3GYPA

Rtt106p
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
237
structure length
225
Chain Sequence
EISETNTIFKLEGVSVLSPLRKKLDLVFYLSNVDGSPVITLLKGNDRELSIYQLNKNIKMASFLPVPEKPNLIYLFMTYTSCEDNKFSEPVVMTLNKENTLNQFKNLGLLDSNVTDFEKCVEYIRKQAILTGFKISNPFVNSFHLQCHRGTKEGTLYFLPDHIIFGFKKPILLFDASDIESITYSSITRLTFNASLVTKDGEKYEFSMTDQTEYAKIDDYVKRKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Chaperone
molecule keywords Histone chaperone RTT106
publication title Structural analysis of Rtt106p reveals a DNA-binding role required for heterochromatin silencing
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 43
structure length 225
sequence length 237
ec nomenclature
pdb deposition date 2009-04-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08512 Rtt106 Histone chaperone Rttp106-like
A PF18469 PH_18 Pleckstrin homology domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 3gypA02
2.30.29.120 Mainly Beta Roll PH-domain like PH-domain like 3gypA01
5KQ1A 1RRPB 1GC7A 4XWXA 1X1GA 3M1IB 4A6FA 1P6SA 3DXEA 1I7AA 2P8VA 5JLJB 3TVVA 4TKNA 1DYNA 5HE0A 2DX5A 5D3WA 3QBVB 5DI9B 5FI1A 1NTYA 2MKRA 4CYEA 1KZGA 2D4QA 2GJYA 3MPXA 3WYFB 3CXBB 4NSWA 5CLQB 1NU2A 2D11A 2ELAA 4HHVA 2DHJA 4CHJA 1U5GA 1TXDA 3DXCA 2EMTA 2YS1A 2YVCA 1ZM0A 3P7ZA 2YF0A 2COCA 1XKEA 3GYPA 3AU4A 4HB3B 5J3YA 2N0YA 2OQBA 1UPQA 1FAOA 4GXBA 1J0WA 4EJNA 4K81A 2Y8GA 3PVLA 2UVMA 2N23A 4PNKA 2DKPA 2DX1A 2G35A 3O96A 2QKMA 3PVUA 4YL8A 1DDVA 2K2JA 3A8QA 2GCLA 1X05A 2YS3A 4HATB 1FHOA 2LKOA 4DXAB 1H10A 2LULA 1WGQA 3PZDA 2Z0QA 3FSSA 2RNRB 2AEHA 4KHAA 2D2QA 2KGXB 5DIFB 2DHKA 2MWNB 4KAXB 3KRXA 3X23A 5EFXA 1J19A 1DROA 1XD4A 3U7DA 4Z2NA 3BINA 2NMBA 3SV1A 1OMWA 1W1GA 2RUKB 1MAIA 2DHIA 2V76A 3U8ZA 1U29A 2KCJA 4NY0A 1U5DA 4C0AA 2L2IA 2HTHB 4IAPA 2AL6A 4KHBB 1FGYA 2D9VA 4WSFA 1KZ7A 3SNHA 5C6RA 1P5TA 3ULBA 1UNPA 1V5UA 1NI2A 3LJUX 5L81A 2K2UA 2XQNM 2D9YA 1OQNA 1MPHA 1LW3A 4K17A 2M38A 1ZC4B 1WJMA 3ZDTA 4HAXB 4KHOA 2R0DA 1EVHA 2COAA 3ZVRA 1UNRA 1PFJA 1XCGA 2L1CA 1FHWA 1XR0B 2NZ8B 3PP2A 1N3HA 1GC6A 4GPTB 2DA0A 2VKIA 2P0FA 5HE1A 4L6EA 5LOPB 2D9ZA 2DTCA 1V61A 2VRWB 5D3YA 1MKEA 1SGHA 2DFKA 2YT0A 4Y94A 1FGZA 5J3TA 4F7GA 2P0DA 3ODWA 1V89A 2RGNB 2E2XA 1AWEA 1X1FA 2I5CA 3V5WA 1X11A 3PG7A 3HQCA 5GOWB 1BWNA 1Y19B 3FM8C 1MIXA 2I1KA 5KQ4A 4IFSA 3KY9A 2MFQA 3TO1A 3ULCA 1M7RA 3BJIA 1BAKA 1I2HA 1U2BA 5C16A 2ADZA 3VIAA 2FJLA 2ZPYA 1DDMA 3D8EA 1EGXA 5FI0A 2RSGA 1Y5OA 4HB2B 2YT1A 1E5WA 1X86A 5D3XA 2P0HA 2COFA 4TYZA 1WJ1A 5DH9B 3UZTA 3G9WA 4WJ7A 4YONA 1MIZB 2HE7A 1OY2A 3IVFA 3SUZA 5J3QA 2ROVA 4IOYX 5CLLB 2X18A 3D8DA 2DN6A 3GYOA 4A6FB 4BBKA 2BCJA 2K00A 2D10A 1EAZA 3F5RA 1WI1A 4GMVA 1WGUA 3ODOA 1UPRA 1Z87A 2CRFA 2MDXA 1FHXA 2YS5A 4MY6A 1ZC3B 2PZ1A 4ZRIA 2YSZA 1AQCA 2IFSA 3HK0A 2YRYA 4HAWB 1Q67A 5D27A 1BTKA 4A5KA 2Y8FA 4KVGB 1ZSQA 3KRWA 2EMSA 1XX0A 2GCJA 2LOXA 1SHCA 2W2WA 2VSZA 1BTNA 2DKQA 4CHMA 1TJ6A 5LONB 2W2XC 2ELBA 1QQGA 3A98B 1K5DB 3A8PA 1ZVRA 5JHGA 3T06A 2CY4A 1PLSA 5C5BB 2R09A 1UEFA 3AJ4A 1PMSA 3HW2B 4F7HA 3VOQA 4B6HA 2LG1A 5HE2A 3WA0A 3PSCA 2M14A 2RLOA 1EF1A 