1I7AA

Evh1 domain from murine homer 2b/vesl 2
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
109
structure length
103
Chain Sequence
EQPIFTTRAHVFQINWVPASKQAVTVSYFYDVTRNSYRIISVDGAKVIINSTITPNMTFTKTSQKFGQWADSRANTVFGLGFSSELQLTKFAEKFQEVREAAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords HOMER 2B
publication title The N-terminal domain of Homer/Vesl is a new class II EVH1 domain.
pubmed doi rcsb
source organism Mus musculus
total genus 20
structure length 103
sequence length 109
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2001-03-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00568 WH1 WH1 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1i7aA00
2VSZA 3BJIA 1U29A 1V5MA 5CLQB 2D9YA 4H8SA 2P0DA 4F7HA 2Q13A 4PQ0A 1FHWA 4HAUB 1V88A 2COFA 2LG1A 2CODA 3PEGA 4GXBA 2I1KA 4KHOA 3ZVRA 2DHKA 2DN6A 1E5WA 2LOXA 2AEHA 5FI1A 2IYBA 2D9VA 1X11A 1KZ7A 1MIXA 1FHOA 3PP2A 1WI1A 2DHIA 1DYNA 4GMXB 5JHHA 5C5BB 2Y8GA 1J0WA 2D11A 3U7DA 1MKEA 2DKPA 3SYXA 1EAZA 1OQNA 3QBVB 2QKLA 2E2XA 4HDQA 1UNQA 2P0FA 3KZ1A 1W1GA 1X1GA 5C16A 2KGXB 1BAKA 1WG7A 2LYDA 1MK9B 4XWXA 5C5BA 4F7UP 1FGYA 1K5GB 1ZM0A 2CY4A 3MDBC 1UPRA 2YS5A 1QQGA 3ODWA 1XODA 2YRYA 4WSFA 3HQCA 1DBHA 2HTHB 3DXDA 1OMWA 4KVGB 3A8PA 2KUPA 4B6HA 1LB1A 1WGQA 2HE7A 2DKQA 3CIKA 4TKNA 3F0WA 2L2IA 4K81A 2QKMA 2RUKB 3KSYA 1AQCA 1I7AA 4HAXB 4KHBB 2PZ1A 5JLJB 1X86A 2ZPYA 4GMVA 1PMSA 2RNRB 4A6FB 1RRPB 3D8DA 4WVFB 2D9XA 4NSWA 1DDWA 5HE1A 4A5KA 5DHFB 4Z2NA 4A6HA 5LONB 4CHJA 1U5EA 4PNKA 3PVLA 4HB3B 4ZRIA 4IFSA 2VKIA 2YS1A 5JP4A 3DXCA 5KCVA 2L1CA 3ODXA 4Z2MB 3LJUX 1AWEA 1W1HA 2I5CA 4HATB 1XX0A 4F7GA 5LOPB 1WJMA 5J3YA 1U2BA 4D0NB 1OY2A 3P6AA 2K2JA 3QWMA 4NY0A 1TJ6A 3X23A 2GCJA 3PSCA 1U27A 2D9ZA 2W2XD 2DHJA 1XR0B 3GYOA 3PVWA 2OQBA 2RGNB 4GPTB 4MY6A 2M38A 5D3XA 1DROA 2CY5A 2D10A 1Y5OA 5HE2A 2P8VA 4HB2B 2I1JA 1K5DB 4HAZB 3O96A 2X18A 4DX90 1XCGA 2YF0A 4A6KA 4MK0A 2RLOA 1UEFA 3T06A 3V5WA 1I2HA 3SNHA 4ZRKA 2Z0PA 3P7ZA 1BWNA 2GS0A 2UZRA 3RCPA 2R0DA 2COCA 1U5GA 2EMTA 2JP2A 1ZC3B 3OANA 3AU4A 3D8EA 1UNRA 2J0JA 1Z87A 5CLLB 4HDOA 3F5RA 1GC6A 3N7CA 1P5TA 1SHCA 5DH9B 4CHMA 1MK7B 1FHXA 3PZDA 1P3RA 2G35A 2H7EA 1H4RA 5DIFB 2K00A 3U8ZA 1LW3A 2XQNM 1EVHA 1NTVA 1Y19B 2Z0QA 2MFQA 4K2PA 1KZGA 4YONA 3TCAA 2COAA 1FB8A 2CRFA 2DA0A 2P0HA 1WVHA 2YS3A 2M14A 5JHGA 4Y94A 5J3QA 1ISNA 1MPHA 2FJLA 1ZC4B 2UZSA 3SV1A 3D8FA 2GJYA 3WYFB 2BCJA 5KQ4A 2DFKA 4GZUA 4CYEA 2W2WA 1BTNA 2NZ8B 3GYPA 1WJ1A 5D3WA 4DX8A 1M7EA 1ZVRA 1TXDA 1MIZB 2MWNB 1V5PA 1V5UA 2R09A 5FI0A 1GC7A 4DXAB 1NU2A 4A6FA 3PVUA 3VIAA 2EMSA 2LOZA 2LULA 2Y7BA 3CXBB 4KAXB 2YVCA 3SUZA 4K2OA 1MAIA 3BINA 3M1IB 1NTYA 5DHAB 1B55A 3DXEA 3TFMA 3A8QA 4TYZA 2ROVA 2DTCA 1J19A 1XKEA 1X1FA 4HB0B 1ZSQA 4HAWB 3PG7A 1H10A 2DX1A 2H7DA 1FOEA 1UNPA 5DI9B 5J3TA 2UVMA 3FM8C 5L81A 3KRWA 2MDXA 3SO6A 2YSZA 4C0AA 1XD4A 5EFXA 5GOWB 3ULBA 4WJ7A 3QIJA 1FAOA 2KCJA 3HW2B 4KHAA 3HK0A 1U5FA 2I5FA 2GCLA 1IRSA 1NI2A 3MPXA 