRKA 1FHWA 4ZRJA 1WJ1A 2RRFA 2I1JA 5C16A 1X11A 2D9YA 2G35A 3FVCA 3HW2B 3T06A 4DX90 1AQCA 1K5DB 2UZSA 5KQ4A 4GPTB 2NZ8B 3FM8C 1GC7A
chains in the Genus database with same CATH topology
3A98B 1BAKA 2R09A 4A5KA 1ZSQA 2VRWB 3FEHA 2P0DA 5C5BA 4Z2NA 4H8SA 2GCJA 3TCAA 2BCJA 4MT7A 4P7IA 3NWAA 1WVHA 1ZVRA 5J3YA 5C5BB 2I5FA 4HHVA 1UPRA 5J3TA 3KSYA 2E2XA 1ISNA 4IOYX 5L81A 1TQZA 2K8EA 1W1HA 2Z0PA 2J0JA 4KVGB 2D4QA 2GJYA 4HAVB 4CSQA 3P6AA 2Y7BA 1DROA 2EC1A 2DKPA 5DI9B 1FAOA 2I1KA 2Z0OA 2OTXA 4A6HA 1TJ6A 1WGUA 2HTHB 4DBBA 4HAZB 2DHKA 3DXEA 1Y5OA 2KR0A 2ROZB 4Y94A 3TO1A 1XKEA 2AL6A 1UNRA 2PZ1A 2R0DA 3VOQA 1U5EA 2Z0QA 5D3WA 4ZRIA 5HE1A 1KZGA 3QIJA 3RCPA 3BINA 3PVWA 1V61A 2IYBA 2P0HA 2D2QA 2MWNB 4L1RA 1I2HA 1U5FA 3KZ1A 2KGXB 4KAXB 3GYPA 3PSCA 5LG4B 3MPXA 4D6WA 4C0AA 2DKQA 3PG7A 1GG3A 3D8EA 3WA0A 3KRXA 5CLQB 2H7EA 1MIZB 3A58A 5D3VA 3SYXA 5IRSA 3NW8A 3G9WA 2DX1A 1IRSA 4IAPA 3ZVRA 3QBVB 2P8VA 3U7DA 2D9WA 4QJ3B 1DYNA 2ZPYA 4PNKA 1NU2A 2Z4DA 5DH9B 3LJUX 2QKLA 4A6KA 2DN6A 1XX0A 1V5PA 4HDOA 2D9ZA 4QJ5B 1X1GA 1XCGA 1XODA 2Q13A 3X23A 2DYQA 1TXDA 4YONA 4DXAB 1H10A 1Z87A 2YT0A 1NTVA 3KRWA 1U2BA 2MDXA 3SUZA 4EJNA 2CAYA 4GN1A 2UVMA 1LB1A 2KIGA 2QKMA 1DDMA 2J0KA 5C79A 4DX8A 1M7RA 3NWDA 4HAXB 1U5DA 3F5RA 5JLJB 2RUKB 4K81A 1W1GA 1PLSA 1ZM0A 1E5WA 2IFSA 4GMVA 2LG1A 3ULBA 1AWEA 4YL8A 1FHOA 2M38A 1BTNA 3AJ4A 2LKOA 2MFQA 2K49A 2VSZA 3VIAA 4F7GA 4EMOA 2N0YA 4BBKA 2OQBA 4OSNA 1NI2A 1FGZA 3HIEA 2X18A 1V89A 2UZRA 2COFA 2CY5A 1QC6A 2L2IA 4HAWB 1X05A 3WYFB 3DXCA 3ULCA 2YT1A 2H7DA 1Y19B 2K2UA 1M7EA 4XWXA 3DXDA 5JHGA 5JP4A 4WJ7A 4CYEA 4HAYB 4GXBA 1X1FA 5D27A 3N7CA 2NMBA 2RGNB 2MKRA 1UNPA 5DHFB 4OT1A 2COCA 5DIFB 2NBVA 2CY4A 2DYNA 3PP2A 1DDVA 2KIEA 1UNQA 3NSUA 1FOEA 5HE3A 3KY9A 4A6FA 1XR0B 4PQ0A 1OQNA 4D0NB 4A6FB 2D9VA 1LW3A 1FB8A 1EVHA 1Q67A 3U12A 2YSZA 2D11A 2VKIA 1J19A 3TVVA 2GCLA 1BTKA 1W1DA 2W2XD 2L1CA 4KHBA 4HB4B 1WJMA 1X86A 5C6RA 4L6EA 4KHBB 1I7AA 2DX5A 4NY0A 4QJ4B 3PZDA 3MDBC 3SNHA 1MK7B 1MAIA 4WSFA 1EAZA 3QWMA 4EKUA 4HATB 3IVFA 4MY6A 3AU4A 5CLLB 3M1IB 2DHIA 3TW1A 2XQNM 1SGHA 2ZKMX 1EF1A 4GOUA 4NSWA 1MIXA 5LOPB 2J59M 5J3QA 2P0FA 4HB2B 1WG7A 1MKEA 2GS0A 1ZC4B 2CODA 4GNKB 5I2MA 3PEGA 1UEFA 