1I7AA

Evh1 domain from murine homer 2b/vesl 2
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
109
structure length
103
Chain Sequence
b'EQPIFTTRAHVFQINWVPASKQAVTVSYFYDVTRNSYRIISVDGAKVIINSTITPNMTFTKTSQKFGQWADSRANTVFGLGFSSELQLTKFAEKFQEVREAAR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HOMER 2B
publication title The N-terminal domain of Homer/Vesl is a new class II EVH1 domain.
pubmed doi rcsb
source organism Mus musculus
molecule tags Signaling protein
total genus 20
structure length 103
sequence length 109
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2001-03-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00568 WH1 WH1 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1i7aA00
3GYPA 3BJIA 4IAPA 2MWNB 1QC6A 1IRSA 3TCAA 2I1JA 2K2JA 3A8PA 4HAYB 2ZPYA 3TO1A 1MK7B 2UVMA 4GZUA 1V61A 2J59M 2DHKA 2YS3A 1EGXA 2GCJA 1GC7A 1DROA 2VSZA 4WSFA 1EF1A 2Z0QA 1TQZA 1DDWA 5KCVA 5D3VA 4NY0A 1K5GB 1Q67A 2YS5A 4HAWB 4Z2MB 3QIJA 2J0KA 2KGXB 2Y8GA 4HB4B 1I2HA 3ODXA 1DBHA 2D9WA 1V89A 2V76A 4KHAA 1V88A 3QBVB 3ULCA 3AU5A 1Y5OA 2ELBA 5LONB 1P6SA 3VIAA 3SUZA 3HW2B 1BTKA 1U5EA 1I7AA 1UNQA 3D8EA 5LOPB 1M7EA 3PSCA 2M14A 1WG7A 4ZRJA 2CY4A 1DYNA 3PEGA 4GXBA 2YS1A 2Z0OA 3LJUX 2DTCA 2VRWB 1UEFA 1SHCA 2YT0A 2L1CA 4XWXA 2QKMA 1XD4A 2K00A 3PG7A 3PVLA 1ZVRA 3UZTA 5HE2A 2G35A 2W2WA 3M1IB 3PP2A 1N3HA 2DHJA 4Z2NA 2I5CA 2DFKA 4TKNA 2BCJA 1AQCA 4K17A 1NI2A 5HE0A 1OY2A 2COCA 4KHBB 2Y8FA 2AEHA 3U8ZA 5J3QA 2CAYA 1XX0A 1GC6A 2NZ8B 3KRXA 1MIZB 5L81A 1FHXA 3T06A 4EJNA 4K2PA 4HB2B 4HDOA 4Y94A 3P7ZA 2D9XA 5JP4A 1MAIA 2D9ZA 2JP2A 3FEHA 4ZRKA 3WA0A 4BBKA 2Y7BA 1KZGA 4YONA 2D11A 3F5RA 1X86A 1W1HA 1X05A 1BAKA 1V5MA 3O96A 1PLSA 1WGQA 2J0MA 2MDXA 2H7EA 1MKEA 3DXCA 4L6EA 2J0JA 2YF0A 3HQCA 1SGHA 3ZDTA 3D8DA 1U2BA 4HATB 3SNHA 5JHGA 1FOEA 5GOWB 1PMSA 1ZC3B 2YVCA 1FGYA 2RUKB 4A6FA 4DX90 1Z87A 1WJMA 2DLWA 4HAZB 2P0FA 2NMBA 2D10A 4HAUB 2Z0PA 1RRPB 1KZ7A 5JHHA 1AWEA 4MK0A 2LOZA 4HB3B 2FJLA 2EMSA 3GYOA 2ROZB 1ISNA 1MPHA 2R0DA 2DKPA 2LKOA 3BINA 4D0NB 4F7UP 4K81A 4F7HA 3FM8C 2HE7A 1FHOA 4DXAB 4ZRIA 2RNRB 2I5FA 3TFMA 1EAZA 1EVHA 1WVHA 5C79A 2KCJA 2GJYA 3P6AA 1UPQA 1UNRA 2IYBA 4PQ0A 3CXBB 4GPTB 1U5GA 2D9VA 5D27A 4CHJA 4CHMA 2DYQA 1J0WA 2N23A 3A8QA 2MKRA 1DDMA 2LULA 3X23A 3KZ1A 2RVBB 2YRYA 1MK9B 1PFJA 2YT1A 3PVWA 1W1DA 1WGUA 3ODWA 4MT7A 5C5BB 3F0WA 2E2XA 2Q13A 1J19A 1X1GA 2EC1A 1BTNA 5D3XA 3VOQA 3KSYA 1M7RA 1U27A 4EMOA 1MIXA 5FI0A 3SYXA 5CLLB 3SO6A 1K5DB 4K2OA 1XKEA 4MY6A 2ELAA 1P3RA 3AJ4A 1B55A 5DIFB 1TXDA 3DXDA 4EKUA 1V5PA 2RLOA 4WVFB 2LOXA 5CLQB 4HDQA 3RCPA 4GMVA 2DYNA 5DI9B 2CRFA 4GN1A 3TVVA 1OMWA 2H7DA 2YSZA 4NSWA 5JLJB 4WJ7A 2DKQA 2PZ1A 2R09A 2I1KA 4P7IA 1LB1A 2UZRA 2IFSA 2P8VA 5C16A 2W2XD 2LYDA 4GMXB 1BWNA 2N0YA 3ULBA 3OANA 4IFSA 4A5KA 3U7DA 1RJ2A 4IOYX 3HK0A 1FGZA 1U5FA 1ZM0A 2LG1A 4TYZA 2DX1A 1NTYA 1DDVA 2W2XC 2XQNM 5C6RA 1KI1B 5DHFB 3TW1A 4HB0B 2ADZA 3ZVRA 2L2IA 1X1FA 1QQGA 1P5TA 2KUPA 5D3WA 