3ODOA 1BTKA 4HB4B 2NMBA 5C6RA 4ZRJA 5C79A 4HHVA 2D2QA 1GG3A 1SGHA 3VOQA 2J59M 2N0YA 2D9WA 1TQZA 2YT0A 1UPQA 1QC6A 4BBKA 3G9WA 2RSGA 4HAYB 2EC1A 2DYNA 2ELBA 2RVBB 4GN1A 4P7IA 2LKOA 2YT1A 1W1DA 3AU5A 5HE3A 3WA0A 4EMOA 1M7RA 2J0KA 2K2UA 4EJNA 1V89A 5KQ1A 2J0MA 1P6SA 3ULCA 4HAVB 5D3YA 5HE0A 2Y8FA 3UZTA 1V61A 5D27A 2ROZB 1RJ2A 1N3HA 2DX5A 4K17A 3IVFA 4YL8A 2DYQA 3A98B 3ZDTA 4DBBA 1DDMA 2VRWB 1EGXA 1U5DA 3TO1A 1DDVA 3TW1A 2Z0OA 4MT7A 3FSSA 1X05A 3ML4A 4EKUA 2DLWA 4IOYX 2MKRA 2EJ8A 1PFJA 2AL6A 2ELAA 4L6EA 2CAYA 4IAPA 2V76A 1FGZA 1Q67A 3KY9A 1PLSA 2N23A 3NSUA 2ADZA 3TVVA 3KRXA 2OTXA 1WGUA 2IFSA 1EF1A 5D3VA 2D4QA 2W2XC 1KI1B 3FEHA 3AJ4A
chains in the Genus database with same CATH superfamily
2VSZA 3BJIA 1U29A 1V5MA 2FJUB 5CLQB 2D9YA 2KIGA 2P0DA 4H8SA 4F7HA 2Q13A 4PQ0A 1FHWA 4HAUB 1V88A 2COFA 2LG1A 3DCXA 3U12A 2CODA 3PEGA 4GXBA 2I1KA 4KHOA 4L1RA 3ZVRA 2DHKA 2DN6A 1E5WA 2LOXA 3OHMB 2AEHA 5FI1A 2IYBA 2D9VA 1X11A 5M4YB 1KZ7A 1MIXA 1FHOA 3PP2A 1WI1A 3NW8A 2DHIA 2YT2A 1DYNA 4GMXB 5JHHA 5C5BB 2Y8GA 1J0WA 2D11A 3U7DA 1MKEA 2RRFA 2DKPA 3SYXA 1EAZA 4OSNA 1OQNA 2K8EA 3QBVB 2QKLA 2E2XA 4HDQA 1UNQA 2P0FA 3KZ1A 1W1GA 1X1GA 5C16A 2KGXB 1BAKA 1WG7A 2LYDA 1MK9B 3A58A 4XWXA 5C5BA 4F7UP 1FGYA 1K5GB 1ZM0A 2CY4A 2R2YA 3MDBC 1UPRA 2YS5A 1QQGA 3ODWA 1XODA 2YRYA 4WSFA 3HQCA 1DBHA 2HTHB 3DXDA 1OMWA 3FVCA 4KVGB 3A8PA 2KUPA 4B6HA 1LB1A 1WGQA 2HE7A 2DKQA 3CIKA 4TKNA 3F0WA 2L2IA 4K81A 2QKMA 2RUKB 3KSYA 1AQCA 1I7AA 4HAXB 4KHBB 1MI1A 2PZ1A 5JLJB 2KR0A 1X86A 2ZPYA 4GMVA 1PMSA 2Z4DA 2RNRB 4A6FB 1RRPB 3D8DA 4WVFB 2D9XA 4NSWA 1DDWA 5HE1A 4A5KA 5DHFB 4Z2NA 4A6HA 5LONB 4CHJA 1U5EA 4PNKA 3PVLA 4HB3B 4ZRIA 4IFSA 2VKIA 2YS1A 5JP4A 3DXCA 5KCVA 2L1CA 3ODXA 4Z2MB 3LJUX 1AWEA 1W1HA 2I5CA 4DIXA 4HATB 1XX0A 4F7GA 5LOPB 1WJMA 5J3YA 1U2BA 4D0NB 1OY2A 3P6AA 2K2JA 3QWMA 5I2MA 4NY0A 1TJ6A 3X23A 3HIEA 2GCJA 3PSCA 1U27A 2D9ZA 2W2XD 2DHJA 1XR0B 3GYOA 4HSIA 3PVWA 2OQBA 2RGNB 4GPTB 4MY6A 2M38A 5D3XA 4QJ4B 1DROA 2CY5A 2D10A 1Y5OA 4OT1A 5HE2A 2P8VA 4HB2B 2I1JA 2ZKMX 1K5DB 4HAZB 3O96A 2X18A 4DX90 1XCGA 2YF0A 4A6KA 4MK0A 2RLOA 1UEFA 3T06A 3V5WA 1I2HA 3SNHA 4ZRKA 2Z0PA 3P7ZA 1BWNA 2GS0A 2UZRA 3RCPA 2R0DA 2COCA 1U5GA 2EMTA 5LG4B 2JP2A 1ZC3B 3OANA 3AU4A 3D8EA 1UNRA 2J0JA 1Z87A 5CLLB 4HDOA 3F5RA 2Z13A 1GC6A 3N7CA 1P5TA 1SHCA 5DH9B 4CHMA 1MK7B 1FHXA 3PZDA 1P3RA 2G35A 2H7EA 2KUQA 1H4RA 5DIFB 2K00A 3U8ZA 1LW3A 2XQNM 1EVHA 1NTVA 1Y19B 2Z0QA 2MFQA 4K2PA 1KZGA 4YONA 3TCAA 2COAA 1FB8A 2CRFA 2NBVA 2DA0A 1ZYIA 2P0HA 1WVHA 4QXAB 2YS3A 2M14A 5JHGA 4Y94A 5J3QA 1ISNA 1MPHA 2FJLA 1ZC4B 2UZSA 3SV1A 3D8FA 2GJYA 3WYFB 2BCJA 4CSQA 4GOUA 5KQ4A 2DFKA 4GZUA 4CYEA 2W2WA 1BTNA 2NZ8B 3GYPA 5IRSA 1WJ1A 5D3WA 4DX8A 1M7EA 1ZVRA 1TXDA 4KHBA 1MIZB 2MWNB 1V5PA 1V5UA 2R09A 5FI0A 1GC7A 4DXAB 1NU2A 4A6FA 3PVUA 3VIAA 2EMSA 2LOZA 2LULA 2Y7BA 3CXBB 4KAXB 2YVCA 3HSAA 3SUZA 4K2OA 1MAIA 3BINA 3M1IB 1NTYA 5DHAB 1B55A 3DXEA 3TFMA 3A8QA 4TYZA 2ROVA 2DTCA 1J19A 5I2SA 