2ELAA 3V5WA 3P7ZA 4KHAA 4MK0A 4QXAB 1OY2A 1N3HA 1RRPB 2RNRB 5EFXA 4TKNA 4HB3B 1PFJA 2RLOA 4B6HA 1FGYA 1NTYA 2KUPA 3ODWA 1B55A 4GZUA 2N23A 3SV1A 1BWNA 4TYZA 2KUQA 3CXBB 2Z14A 3OANA 5I2SA 5FI1A 2YS5A 4KHOA 3A8PA 3O96A 3NWFA 1SHCA 4CHJA 2J0MA 2M14A 5KQ1A 2K00A 5FI0A 2FJUB 1RJ2A 1UPQA 4IFSA 3OHMB 2JP2A 1P5TA 4F7HA 1ZYIA 5DHAB 3A8QA 1U5GA 5GOWB 1P3RA 5M4YB 2YF0A 2AEHA 3PVLA 1J0WA 2D9XA 5JHHA 1GC6A 2ADZA 3UZTA 4Z2MB 4K2PA 5D3YA 3D8FA 2DLWA 4DIXA 1XD4A 3U8ZA 5D3XA 1DBHA 1KI1B 2LULA 2LOZA 1MK9B 1QQGA 1ZC3B 2W2WA 3HK0A 2KCJA 4HDQA 3BJIA 2R2YA 2DHJA 1V88A 4HAUB 4CHMA 2DA0A 3F0WA 1H4RA 2D10A 4F7UP 2Y8GA 1WGQA 5HE2A 1P6SA 2Z13A 1KZ7A 2YT2A 2DTCA 3PVUA 4GMXB 2YS3A 2ROVA 1PMSA 3D8DA 2K2JA 2LOXA 2W2XC 4WVFB 2Y8FA 3ODXA 2YS1A 2YRYA 1FHXA 5LONB 2COAA 2ELBA 4K2OA 4HSIA 2Z59A 3ZDTA 3GYOA 2DFKA 4K17A 2EMTA 2YVCA 2FJLA 2LYDA 5HE0A 2RVBB 3AU5A 3CIKA 1EGXA 2EJ8A 2V76A 2GUMA 3HQCA 3TFMA 1V5MA 5KCVA 4HB0B 3FSSA 3SO6A 1OMWA 1U27A 2RSGA 2EMSA 1WI1A 1MPHA 1U29A 1DDWA 1V5UA 2CRFA 1K5GB 3ODOA 3ML4A 2HE7A 2I5CA 4ZRKA 1FHWA 4ZRJA 1WJ1A 2RRFA 2I1JA 5C16A 1X11A 2D9YA 2G35A 3HW2B 3FVCA 3T06A 4DX90 1AQCA 1K5DB 2UZSA 5KQ4A 4GPTB 2NZ8B 3FM8C 1GC7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3A98 B;  1BAK A;  2R09 A;  4A5K A;  1ZSQ A;  2VRW B;  3FEH A;  2P0D A;  5C5B A;  4Z2N A;  4H8S A;  2GCJ A;  3TCA A;  2BCJ A;  4MT7 A;  4P7I A;  1WVH A;  1ZVR A;  5J3Y A;  5C5B B;  2I5F A;  4HHV A;  1UPR A;  5J3T A;  3KSY A;  2E2X A;  1ISN A;  4IOY X;  5L81 A;  1TQZ A;  1W1H A;  2Z0P A;  2J0J A;  4KVG B;  2D4Q A;  2GJY A;  4HAV B;  3P6A A;  2Y7B A;  1DRO A;  2EC1 A;  2DKP A;  5DI9 B;  1FAO A;  2I1K A;  2Z0O A;  2OTX A;  4A6H A;  1TJ6 A;  1WGU A;  2HTH B;  4DBB A;  4HAZ B;  2DHK A;  3DXE A;  1Y5O A;  2ROZ B;  4Y94 A;  3TO1 A;  1XKE A;  2AL6 A;  1UNR A;  2PZ1 A;  2R0D A;  3VOQ A;  1U5E A;  2Z0Q A;  5D3W A;  4ZRI A;  5HE1 A;  1KZG A;  3QIJ A;  3RCP A;  3BIN A;  3PVW A;  1V61 A;  2IYB A;  2P0H A;  2D2Q A;  2MWN B;  1I2H A;  1U5F A;  3KZ1 A;  2KGX B;  4KAX B;  3GYP A;  3PSC A;  3MPX A;  4C0A A;  2DKQ A;  3PG7 A;  1GG3 A;  3D8E A;  3WA0 A;  3KRX A;  5CLQ B;  2H7E A;  1MIZ B;  5D3V A;  3SYX A;  3G9W A;  