3PVUA 2D4QA 5EFXA 4YL8A 1UNPA 2CY5A 1FAOA 1WJ1A 1OQNA 2COFA 4F7GA 2AL6A 3CIKA 1FHWA 2RGNB 3PZDA 3MPXA 3V5WA 4A6KA 4KHOA 2MFQA 2P0HA 2GS0A 2CODA 1W1GA 1XR0B 1GG3A 2K2UA 1NTVA 3D8FA 1XODA 3A98B 5FI1A 2M38A 3SV1A 2ROVA 2OQBA 2EMTA 5DHAB 4DBBA 1X11A 2DN6A 1ZSQA 4C0AA 3MDBC 2DHIA 4HAVB 2D9YA 3KRWA 5DH9B 2X18A 5D3YA 4B6HA 3FSSA 1H10A 1V5UA 4DX8A 3AU4A 2DX5A 4PNKA 1UPRA 5J3YA 5C5BA 3QWMA 5HE3A 2D2QA 3NSUA 3G9WA 4CYEA 2RSGA 1FB8A 3DXEA 2DA0A 1XCGA 4A6HA 1E5WA 3ODOA 2HTHB 5J3TA 4KAXB 3KY9A 1WI1A 4HAXB 3WYFB 4H8SA 4KVGB 3ML4A 4HHVA 1Y19B 1NU2A 1LW3A 2UZSA 1U5DA 1U29A 2P0DA 2GCLA 3IVFA 1ZC4B 5KQ1A 1TJ6A 2VKIA 2COAA 1H4RA 5KQ4A 2QKLA 2OTXA 5HE1A 4A6FB 3N7CA 2EJ8A
chains in the Genus database with same CATH superfamily
3GYPA 3BJIA 4IAPA 2MWNB 1QC6A 1IRSA 3TCAA 2I1JA 2K2JA 3A8PA 4HAYB 4HSIA 2ZPYA 3TO1A 1MK7B 2UVMA 4GZUA 1V61A 4L1RA 2J59M 2DHKA 2YS3A 1EGXA 2GCJA 1GC7A 1DROA 2VSZA 4WSFA 1EF1A 2Z0QA 1TQZA 2Z13A 1DDWA 5KCVA 5D3VA 4DIXA 4NY0A 1K5GB 1Q67A 2YS5A 4HAWB 4Z2MB 1T77A 3QIJA 2J0KA 2KGXB 2Y8GA 4HB4B 1I2HA 3ODXA 1DBHA 2D9WA 1V89A 2V76A 4KHAA 1V88A 3QBVB 3ULCA 3AU5A 1Y5OA 2ELBA 5LONB 1P6SA 3VIAA 4QJ4B 3SUZA 3HW2B 1BTKA 1U5EA 1I7AA 1UNQA 3D8EA 5LOPB 1M7EA 3PSCA 2M14A 1WG7A 4ZRJA 2CY4A 1DYNA 3PEGA 4GXBA 2YS1A 2Z0OA 3A58A 3LJUX 2DTCA 2VRWB 1UEFA 1SHCA 2YT0A 2L1CA 4XWXA 2QKMA 1XD4A 2K00A 3PG7A 3PVLA 2KUQA 1ZVRA 3UZTA 5HE2A 2G35A 2W2WA 3M1IB 3PP2A 1N3HA 2DHJA 4Z2NA 2I5CA 2DFKA 4TKNA 2BCJA 1AQCA 4K17A 1NI2A 5HE0A 1OY2A 2COCA 4KHBB 2Y8FA 2AEHA 3U8ZA 5J3QA 2CAYA 1XX0A 1GC6A 2NZ8B 3KRXA 1MIZB 5L81A 1FHXA 3T06A 4EJNA 4K2PA 4GOUA 4HB2B 4HDOA 2NBVA 4Y94A 3NWFA 3P7ZA 2D9XA 5JP4A 4QXAB 1MAIA 2D9ZA 4KHBA 2JP2A 3FEHA 4ZRKA 3HIEA 3WA0A 4BBKA 3DCXA 2Y7BA 1KZGA 4YONA 5I2SA 2D11A 3F5RA 1X86A 1W1HA 4OT1A 1X05A 1BAKA 1V5MA 3O96A 1PLSA 5IRSA 1WGQA 2J0MA 2MDXA 2H7EA 1MKEA 3DXCA 4L6EA 2J0JA 2YF0A 3HQCA 1SGHA 3ZDTA 3D8DA 2Z59A 1U2BA 4HATB 3NWDA 3SNHA 5JHGA 1FOEA 5GOWB 1PMSA 1ZC3B 2YVCA 1FGYA 2RUKB 4A6FA 4DX90 5LG4B 1Z87A 1WJMA 2DLWA 4HAZB 3B77A 2P0FA 2NMBA 2D10A 4HAUB 2Z0PA 1RRPB 1KZ7A 5JHHA 1AWEA 4MK0A 2LOZA 4HB3B 2FJLA 2EMSA 3GYOA 2ROZB 1ISNA 1MPHA 2R0DA 2DKPA 2LKOA 3BINA 4D0NB 4GNKB 4K81A 4F7UP 4F7HA 3FM8C 2KIEA 2HE7A 1FHOA 4DXAB 4ZRIA 2RNRB 2I5FA 3TFMA 1EAZA 1EVHA 2FJUB 2ZKMX 1WVHA 5C79A 2KCJA 2GJYA 2RRFA 1UPQA 3FVCA 3P6AA 1UNRA 2IYBA 4PQ0A 3CXBB 4GPTB 1U5GA 2D9VA 5D27A 4CHJA 4CHMA 2DYQA 1J0WA 2N23A 3A8QA 2MKRA 1DDMA 2LULA 3X23A 3KZ1A 2RVBB 2YRYA 1MK9B 1PFJA 2YT1A 3PVWA 1W1DA 1WGUA 3ODWA 4MT7A 5C5BB 3F0WA 2E2XA 2Q13A 3U12A 1J19A 1X1GA 2EC1A 1BTNA 5D3XA 3VOQA 3KSYA 1M7RA 1U27A 4EMOA 1MIXA 5FI0A 3SYXA 5CLLB 3SO6A 1K5DB 4K2OA 1XKEA 4MY6A 2ELAA 1P3RA 3AJ4A 1B55A 1MI1A 5DIFB 1TXDA 3HSAA 3DXDA 4EKUA 1V5PA 2RLOA 4WVFB 2LOXA 5CLQB 4HDQA 3RCPA 4GMVA 2DYNA 5DI9B 2CRFA 2YT2A 4GN1A 3TVVA 1OMWA 2H7DA 4QJ5B 2YSZA 4NSWA 5JLJB 4WJ7A 2DKQA 2PZ1A 2R09A 2Z14A 2I1KA 4P7IA 1LB1A 2UZRA 2IFSA 2P8VA 5C16A 5M4YB 