1TQZA 2DYQA 4DX90 2Q13A 4GMXB 3F0WA 2GS0A 3PEGA 2DYNA 3RCPA 1ISNA 3AU5A 3KSYA 1UNQA 4P7IA 4HAYB 1DBHA 3TW1A 1RJ2A 1IRSA 4K2OA 2LOZA 2JP2A 4K2PA 2H7DA 3ODXA 2W2XD 4HAVB 5JHHA 1M7EA 2D9WA 1V5PA 4EKUA 1QC6A 2I1JA 5C5BA 1MK7B 4MK0A 2J59M 4HDOA 3KZ1A 5C79A 2J0MA 3QIJA 4HDQA 1U27A 3MDBC 1XODA 2CAYA 3CIKA 2OTXA 2EJ8A 4HAZB 3DXDA 4EMOA 3P6AA 5KCVA 2I5FA 3TFMA 4GZUA 3D8FA 1GG3A 2DLWA 1FOEA 4ZRKA 2ROZB 1W1HA 4ZRJA 2J0KA 2UZRA 1KI1B 1W1DA 3NSUA 1FB8A 3PVWA 4D0NB 2CY5A 1LB1A 3FEHA 2LYDA 2Z0PA 5HE3A 2Y7BA 4H8SA 3N7CA 2QKLA 5DHFB 4DBBA 3SYXA 4HB0B 4DX8A 2KUPA 4MT7A 1DDWA 1H4RA 2D9XA 5D3VA 1WVHA 1U5EA 2IYBA 1P3RA 2CODA 2Z0OA 4WVFB 3OANA 3SO6A 4HAUB 2H7EA 1WG7A 1MK9B 4A6HA 4PQ0A 4GN1A 1NTVA 1V5MA 4HB4B 1K5GB 1V88A 5DHAB 3QWMA 2J0JA 2EC1A 4F7UP 1B55A 4A6KA 4Z2MB 2RVBB 5JP4A 3ML4A 2UZSA 3TCAA 1U5FA
chains in the Genus database with same CATH superfamily
5KQ1A 1RRPB 1GC7A 4XWXA 1X1GA 3M1IB 4A6FA 3U12A 5IRSA 2K8EA 4QJ5B 1P6SA 4HSIA 3DXEA 1I7AA 2P8VA 5JLJB 3TVVA 4TKNA 1DYNA 5HE0A 3HSAA 2DX5A 5D3WA 3QBVB 5DI9B 5FI1A 1NTYA 2MKRA 4CYEA 1KZGA 2D4QA 2GJYA 3MPXA 2FJUB 3WYFB 3CXBB 3B77A 4NSWA 5CLQB 1NU2A 2D11A 2ELAA 4HHVA 2DHJA 4CHJA 1U5GA 1TXDA 3DXCA 2EMTA 2YS1A 2YVCA 1ZM0A 3P7ZA 2YF0A 4QJ4B 2COCA 1XKEA 3GYPA 3AU4A 4HB3B 5J3YA 2N0YA 2OQBA 1UPQA 1FAOA 4GXBA 1J0WA 4EJNA 4K81A 2Y8GA 3PVLA 2UVMA 2N23A 4PNKA 2DKPA 2DX1A 2G35A 3O96A 2QKMA 3PVUA 4YL8A 1DDVA 2K2JA 3A8QA 2GCLA 2GUMA 1X05A 2YS3A 4HATB 2Z4DA 1FHOA 2LKOA 4DXAB 3OHMB 1H10A 2LULA 1WGQA 3PZDA 2Z0QA 3FSSA 2RNRB 2AEHA 4KHAA 2D2QA 2KGXB 5DIFB 2DHKA 4L1RA 2MWNB 4KAXB 3KRXA 3X23A 4D6WA 5EFXA 1J19A 1DROA 1XD4A 3U7DA 4Z2NA 3BINA 4QJ3B 2NMBA 3SV1A 1OMWA 1W1GA 3A58A 2RUKB 1MAIA 2DHIA 2V76A 3U8ZA 1U29A 2KCJA 4NY0A 1U5DA 4C0AA 2L2IA 2HTHB 4IAPA 2AL6A 4KHBB 1FGYA 2K49A 5LG4B 2D9VA 4WSFA 1KZ7A 3SNHA 5C6RA 1P5TA 3ULBA 1UNPA 1V5UA 1NI2A 3LJUX 4GNKB 5L81A 2K2UA 1T77A 2XQNM 2D9YA 1OQNA 1MPHA 4GOUA 1LW3A 4K17A 2M38A 1ZC4B 1WJMA 3ZDTA 4HAXB 4KHOA 2R0DA 1EVHA 2COAA 3ZVRA 1UNRA 1PFJA 4OT1A 1XCGA 2L1CA 5M4YB 1FHWA 1XR0B 2NZ8B 3PP2A 1N3HA 1GC6A 4GPTB 2DA0A 2VKIA 2P0FA 5HE1A 4L6EA 5LOPB 2D9ZA 2DTCA 1V61A 2VRWB 5D3YA 1MKEA 1SGHA 2DFKA 2YT0A 4Y94A 1FGZA 5J3TA 4F7GA 2P0DA 3ODWA 1V89A 2RGNB 2E2XA 1AWEA 1X1FA 2RRFA 2I5CA 2Z14A 3V5WA 1X11A 3PG7A 3HQCA 5GOWB 1BWNA 1Y19B 3FM8C 1MIXA 2I1KA 5KQ4A 4QXAB 4IFSA 3KY9A 2MFQA 3TO1A 3ULCA 1M7RA 3BJIA 1BAKA 1I2HA 1U2BA 5C16A 2ADZA 1ZYIA 3VIAA 5I2MA 2FJLA 2ZPYA 1DDMA 3D8EA 1EGXA 5FI0A 2RSGA 1Y5OA 4HB2B 2YT1A 1E5WA 1X86A 5I2SA 5D3XA 2P0HA 2COFA 4TYZA 1WJ1A 5DH9B 3UZTA 3G9WA 4WJ7A 4YONA 1MIZB 2HE7A 1OY2A 3IVFA 3SUZA 5J3QA 2ROVA 3NWAA 4IOYX 5CLLB 2X18A 3D8DA 2DN6A 3GYOA 4A6FB 4BBKA 2BCJA 2K00A 2D10A 1EAZA 3F5RA 1WI1A 2NBVA 4GMVA 1MI1A 1WGUA 3ODOA 1UPRA 1Z87A 2CRFA 2MDXA 1FHXA 2YS5A 4MY6A 3FVCA 1ZC3B 2PZ1A 4ZRIA 2YSZA 1AQCA 3NW8A 2IFSA 3HK0A 2YRYA 4HAWB 1Q67A 5D27A 1BTKA 4A5KA 2R2YA 2Y8FA 4KVGB 1ZSQA 3KRWA 2EMSA 1XX0A 2GCJA 2LOXA 1SHCA 2W2WA 2VSZA 1BTNA 2DKQA 4CHMA 1TJ6A 5LONB 2W2XC 2ELBA 1QQGA 3A98B 1K5DB 3A8PA 1ZVRA 5JHGA 3T06A 2YT2A 2CY4A 