1XKEA 1X1FA 4HB0B 1ZSQA 4HAWB 1H10A 2DX1A 2H7DA 3PG7A 1FOEA 1UNPA 5DI9B 5J3TA 2UVMA 3FM8C 5L81A 3KRWA 2MDXA 1T77A 3SO6A 2YSZA 4QJ3B 3NWAA 4C0AA 1XD4A 2GUMA 5EFXA 5GOWB 3ULBA 4WJ7A 3QIJA 1FAOA 2KCJA 3HW2B 4KHAA 3HK0A 1U5FA 2I5FA 2GCLA 1IRSA 1NI2A 3MPXA 3ODOA 1BTKA 4HB4B 2NMBA 5C6RA 4ZRJA 5C79A 4HHVA 2D2QA 1GG3A 1SGHA 3VOQA 2J59M 2N0YA 2D9WA 1TQZA 2YT0A 1UPQA 1QC6A 4BBKA 3G9WA 3NWFA 2RSGA 4HAYB 2EC1A 2DYNA 2ELBA 2RVBB 4GN1A 4P7IA 2LKOA 2YT1A 1W1DA 3AU5A 2K49A 5HE3A 3WA0A 4EMOA 1M7RA 2J0KA 2K2UA 4EJNA 1V89A 5KQ1A 2J0MA 1P6SA 3ULCA 4HAVB 5D3YA 5HE0A 2Y8FA 3UZTA 1V61A 5D27A 2ROZB 2KIEA 4D6WA 1RJ2A 1N3HA 2DX5A 4K17A 3IVFA 4YL8A 2DYQA 2Z59A 3A98B 3ZDTA 4DBBA 1DDMA 2Z14A 2VRWB 1EGXA 1U5DA 3TO1A 1DDVA 3TW1A 2Z0OA 4MT7A 3FSSA 1X05A 3ML4A 3NWDA 4EKUA 2DLWA 4IOYX 3B77A 2MKRA 2EJ8A 1PFJA 2AL6A 2ELAA 4L6EA 2CAYA 4IAPA 2V76A 4QJ5B 1FGZA 1Q67A 3KY9A 1PLSA 2N23A 3NSUA 2ADZA 3TVVA 4GNKB 3KRXA 2OTXA 1WGUA 2IFSA 1EF1A 5D3VA 2D4QA 2W2XC 1KI1B 3FEHA 3AJ4A
chains in the Genus database with same CATH topology
2VSZA 3BJIA 1U29A 1V5MA 5CLQB 2D9YA 4H8SA 2P0DA 4F7HA 2Q13A 4PQ0A 1FHWA 4HAUB 1V88A 2COFA 2LG1A 2CODA 3PEGA 4GXBA 2I1KA 4KHOA 3ZVRA 2DHKA 2DN6A 1E5WA 2LOXA 2AEHA 5FI1A 2IYBA 2D9VA 1X11A 1KZ7A 1MIXA 1FHOA 3PP2A 1WI1A 2DHIA 1DYNA 4GMXB 5JHHA 5C5BB 2Y8GA 1J0WA 2D11A 3U7DA 1MKEA 2DKPA 3SYXA 1EAZA 1OQNA 3QBVB 2QKLA 2E2XA 4HDQA 1UNQA 2P0FA 3KZ1A 1W1GA 1X1GA 5C16A 2KGXB 1BAKA 1WG7A 2LYDA 1MK9B 4XWXA 5C5BA 4F7UP 1FGYA 1K5GB 1ZM0A 2CY4A 3MDBC 1UPRA 2YS5A 1QQGA 3ODWA 1XODA 2YRYA 4WSFA 3HQCA 1DBHA 2HTHB 3DXDA 1OMWA 4KVGB 3A8PA 2KUPA 4B6HA 1LB1A 1WGQA 2HE7A 2DKQA 3CIKA 4TKNA 3F0WA 2L2IA 4K81A 2QKMA 2RUKB 3KSYA 1AQCA 1I7AA 4HAXB 4KHBB 2PZ1A 5JLJB 1X86A 2ZPYA 4GMVA 1PMSA 2RNRB 4A6FB 1RRPB 3D8DA 4WVFB 2D9XA 4NSWA 1DDWA 5HE1A 4A5KA 5DHFB 4Z2NA 4A6HA 5LONB 4CHJA 1U5EA 4PNKA 3PVLA 4HB3B 4ZRIA 4IFSA 2VKIA 2YS1A 5JP4A 3DXCA 5KCVA 2L1CA 3ODXA 4Z2MB 3LJUX 1AWEA 1W1HA 2I5CA 4HATB 1XX0A 4F7GA 5LOPB 1WJMA 5J3YA 1U2BA 4D0NB 1OY2A 3P6AA 2K2JA 3QWMA 4NY0A 1TJ6A 3X23A 2GCJA 3PSCA 1U27A 2D9ZA 2W2XD 2DHJA 1XR0B 3GYOA 3PVWA 2OQBA 2RGNB 4GPTB 4MY6A 2M38A 5D3XA 1DROA 2CY5A 2D10A 1Y5OA 5HE2A 2P8VA 4HB2B 2I1JA 1K5DB 4HAZB 3O96A 2X18A 4DX90 1XCGA 2YF0A 4A6KA 4MK0A 2RLOA 1UEFA 3T06A 3V5WA 1I2HA 3SNHA 4ZRKA 2Z0PA 3P7ZA 1BWNA 2GS0A 2UZRA 3RCPA 2R0DA 2COCA 1U5GA 2EMTA 2JP2A 1ZC3B 3OANA 3AU4A 3D8EA 1UNRA 2J0JA 1Z87A 5CLLB 4HDOA 3F5RA 1GC6A 3N7CA 1P5TA 1SHCA 5DH9B 4CHMA 1MK7B 1FHXA 3PZDA 1P3RA 2G35A 2H7EA 1H4RA 5DIFB 2K00A 3U8ZA 1LW3A 2XQNM 1EVHA 1NTVA 1Y19B 2Z0QA 2MFQA 4K2PA 1KZGA 4YONA 3TCAA 2COAA 1FB8A 2CRFA 2DA0A 2P0HA 1WVHA 2YS3A 2M14A 5JHGA 4Y94A 5J3QA 1ISNA 1MPHA 2FJLA 1ZC4B 2UZSA 3SV1A 3D8FA 2GJYA 3WYFB 2BCJA 5KQ4A 2DFKA 4GZUA 4CYEA 2W2WA 1BTNA 2NZ8B 3GYPA 1WJ1A 5D3WA 4DX8A 1M7EA 1ZVRA 1TXDA 1MIZB 2MWNB 1V5PA 1V5UA 2R09A 5FI0A 1GC7A 4DXAB 1NU2A 4A6FA 3PVUA 3VIAA 2EMSA 2LOZA 2LULA 2Y7BA 3CXBB 4KAXB 2YVCA 