2W2XD 2LYDA 4GMXB 1BWNA 2N0YA 3ULBA 3OANA 4IFSA 4A5KA 3U7DA 1RJ2A 2KR0A 4IOYX 3HK0A 4QJ3B 1FGZA 1U5FA 1ZM0A 2LG1A 4TYZA 2DX1A 1NTYA 1DDVA 2GUMA 2W2XC 2XQNM 5C6RA 1KI1B 5DHFB 4D6WA 3TW1A 4HB0B 2ADZA 3ZVRA 2L2IA 1X1FA 2K49A 1QQGA 1P5TA 2KUPA 2Z4DA 5D3WA 3PVUA 2D4QA 5EFXA 4YL8A 1UNPA 2CY5A 1FAOA 1WJ1A 1OQNA 2COFA 3NW8A 3OHMB 4F7GA 2AL6A 3CIKA 1FHWA 2RGNB 3PZDA 3MPXA 3V5WA 4A6KA 4KHOA 2MFQA 2P0HA 2GS0A 2CODA 1W1GA 1XR0B 1GG3A 2K2UA 1NTVA 1ZYIA 3D8FA 1XODA 3A98B 2KIGA 5FI1A 2M38A 3SV1A 2ROVA 2OQBA 2EMTA 5DHAB 4DBBA 1X11A 2DN6A 1ZSQA 4C0AA 3MDBC 2DHIA 4HAVB 2D9YA 3KRWA 5DH9B 2X18A 5D3YA 4B6HA 3FSSA 4OSNA 1H10A 1V5UA 4DX8A 3AU4A 2DX5A 4PNKA 1UPRA 5J3YA 5C5BA 3QWMA 5HE3A 2D2QA 3NSUA 3G9WA 4CYEA 2RSGA 3DXEA 1FB8A 2DA0A 1XCGA 4A6HA 1E5WA 3ODOA 2HTHB 5J3TA 4KAXB 4CSQA 3KY9A 1WI1A 4HAXB 3WYFB 4H8SA 2K8EA 4KVGB 3NWAA 3ML4A 4HHVA 1Y19B 1NU2A 1LW3A 2R2YA 2UZSA 1U5DA 1U29A 2P0DA 2GCLA 3IVFA 1ZC4B 5KQ1A 1TJ6A 5I2MA 2VKIA 2COAA 1H4RA 5KQ4A 2QKLA 2OTXA 5HE1A 4A6FB 3N7CA 2EJ8A
chains in the Genus database with same CATH topology
3GYPA 3BJIA 4IAPA 2MWNB 1QC6A 1IRSA 3TCAA 2I1JA 2K2JA 3A8PA 4HAYB 2ZPYA 3TO1A 1MK7B 2UVMA 4GZUA 1V61A 2J59M 2DHKA 2YS3A 1EGXA 2GCJA 1GC7A 1DROA 2VSZA 4WSFA 1EF1A 2Z0QA 1TQZA 1DDWA 5KCVA 5D3VA 4NY0A 1K5GB 1Q67A 2YS5A 4HAWB 4Z2MB 3QIJA 2J0KA 2KGXB 2Y8GA 4HB4B 1I2HA 3ODXA 1DBHA 2D9WA 1V89A 2V76A 4KHAA 1V88A 3QBVB 3ULCA 3AU5A 1Y5OA 2ELBA 5LONB 1P6SA 3VIAA 3SUZA 3HW2B 1BTKA 1U5EA 1I7AA 1UNQA 3D8EA 5LOPB 1M7EA 3PSCA 2M14A 1WG7A 4ZRJA 2CY4A 1DYNA 3PEGA 4GXBA 2YS1A 2Z0OA 3LJUX 2DTCA 2VRWB 1UEFA 1SHCA 2YT0A 2L1CA 4XWXA 2QKMA 1XD4A 2K00A 3PG7A 3PVLA 1ZVRA 3UZTA 5HE2A 2G35A 2W2WA 3M1IB 3PP2A 1N3HA 2DHJA 4Z2NA 2I5CA 2DFKA 4TKNA 2BCJA 1AQCA 4K17A 1NI2A 5HE0A 1OY2A 2COCA 4KHBB 2Y8FA 2AEHA 3U8ZA 5J3QA 2CAYA 1XX0A 1GC6A 2NZ8B 3KRXA 1MIZB 5L81A 1FHXA 3T06A 4EJNA 4K2PA 4HB2B 4HDOA 4Y94A 3P7ZA 2D9XA 5JP4A 1MAIA 2D9ZA 2JP2A 3FEHA 4ZRKA 3WA0A 4BBKA 2Y7BA 1KZGA 4YONA 2D11A 3F5RA 1X86A 1W1HA 1X05A 1BAKA 1V5MA 3O96A 1PLSA 1WGQA 2J0MA 2MDXA 2H7EA 1MKEA 3DXCA 4L6EA 2J0JA 2YF0A 3HQCA 1SGHA 3ZDTA 3D8DA 1U2BA 4HATB 3SNHA 5JHGA 1FOEA 5GOWB 1PMSA 1ZC3B 2YVCA 1FGYA 2RUKB 4A6FA 4DX90 1Z87A 1WJMA 2DLWA 4HAZB 2P0FA 2NMBA 2D10A 4HAUB 2Z0PA 1RRPB 1KZ7A 5JHHA 1AWEA 4MK0A 2LOZA 4HB3B 2FJLA 2EMSA 3GYOA 2ROZB 1ISNA 1MPHA 2R0DA 2DKPA 2LKOA 3BINA 4D0NB 4F7UP 4K81A 4F7HA 3FM8C 2HE7A 1FHOA 4DXAB 4ZRIA 2RNRB 2I5FA 3TFMA 1EAZA 1EVHA 1WVHA 5C79A 2KCJA 2GJYA 3P6AA 1UPQA 1UNRA 2IYBA 4PQ0A 3CXBB 4GPTB 1U5GA 2D9VA 5D27A 4CHJA 4CHMA 2DYQA 1J0WA 2N23A 3A8QA 2MKRA 1DDMA 2LULA 3X23A 3KZ1A 2RVBB 2YRYA 1MK9B 1PFJA 2YT1A 3PVWA 1W1DA 1WGUA 3ODWA 4MT7A 5C5BB 3F0WA 2E2XA 2Q13A 1J19A 1X1GA 2EC1A 1BTNA 5D3XA 3VOQA 3KSYA 1M7RA 1U27A 4EMOA 1MIXA 5FI0A 3SYXA 5CLLB 3SO6A 1K5DB 4K2OA 1XKEA 4MY6A 2ELAA 1P3RA 3AJ4A 1B55A 5DIFB 1TXDA 3DXDA 4EKUA 1V5PA 2RLOA 4WVFB 2LOXA 5CLQB 4HDQA 3RCPA 4GMVA 2DYNA 5DI9B 2CRFA 4GN1A 3TVVA 