2DX1 A;  1IRS A;  4IAP A;  3ZVR A;  3QBV B;  2P8V A;  3U7D A;  2D9W A;  1DYN A;  2ZPY A;  4PNK A;  1NU2 A;  5DH9 B;  3LJU X;  2QKL A;  4A6K A;  2DN6 A;  1XX0 A;  1V5P A;  4HDO A;  2D9Z A;  1X1G A;  1XCG A;  1XOD A;  2Q13 A;  3X23 A;  2DYQ A;  1TXD A;  4YON A;  4DXA B;  1H10 A;  1Z87 A;  2YT0 A;  1NTV A;  3KRW A;  1U2B A;  2MDX A;  3SUZ A;  4EJN A;  2CAY A;  4GN1 A;  2UVM A;  1LB1 A;  2QKM A;  1DDM A;  2J0K A;  5C79 A;  4DX8 A;  1M7R A;  4HAX B;  1U5D A;  3F5R A;  5JLJ B;  2RUK B;  4K81 A;  1W1G A;  1PLS A;  1ZM0 A;  1E5W A;  2IFS A;  4GMV A;  2LG1 A;  3ULB A;  1AWE A;  4YL8 A;  1FHO A;  2M38 A;  1BTN A;  3AJ4 A;  2LKO A;  2MFQ A;  2VSZ A;  3VIA A;  4F7G A;  4EMO A;  2N0Y A;  4BBK A;  2OQB A;  1NI2 A;  1FGZ A;  2X18 A;  1V89 A;  2UZR A;  2COF A;  2CY5 A;  1QC6 A;  2L2I A;  4HAW B;  1X05 A;  3WYF B;  3DXC A;  3ULC A;  2YT1 A;  2H7D A;  1Y19 B;  2K2U A;  1M7E A;  4XWX A;  3DXD A;  5JHG A;  5JP4 A;  4WJ7 A;  4CYE A;  4HAY B;  4GXB A;  1X1F A;  5D27 A;  3N7C A;  2NMB A;  2RGN B;  2MKR A;  1UNP A;  5DHF B;  2COC A;  5DIF B;  2CY4 A;  2DYN A;  3PP2 A;  1DDV A;  1UNQ A;  3NSU A;  1FOE A;  5HE3 A;  3KY9 A;  4A6F A;  1XR0 B;  4PQ0 A;  1OQN A;  4D0N B;  4A6F B;  2D9V A;  1LW3 A;  1FB8 A;  1EVH A;  1Q67 A;  2YSZ A;  2D11 A;  2VKI A;  1J19 A;  3TVV A;  2GCL A;  1BTK A;  1W1D A;  2W2X D;  2L1C A;  4HB4 B;  1WJM A;  1X86 A;  5C6R A;  4L6E A;  4KHB B;  1I7A A;  2DX5 A;  4NY0 A;  3PZD A;  3MDB C;  3SNH A;  1MK7 B;  1MAI A;  4WSF A;  1EAZ A;  3QWM A;  4EKU A;  4HAT B;  3IVF A;  4MY6 A;  3AU4 A;  5CLL B;  3M1I B;  2DHI A;  3TW1 A;  2XQN M;  1SGH A;  1EF1 A;  4NSW A;  1MIX A;  5LOP B;  2J59 M;  5J3Q A;  2P0F A;  4HB2 B;  1WG7 A;  1MKE A;  2GS0 A;  1ZC4 B;  2COD A;  3PEG A;  1UEF A;  2ELA A;  3V5W A;  3P7Z A;  4KHA A;  4MK0 A;  1OY2 A;  1N3H A;  1RRP B;  2RNR B;  5EFX A;  4TKN A;  4HB3 B;  1PFJ A;  2RLO A;  4B6H A;  1FGY A;  1NTY A;  2KUP A;  3ODW A;  1B55 A;  4GZU A;  2N23 A;  3SV1 A;  1BWN A;  4TYZ A;  3CXB B;  3OAN A;  5FI1 A;  2YS5 A;  4KHO A;  3A8P A;  3O96 A;  1SHC A;  4CHJ A;  2J0M A;  2M14 A;  5KQ1 A;  2K00 A;  5FI0 A;  1RJ2 A;  1UPQ A;  4IFS A;  2JP2 A;  1P5T A;  