3SUZA 4K2OA 1MAIA 3BINA 3M1IB 1NTYA 5DHAB 1B55A 3DXEA 3TFMA 3A8QA 4TYZA 2ROVA 2DTCA 1J19A 1XKEA 1X1FA 4HB0B 1ZSQA 4HAWB 3PG7A 1H10A 2DX1A 2H7DA 1FOEA 1UNPA 5DI9B 5J3TA 2UVMA 3FM8C 5L81A 3KRWA 2MDXA 3SO6A 2YSZA 4C0AA 1XD4A 5EFXA 5GOWB 3ULBA 4WJ7A 3QIJA 1FAOA 2KCJA 3HW2B 4KHAA 3HK0A 1U5FA 2I5FA 2GCLA 1IRSA 1NI2A 3MPXA 3ODOA 1BTKA 4HB4B 2NMBA 5C6RA 4ZRJA 5C79A 4HHVA 2D2QA 1GG3A 1SGHA 3VOQA 2J59M 2N0YA 2D9WA 1TQZA 2YT0A 1UPQA 1QC6A 4BBKA 3G9WA 2RSGA 4HAYB 2EC1A 2DYNA 2ELBA 2RVBB 4GN1A 4P7IA 2LKOA 2YT1A 1W1DA 3AU5A 5HE3A 3WA0A 4EMOA 1M7RA 2J0KA 2K2UA 4EJNA 1V89A 5KQ1A 2J0MA 1P6SA 3ULCA 4HAVB 5D3YA 5HE0A 2Y8FA 3UZTA 1V61A 5D27A 2ROZB 1RJ2A 1N3HA 2DX5A 4K17A 3IVFA 4YL8A 2DYQA 3A98B 3ZDTA 4DBBA 1DDMA 2VRWB 1EGXA 1U5DA 3TO1A 1DDVA 3TW1A 2Z0OA 4MT7A 3FSSA 1X05A 3ML4A 4EKUA 2DLWA 4IOYX 2MKRA 2EJ8A 1PFJA 2AL6A 2ELAA 4L6EA 2CAYA 4IAPA 2V76A 1FGZA 1Q67A 3KY9A 1PLSA 2N23A 3NSUA 2ADZA 3TVVA 3KRXA 2OTXA 1WGUA 2IFSA 1EF1A 5D3VA 2D4QA 2W2XC 1KI1B 3FEHA 3AJ4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VSZ A;  3BJI A;  1U29 A;  1V5M A;  5CLQ B;  2D9Y A;  4H8S A;  2P0D A;  4F7H A;  2Q13 A;  4PQ0 A;  1FHW A;  4HAU B;  1V88 A;  2COF A;  2LG1 A;  2COD A;  3PEG A;  4GXB A;  2I1K A;  4KHO A;  3ZVR A;  2DHK A;  2DN6 A;  1E5W A;  2LOX A;  2AEH A;  5FI1 A;  2IYB A;  2D9V A;  1X11 A;  1KZ7 A;  1MIX A;  1FHO A;  3PP2 A;  1WI1 A;  2DHI A;  1DYN A;  4GMX B;  5JHH A;  5C5B B;  2Y8G A;  1J0W A;  2D11 A;  3U7D A;  1MKE A;  2DKP A;  3SYX A;  1EAZ A;  1OQN A;  3QBV B;  2QKL A;  2E2X A;  4HDQ A;  1UNQ A;  2P0F A;  3KZ1 A;  1W1G A;  1X1G A;  5C16 A;  2KGX B;  1BAK A;  1WG7 A;  2LYD A;  1MK9 B;  4XWX A;  5C5B A;  4F7U P;  1FGY A;  1K5G B;  1ZM0 A;  2CY4 A;  3MDB C;  1UPR A;  2YS5 A;  1QQG A;  3ODW A;  1XOD A;  2YRY A;  4WSF A;  3HQC A;  1DBH A;  2HTH B;  3DXD A;  1OMW A;  4KVG B;  3A8P A;  2KUP A;  4B6H A;  1LB1 A;  1WGQ A;  2HE7 A;  2DKQ A;  3CIK A;  4TKN A;  3F0W A;  2L2I A;  4K81 A;  2QKM A;  2RUK B;  3KSY A;  1AQC A;  1I7A A;  4HAX B;  4KHB B;  2PZ1 A;  5JLJ B;  1X86 A;  2ZPY A;  4GMV A;  1PMS A;  2RNR B;  4A6F B;  1RRP B;  3D8D A;  4WVF B;  2D9X A;  4NSW A;  1DDW A;  5HE1 A;  4A5K A;  5DHF B;  4Z2N A;  4A6H A;  5LON B;  4CHJ A;  1U5E A;  4PNK A;  3PVL A;  4HB3 B;  4ZRI A;  4IFS A;  2VKI A;  2YS1 A;  5JP4 A;  3DXC A;  5KCV A;  2L1C A;  3ODX A;  4Z2M B;  3LJU X;  1AWE A;  1W1H A;  2I5C A;  4HAT B;  1XX0 A;  4F7G A;  5LOP B;  1WJM A;  5J3Y A;  1U2B A;  4D0N B;  1OY2 A;  3P6A A;  2K2J A;  3QWM A;  4NY0 A;  1TJ6 A;  3X23 A;  2GCJ A;  3PSC A;  1U27 A;  2D9Z A;  2W2X D;  2DHJ A;  1XR0 B;  3GYO A;  3PVW A;  2OQB A;  2RGN B;  4GPT B;  4MY6 A;  2M38 A;  5D3X A;  1DRO A;  2CY5 A;  2D10 A;  1Y5O A;  5HE2 A;  2P8V A;  4HB2 B;  2I1J A;  1K5D B;  4HAZ B;  3O96 A;  2X18 A;  4DX9 0;  1XCG A;  2YF0 A;  4A6K A;  4MK0 A;  2RLO A;  1UEF A;  3T06 A;  3V5W A;  1I2H A;  3SNH A;  4ZRK A;  2Z0P A;  3P7Z A;  