1OMWA 2H7DA 2YSZA 4NSWA 5JLJB 4WJ7A 2DKQA 2PZ1A 2R09A 2I1KA 4P7IA 1LB1A 2UZRA 2IFSA 2P8VA 5C16A 2W2XD 2LYDA 4GMXB 1BWNA 2N0YA 3ULBA 3OANA 4IFSA 4A5KA 3U7DA 1RJ2A 4IOYX 3HK0A 1FGZA 1U5FA 1ZM0A 2LG1A 4TYZA 2DX1A 1NTYA 1DDVA 2W2XC 2XQNM 5C6RA 1KI1B 5DHFB 3TW1A 4HB0B 2ADZA 3ZVRA 2L2IA 1X1FA 1QQGA 1P5TA 2KUPA 5D3WA 3PVUA 2D4QA 5EFXA 4YL8A 1UNPA 2CY5A 1FAOA 1WJ1A 1OQNA 2COFA 4F7GA 2AL6A 3CIKA 1FHWA 2RGNB 3PZDA 3MPXA 3V5WA 4A6KA 4KHOA 2MFQA 2P0HA 2GS0A 2CODA 1W1GA 1XR0B 1GG3A 2K2UA 1NTVA 3D8FA 1XODA 3A98B 5FI1A 2M38A 3SV1A 2ROVA 2OQBA 2EMTA 5DHAB 4DBBA 1X11A 2DN6A 1ZSQA 4C0AA 3MDBC 2DHIA 4HAVB 2D9YA 3KRWA 5DH9B 2X18A 5D3YA 4B6HA 3FSSA 1H10A 1V5UA 4DX8A 3AU4A 2DX5A 4PNKA 1UPRA 5J3YA 5C5BA 3QWMA 5HE3A 2D2QA 3NSUA 3G9WA 4CYEA 2RSGA 1FB8A 3DXEA 2DA0A 1XCGA 4A6HA 1E5WA 3ODOA 2HTHB 5J3TA 4KAXB 3KY9A 1WI1A 4HAXB 3WYFB 4H8SA 4KVGB 3ML4A 4HHVA 1Y19B 1NU2A 1LW3A 2UZSA 1U5DA 1U29A 2P0DA 2GCLA 3IVFA 1ZC4B 5KQ1A 1TJ6A 2VKIA 2COAA 1H4RA 5KQ4A 2QKLA 2OTXA 5HE1A 4A6FB 3N7CA 2EJ8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GYP A;  3BJI A;  4IAP A;  2MWN B;  1QC6 A;  1IRS A;  3TCA A;  2I1J A;  2K2J A;  3A8P A;  4HAY B;  2ZPY A;  3TO1 A;  1MK7 B;  2UVM A;  4GZU A;  1V61 A;  2J59 M;  2DHK A;  2YS3 A;  1EGX A;  2GCJ A;  1GC7 A;  1DRO A;  2VSZ A;  4WSF A;  1EF1 A;  2Z0Q A;  1TQZ A;  1DDW A;  5KCV A;  5D3V A;  4NY0 A;  1K5G B;  1Q67 A;  2YS5 A;  4HAW B;  4Z2M B;  3QIJ A;  2J0K A;  2KGX B;  2Y8G A;  4HB4 B;  1I2H A;  3ODX A;  1DBH A;  2D9W A;  1V89 A;  2V76 A;  4KHA A;  1V88 A;  3QBV B;  3ULC A;  3AU5 A;  1Y5O A;  2ELB A;  5LON B;  1P6S A;  3VIA A;  3SUZ A;  3HW2 B;  1BTK A;  1U5E A;  1I7A A;  1UNQ A;  3D8E A;  5LOP B;  1M7E A;  3PSC A;  2M14 A;  1WG7 A;  4ZRJ A;  2CY4 A;  1DYN A;  3PEG A;  4GXB A;  2YS1 A;  2Z0O A;  3LJU X;  2DTC A;  2VRW B;  1UEF A;  1SHC A;  2YT0 A;  2L1C A;  4XWX A;  2QKM A;  1XD4 A;  2K00 A;  3PG7 A;  3PVL A;  1ZVR A;  3UZT A;  5HE2 A;  2G35 A;  2W2W A;  3M1I B;  3PP2 A;  1N3H A;  2DHJ A;  4Z2N A;  2I5C A;  2DFK A;  4TKN A;  2BCJ A;  1AQC A;  4K17 A;  1NI2 A;  5HE0 A;  1OY2 A;  2COC A;  4KHB B;  2Y8F A;  2AEH A;  3U8Z A;  5J3Q A;  2CAY A;  1XX0 A;  1GC6 A;  2NZ8 B;  3KRX A;  1MIZ B;  5L81 A;  1FHX A;  3T06 A;  4EJN A;  4K2P A;  4HB2 B;  4HDO A;  4Y94 A;  3P7Z A;  2D9X A;  5JP4 A;  1MAI A;  2D9Z A;  2JP2 A;  3FEH A;  4ZRK A;  3WA0 A;  4BBK A;  2Y7B A;  1KZG A;  4YON A;  2D11 A;  3F5R A;  1X86 A;  1W1H A;  1X05 A;  1BAK A;  1V5M A;  3O96 A;  1PLS A;  1WGQ A;  2J0M A;  2MDX A;  2H7E A;  1MKE A;  3DXC A;  4L6E A;  2J0J A;  2YF0 A;  3HQC A;  1SGH A;  3ZDT A;  3D8D A;  1U2B A;  4HAT B;  3SNH A;  5JHG A;  1FOE A;  5GOW B;  1PMS A;  1ZC3 B;  2YVC A;  1FGY A;  2RUK B;  4A6F A;  4DX9 0;  1Z87 A;  1WJM A;  2DLW A;  4HAZ B;  2P0F A;  2NMB A;  2D10 A;  4HAU B;  2Z0P A;  1RRP B;  1KZ7 A;  5JHH A;  1AWE A;  4MK0 A;  2LOZ A;  4HB3 B;  2FJL A;  2EMS A;  3GYO A;  2ROZ B;  1ISN