4F7H A;  5DHA B;  3A8Q A;  1U5G A;  5GOW B;  1P3R A;  2YF0 A;  2AEH A;  3PVL A;  1J0W A;  2D9X A;  5JHH A;  1GC6 A;  2ADZ A;  3UZT A;  4Z2M B;  4K2P A;  5D3Y A;  3D8F A;  2DLW A;  1XD4 A;  3U8Z A;  5D3X A;  1DBH A;  1KI1 B;  2LUL A;  2LOZ A;  1MK9 B;  1QQG A;  1ZC3 B;  2W2W A;  3HK0 A;  2KCJ A;  4HDQ A;  3BJI A;  2DHJ A;  1V88 A;  4HAU B;  4CHM A;  2DA0 A;  3F0W A;  1H4R A;  2D10 A;  4F7U P;  2Y8G A;  1WGQ A;  5HE2 A;  1P6S A;  1KZ7 A;  2DTC A;  3PVU A;  4GMX B;  2YS3 A;  2ROV A;  1PMS A;  3D8D A;  2K2J A;  2LOX A;  2W2X C;  4WVF B;  2Y8F A;  3ODX A;  2YS1 A;  2YRY A;  1FHX A;  5LON B;  2COA A;  2ELB A;  4K2O A;  3ZDT A;  3GYO A;  2DFK A;  4K17 A;  2EMT A;  2YVC A;  2FJL A;  2LYD A;  5HE0 A;  2RVB B;  3AU5 A;  3CIK A;  1EGX A;  2EJ8 A;  2V76 A;  3HQC A;  3TFM A;  1V5M A;  5KCV A;  4HB0 B;  3FSS A;  3SO6 A;  1OMW A;  1U27 A;  2RSG A;  2EMS A;  1WI1 A;  1MPH A;  1U29 A;  1DDW A;  1V5U A;  2CRF A;  1K5G B;  3ODO A;  3ML4 A;  2HE7 A;  2I5C A;  4ZRK A;  1FHW A;  4ZRJ A;  1WJ1 A;  2I1J A;  5C16 A;  1X11 A;  2D9Y A;  2G35 A;  3HW2 B;  3T06 A;  4DX9 0;  1AQC A;  1K5D B;  2UZS A;  5KQ4 A;  4GPT B;  2NZ8 B;  3FM8 C;  1GC7 A; 
#chains in the Genus database with same CATH topology
 3A98 B;  1BAK A;  2R09 A;  4A5K A;  1ZSQ A;  2VRW B;  3FEH A;  2P0D A;  5C5B A;  4Z2N A;  4H8S A;  2GCJ A;  3TCA A;  2BCJ A;  4MT7 A;  4P7I A;  3NWA A;  1WVH A;  1ZVR A;  5J3Y A;  5C5B B;  2I5F A;  4HHV A;  1UPR A;  5J3T A;  3KSY A;  2E2X A;  1ISN A;  4IOY X;  5L81 A;  1TQZ A;  2K8E A;  1W1H A;  2Z0P A;  2J0J A;  4KVG B;  2D4Q A;  2GJY A;  4HAV B;  4CSQ A;  3P6A A;  2Y7B A;  1DRO A;  2EC1 A;  2DKP A;  5DI9 B;  1FAO A;  2I1K A;  2Z0O A;  2OTX A;  4A6H A;  1TJ6 A;  1WGU A;  2HTH B;  4DBB A;  4HAZ B;  2DHK A;  3DXE A;  1Y5O A;  2KR0 A;  2ROZ B;  4Y94 A;  3TO1 A;  1XKE A;  2AL6 A;  3DCX A;  1UNR A;  2PZ1 A;  2R0D A;  3VOQ A;  1U5E A;  2Z0Q A;  5D3W A;  4ZRI A;  5HE1 A;  1KZG A;  3QIJ A;  3RCP A;  3BIN A;  3PVW A;  1V61 A;  2IYB A;  2P0H A;  2D2Q A;  2MWN B;  4L1R A;  1I2H A;  1U5F A;  3KZ1 A;  2KGX B;  4KAX B;  3GYP A;  3PSC A;  5LG4 B;  3MPX A;  4D6W A;  4C0A A;  2DKQ A;  3PG7 A;  1GG3 