1BWN A;  2GS0 A;  2UZR A;  3RCP A;  2R0D A;  2COC A;  1U5G A;  2EMT A;  2JP2 A;  1ZC3 B;  3OAN A;  3AU4 A;  3D8E A;  1UNR A;  2J0J A;  1Z87 A;  5CLL B;  4HDO A;  3F5R A;  1GC6 A;  3N7C A;  1P5T A;  1SHC A;  5DH9 B;  4CHM A;  1MK7 B;  1FHX A;  3PZD A;  1P3R A;  2G35 A;  2H7E A;  1H4R A;  5DIF B;  2K00 A;  3U8Z A;  1LW3 A;  2XQN M;  1EVH A;  1NTV A;  1Y19 B;  2Z0Q A;  2MFQ A;  4K2P A;  1KZG A;  4YON A;  3TCA A;  2COA A;  1FB8 A;  2CRF A;  2DA0 A;  2P0H A;  1WVH A;  2YS3 A;  2M14 A;  5JHG A;  4Y94 A;  5J3Q A;  1ISN A;  1MPH A;  2FJL A;  1ZC4 B;  2UZS A;  3SV1 A;  3D8F A;  2GJY A;  3WYF B;  2BCJ A;  5KQ4 A;  2DFK A;  4GZU A;  4CYE A;  2W2W A;  1BTN A;  2NZ8 B;  3GYP A;  1WJ1 A;  5D3W A;  4DX8 A;  1M7E A;  1ZVR A;  1TXD A;  1MIZ B;  2MWN B;  1V5P A;  1V5U A;  2R09 A;  5FI0 A;  1GC7 A;  4DXA B;  1NU2 A;  4A6F A;  3PVU A;  3VIA A;  2EMS A;  2LOZ A;  2LUL A;  2Y7B A;  3CXB B;  4KAX B;  2YVC A;  3SUZ A;  4K2O A;  1MAI A;  3BIN A;  3M1I B;  1NTY A;  5DHA B;  1B55 A;  3DXE A;  3TFM A;  3A8Q A;  4TYZ A;  2ROV A;  2DTC A;  1J19 A;  1XKE A;  1X1F A;  4HB0 B;  1ZSQ A;  4HAW B;  3PG7 A;  1H10 A;  2DX1 A;  2H7D A;  1FOE A;  1UNP A;  5DI9 B;  5J3T A;  2UVM A;  3FM8 C;  5L81 A;  3KRW A;  2MDX A;  3SO6 A;  2YSZ A;  4C0A A;  1XD4 A;  5EFX A;  5GOW B;  3ULB A;  4WJ7 A;  3QIJ A;  1FAO A;  2KCJ A;  3HW2 B;  4KHA A;  3HK0 A;  1U5F A;  2I5F A;  2GCL A;  1IRS A;  1NI2 A;  3MPX A;  3ODO A;  1BTK A;  4HB4 B;  2NMB A;  5C6R A;  4ZRJ A;  5C79 A;  4HHV A;  2D2Q A;  1GG3 A;  1SGH A;  3VOQ A;  2J59 M;  2N0Y A;  2D9W A;  1TQZ A;  2YT0 A;  1UPQ A;  1QC6 A;  4BBK A;  3G9W A;  2RSG A;  4HAY B;  2EC1 A;  2DYN A;  2ELB A;  2RVB B;  4GN1 A;  4P7I A;  2LKO A;  2YT1 A;  1W1D A;  3AU5 A;  5HE3 A;  3WA0 A;  4EMO A;  1M7R A;  2J0K A;  2K2U A;  4EJN A;  1V89 A;  5KQ1 A;  2J0M A;  1P6S A;  3ULC A;  4HAV B;  5D3Y A;  5HE0 A;  2Y8F A;  3UZT A;  1V61 A;  5D27 A;  2ROZ B;  1RJ2 A;  1N3H A;  2DX5 A;  4K17 A;  3IVF A;  4YL8 A;  2DYQ A;  3A98 B;  3ZDT A;  4DBB A;  1DDM A;  2VRW B;  1EGX A;  1U5D A;  3TO1 A;  1DDV A;  3TW1 A;  2Z0O A;  4MT7 A;  3FSS A;  1X05 A;  3ML4 A;  4EKU A;  2DLW A;  4IOY X;  2MKR A;  2EJ8 A;  1PFJ A;  2AL6 A;  2ELA A;  4L6E A;  2CAY A;  4IAP A;  2V76 A;  1FGZ A;  1Q67 A;  3KY9 A;  1PLS A;  2N23 A;  3NSU A;  2ADZ A;  3TVV A;  3KRX A;  2OTX A;  1WGU A;  2IFS A;  1EF1 A;  5D3V A;  2D4Q A;  2W2X C;  1KI1 B;  3FEH A;  3AJ4 A; 
#chains in the Genus database with same CATH topology