1PLSA 5C5BB 2R09A 3HIEA 1UEFA 2Z13A 3AJ4A 1PMSA 3HW2B 3NWFA 4F7HA 3VOQA 4B6HA 2LG1A 5HE2A 3WA0A 3PSCA 3NWDA 4KHBA 2M14A 2RLOA 1EF1A 1TQZA 2DYQA 4DX90 2Q13A 4GMXB 3F0WA 2GS0A 2KIEA 3PEGA 2DYNA 3RCPA 1ISNA 3AU5A 3DCXA 1UNQA 3KSYA 4P7IA 4HAYB 1DBHA 3TW1A 1RJ2A 1IRSA 4K2OA 2LOZA 2JP2A 4K2PA 2H7DA 3ODXA 2W2XD 4HAVB 5JHHA 1M7EA 2D9WA 1V5PA 4EKUA 1QC6A 2I1JA 2KR0A 5C5BA 1MK7B 4MK0A 2J59M 4HDOA 3KZ1A 5C79A 2J0MA 3QIJA 4HDQA 1U27A 3MDBC 1XODA 2CAYA 3CIKA 2OTXA 2EJ8A 4HAZB 3DXDA 4EMOA 3P6AA 5KCVA 2I5FA 3TFMA 4GZUA 3D8FA 1GG3A 2DLWA 1FOEA 4ZRKA 2ROZB 1W1HA 2KUQA 4ZRJA 2J0KA 2UZRA 1KI1B 1W1DA 3NSUA 1FB8A 3PVWA 4D0NB 2CY5A 1LB1A 3FEHA 2LYDA 2Z0PA 5HE3A 2Y7BA 4CSQA 4H8SA 3N7CA 2KIGA 2QKLA 5DHFB 4DBBA 3SYXA 4HB0B 4DX8A 2KUPA 4MT7A 1DDWA 1H4RA 2D9XA 5D3VA 4DIXA 1WVHA 1U5EA 2IYBA 1P3RA 2CODA 2ZKMX 2Z0OA 4WVFB 3OANA 3SO6A 4HAUB 2H7EA 1WG7A 1MK9B 4A6HA 4PQ0A 4GN1A 2Z59A 1NTVA 1V5MA 4HB4B 1K5GB 1V88A 5DHAB 3QWMA 2J0JA 2EC1A 4F7UP 1B55A 4A6KA 4OSNA 4Z2MB 2RVBB 5JP4A 3ML4A 2UZSA 3TCAA 1U5FA
chains in the Genus database with same CATH topology
5KQ1A 1RRPB 1GC7A 4XWXA 1X1GA 3M1IB 4A6FA 3U12A 5IRSA 2K8EA 4QJ5B 1P6SA 4HSIA 3DXEA 1I7AA 2P8VA 5JLJB 3TVVA 4TKNA 1DYNA 5HE0A 2DX5A 5D3WA 3QBVB 5DI9B 5FI1A 1NTYA 2MKRA 4CYEA 1KZGA 2D4QA 2GJYA 3MPXA 3WYFB 2FJUB 3CXBB 4NSWA 5CLQB 1NU2A 2D11A 2ELAA 4HHVA 2DHJA 4CHJA 1U5GA 1TXDA 3DXCA 2EMTA 2YS1A 2YVCA 1ZM0A 3P7ZA 2YF0A 4QJ4B 2COCA 1XKEA 3GYPA 3AU4A 4HB3B 5J3YA 2N0YA 2OQBA 1UPQA 1FAOA 4GXBA 1J0WA 4EJNA 4K81A 2Y8GA 3PVLA 2UVMA 2N23A 4PNKA 2DKPA 2DX1A 2G35A 3O96A 2QKMA 3PVUA 4YL8A 1DDVA 2K2JA 3A8QA 2GCLA 2GUMA 1X05A 2YS3A 4HATB 2Z4DA 1FHOA 2LKOA 4DXAB 3OHMB 1H10A 2LULA 1WGQA 3PZDA 2Z0QA 3FSSA 2RNRB 2AEHA 4KHAA 2D2QA 2KGXB 5DIFB 2DHKA 4L1RA 2MWNB 4KAXB 3KRXA 3X23A 4D6WA 5EFXA 1J19A 1DROA 1XD4A 3U7DA 4Z2NA 3BINA 4QJ3B 2NMBA 3SV1A 1OMWA 1W1GA 3A58A 2RUKB 1MAIA 2DHIA 2V76A 3U8ZA 1U29A 2KCJA 4NY0A 1U5DA 4C0AA 2L2IA 2HTHB 4IAPA 2AL6A 4KHBB 1FGYA 2K49A 5LG4B 2D9VA 4WSFA 1KZ7A 3SNHA 5C6RA 1P5TA 3ULBA 1UNPA 1V5UA 1NI2A 3LJUX 4GNKB 5L81A 2K2UA 2XQNM 2D9YA 1OQNA 1MPHA 4GOUA 1LW3A 4K17A 2M38A 1ZC4B 1WJMA 3ZDTA 4HAXB 4KHOA 2R0DA 1EVHA 2COAA 3ZVRA 1UNRA 1PFJA 4OT1A 1XCGA 2L1CA 5M4YB 1FHWA 1XR0B 2NZ8B 3PP2A 1N3HA 1GC6A 4GPTB 2DA0A 2VKIA 2P0FA 5HE1A 4L6EA 5LOPB 2D9ZA 2DTCA 1V61A 2VRWB 5D3YA 1MKEA 1SGHA 2DFKA 2YT0A 4Y94A 1FGZA 5J3TA 4F7GA 2P0DA 3ODWA 1V89A 2RGNB 2E2XA 1AWEA 1X1FA 2RRFA 2I5CA 2Z14A 3V5WA 1X11A 3PG7A 3HQCA 5GOWB 1BWNA 1Y19B 3FM8C 1MIXA 2I1KA 5KQ4A 4QXAB 4IFSA 3KY9A 2MFQA 3TO1A 3ULCA 1M7RA 3BJIA 1BAKA 1I2HA 1U2BA 5C16A 2ADZA 1ZYIA 3VIAA 5I2MA 2FJLA 2ZPYA 1DDMA 3D8EA 1EGXA 5FI0A 2RSGA 1Y5OA 4HB2B 2YT1A 1E5WA 1X86A 5I2SA 5D3XA 2P0HA 2COFA 4TYZA 1WJ1A 5DH9B 3UZTA 3G9WA 4WJ7A 4YONA 1MIZB 2HE7A 1OY2A 3IVFA 3SUZA 5J3QA 2ROVA 3NWAA 4IOYX 5CLLB 2X18A 3D8DA 2DN6A 3GYOA 4A6FB 4BBKA 2BCJA 2K00A 2D10A 1EAZA 3F5RA 1WI1A 2NBVA 4GMVA 1WGUA 3ODOA 1UPRA 1Z87A 2CRFA 2MDXA 1FHXA 2YS5A 4MY6A 3FVCA 1ZC3B 2PZ1A 4ZRIA 2YSZA 1AQCA 3NW8A 2IFSA 3HK0A 2YRYA 4HAWB 1Q67A 5D27A 1BTKA 4A5KA 2R2YA 