A;  3D8E A;  3WA0 A;  3KRX A;  5CLQ B;  2H7E A;  1MIZ B;  3A58 A;  5D3V A;  3SYX A;  5IRS A;  3NW8 A;  3G9W A;  2DX1 A;  1IRS A;  4IAP A;  3ZVR A;  3QBV B;  2P8V A;  3U7D A;  2D9W A;  4QJ3 B;  1DYN A;  2ZPY A;  4PNK A;  1NU2 A;  2Z4D A;  5DH9 B;  3LJU X;  2QKL A;  4A6K A;  2DN6 A;  1XX0 A;  1V5P A;  4HDO A;  2D9Z A;  4QJ5 B;  1X1G A;  1XCG A;  1XOD A;  2Q13 A;  3X23 A;  2DYQ A;  1TXD A;  4YON A;  4DXA B;  1H10 A;  1Z87 A;  2YT0 A;  1NTV A;  3KRW A;  1U2B A;  2MDX A;  3SUZ A;  4EJN A;  2CAY A;  4GN1 A;  2UVM A;  1LB1 A;  2KIG A;  2QKM A;  1DDM A;  2J0K A;  5C79 A;  4DX8 A;  1M7R A;  3NWD A;  4HAX B;  1U5D A;  3F5R A;  5JLJ B;  2RUK B;  4K81 A;  1W1G A;  1PLS A;  1ZM0 A;  1E5W A;  2IFS A;  4GMV A;  2LG1 A;  3ULB A;  1AWE A;  4YL8 A;  1FHO A;  2M38 A;  1BTN A;  3AJ4 A;  2LKO A;  2K49 A;  2MFQ A;  2VSZ A;  3VIA A;  4F7G A;  4EMO A;  2N0Y A;  4BBK A;  2OQB A;  4OSN A;  1NI2 A;  1FGZ A;  3HIE A;  2X18 A;  1V89 A;  2UZR A;  2COF A;  2CY5 A;  1QC6 A;  2L2I A;  4HAW B;  1X05 A;  3WYF B;  3DXC A;  3ULC A;  2YT1 A;  2H7D A;  1Y19 B;  2K2U A;  1M7E A;  4XWX A;  3DXD A;  5JHG A;  5JP4 A;  4WJ7 A;  4CYE A;  4HAY B;  4GXB A;  1X1F A;  1T77 A;  5D27 A;  3N7C A;  2NMB A;  2RGN B;  2MKR A;  1UNP A;  5DHF B;  4OT1 A;  2COC A;  5DIF B;  2NBV A;  2CY4 A;  2DYN A;  3PP2 A;  1DDV A;  2KIE A;  1UNQ A;  3NSU A;  1FOE A;  5HE3 A;  3KY9 A;  4A6F A;  1XR0 B;  4PQ0 A;  1OQN A;  4D0N B;  4A6F B;  2D9V A;  1LW3 A;  1FB8 A;  1EVH A;  1Q67 A;  3U12 A;  2YSZ A;  2D11 A;  2VKI A;  1J19 A;  3TVV A;  2GCL A;  1BTK A;  1W1D A;  2W2X D;  2L1C A;  4KHB A;  4HB4 B;  1WJM A;  1X86 A;  5C6R A;  4L6E A;  4KHB B;  1I7A A;  2DX5 A;  4NY0 A;  4QJ4 B;  3PZD A;  3MDB C;  3SNH A;  1MK7 B;  1MAI A;  4WSF A;  1EAZ A;  3QWM A;  4EKU A;  4HAT B;  3IVF A;  4MY6 A;  3AU4 A;  5CLL B;  2DHI A;  3M1I B;  3TW1 A;  2XQN M;  1SGH A;  2ZKM X;  1EF1 A;  4GOU A;  4NSW A;  1MIX A;  5LOP B;  2J59 M;  5J3Q A;  2P0F A;  4HB2 B;  1WG7 A;  1MKE A;  2GS0 A;  1ZC4 B;  2COD A;  4GNK B;  5I2M A;  3PEG A;  1UEF A;  2ELA A;  3V5W A;  3P7Z A;  4KHA A;  4MK0 A;  4QXA B;  1OY2 A;  1N3H A;  3HSA A;  1RRP B;  2RNR B;  5EFX A;  4TKN