 2VSZ A;  3BJI A;  1U29 A;  1V5M A;  2FJU B;  5CLQ B;  2D9Y A;  2KIG A;  2P0D A;  4H8S A;  4F7H A;  2Q13 A;  4PQ0 A;  1FHW A;  4HAU B;  1V88 A;  2COF A;  2LG1 A;  3DCX A;  3U12 A;  2COD A;  3PEG A;  4GXB A;  2I1K A;  4KHO A;  4L1R A;  3ZVR A;  2DHK A;  2DN6 A;  1E5W A;  2LOX A;  3OHM B;  2AEH A;  5FI1 A;  2IYB A;  2D9V A;  1X11 A;  5M4Y B;  1KZ7 A;  1MIX A;  1FHO A;  3PP2 A;  1WI1 A;  3NW8 A;  2DHI A;  2YT2 A;  1DYN A;  4GMX B;  5JHH A;  5C5B B;  2Y8G A;  1J0W A;  2D11 A;  3U7D A;  1MKE A;  2RRF A;  2DKP A;  3SYX A;  1EAZ A;  4OSN A;  1OQN A;  2K8E A;  3QBV B;  2QKL A;  2E2X A;  4HDQ A;  1UNQ A;  2P0F A;  3KZ1 A;  1W1G A;  1X1G A;  5C16 A;  2KGX B;  1BAK A;  1WG7 A;  2LYD A;  1MK9 B;  3A58 A;  4XWX A;  5C5B A;  4F7U P;  1FGY A;  1K5G B;  1ZM0 A;  2CY4 A;  2R2Y A;  3MDB C;  1UPR A;  2YS5 A;  1QQG A;  3ODW A;  1XOD A;  2YRY A;  4WSF A;  3HQC A;  1DBH A;  2HTH B;  3DXD A;  1OMW A;  3FVC A;  4KVG B;  3A8P A;  2KUP A;  4B6H A;  1LB1 A;  1WGQ A;  2HE7 A;  2DKQ A;  3CIK A;  4TKN A;  3F0W A;  2L2I A;  4K81 A;  2QKM A;  2RUK B;  3KSY A;  1AQC A;  1I7A A;  4HAX B;  4KHB B;  1MI1 A;  2PZ1 A;  5JLJ B;  2KR0 A;  1X86 A;  2ZPY A;  4GMV A;  1PMS A;  2Z4D A;  2RNR B;  4A6F B;  1RRP B;  3D8D A;  4WVF B;  2D9X A;  4NSW A;  1DDW A;  5HE1 A;  4A5K A;  5DHF B;  4Z2N A;  4A6H A;  5LON B;  4CHJ A;  1U5E A;  4PNK A;  3PVL A;  4HB3 B;  4ZRI A;  4IFS A;  2VKI A;  2YS1 A;  5JP4 A;  3DXC A;  5KCV A;  2L1C A;  3ODX A;  4Z2M B;  3LJU X;  1AWE A;  1W1H A;  2I5C A;  4DIX A;  4HAT B;  1XX0 A;  4F7G A;  5LOP B;  1WJM A;  5J3Y A;  1U2B A;  4D0N B;  1OY2 A;  3P6A A;  2K2J A;  3QWM A;  5I2M A;  4NY0 A;  1TJ6 A;  3X23 A;  3HIE A;  2GCJ A;  3PSC A;  1U27 A;  2D9Z A;  2W2X D;  2DHJ A;  1XR0 B;  3GYO A;  4HSI A;  3PVW A;  2OQB A;  2RGN B;  4GPT B;  4MY6 A;  2M38 A;  5D3X A;  4QJ4 B;  1DRO A;  2CY5 A;  2D10 A;  1Y5O A;  4OT1 A;  5HE2 A;  2P8V A;  4HB2 B;  2I1J A;  2ZKM X;  1K5D B;  4HAZ B;  3O96 A;  2X18 A;  4DX9 0;  1XCG A;  2YF0 A;  4A6K A;  4MK0 A;  2RLO A;  1UEF A;  3T06 A;  3V5W A;  1I2H A;  3SNH A;  4ZRK A;  2Z0P A;  3P7Z A;  1BWN A;  2GS0 A;  2UZR A;  3RCP A;  2R0D A;  2COC A;  1U5G A;  2EMT A;  5LG4 B;  2JP2 A;  1ZC3 B;  3OAN A;  3AU4 A;  3D8E A;  1UNR A;  2J0J A;  1Z87 A;  5CLL B;  4HDO A;  3F5R A;  2Z13 A;  1GC6 A;  3N7C A;  1P5T A;  1SHC A;  5DH9 B;  4CHM A;  1MK7 B;  1FHX A;  3PZD A;  1P3R A;  2G35 A;  2H7E A;  2KUQ A;  1H4R A;  5DIF B;  2K00 A;  3U8Z A;  1LW3 A;  2XQN M;  1EVH A;  1NTV A;  1Y19 B;  2Z0Q A;  2MFQ A;  4K2P A;  1KZG A;  4YON A;  3TCA A;  2COA A;  1FB8 A;  2CRF A;  2NBV A;  2DA0 A;  1ZYI A;  2P0H A;  1WVH A;  4QXA B;  2YS3 A;  2M14 A;  5JHG A;  4Y94 A;  5J3Q A;  1ISN A;  1MPH A;  2FJL A;  1ZC4 B;  2UZS A;  3SV1 A;  3D8F A;  2GJY A;  3WYF B;  2BCJ A;  4CSQ A;  4GOU A;  5KQ4 A;  2DFK A;  4GZU A;  4CYE A;  2W2W A;  1BTN A;  2NZ8 B;  3GYP A;  5IRS A;  1WJ1 A;  5D3W A;  4DX8 A;  1M7E A;  1ZVR A;  1TXD A;  4KHB A;  1MIZ B;  2MWN B;  1V5P A;  1V5U A;  2R09 A;  5FI0 A;  1GC7 A;  4DXA B;  1NU2 A;  4A6F A;  3PVU A;  3VIA A;  2EMS A;  2LOZ A;  2LUL A;  2Y7B A;  3CXB B;  4KAX B;  2YVC A;  3HSA A;  3SUZ A;  4K2O A;  1MAI A;  3BIN A;  3M1I B;  1NTY A;  5DHA B;  1B55 A;  3DXE A;  3TFM A;  3A8Q A;  4TYZ A;  2ROV A;  2DTC A;  1J19 A;  5I2S A;  1XKE A;  1X1F A;  4HB0 B;  1ZSQ A;  4HAW B;  1H10 A;  