2Y8FA 4KVGB 1ZSQA 3KRWA 2EMSA 1XX0A 2GCJA 2LOXA 1SHCA 2W2WA 2VSZA 1BTNA 2DKQA 4CHMA 1TJ6A 5LONB 2W2XC 2ELBA 1QQGA 3A98B 1K5DB 3A8PA 1ZVRA 5JHGA 3T06A 2YT2A 2CY4A 1PLSA 5C5BB 2R09A 3HIEA 1UEFA 2Z13A 3AJ4A 1PMSA 3HW2B 3NWFA 4F7HA 3VOQA 4B6HA 2LG1A 5HE2A 3WA0A 3PSCA 3NWDA 4KHBA 2M14A 2RLOA 1EF1A 1TQZA 2DYQA 4DX90 2Q13A 4GMXB 3F0WA 2GS0A 2KIEA 3PEGA 2DYNA 3RCPA 1ISNA 3AU5A 3KSYA 1UNQA 4P7IA 4HAYB 1DBHA 3TW1A 1RJ2A 1IRSA 4K2OA 2LOZA 2JP2A 4K2PA 2H7DA 3ODXA 2W2XD 4HAVB 5JHHA 1M7EA 2D9WA 1V5PA 4EKUA 1QC6A 2I1JA 5C5BA 2KR0A 1MK7B 4MK0A 2J59M 4HDOA 3KZ1A 5C79A 2J0MA 3QIJA 4HDQA 1U27A 3MDBC 1XODA 2CAYA 3CIKA 2OTXA 2EJ8A 4HAZB 3DXDA 4EMOA 3P6AA 5KCVA 2I5FA 3TFMA 4GZUA 3D8FA 1GG3A 2DLWA 1FOEA 4ZRKA 2ROZB 1W1HA 2KUQA 4ZRJA 2J0KA 2UZRA 1KI1B 1W1DA 3NSUA 1FB8A 3PVWA 4D0NB 2CY5A 1LB1A 3FEHA 2LYDA 2Z0PA 5HE3A 2Y7BA 4CSQA 4H8SA 3N7CA 2KIGA 2QKLA 5DHFB 4DBBA 3SYXA 4HB0B 4DX8A 2KUPA 4MT7A 1DDWA 1H4RA 2D9XA 5D3VA 4DIXA 1WVHA 1U5EA 2IYBA 1P3RA 2CODA 2ZKMX 2Z0OA 4WVFB 3OANA 3SO6A 4HAUB 2H7EA 1WG7A 1MK9B 4A6HA 4PQ0A 4GN1A 2Z59A 1NTVA 1V5MA 4HB4B 1K5GB 1V88A 5DHAB 3QWMA 2J0JA 2EC1A 4F7UP 1B55A 4A6KA 4OSNA 4Z2MB 2RVBB 5JP4A 3ML4A 2UZSA 3TCAA 1U5FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5KQ1 A;  1RRP B;  1GC7 A;  4XWX A;  1X1G A;  3M1I B;  4A6F A;  1P6S A;  3DXE A;  1I7A A;  2P8V A;  5JLJ B;  3TVV A;  4TKN A;  1DYN A;  5HE0 A;  2DX5 A;  5D3W A;  3QBV B;  5DI9 B;  5FI1 A;  1NTY A;  2MKR A;  4CYE A;  1KZG A;  2D4Q A;  2GJY A;  3MPX A;  3WYF B;  3CXB B;  4NSW A;  5CLQ B;  1NU2 A;  2D11 A;  2ELA A;  4HHV A;  2DHJ A;  4CHJ A;  1U5G A;  1TXD A;  3DXC A;  2EMT A;  2YS1 A;  2YVC A;  1ZM0 A;  3P7Z A;  2YF0 A;  2COC A;  1XKE A;  3GYP A;  3AU4 A;  4HB3 B;  5J3Y A;  2N0Y A;  2OQB A;  1UPQ A;  1FAO A;  4GXB A;  1J0W A;  4EJN A;  4K81 A;  2Y8G A;  3PVL A;  2UVM A;  2N23 A;  4PNK A;  2DKP A;  2DX1 A;  2G35 A;  3O96 A;  2QKM A;  3PVU A;  4YL8 A;  1DDV A;  2K2J A;  3A8Q A;  2GCL A;  1X05 A;  2YS3 A;  4HAT B;  1FHO A;  2LKO A;  4DXA B;  1H10 A;  2LUL A;  1WGQ A;  3PZD A;  2Z0Q A;  3FSS A;  2RNR B;  2AEH A;  4KHA A;  2D2Q A;  2KGX B;  5DIF B;  2DHK A;  2MWN B;  4KAX B;  3KRX A;  3X23 A;  5EFX A;  1J19 A;  1DRO A;  1XD4 A;  3U7D A;  4Z2N A;  3BIN A;  2NMB A;  3SV1 A;  1OMW A;  1W1G A;  2RUK B;  1MAI A;  2DHI A;  2V76 A;  3U8Z A;  1U29 A;  2KCJ A;  4NY0 A;  1U5D A;  4C0A A;  2L2I A;  2HTH B;  4IAP A;  2AL6 A;  4KHB B;  1FGY A;  2D9V A;  4WSF A;  1KZ7 A;  3SNH A;  5C6R A;  1P5T A;  3ULB A;  1UNP A;  1V5U A;  1NI2 A;  3LJU X;  5L81 A;  2K2U A;  2XQN M;  2D9Y A;  1OQN A;  1MPH A;  1LW3 A;  4K17 A;  2M38 A;  1ZC4 B;  1WJM A;  3ZDT A;  4HAX B;  4KHO A;  2R0D A;  1EVH A;  2COA A;  3ZVR A;  1UNR A;  1PFJ A;  1XCG A;  2L1C A;  1FHW A;  1XR0 B;  2NZ8 B;  3PP2 A;  1N3H A;  1GC6 A;  4GPT B;  2DA0 A;  2VKI A;  2P0F A;  5HE1 A;  4L6E A;  5LOP B;  2D9Z A;  2DTC A;  1V61 A;  2VRW B;  5D3Y A;  1MKE A;  1SGH A;  2DFK A;  2YT0 A;  4Y94 A;  1FGZ A;  5J3T A;  4F7G A;  2P0D A;  3ODW A;  1V89 A;  2RGN B;  2E2X A;  1AWE A;  1X1F