A;  4HB3 B;  1PFJ A;  2RLO A;  4B6H A;  1FGY A;  1NTY A;  2KUP A;  3ODW A;  1B55 A;  4GZU A;  2N23 A;  3SV1 A;  1BWN A;  4TYZ A;  2KUQ A;  3CXB B;  2Z14 A;  3OAN A;  5I2S A;  5FI1 A;  2YS5 A;  4KHO A;  3A8P A;  3O96 A;  3NWF A;  1SHC A;  4CHJ A;  2J0M A;  2M14 A;  5KQ1 A;  2K00 A;  2FJU B;  5FI0 A;  1RJ2 A;  1UPQ A;  4IFS A;  3OHM B;  1MI1 A;  2JP2 A;  1P5T A;  4F7H A;  3B77 A;  1ZYI A;  5DHA B;  3A8Q A;  1U5G A;  5GOW B;  1P3R A;  5M4Y B;  2YF0 A;  2AEH A;  3PVL A;  1J0W A;  2D9X A;  5JHH A;  1GC6 A;  2ADZ A;  3UZT A;  4Z2M B;  4K2P A;  5D3Y A;  3D8F A;  2DLW A;  4DIX A;  1XD4 A;  3U8Z A;  5D3X A;  1DBH A;  1KI1 B;  2LUL A;  2LOZ A;  1MK9 B;  1QQG A;  1ZC3 B;  2W2W A;  3HK0 A;  2KCJ A;  4HDQ A;  3BJI A;  2R2Y A;  2DHJ A;  1V88 A;  4HAU B;  4CHM A;  2DA0 A;  3F0W A;  1H4R A;  2D10 A;  4F7U P;  2Y8G A;  1WGQ A;  5HE2 A;  1P6S A;  2Z13 A;  1KZ7 A;  2YT2 A;  2DTC A;  3PVU A;  4GMX B;  2YS3 A;  2ROV A;  1PMS A;  3D8D A;  2K2J A;  2LOX A;  2W2X C;  4WVF B;  2Y8F A;  3ODX A;  2YS1 A;  2YRY A;  1FHX A;  5LON B;  2COA A;  2ELB A;  4K2O A;  4HSI A;  2Z59 A;  3ZDT A;  3GYO A;  2DFK A;  4K17 A;  2EMT A;  2YVC A;  2FJL A;  2LYD A;  5HE0 A;  2RVB B;  3AU5 A;  3CIK A;  1EGX A;  2EJ8 A;  2V76 A;  2GUM A;  3HQC A;  3TFM A;  1V5M A;  5KCV A;  4HB0 B;  3FSS A;  3SO6 A;  1OMW A;  1U27 A;  2RSG A;  2EMS A;  1WI1 A;  1MPH A;  1U29 A;  1DDW A;  1V5U A;  2CRF A;  1K5G B;  3ODO A;  3ML4 A;  2HE7 A;  2I5C A;  4ZRK A;  1FHW A;  4ZRJ A;  1WJ1 A;  2RRF A;  2I1J A;  5C16 A;  1X11 A;  2D9Y A;  2G35 A;  3FVC A;  3HW2 B;  3T06 A;  4DX9 0;  1AQC A;  1K5D B;  2UZS A;  5KQ4 A;  4GPT B;  2NZ8 B;  3FM8 C;  1GC7 A; 
#chains in the Genus database with same CATH homology
 3A98 B;  1BAK A;  2R09 A;  4A5K A;  1ZSQ A;  2VRW B;  3FEH A;  2P0D A;  5C5B A;  4Z2N A;  4H8S A;  2GCJ A;  3TCA A;  2BCJ A;  4MT7 A;  4P7I A;  3NWA A;  1WVH A;  1ZVR A;  5J3Y A;  5C5B B;  2I5F A;  4HHV A;  1UPR A;  5J3T A;  3KSY A;  2E2X A;  1ISN A;  4IOY X;  5L81 A;  1TQZ A;  2K8E A;  1W1H A;  2Z0P A;  2J0J A;  4KVG B;  2D4Q A;  2GJY A;  4HAV B;  4CSQ A;  3P6A A;  2Y7B A;  1DRO A;  2EC1 A;  2DKP A;  5DI9 B;  1FAO A;  