2DX1 A;  2H7D A;  3PG7 A;  1FOE A;  1UNP A;  5DI9 B;  5J3T A;  2UVM A;  3FM8 C;  5L81 A;  3KRW A;  2MDX A;  1T77 A;  3SO6 A;  2YSZ A;  4QJ3 B;  3NWA A;  4C0A A;  1XD4 A;  2GUM A;  5EFX A;  5GOW B;  3ULB A;  4WJ7 A;  3QIJ A;  1FAO A;  2KCJ A;  3HW2 B;  4KHA A;  3HK0 A;  1U5F A;  2I5F A;  2GCL A;  1IRS A;  1NI2 A;  3MPX A;  3ODO A;  1BTK A;  4HB4 B;  2NMB A;  5C6R A;  4ZRJ A;  5C79 A;  4HHV A;  2D2Q A;  1GG3 A;  1SGH A;  3VOQ A;  2J59 M;  2N0Y A;  2D9W A;  1TQZ A;  2YT0 A;  1UPQ A;  1QC6 A;  4BBK A;  3G9W A;  3NWF A;  2RSG A;  4HAY B;  2EC1 A;  2DYN A;  2ELB A;  2RVB B;  4GN1 A;  4P7I A;  2LKO A;  2YT1 A;  1W1D A;  3AU5 A;  2K49 A;  5HE3 A;  3WA0 A;  4EMO A;  1M7R A;  2J0K A;  2K2U A;  4EJN A;  1V89 A;  5KQ1 A;  2J0M A;  1P6S A;  3ULC A;  4HAV B;  5D3Y A;  5HE0 A;  2Y8F A;  3UZT A;  1V61 A;  5D27 A;  2ROZ B;  2KIE A;  4D6W A;  1RJ2 A;  1N3H A;  2DX5 A;  4K17 A;  3IVF A;  4YL8 A;  2DYQ A;  2Z59 A;  3A98 B;  3ZDT A;  4DBB A;  1DDM A;  2Z14 A;  2VRW B;  1EGX A;  1U5D A;  3TO1 A;  1DDV A;  3TW1 A;  2Z0O A;  4MT7 A;  3FSS A;  1X05 A;  3ML4 A;  3NWD A;  4EKU A;  2DLW A;  4IOY X;  3B77 A;  2MKR A;  2EJ8 A;  1PFJ A;  2AL6 A;  2ELA A;  4L6E A;  2CAY A;  4IAP A;  2V76 A;  4QJ5 B;  1FGZ A;  1Q67 A;  3KY9 A;  1PLS A;  2N23 A;  3NSU A;  2ADZ A;  3TVV A;  4GNK B;  3KRX A;  2OTX A;  1WGU A;  2IFS A;  1EF1 A;  5D3V A;  2D4Q A;  2W2X C;  1KI1 B;  3FEH A;  3AJ4 A; 
#chains in the Genus database with same CATH homology
 2VSZ A;  3BJI A;  1U29 A;  1V5M A;  5CLQ B;  2D9Y A;  4H8S A;  2P0D A;  4F7H A;  2Q13 A;  4PQ0 A;  1FHW A;  4HAU B;  1V88 A;  2COF A;  2LG1 A;  2COD A;  3PEG A;  4GXB A;  2I1K A;  4KHO A;  3ZVR A;  2DHK A;  2DN6 A;  1E5W A;  2LOX A;  2AEH A;  5FI1 A;  2IYB A;  2D9V A;  1X11 A;  1KZ7 A;  1MIX A;  1FHO A;  3PP2 A;  1WI1 A;  2DHI A;  1DYN A;  4GMX B;  5JHH A;  5C5B B;  2Y8G A;  1J0W A;  2D11 A;  3U7D A;  1MKE A;  2DKP A;  3SYX A;  1EAZ A;  1OQN A;  3QBV B;  2QKL A;  2E2X A;  4HDQ A;  1UNQ A;  2P0F A;  3KZ1 A;  1W1G A;  1X1G A;  5C16 A;  2KGX B;  1BAK A;  1WG7 A;  2LYD A;  1MK9 B;  4XWX A;  5C5B A;  4F7U P;  1FGY A;  1K5G B;  1ZM0 A;  2CY4 A;  3MDB C;  1UPR A;  2YS5 A;  1QQG A;  3ODW A;  1XOD A;  2YRY A;  4WSF A;  3HQC A;  1DBH A;  2HTH B;  3DXD A;  1OMW A;  4KVG B;  3A8P A;  2KUP A;  4B6H A;  1LB1 A;  1WGQ A;  2HE7 A;  2DKQ A;  3CIK A;  4TKN A;  3F0W A;  2L2I A;  4K81 A;  2QKM A;  2RUK B;  3KSY A;  1AQC A;  1I7A A;  4HAX B;  4KHB B;  2PZ1 A;  5JLJ B;  1X86 A;  2ZPY A;  4GMV A;  1PMS A;  2RNR B;  4A6F B;  1RRP B;  3D8D A;  4WVF B;  2D9X A;  4NSW A;  1DDW A;  5HE1 A;  4A5K A;  5DHF B;  4Z2N A;  4A6H A;  5LON B;  4CHJ A;  1U5E A;  4PNK A;  3PVL A;  4HB3 B;  4ZRI A;  4IFS A;  2VKI A;  2YS1 A;  5JP4 A;  3DXC A;  5KCV A;  2L1C A;  3ODX A;  4Z2M B;  3LJU X;  1AWE A;  1W1H A;  2I5C A;  4HAT B;  1XX0 A;  4F7G A;  5LOP B;  1WJM A;  5J3Y A;  1U2B A;  4D0N B;  1OY2 A;  