A;  2I5C A;  3V5W A;  1X11 A;  3PG7 A;  3HQC A;  5GOW B;  1BWN A;  1Y19 B;  3FM8 C;  1MIX A;  2I1K A;  5KQ4 A;  4IFS A;  3KY9 A;  2MFQ A;  3TO1 A;  3ULC A;  1M7R A;  3BJI A;  1BAK A;  1I2H A;  1U2B A;  5C16 A;  2ADZ A;  3VIA A;  2FJL A;  2ZPY A;  1DDM A;  3D8E A;  1EGX A;  5FI0 A;  2RSG A;  1Y5O A;  4HB2 B;  2YT1 A;  1E5W A;  1X86 A;  5D3X A;  2P0H A;  2COF A;  4TYZ A;  1WJ1 A;  5DH9 B;  3UZT A;  3G9W A;  4WJ7 A;  4YON A;  1MIZ B;  2HE7 A;  1OY2 A;  3IVF A;  3SUZ A;  5J3Q A;  2ROV A;  4IOY X;  5CLL B;  2X18 A;  3D8D A;  2DN6 A;  3GYO A;  4A6F B;  4BBK A;  2BCJ A;  2K00 A;  2D10 A;  1EAZ A;  3F5R A;  1WI1 A;  4GMV A;  1WGU A;  3ODO A;  1UPR A;  1Z87 A;  2CRF A;  2MDX A;  1FHX A;  2YS5 A;  4MY6 A;  1ZC3 B;  2PZ1 A;  4ZRI A;  2YSZ A;  1AQC A;  2IFS A;  3HK0 A;  2YRY A;  4HAW B;  1Q67 A;  5D27 A;  1BTK A;  4A5K A;  2Y8F A;  4KVG B;  1ZSQ A;  3KRW A;  2EMS A;  1XX0 A;  2GCJ A;  2LOX A;  1SHC A;  2W2W A;  2VSZ A;  1BTN A;  2DKQ A;  4CHM A;  1TJ6 A;  5LON B;  2W2X C;  2ELB A;  1QQG A;  3A98 B;  1K5D B;  3A8P A;  1ZVR A;  5JHG A;  3T06 A;  2CY4 A;  1PLS A;  5C5B B;  2R09 A;  1UEF A;  3AJ4 A;  1PMS A;  3HW2 B;  4F7H A;  3VOQ A;  4B6H A;  2LG1 A;  5HE2 A;  3WA0 A;  3PSC A;  2M14 A;  2RLO A;  1EF1 A;  1TQZ A;  2DYQ A;  4DX9 0;  2Q13 A;  4GMX B;  3F0W A;  2GS0 A;  3PEG A;  2DYN A;  3RCP A;  1ISN A;  3AU5 A;  3KSY A;  1UNQ A;  4P7I A;  4HAY B;  1DBH A;  3TW1 A;  1RJ2 A;  1IRS A;  4K2O A;  2LOZ A;  2JP2 A;  4K2P A;  2H7D A;  3ODX A;  2W2X D;  4HAV B;  5JHH A;  1M7E A;  2D9W A;  1V5P A;  4EKU A;  1QC6 A;  2I1J A;  5C5B A;  1MK7 B;  4MK0 A;  2J59 M;  4HDO A;  3KZ1 A;  5C79 A;  2J0M A;  3QIJ A;  4HDQ A;  1U27 A;  3MDB C;  1XOD A;  2CAY A;  3CIK A;  2OTX A;  2EJ8 A;  4HAZ B;  3DXD A;  4EMO A;  3P6A A;  5KCV A;  2I5F A;  3TFM A;  4GZU A;  3D8F A;  1GG3 A;  2DLW A;  1FOE A;  4ZRK A;  2ROZ B;  1W1H A;  4ZRJ A;  2J0K A;  2UZR A;  1KI1 B;  1W1D A;  3NSU A;  1FB8 A;  3PVW A;  4D0N B;  2CY5 A;  1LB1 A;  3FEH A;  2LYD A;  2Z0P A;  5HE3 A;  2Y7B A;  4H8S A;  3N7C A;  2QKL A;  5DHF B;  4DBB A;  3SYX A;  4HB0 B;  4DX8 A;  2KUP A;  4MT7 A;  1DDW A;  1H4R A;  2D9X A;  5D3V A;  1WVH A;  1U5E A;  2IYB A;  1P3R A;  2COD A;  2Z0O A;  4WVF B;  3OAN A;  3SO6 A;  4HAU B;  2H7E A;  1WG7 A;  1MK9 B;  4A6H A;  4PQ0 A;  4GN1 A;  1NTV A;  1V5M A;  4HB4 B;  1K5G B;  1V88 A;  5DHA B;  3QWM A;  2J0J A;  2EC1 A;  4F7U P;  1B55 A;  4A6K A;  4Z2M B;  2RVB B;  5JP4 A;  3ML4 A;  2UZS A;  3TCA A;  1U5F A; 
#chains in the Genus database with same CATH topology
 5KQ1 A;  1RRP B;  1GC7 A;  4XWX A;  1X1G A;  3M1I B;  4A6F A;  3U12 A;  5IRS A;  2K8E A;  4QJ5 B;  1P6S A;  4HSI A;  3DXE A;  1I7A A;  2P8V A;  5JLJ B;  3TVV A;  4TKN A;  1DYN A;  5HE0 A;  3HSA A;  2DX5 A;  5D3W A;  3QBV B;  5DI9 B;  5FI1 A;  1NTY A;  2MKR A;  4CYE A;  1KZG A;  2D4Q A;  2GJY A;  3MPX A;  2FJU B;  3WYF B;  3CXB B;  3B77 A;  4NSW A;  5CLQ B;  1NU2 A;  2D11 A;  2ELA A;  4HHV A;  2DHJ A;  4CHJ A;  1U5G A;  1TXD A;  3DXC A;  2EMT A;  2YS1 A;  2YVC A;  