A;  1MPH A;  2R0D A;  2DKP A;  2LKO A;  3BIN A;  4D0N B;  4F7U P;  4K81 A;  4F7H A;  3FM8 C;  2HE7 A;  1FHO A;  4DXA B;  4ZRI A;  2RNR B;  2I5F A;  3TFM A;  1EAZ A;  1EVH A;  1WVH A;  5C79 A;  2KCJ A;  2GJY A;  3P6A A;  1UPQ A;  1UNR A;  2IYB A;  4PQ0 A;  3CXB B;  4GPT B;  1U5G A;  2D9V A;  5D27 A;  4CHJ A;  4CHM A;  2DYQ A;  1J0W A;  2N23 A;  3A8Q A;  2MKR A;  1DDM A;  2LUL A;  3X23 A;  3KZ1 A;  2RVB B;  2YRY A;  1MK9 B;  1PFJ A;  2YT1 A;  3PVW A;  1W1D A;  1WGU A;  3ODW A;  4MT7 A;  5C5B B;  3F0W A;  2E2X A;  2Q13 A;  1J19 A;  1X1G A;  2EC1 A;  1BTN A;  5D3X A;  3VOQ A;  3KSY A;  1M7R A;  1U27 A;  4EMO A;  1MIX A;  5FI0 A;  3SYX A;  5CLL B;  3SO6 A;  1K5D B;  4K2O A;  1XKE A;  4MY6 A;  2ELA A;  1P3R A;  3AJ4 A;  1B55 A;  5DIF B;  1TXD A;  3DXD A;  4EKU A;  1V5P A;  2RLO A;  4WVF B;  2LOX A;  5CLQ B;  4HDQ A;  3RCP A;  4GMV A;  2DYN A;  5DI9 B;  2CRF A;  4GN1 A;  3TVV A;  1OMW A;  2H7D A;  2YSZ A;  4NSW A;  5JLJ B;  4WJ7 A;  2DKQ A;  2PZ1 A;  2R09 A;  2I1K A;  4P7I A;  1LB1 A;  2UZR A;  2IFS A;  2P8V A;  5C16 A;  2W2X D;  2LYD A;  4GMX B;  1BWN A;  2N0Y A;  3ULB A;  3OAN A;  4IFS A;  4A5K A;  3U7D A;  1RJ2 A;  4IOY X;  3HK0 A;  1FGZ A;  1U5F A;  1ZM0 A;  2LG1 A;  4TYZ A;  2DX1 A;  1NTY A;  1DDV A;  2W2X C;  2XQN M;  5C6R A;  1KI1 B;  5DHF B;  3TW1 A;  4HB0 B;  2ADZ A;  3ZVR A;  2L2I A;  1X1F A;  1QQG A;  1P5T A;  2KUP A;  5D3W A;  3PVU A;  2D4Q A;  5EFX A;  4YL8 A;  1UNP A;  2CY5 A;  1FAO A;  1WJ1 A;  1OQN A;  2COF A;  4F7G A;  2AL6 A;  3CIK A;  1FHW A;  2RGN B;  3PZD A;  3MPX A;  3V5W A;  4A6K A;  4KHO A;  2MFQ A;  2P0H A;  2GS0 A;  2COD A;  1W1G A;  1XR0 B;  1GG3 A;  2K2U A;  1NTV A;  3D8F A;  1XOD A;  3A98 B;  5FI1 A;  2M38 A;  3SV1 A;  2ROV A;  2OQB A;  2EMT A;  5DHA B;  4DBB A;  1X11 A;  2DN6 A;  1ZSQ A;  4C0A A;  3MDB C;  2DHI A;  4HAV B;  2D9Y A;  3KRW A;  5DH9 B;  2X18 A;  5D3Y A;  4B6H A;  3FSS A;  1H10 A;  1V5U A;  4DX8 A;  3AU4 A;  2DX5 A;  4PNK A;  1UPR A;  5J3Y A;  5C5B A;  3QWM A;  5HE3 A;  2D2Q A;  3NSU A;  3G9W A;  4CYE A;  2RSG A;  1FB8 A;  3DXE A;  2DA0 A;  1XCG A;  4A6H A;  1E5W A;  3ODO A;  2HTH B;  5J3T A;  4KAX B;  3KY9 A;  1WI1 A;  4HAX B;  3WYF B;  4H8S A;  4KVG B;  3ML4 A;  4HHV A;  1Y19 B;  1NU2 A;  1LW3 A;  2UZS A;  1U5D A;  1U29 A;  2P0D A;  2GCL A;  3IVF A;  1ZC4 B;  5KQ1 A;  1TJ6 A;  2VKI A;  2COA A;  1H4R A;  5KQ4 A;  2QKL A;  2OTX A;  5HE1 A;  4A6F B;  3N7C A;  2EJ8 A; 
#chains in the Genus database with same CATH topology