2I1K A;  2Z0O A;  2OTX A;  4A6H A;  1TJ6 A;  1WGU A;  2HTH B;  4DBB A;  4HAZ B;  2DHK A;  3DXE A;  1Y5O A;  2KR0 A;  2ROZ B;  4Y94 A;  3TO1 A;  1XKE A;  2AL6 A;  1UNR A;  2PZ1 A;  2R0D A;  3VOQ A;  1U5E A;  2Z0Q A;  5D3W A;  4ZRI A;  5HE1 A;  1KZG A;  3QIJ A;  3RCP A;  3BIN A;  3PVW A;  1V61 A;  2IYB A;  2P0H A;  2D2Q A;  2MWN B;  4L1R A;  1I2H A;  1U5F A;  3KZ1 A;  2KGX B;  4KAX B;  3GYP A;  3PSC A;  5LG4 B;  3MPX A;  4D6W A;  4C0A A;  2DKQ A;  3PG7 A;  1GG3 A;  3D8E A;  3WA0 A;  3KRX A;  5CLQ B;  2H7E A;  1MIZ B;  3A58 A;  5D3V A;  3SYX A;  5IRS A;  3NW8 A;  3G9W A;  2DX1 A;  1IRS A;  4IAP A;  3ZVR A;  3QBV B;  2P8V A;  3U7D A;  2D9W A;  4QJ3 B;  1DYN A;  2ZPY A;  4PNK A;  1NU2 A;  2Z4D A;  5DH9 B;  3LJU X;  2QKL A;  4A6K A;  2DN6 A;  1XX0 A;  1V5P A;  4HDO A;  2D9Z A;  4QJ5 B;  1X1G A;  1XCG A;  1XOD A;  2Q13 A;  3X23 A;  2DYQ A;  1TXD A;  4YON A;  4DXA B;  1H10 A;  1Z87 A;  2YT0 A;  1NTV A;  3KRW A;  1U2B A;  2MDX A;  3SUZ A;  4EJN A;  2CAY A;  4GN1 A;  2UVM A;  1LB1 A;  2KIG A;  2QKM A;  1DDM A;  2J0K A;  5C79 A;  4DX8 A;  1M7R A;  3NWD A;  4HAX B;  1U5D A;  3F5R A;  5JLJ B;  2RUK B;  4K81 A;  1W1G A;  1PLS A;  1ZM0 A;  1E5W A;  2IFS A;  4GMV A;  2LG1 A;  3ULB A;  1AWE A;  4YL8 A;  1FHO A;  2M38 A;  1BTN A;  3AJ4 A;  2LKO A;  2MFQ A;  2K49 A;  2VSZ A;  3VIA A;  4F7G A;  4EMO A;  2N0Y A;  4BBK A;  2OQB A;  4OSN A;  1NI2 A;  1FGZ A;  3HIE A;  2X18 A;  1V89 A;  2UZR A;  2COF A;  2CY5 A;  1QC6 A;  2L2I A;  4HAW B;  1X05 A;  3WYF B;  3DXC A;  3ULC A;  2YT1 A;  2H7D A;  1Y19 B;  2K2U A;  1M7E A;  4XWX A;  3DXD A;  5JHG A;  5JP4 A;  4WJ7 A;  4CYE A;  4HAY B;  4GXB A;  1X1F A;  5D27 A;  3N7C A;  2NMB A;  2RGN B;  2MKR A;  1UNP A;  5DHF B;  4OT1 A;  2COC A;  5DIF B;  2NBV A;  2CY4 A;  2DYN A;  3PP2 A;  1DDV A;  2KIE A;  1UNQ A;  3NSU A;  1FOE A;  5HE3 A;  3KY9 A;  4A6F A;  1XR0 B;  4PQ0 A;  1OQN A;  4D0N B;  4A6F B;  2D9V A;  1LW3 A;  1FB8 A;  1EVH A;  1Q67 A;  3U12 A;  2YSZ A;  2D11 A;  2VKI A;  1J19 A;  3TVV A;  2GCL A;  1BTK A;  1W1D A;  2W2X D;  2L1C A;  4KHB A;  4HB4 B;  1WJM A;  1X86 A;  5C6R A;  4L6E A;  4KHB B;  1I7A A;  2DX5 A;  4NY0 A;  4QJ4 B;  