1ZM0 A;  3P7Z A;  2YF0 A;  4QJ4 B;  2COC A;  1XKE A;  3GYP A;  3AU4 A;  4HB3 B;  5J3Y A;  2N0Y A;  2OQB A;  1UPQ A;  1FAO A;  4GXB A;  1J0W A;  4EJN A;  4K81 A;  2Y8G A;  3PVL A;  2UVM A;  2N23 A;  4PNK A;  2DKP A;  2DX1 A;  2G35 A;  3O96 A;  2QKM A;  3PVU A;  4YL8 A;  1DDV A;  2K2J A;  3A8Q A;  2GCL A;  2GUM A;  1X05 A;  2YS3 A;  4HAT B;  2Z4D A;  1FHO A;  2LKO A;  4DXA B;  3OHM B;  1H10 A;  2LUL A;  1WGQ A;  3PZD A;  2Z0Q A;  3FSS A;  2RNR B;  2AEH A;  4KHA A;  2D2Q A;  2KGX B;  5DIF B;  2DHK A;  4L1R A;  2MWN B;  4KAX B;  3KRX A;  3X23 A;  4D6W A;  5EFX A;  1J19 A;  1DRO A;  1XD4 A;  3U7D A;  4Z2N A;  3BIN A;  4QJ3 B;  2NMB A;  3SV1 A;  1OMW A;  1W1G A;  3A58 A;  2RUK B;  1MAI A;  2DHI A;  2V76 A;  3U8Z A;  1U29 A;  2KCJ A;  4NY0 A;  1U5D A;  4C0A A;  2L2I A;  2HTH B;  4IAP A;  2AL6 A;  4KHB B;  1FGY A;  2K49 A;  5LG4 B;  2D9V A;  4WSF A;  1KZ7 A;  3SNH A;  5C6R A;  1P5T A;  3ULB A;  1UNP A;  1V5U A;  1NI2 A;  3LJU X;  4GNK B;  5L81 A;  2K2U A;  1T77 A;  2XQN M;  2D9Y A;  1OQN A;  1MPH A;  4GOU A;  1LW3 A;  4K17 A;  2M38 A;  1ZC4 B;  1WJM A;  3ZDT A;  4HAX B;  4KHO A;  2R0D A;  1EVH A;  2COA A;  3ZVR A;  1UNR A;  1PFJ A;  4OT1 A;  1XCG A;  2L1C A;  5M4Y B;  1FHW A;  1XR0 B;  2NZ8 B;  3PP2 A;  1N3H A;  1GC6 A;  4GPT B;  2DA0 A;  2VKI A;  2P0F A;  5HE1 A;  4L6E A;  5LOP B;  2D9Z A;  2DTC A;  1V61 A;  2VRW B;  5D3Y A;  1MKE A;  1SGH A;  2DFK A;  2YT0 A;  4Y94 A;  1FGZ A;  5J3T A;  4F7G A;  2P0D A;  3ODW A;  1V89 A;  2RGN B;  2E2X A;  1AWE A;  1X1F A;  2RRF A;  2I5C A;  2Z14 A;  3V5W A;  1X11 A;  3PG7 A;  3HQC A;  5GOW B;  1BWN A;  1Y19 B;  3FM8 C;  1MIX A;  2I1K A;  5KQ4 A;  4QXA B;  4IFS A;  3KY9 A;  2MFQ A;  3TO1 A;  3ULC A;  1M7R A;  3BJI A;  1BAK A;  1I2H A;  1U2B A;  5C16 A;  2ADZ A;  1ZYI A;  3VIA A;  5I2M A;  2FJL A;  2ZPY A;  1DDM A;  3D8E A;  1EGX A;  5FI0 A;  2RSG A;  1Y5O A;  4HB2 B;  2YT1 A;  1E5W A;  1X86 A;  5I2S A;  5D3X A;  2P0H A;  2COF A;  4TYZ A;  1WJ1 A;  5DH9 B;  3UZT A;  3G9W A;  4WJ7 A;  4YON A;  1MIZ B;  2HE7 A;  1OY2 A;  3IVF A;  3SUZ A;  5J3Q A;  2ROV A;  3NWA A;  4IOY X;  5CLL B;  2X18 A;  3D8D A;  2DN6 A;  3GYO A;  4A6F B;  4BBK A;  2BCJ A;  2K00 A;  2D10 A;  1EAZ A;  3F5R A;  1WI1 A;  2NBV A;  4GMV A;  1MI1 A;  1WGU A;  3ODO A;  1UPR A;  1Z87 A;  2CRF A;  2MDX A;  1FHX A;  2YS5 A;  4MY6 A;  3FVC A;  1ZC3 B;  2PZ1 A;  4ZRI A;  2YSZ A;  1AQC A;  3NW8 A;  2IFS A;  3HK0 A;  2YRY A;  4HAW B;  1Q67 A;  5D27 A;  1BTK A;  4A5K A;  2R2Y A;  2Y8F A;  4KVG B;  1ZSQ A;  3KRW A;  2EMS A;  1XX0 A;  2GCJ A;  2LOX A;  1SHC A;  2W2W A;  2VSZ A;  1BTN A;  2DKQ A;  4CHM A;  1TJ6 A;  5LON B;  2W2X C;  2ELB A;  1QQG A;  3A98 B;  1K5D B;  3A8P A;  1ZVR A;  5JHG A;  3T06 A;  2YT2 A;  2CY4 A;  1PLS A;  5C5B B;  2R09 A;  3HIE A;  1UEF A;  2Z13 A;  3AJ4 A;  1PMS A;  3HW2 B;  3NWF A;  4F7H A;  3VOQ A;  4B6H A;  2LG1 A;  5HE2 A;  3WA0 A;  3PSC A;  3NWD A;  4KHB A;  2M14 A;  2RLO A;  1EF1 A;  1TQZ A;  2DYQ A;  4DX9 0;  2Q13 A;  4GMX B;  3F0W A;  2GS0 A;  2KIE A;  3PEG A;  