 3GYP A;  3BJI A;  4IAP A;  2MWN B;  1QC6 A;  1IRS A;  3TCA A;  2I1J A;  2K2J A;  3A8P A;  4HAY B;  4HSI A;  2ZPY A;  3TO1 A;  1MK7 B;  2UVM A;  4GZU A;  1V61 A;  4L1R A;  2J59 M;  2DHK A;  2YS3 A;  1EGX A;  2GCJ A;  1GC7 A;  1DRO A;  2VSZ A;  4WSF A;  1EF1 A;  2Z0Q A;  1TQZ A;  2Z13 A;  1DDW A;  5KCV A;  5D3V A;  4DIX A;  4NY0 A;  1K5G B;  1Q67 A;  2YS5 A;  4HAW B;  4Z2M B;  1T77 A;  3QIJ A;  2J0K A;  2KGX B;  2Y8G A;  4HB4 B;  1I2H A;  3ODX A;  1DBH A;  2D9W A;  1V89 A;  2V76 A;  4KHA A;  1V88 A;  3QBV B;  3ULC A;  3AU5 A;  1Y5O A;  2ELB A;  5LON B;  1P6S A;  3VIA A;  4QJ4 B;  3SUZ A;  3HW2 B;  1BTK A;  1U5E A;  1I7A A;  1UNQ A;  3D8E A;  5LOP B;  1M7E A;  3PSC A;  2M14 A;  1WG7 A;  4ZRJ A;  2CY4 A;  1DYN A;  3PEG A;  4GXB A;  2YS1 A;  2Z0O A;  3A58 A;  3LJU X;  2DTC A;  2VRW B;  1UEF A;  1SHC A;  2YT0 A;  2L1C A;  4XWX A;  2QKM A;  1XD4 A;  2K00 A;  3PG7 A;  3PVL A;  2KUQ A;  1ZVR A;  3UZT A;  5HE2 A;  2G35 A;  2W2W A;  3M1I B;  3PP2 A;  1N3H A;  2DHJ A;  4Z2N A;  2I5C A;  2DFK A;  4TKN A;  2BCJ A;  1AQC A;  4K17 A;  1NI2 A;  5HE0 A;  1OY2 A;  2COC A;  4KHB B;  2Y8F A;  2AEH A;  3U8Z A;  5J3Q A;  2CAY A;  1XX0 A;  1GC6 A;  2NZ8 B;  3KRX A;  1MIZ B;  5L81 A;  1FHX A;  3T06 A;  4EJN A;  4K2P A;  4GOU A;  4HB2 B;  4HDO A;  2NBV A;  4Y94 A;  3NWF A;  3P7Z A;  2D9X A;  5JP4 A;  4QXA B;  1MAI A;  2D9Z A;  4KHB A;  2JP2 A;  3FEH A;  4ZRK A;  3HIE A;  3WA0 A;  4BBK A;  3DCX A;  2Y7B A;  1KZG A;  4YON A;  5I2S A;  2D11 A;  3F5R A;  1X86 A;  1W1H A;  4OT1 A;  1X05 A;  1BAK A;  1V5M A;  3O96 A;  1PLS A;  5IRS A;  1WGQ A;  2J0M A;  2MDX A;  2H7E A;  1MKE A;  3DXC A;  4L6E A;  2J0J A;  2YF0 A;  3HQC A;  1SGH A;  3ZDT A;  3D8D A;  2Z59 A;  1U2B A;  4HAT B;  3NWD A;  3SNH A;  5JHG A;  1FOE A;  5GOW B;  1PMS A;  1ZC3 B;  2YVC A;  1FGY A;  2RUK B;  4A6F A;  4DX9 0;  5LG4 B;  1Z87 A;  1WJM A;  2DLW A;  4HAZ B;  3B77 A;  2P0F A;  2NMB A;  2D10 A;  4HAU B;  2Z0P A;  1RRP B;  1KZ7 A;  5JHH A;  1AWE A;  4MK0 A;  2LOZ A;  4HB3 B;  2FJL A;  2EMS A;  3GYO A;  2ROZ B;  1ISN A;  1MPH A;  2R0D A;  2DKP A;  2LKO A;  3BIN A;  4D0N B;  4GNK B;  4K81 A;  4F7U P;  4F7H A;  3FM8 C;  2KIE A;  2HE7 A;  1FHO A;  4DXA B;  4ZRI A;  2RNR B;  2I5F A;  3TFM A;  1EAZ A;  1EVH A;  2FJU B;  2ZKM X;  1WVH A;  5C79 A;  2KCJ A;  2GJY A;  2RRF A;  1UPQ A;  3FVC A;  3P6A A;  1UNR A;  2IYB A;  4PQ0 A;  3CXB B;  4GPT B;  1U5G A;  2D9V A;  5D27 A;  4CHJ A;  4CHM A;  2DYQ A;  1J0W A;  2N23 A;  3A8Q A;  2MKR A;  1DDM A;  2LUL A;  3X23 A;  3KZ1 A;  2RVB B;  2YRY A;  1MK9 B;  1PFJ A;  2YT1 A;  3PVW A;  1W1D A;  1WGU A;  3ODW A;  4MT7 A;  5C5B B;  3F0W A;  2E2X A;  2Q13 A;  3U12 A;  1J19 A;  1X1G A;  2EC1 A;  1BTN A;  5D3X A;  3VOQ A;  3KSY A;  1M7R A;  1U27 A;  4EMO A;  1MIX A;  5FI0 A;  3SYX A;  5CLL B;  3SO6 A;  1K5D B;  4K2O A;  1XKE A;  4MY6 A;  2ELA A;  1P3R A;  3AJ4 A;  1B55 A;  1MI1 A;  5DIF B;  1TXD A;  3HSA A;  3DXD A;  4EKU A;  1V5P A;  2RLO A;  4WVF B;  2LOX A;  5CLQ B;  4HDQ A;  3RCP A;  4GMV A;  2DYN A;  5DI9 B;  2CRF A;  2YT2 A;  4GN1 A;  3TVV A;  1OMW A;  2H7D A;  4QJ5 B;  2YSZ A;  4NSW A;  5JLJ B;  4WJ7 A;  2DKQ A;  2PZ1 A;  2R09 A;  2Z14 A;  2I1K A;  4P7I A;  1LB1 A;  2UZR A;  2IFS A;  2P8V A;  5C16 A;  5M4Y B;  2W2X D;  2LYD A;  4GMX B;  1BWN A;  2N0Y A;  3ULB A;  3OAN A;  4IFS A;  4A5K A;  