3PZD A;  3MDB C;  3SNH A;  1MK7 B;  1MAI A;  4WSF A;  1EAZ A;  3QWM A;  4EKU A;  4HAT B;  3IVF A;  4MY6 A;  3AU4 A;  5CLL B;  3M1I B;  2DHI A;  3TW1 A;  2XQN M;  1SGH A;  2ZKM X;  1EF1 A;  4GOU A;  4NSW A;  1MIX A;  5LOP B;  2J59 M;  5J3Q A;  2P0F A;  4HB2 B;  1WG7 A;  1MKE A;  2GS0 A;  1ZC4 B;  2COD A;  4GNK B;  5I2M A;  3PEG A;  1UEF A;  2ELA A;  3V5W A;  3P7Z A;  4KHA A;  4MK0 A;  4QXA B;  1OY2 A;  1N3H A;  1RRP B;  2RNR B;  5EFX A;  4TKN A;  4HB3 B;  1PFJ A;  2RLO A;  4B6H A;  1FGY A;  1NTY A;  2KUP A;  3ODW A;  1B55 A;  4GZU A;  2N23 A;  3SV1 A;  1BWN A;  4TYZ A;  2KUQ A;  3CXB B;  2Z14 A;  3OAN A;  5I2S A;  5FI1 A;  2YS5 A;  4KHO A;  3A8P A;  3O96 A;  3NWF A;  1SHC A;  4CHJ A;  2J0M A;  2M14 A;  5KQ1 A;  2K00 A;  5FI0 A;  2FJU B;  1RJ2 A;  1UPQ A;  4IFS A;  3OHM B;  2JP2 A;  1P5T A;  4F7H A;  1ZYI A;  5DHA B;  3A8Q A;  1U5G A;  5GOW B;  1P3R A;  5M4Y B;  2YF0 A;  2AEH A;  3PVL A;  1J0W A;  2D9X A;  5JHH A;  1GC6 A;  2ADZ A;  3UZT A;  4Z2M B;  4K2P A;  5D3Y A;  3D8F A;  2DLW A;  4DIX A;  1XD4 A;  3U8Z A;  5D3X A;  1DBH A;  1KI1 B;  2LUL A;  2LOZ A;  1MK9 B;  1QQG A;  1ZC3 B;  2W2W A;  3HK0 A;  2KCJ A;  4HDQ A;  3BJI A;  2R2Y A;  2DHJ A;  1V88 A;  4HAU B;  4CHM A;  2DA0 A;  3F0W A;  1H4R A;  2D10 A;  4F7U P;  2Y8G A;  1WGQ A;  5HE2 A;  1P6S A;  2Z13 A;  1KZ7 A;  2YT2 A;  2DTC A;  3PVU A;  4GMX B;  2YS3 A;  2ROV A;  1PMS A;  3D8D A;  2K2J A;  2LOX A;  2W2X C;  4WVF B;  2Y8F A;  3ODX A;  2YS1 A;  2YRY A;  1FHX A;  5LON B;  2COA A;  2ELB A;  4K2O A;  4HSI A;  2Z59 A;  3ZDT A;  3GYO A;  2DFK A;  4K17 A;  2EMT A;  2YVC A;  2FJL A;  2LYD A;  5HE0 A;  2RVB B;  3AU5 A;  3CIK A;  1EGX A;  2EJ8 A;  2V76 A;  2GUM A;  3HQC A;  3TFM A;  1V5M A;  5KCV A;  4HB0 B;  3FSS A;  3SO6 A;  1OMW A;  1U27 A;  2RSG A;  2EMS A;  1WI1 A;  1MPH A;  1U29 A;  1DDW A;  1V5U A;  2CRF A;  1K5G B;  3ODO A;  3ML4 A;  2HE7 A;  2I5C A;  4ZRK A;  1FHW A;  4ZRJ A;  1WJ1 A;  2RRF A;  2I1J A;  5C16 A;  1X11 A;  2D9Y A;  2G35 A;  3HW2 B;  3FVC A;  3T06 A;  4DX9 0;  1AQC A;  1K5D B;  2UZS A;  5KQ4 A;  4GPT B;  2NZ8 B;  3FM8 C;  1GC7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...