3P6A A;  2K2J A;  3QWM A;  4NY0 A;  1TJ6 A;  3X23 A;  2GCJ A;  3PSC A;  1U27 A;  2D9Z A;  2W2X D;  2DHJ A;  1XR0 B;  3GYO A;  3PVW A;  2OQB A;  2RGN B;  4GPT B;  4MY6 A;  2M38 A;  5D3X A;  1DRO A;  2CY5 A;  2D10 A;  1Y5O A;  5HE2 A;  2P8V A;  4HB2 B;  2I1J A;  1K5D B;  4HAZ B;  3O96 A;  2X18 A;  4DX9 0;  1XCG A;  2YF0 A;  4A6K A;  4MK0 A;  2RLO A;  1UEF A;  3T06 A;  3V5W A;  1I2H A;  3SNH A;  4ZRK A;  2Z0P A;  3P7Z A;  1BWN A;  2GS0 A;  2UZR A;  3RCP A;  2R0D A;  2COC A;  1U5G A;  2EMT A;  2JP2 A;  1ZC3 B;  3OAN A;  3AU4 A;  3D8E A;  1UNR A;  2J0J A;  1Z87 A;  5CLL B;  4HDO A;  3F5R A;  1GC6 A;  3N7C A;  1P5T A;  1SHC A;  5DH9 B;  4CHM A;  1MK7 B;  1FHX A;  3PZD A;  1P3R A;  2G35 A;  2H7E A;  1H4R A;  5DIF B;  2K00 A;  3U8Z A;  1LW3 A;  2XQN M;  1EVH A;  1NTV A;  1Y19 B;  2Z0Q A;  2MFQ A;  4K2P A;  1KZG A;  4YON A;  3TCA A;  2COA A;  1FB8 A;  2CRF A;  2DA0 A;  2P0H A;  1WVH A;  2YS3 A;  2M14 A;  5JHG A;  4Y94 A;  5J3Q A;  1ISN A;  1MPH A;  2FJL A;  1ZC4 B;  2UZS A;  3SV1 A;  3D8F A;  2GJY A;  3WYF B;  2BCJ A;  5KQ4 A;  2DFK A;  4GZU A;  4CYE A;  2W2W A;  1BTN A;  2NZ8 B;  3GYP A;  1WJ1 A;  5D3W A;  4DX8 A;  1M7E A;  1ZVR A;  1TXD A;  1MIZ B;  2MWN B;  1V5P A;  1V5U A;  2R09 A;  5FI0 A;  1GC7 A;  4DXA B;  1NU2 A;  4A6F A;  3PVU A;  3VIA A;  2EMS A;  2LOZ A;  2LUL A;  2Y7B A;  3CXB B;  4KAX B;  2YVC A;  3SUZ A;  4K2O A;  1MAI A;  3BIN A;  3M1I B;  1NTY A;  5DHA B;  1B55 A;  3DXE A;  3TFM A;  3A8Q A;  4TYZ A;  2ROV A;  2DTC A;  1J19 A;  1XKE A;  1X1F A;  4HB0 B;  1ZSQ A;  4HAW B;  3PG7 A;  1H10 A;  2DX1 A;  2H7D A;  1FOE A;  1UNP A;  5DI9 B;  5J3T A;  2UVM A;  3FM8 C;  5L81 A;  3KRW A;  2MDX A;  3SO6 A;  2YSZ A;  4C0A A;  1XD4 A;  5EFX A;  5GOW B;  3ULB A;  4WJ7 A;  3QIJ A;  1FAO A;  2KCJ A;  3HW2 B;  4KHA A;  3HK0 A;  1U5F A;  2I5F A;  2GCL A;  1IRS A;  1NI2 A;  3MPX A;  3ODO A;  1BTK A;  4HB4 B;  2NMB A;  5C6R A;  4ZRJ A;  5C79 A;  4HHV A;  2D2Q A;  1GG3 A;  1SGH A;  3VOQ A;  2J59 M;  2N0Y A;  2D9W A;  1TQZ A;  2YT0 A;  1UPQ A;  1QC6 A;  4BBK A;  3G9W A;  2RSG A;  4HAY B;  2EC1 A;  2DYN A;  2ELB A;  2RVB B;  4GN1 A;  4P7I A;  2LKO A;  2YT1 A;  1W1D A;  3AU5 A;  5HE3 A;  3WA0 A;  4EMO A;  1M7R A;  2J0K A;  2K2U A;  4EJN A;  1V89 A;  5KQ1 A;  2J0M A;  1P6S A;  3ULC A;  4HAV B;  5D3Y A;  5HE0 A;  2Y8F A;  3UZT A;  1V61 A;  5D27 A;  2ROZ B;  1RJ2 A;  1N3H A;  2DX5 A;  4K17 A;  3IVF A;  4YL8 A;  2DYQ A;  3A98 B;  3ZDT A;  4DBB A;  1DDM A;  2VRW B;  1EGX A;  1U5D A;  3TO1 A;  1DDV A;  3TW1 A;  2Z0O A;  4MT7 A;  3FSS A;  1X05 A;  3ML4 A;  4EKU A;  2DLW A;  4IOY X;  2MKR A;  2EJ8 A;  1PFJ A;  2AL6 A;  2ELA A;  4L6E A;  2CAY A;  4IAP A;  2V76 A;  1FGZ A;  1Q67 A;  3KY9 A;  1PLS A;  2N23 A;  3NSU A;  2ADZ A;  3TVV A;  3KRX A;  2OTX A;  1WGU A;  2IFS A;  1EF1 A;  5D3V A;  2D4Q A;  2W2X C;  1KI1 B;  3FEH A;  3AJ4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...