3U7D A;  1RJ2 A;  2KR0 A;  4IOY X;  3HK0 A;  4QJ3 B;  1FGZ A;  1U5F A;  1ZM0 A;  2LG1 A;  4TYZ A;  2DX1 A;  1NTY A;  1DDV A;  2GUM A;  2W2X C;  2XQN M;  5C6R A;  1KI1 B;  5DHF B;  4D6W A;  3TW1 A;  4HB0 B;  2ADZ A;  3ZVR A;  2L2I A;  1X1F A;  2K49 A;  1QQG A;  1P5T A;  2KUP A;  2Z4D A;  5D3W A;  3PVU A;  2D4Q A;  5EFX A;  4YL8 A;  1UNP A;  2CY5 A;  1FAO A;  1WJ1 A;  1OQN A;  2COF A;  3NW8 A;  3OHM B;  4F7G A;  2AL6 A;  3CIK A;  1FHW A;  2RGN B;  3PZD A;  3MPX A;  3V5W A;  4A6K A;  4KHO A;  2MFQ A;  2P0H A;  2GS0 A;  2COD A;  1W1G A;  1XR0 B;  1GG3 A;  2K2U A;  1NTV A;  1ZYI A;  3D8F A;  1XOD A;  3A98 B;  2KIG A;  5FI1 A;  2M38 A;  3SV1 A;  2ROV A;  2OQB A;  2EMT A;  5DHA B;  4DBB A;  1X11 A;  2DN6 A;  1ZSQ A;  4C0A A;  3MDB C;  2DHI A;  4HAV B;  2D9Y A;  3KRW A;  5DH9 B;  2X18 A;  5D3Y A;  4B6H A;  3FSS A;  4OSN A;  1H10 A;  1V5U A;  4DX8 A;  3AU4 A;  2DX5 A;  4PNK A;  1UPR A;  5J3Y A;  5C5B A;  3QWM A;  5HE3 A;  2D2Q A;  3NSU A;  3G9W A;  4CYE A;  2RSG A;  3DXE A;  1FB8 A;  2DA0 A;  1XCG A;  4A6H A;  1E5W A;  3ODO A;  2HTH B;  5J3T A;  4KAX B;  4CSQ A;  3KY9 A;  1WI1 A;  4HAX B;  3WYF B;  4H8S A;  2K8E A;  4KVG B;  3NWA A;  3ML4 A;  4HHV A;  1Y19 B;  1NU2 A;  1LW3 A;  2R2Y A;  2UZS A;  1U5D A;  1U29 A;  2P0D A;  2GCL A;  3IVF A;  1ZC4 B;  5KQ1 A;  1TJ6 A;  5I2M A;  2VKI A;  2COA A;  1H4R A;  5KQ4 A;  2QKL A;  2OTX A;  5HE1 A;  4A6F B;  3N7C A;  2EJ8 A; 
#chains in the Genus database with same CATH homology
 3GYP A;  3BJI A;  4IAP A;  2MWN B;  1QC6 A;  1IRS A;  3TCA A;  2I1J A;  2K2J A;  3A8P A;  4HAY B;  2ZPY A;  3TO1 A;  1MK7 B;  2UVM A;  4GZU A;  1V61 A;  2J59 M;  2DHK A;  2YS3 A;  1EGX A;  2GCJ A;  1GC7 A;  1DRO A;  2VSZ A;  4WSF A;  1EF1 A;  2Z0Q A;  1TQZ A;  1DDW A;  5KCV A;  5D3V A;  4NY0 A;  1K5G B;  1Q67 A;  2YS5 A;  4HAW B;  4Z2M B;  3QIJ A;  2J0K A;  2KGX B;  2Y8G A;  4HB4 B;  1I2H A;  3ODX A;  1DBH A;  2D9W A;  1V89 A;  2V76 A;  4KHA A;  1V88 A;  3QBV B;  3ULC A;  3AU5 A;  1Y5O A;  2ELB A;  5LON B;  1P6S A;  3VIA A;  3SUZ A;  3HW2 B;  1BTK A;  1U5E A;  1I7A A;  1UNQ A;  3D8E A;  5LOP B;  1M7E A;  3PSC A;  2M14 A;  1WG7 A;  4ZRJ A;  2CY4 A;  1DYN A;  3PEG A;  4GXB A;  2YS1 A;  2Z0O A;  3LJU X;  2DTC A;  2VRW B;  1UEF A;  1SHC A;  2YT0 A;  2L1C A;  4XWX A;  2QKM A;  1XD4 A;  2K00 A;  3PG7 A;  3PVL A;  1ZVR A;  3UZT A;  5HE2 A;  2G35 A;  2W2W A;  3M1I B;  3PP2 A;  1N3H A;  2DHJ A;  4Z2N A;  2I5C A;  2DFK A;  4TKN A;  2BCJ A;  1AQC A;  4K17 A;  1NI2 A;  5HE0 A;  1OY2 A;  2COC A;  4KHB B;  2Y8F A;  2AEH A;  3U8Z A;  5J3Q A;  2CAY A;  1XX0 A;  1GC6 A;  2NZ8 B;  3KRX A;  1MIZ B;  5L81 A;  1FHX A;  3T06 A;  4EJN A;  4K2P A;  4HB2 B;  4HDO A;  4Y94 A;  3P7Z A;  2D9X A;  5JP4 A;  1MAI A;  2D9Z A;  2JP2 A;  3FEH A;  4ZRK A;  3WA0 A;  4BBK A;  2Y7B A;  1KZG A;  4YON A;  2D11 A;  3F5R A;  1X86 A;  1W1H A;  1X05 A;  1BAK A;  1V5M A;  3O96 A;  1PLS A;  1WGQ A;  