2DYN A;  3RCP A;  1ISN A;  3AU5 A;  3DCX A;  1UNQ A;  3KSY A;  4P7I A;  4HAY B;  1DBH A;  3TW1 A;  1RJ2 A;  1IRS A;  4K2O A;  2LOZ A;  2JP2 A;  4K2P A;  2H7D A;  3ODX A;  2W2X D;  4HAV B;  5JHH A;  1M7E A;  2D9W A;  1V5P A;  4EKU A;  1QC6 A;  2I1J A;  2KR0 A;  5C5B A;  1MK7 B;  4MK0 A;  2J59 M;  4HDO A;  3KZ1 A;  5C79 A;  2J0M A;  3QIJ A;  4HDQ A;  1U27 A;  3MDB C;  1XOD A;  2CAY A;  3CIK A;  2OTX A;  2EJ8 A;  4HAZ B;  3DXD A;  4EMO A;  3P6A A;  5KCV A;  2I5F A;  3TFM A;  4GZU A;  3D8F A;  1GG3 A;  2DLW A;  1FOE A;  4ZRK A;  2ROZ B;  1W1H A;  2KUQ A;  4ZRJ A;  2J0K A;  2UZR A;  1KI1 B;  1W1D A;  3NSU A;  1FB8 A;  3PVW A;  4D0N B;  2CY5 A;  1LB1 A;  3FEH A;  2LYD A;  2Z0P A;  5HE3 A;  2Y7B A;  4CSQ A;  4H8S A;  3N7C A;  2KIG A;  2QKL A;  5DHF B;  4DBB A;  3SYX A;  4HB0 B;  4DX8 A;  2KUP A;  4MT7 A;  1DDW A;  1H4R A;  2D9X A;  5D3V A;  4DIX A;  1WVH A;  1U5E A;  2IYB A;  1P3R A;  2COD A;  2ZKM X;  2Z0O A;  4WVF B;  3OAN A;  3SO6 A;  4HAU B;  2H7E A;  1WG7 A;  1MK9 B;  4A6H A;  4PQ0 A;  4GN1 A;  2Z59 A;  1NTV A;  1V5M A;  4HB4 B;  1K5G B;  1V88 A;  5DHA B;  3QWM A;  2J0J A;  2EC1 A;  4F7U P;  1B55 A;  4A6K A;  4OSN A;  4Z2M B;  2RVB B;  5JP4 A;  3ML4 A;  2UZS A;  3TCA A;  1U5F A; 
#chains in the Genus database with same CATH homology
 5KQ1 A;  1RRP B;  1GC7 A;  4XWX A;  1X1G A;  3M1I B;  4A6F A;  3U12 A;  5IRS A;  2K8E A;  4QJ5 B;  1P6S A;  4HSI A;  3DXE A;  1I7A A;  2P8V A;  5JLJ B;  3TVV A;  4TKN A;  1DYN A;  5HE0 A;  2DX5 A;  5D3W A;  3QBV B;  5DI9 B;  5FI1 A;  1NTY A;  2MKR A;  4CYE A;  1KZG A;  2D4Q A;  2GJY A;  3MPX A;  3WYF B;  2FJU B;  3CXB B;  4NSW A;  5CLQ B;  1NU2 A;  2D11 A;  2ELA A;  4HHV A;  2DHJ A;  4CHJ A;  1U5G A;  1TXD A;  3DXC A;  2EMT A;  2YS1 A;  2YVC A;  1ZM0 A;  3P7Z A;  2YF0 A;  4QJ4 B;  2COC A;  1XKE A;  3GYP A;  3AU4 A;  4HB3 B;  5J3Y A;  2N0Y A;  2OQB A;  1UPQ A;  1FAO A;  4GXB A;  1J0W A;  4EJN A;  4K81 A;  2Y8G A;  3PVL A;  2UVM A;  2N23 A;  4PNK A;  2DKP A;  2DX1 A;  2G35 A;  3O96 A;  2QKM A;  3PVU A;  4YL8 A;  1DDV A;  2K2J A;  3A8Q A;  2GCL A;  2GUM A;  1X05 A;  2YS3 A;  4HAT B;  2Z4D A;  1FHO A;  2LKO A;  4DXA B;  3OHM B;  1H10 A;  2LUL A;  1WGQ A;  3PZD A;  2Z0Q A;  3FSS A;  2RNR B;  2AEH A;  4KHA A;  2D2Q A;  2KGX B;  5DIF B;  2DHK A;  4L1R A;  2MWN B;  4KAX B;  3KRX A;  3X23 A;  4D6W A;  5EFX A;  1J19 A;  1DRO A;  1XD4 A;  3U7D A;  4Z2N A;  3BIN A;  4QJ3 B;  2NMB A;  3SV1 A;  1OMW A;  1W1G A;  3A58 A;  2RUK B;  1MAI A;  2DHI A;  2V76 A;  3U8Z A;  1U29 A;  2KCJ A;  4NY0 A;  1U5D A;  4C0A A;  2L2I A;  2HTH B;  4IAP A;  2AL6 A;  4KHB B;  1FGY A;  2K49 A;  5LG4 B;  2D9V A;  4WSF A;  1KZ7 A;  3SNH A;  5C6R A;  1P5T A;  3ULB A;  1UNP A;  1V5U A;  1NI2 A;  3LJU X;  4GNK B;  5L81 A;  2K2U A;  2XQN M;  2D9Y A;  1OQN A;  1MPH A;  4GOU A;  1LW3 A;  4K17 A;  2M38 A;  1ZC4 B;  1WJM A;  3ZDT A;  4HAX B;  4KHO A;  2R0D A;  1EVH A;  2COA A;  3ZVR A;  1UNR A;  1PFJ A;  4OT1 A;  1XCG A;  2L1C A;  5M4Y B;  1FHW A;  1XR0 B;  2NZ8 B;  3PP2 A;  1N3H A;  1GC6 