2J0M A;  2MDX A;  2H7E A;  1MKE A;  3DXC A;  4L6E A;  2J0J A;  2YF0 A;  3HQC A;  1SGH A;  3ZDT A;  3D8D A;  1U2B A;  4HAT B;  3SNH A;  5JHG A;  1FOE A;  5GOW B;  1PMS A;  1ZC3 B;  2YVC A;  1FGY A;  2RUK B;  4A6F A;  4DX9 0;  1Z87 A;  1WJM A;  2DLW A;  4HAZ B;  2P0F A;  2NMB A;  2D10 A;  4HAU B;  2Z0P A;  1RRP B;  1KZ7 A;  5JHH A;  1AWE A;  4MK0 A;  2LOZ A;  4HB3 B;  2FJL A;  2EMS A;  3GYO A;  2ROZ B;  1ISN A;  1MPH A;  2R0D A;  2DKP A;  2LKO A;  3BIN A;  4D0N B;  4F7U P;  4K81 A;  4F7H A;  3FM8 C;  2HE7 A;  1FHO A;  4DXA B;  4ZRI A;  2RNR B;  2I5F A;  3TFM A;  1EAZ A;  1EVH A;  1WVH A;  5C79 A;  2KCJ A;  2GJY A;  3P6A A;  1UPQ A;  1UNR A;  2IYB A;  4PQ0 A;  3CXB B;  4GPT B;  1U5G A;  2D9V A;  5D27 A;  4CHJ A;  4CHM A;  2DYQ A;  1J0W A;  2N23 A;  3A8Q A;  2MKR A;  1DDM A;  2LUL A;  3X23 A;  3KZ1 A;  2RVB B;  2YRY A;  1MK9 B;  1PFJ A;  2YT1 A;  3PVW A;  1W1D A;  1WGU A;  3ODW A;  4MT7 A;  5C5B B;  3F0W A;  2E2X A;  2Q13 A;  1J19 A;  1X1G A;  2EC1 A;  1BTN A;  5D3X A;  3VOQ A;  3KSY A;  1M7R A;  1U27 A;  4EMO A;  1MIX A;  5FI0 A;  3SYX A;  5CLL B;  3SO6 A;  1K5D B;  4K2O A;  1XKE A;  4MY6 A;  2ELA A;  1P3R A;  3AJ4 A;  1B55 A;  5DIF B;  1TXD A;  3DXD A;  4EKU A;  1V5P A;  2RLO A;  4WVF B;  2LOX A;  5CLQ B;  4HDQ A;  3RCP A;  4GMV A;  2DYN A;  5DI9 B;  2CRF A;  4GN1 A;  3TVV A;  1OMW A;  2H7D A;  2YSZ A;  4NSW A;  5JLJ B;  4WJ7 A;  2DKQ A;  2PZ1 A;  2R09 A;  2I1K A;  4P7I A;  1LB1 A;  2UZR A;  2IFS A;  2P8V A;  5C16 A;  2W2X D;  2LYD A;  4GMX B;  1BWN A;  2N0Y A;  3ULB A;  3OAN A;  4IFS A;  4A5K A;  3U7D A;  1RJ2 A;  4IOY X;  3HK0 A;  1FGZ A;  1U5F A;  1ZM0 A;  2LG1 A;  4TYZ A;  2DX1 A;  1NTY A;  1DDV A;  2W2X C;  2XQN M;  5C6R A;  1KI1 B;  5DHF B;  3TW1 A;  4HB0 B;  2ADZ A;  3ZVR A;  2L2I A;  1X1F A;  1QQG A;  1P5T A;  2KUP A;  5D3W A;  3PVU A;  2D4Q A;  5EFX A;  4YL8 A;  1UNP A;  2CY5 A;  1FAO A;  1WJ1 A;  1OQN A;  2COF A;  4F7G A;  2AL6 A;  3CIK A;  1FHW A;  2RGN B;  3PZD A;  3MPX A;  3V5W A;  4A6K A;  4KHO A;  2MFQ A;  2P0H A;  2GS0 A;  2COD A;  1W1G A;  1XR0 B;  1GG3 A;  2K2U A;  1NTV A;  3D8F A;  1XOD A;  3A98 B;  5FI1 A;  2M38 A;  3SV1 A;  2ROV A;  2OQB A;  2EMT A;  5DHA B;  4DBB A;  1X11 A;  2DN6 A;  1ZSQ A;  4C0A A;  3MDB C;  2DHI A;  4HAV B;  2D9Y A;  3KRW A;  5DH9 B;  2X18 A;  5D3Y A;  4B6H A;  3FSS A;  1H10 A;  1V5U A;  4DX8 A;  3AU4 A;  2DX5 A;  4PNK A;  1UPR A;  5J3Y A;  5C5B A;  3QWM A;  5HE3 A;  2D2Q A;  3NSU A;  3G9W A;  4CYE A;  2RSG A;  1FB8 A;  3DXE A;  2DA0 A;  1XCG A;  4A6H A;  1E5W A;  3ODO A;  2HTH B;  5J3T A;  4KAX B;  3KY9 A;  1WI1 A;  4HAX B;  3WYF B;  4H8S A;  4KVG B;  3ML4 A;  4HHV A;  1Y19 B;  1NU2 A;  1LW3 A;  2UZS A;  1U5D A;  1U29 A;  2P0D A;  2GCL A;  3IVF A;  1ZC4 B;  5KQ1 A;  1TJ6 A;  2VKI A;  2COA A;  1H4R A;  5KQ4 A;  2QKL A;  2OTX A;  5HE1 A;  4A6F B;  3N7C A;  2EJ8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...