A;  4GPT B;  2DA0 A;  2VKI A;  2P0F A;  5HE1 A;  4L6E A;  5LOP B;  2D9Z A;  2DTC A;  1V61 A;  2VRW B;  5D3Y A;  1MKE A;  1SGH A;  2DFK A;  2YT0 A;  4Y94 A;  1FGZ A;  5J3T A;  4F7G A;  2P0D A;  3ODW A;  1V89 A;  2RGN B;  2E2X A;  1AWE A;  1X1F A;  2RRF A;  2I5C A;  2Z14 A;  3V5W A;  1X11 A;  3PG7 A;  3HQC A;  5GOW B;  1BWN A;  1Y19 B;  3FM8 C;  1MIX A;  2I1K A;  5KQ4 A;  4QXA B;  4IFS A;  3KY9 A;  2MFQ A;  3TO1 A;  3ULC A;  1M7R A;  3BJI A;  1BAK A;  1I2H A;  1U2B A;  5C16 A;  2ADZ A;  1ZYI A;  3VIA A;  5I2M A;  2FJL A;  2ZPY A;  1DDM A;  3D8E A;  1EGX A;  5FI0 A;  2RSG A;  1Y5O A;  4HB2 B;  2YT1 A;  1E5W A;  1X86 A;  5I2S A;  5D3X A;  2P0H A;  2COF A;  4TYZ A;  1WJ1 A;  5DH9 B;  3UZT A;  3G9W A;  4WJ7 A;  4YON A;  1MIZ B;  2HE7 A;  1OY2 A;  3IVF A;  3SUZ A;  5J3Q A;  2ROV A;  3NWA A;  4IOY X;  5CLL B;  2X18 A;  3D8D A;  2DN6 A;  3GYO A;  4A6F B;  4BBK A;  2BCJ A;  2K00 A;  2D10 A;  1EAZ A;  3F5R A;  1WI1 A;  2NBV A;  4GMV A;  1WGU A;  3ODO A;  1UPR A;  1Z87 A;  2CRF A;  2MDX A;  1FHX A;  2YS5 A;  4MY6 A;  3FVC A;  1ZC3 B;  2PZ1 A;  4ZRI A;  2YSZ A;  1AQC A;  3NW8 A;  2IFS A;  3HK0 A;  2YRY A;  4HAW B;  1Q67 A;  5D27 A;  1BTK A;  4A5K A;  2R2Y A;  2Y8F A;  4KVG B;  1ZSQ A;  3KRW A;  2EMS A;  1XX0 A;  2GCJ A;  2LOX A;  1SHC A;  2W2W A;  2VSZ A;  1BTN A;  2DKQ A;  4CHM A;  1TJ6 A;  5LON B;  2W2X C;  2ELB A;  1QQG A;  3A98 B;  1K5D B;  3A8P A;  1ZVR A;  5JHG A;  3T06 A;  2YT2 A;  2CY4 A;  1PLS A;  5C5B B;  2R09 A;  3HIE A;  1UEF A;  2Z13 A;  3AJ4 A;  1PMS A;  3HW2 B;  3NWF A;  4F7H A;  3VOQ A;  4B6H A;  2LG1 A;  5HE2 A;  3WA0 A;  3PSC A;  3NWD A;  4KHB A;  2M14 A;  2RLO A;  1EF1 A;  1TQZ A;  2DYQ A;  4DX9 0;  2Q13 A;  4GMX B;  3F0W A;  2GS0 A;  2KIE A;  3PEG A;  2DYN A;  3RCP A;  1ISN A;  3AU5 A;  3KSY A;  1UNQ A;  4P7I A;  4HAY B;  1DBH A;  3TW1 A;  1RJ2 A;  1IRS A;  4K2O A;  2LOZ A;  2JP2 A;  4K2P A;  2H7D A;  3ODX A;  2W2X D;  4HAV B;  5JHH A;  1M7E A;  2D9W A;  1V5P A;  4EKU A;  1QC6 A;  2I1J A;  5C5B A;  2KR0 A;  1MK7 B;  4MK0 A;  2J59 M;  4HDO A;  3KZ1 A;  5C79 A;  2J0M A;  3QIJ A;  4HDQ A;  1U27 A;  3MDB C;  1XOD A;  2CAY A;  3CIK A;  2OTX A;  2EJ8 A;  4HAZ B;  3DXD A;  4EMO A;  3P6A A;  5KCV A;  2I5F A;  3TFM A;  4GZU A;  3D8F A;  1GG3 A;  2DLW A;  1FOE A;  4ZRK A;  2ROZ B;  1W1H A;  2KUQ A;  4ZRJ A;  2J0K A;  2UZR A;  1KI1 B;  1W1D A;  3NSU A;  1FB8 A;  3PVW A;  4D0N B;  2CY5 A;  1LB1 A;  3FEH A;  2LYD A;  2Z0P A;  5HE3 A;  2Y7B A;  4CSQ A;  4H8S A;  3N7C A;  2KIG A;  2QKL A;  5DHF B;  4DBB A;  3SYX A;  4HB0 B;  4DX8 A;  2KUP A;  4MT7 A;  1DDW A;  1H4R A;  2D9X A;  5D3V A;  4DIX A;  1WVH A;  1U5E A;  2IYB A;  1P3R A;  2COD A;  2ZKM X;  2Z0O A;  4WVF B;  3OAN A;  3SO6 A;  4HAU B;  2H7E A;  1WG7 A;  1MK9 B;  4A6H A;  4PQ0 A;  4GN1 A;  2Z59 A;  1NTV A;  1V5M A;  4HB4 B;  1K5G B;  1V88 A;  5DHA B;  3QWM A;  2J0J A;  2EC1 A;  4F7U P;  1B55 A;  4A6K A;  4OSN A;  4Z2M B;  2RVB B;  5JP4 A;  3ML4 A;  2UZS A;  3TCA A;  1U5F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...