1I7AA

Evh1 domain from murine homer 2b/vesl 2
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
109
structure length
103
Chain Sequence
EQPIFTTRAHVFQINWVPASKQAVTVSYFYDVTRNSYRIISVDGAKVIINSTITPNMTFTKTSQKFGQWADSRANTVFGLGFSSELQLTKFAEKFQEVREAAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HOMER 2B
publication title The N-terminal domain of Homer/Vesl is a new class II EVH1 domain.
pubmed doi rcsb
source organism Mus musculus
molecule tags Signaling protein
total genus 20
structure length 103
sequence length 109
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2001-03-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00568 WH1 WH1 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1i7aA00
2DN6A 2YS3A 4YONA 2CRFA 5HE0A 1FHWA 1WI1A 1QC6A 2VKIA 4HB3B 1RRPB 1K5DB 2D10A 2N23A 2GJYA 1P3RA 5D3WA 1DBHA 4HAYB 4WSFA 1NTVA 2YT1A 3VIAA 2CY4A 1V88A 3DXCA 2DX1A 4L6EA 3ODOA 5J3YA 3KZ1A 3ODXA 2GS0A 4EKUA 3TO1A 5JHHA 1ZSQA 4A6FB 1WGUA 3GYPA 4CYEA 2DFKA 2ELBA 1V5UA 2ELAA 1DROA 4P7IA 2AL6A 1SHCA 1EVHA 1DDVA 1MPHA 2M38A 4GPTB 4A6KA 2I1KA 1B55A 3QBVB 2HTHB 4EJNA 2PZ1A 2J0JA 3RCPA 5FI0A 2MWNB 3TW1A 1RJ2A 3SNHA 2K2UA 1U5GA 2H7EA 3KSYA 1UPQA 3AJ4A 4HHVA 3QWMA 2D9VA 2YS1A 4HB2B 2D9WA 2IYBA 1Z87A 1FGZA 3FEHA 3P7ZA 5FI1A 3V5WA 2KUPA 2D11A 2Y7BA 1XR0B 2D9XA 1X86A 3N7CA 5CLLB 5DH9B 1KI1B 5C79A 1OMWA 3A8PA 1EF1A 1GG3A 1U27A 3CXBB 3PEGA 5HE2A 3ZDTA 2W2XD 1TJ6A 2DYNA 2YS5A 2IFSA 1UPRA 3ODWA 4ZRKA 2RUKB 3U8ZA 4KVGB 1K5GB 2RSGA 1FB8A 1QQGA 2Z0OA 1UNPA 1V61A 4CHMA 2YF0A 4KAXB 3KRXA 3CIKA 4IOYX 3M1IB 2E2XA 4YL8A 1X05A 2R0DA 2COAA 4HAUB 3PSCA 4DXAB 3VOQA 4B6HA 1FOEA 1ISNA 4HB0B 2W2WA 3MPXA 4C0AA 3ULCA 4WVFB 1N3HA 1GC6A 1EAZA 2ZPYA 1P5TA 1DYNA 2GCLA 2MDXA 1E5WA 2D2QA 3T06A 3SO6A 2DA0A 2Y8GA 1X1FA 3D8DA 4A5KA 4HAXB 2G35A 1BTKA 1NU2A 2DTCA 4HDQA 4K2OA 2R09A 5KQ4A 2YVCA 2YRYA 4KHAA 4HAZB 4F7GA 2P0FA 2I5CA 4XWXA 1ZC3B 1WVHA 3WYFB 2RGNB 1DDWA 1MK7B 3P6AA 3PG7A 5LOPB 5EFXA 4MT7A 2UVMA 4Z2MB 3PVWA 5JP4A 1GC7A 3SV1A 4F7UP 2ROVA 5HE3A 1J0WA 5GOWB 1UNRA 3PVLA 3G9WA 1ZC4B 1U5FA 3TVVA 3AU5A 1U29A 2QKMA 5DHFB 3KRWA 1W1DA 3F5RA 2D9ZA 5D3VA 3HQCA 4H8SA 3BJIA 3ULBA 2EC1A 1LW3A 1EGXA 4CHJA 2OTXA 1IRSA 3F0WA 1KZGA 2HE7A 1WJ1A 1OY2A 1KZ7A 4TYZA 1BWNA 2LYDA 2BCJA 1M7RA 1LB1A 2COFA 3HW2B 2UZRA 2M14A 2Z0PA 2DLWA 2LG1A 2NZ8B 2LOZA 1MAIA 4HAVB 5J3TA 3MDBC 2P0DA 3U7DA 2KGXB 4ZRJA 4TKNA 3ML4A 5D27A 2K2JA 2DHKA 1XD4A 1Q67A 3TFMA 5J3QA 1V89A 4DBBA 2DX5A 1PLSA 2RNRB 4Y94A 1DDMA 1NI2A 2J0KA 1AQCA 4HDOA 2JP2A 1V5PA 1AWEA 4WJ7A 1SGHA 4MY6A 2EJ8A 5JLJB 4Z2NA 3FSSA 4ZRIA 1Y19B 2K00A 3O96A 5L81A 2GCJA 2DKPA 2XQNM 2Q13A 2NMBA 1X1GA 2VSZA 3PZDA 1XKEA 3SYXA 5DHAB 5LONB 3BINA 4BBKA 4F7HA 4HB4B 1X11A 3ZVRA 1BAKA 4D0NB 2CAYA 4K17A 2ROZB 4DX8A 3DXDA 4EMOA 1NTYA 1WGQA 1UNQA 4HATB 2Z0QA 1MK9B 2VRWB 5D3YA 1H4RA 1I2HA 1BTNA 4NSWA 1P6SA 1V5MA 1W1HA 3HK0A 5JHGA 4GMVA 2V76A 2DHJA 4PQ0A 3FM8C 3OANA 1I7AA 2ADZA 3AU4A 1XCGA 4HAWB 3QIJA 1UEFA 2UZSA 4NY0A 3UZTA 2DHIA 2RLOA 3A8QA 2P0HA 2YT0A 2COCA 4GMXB 1J19A 2X18A 2N0YA 1MIXA 2EMTA 3KY9A 3PP2A 4GN1A 3GYOA 2DKQA 1FAOA 5C6RA 3D8FA 5C5BA 1H10A 1M7EA 2J59M 2L2IA 4KHOA 1PMSA 2MKRA 1FGYA 2LULA 3SUZA 4K2PA 3TCAA 2I5FA 1WJMA 1FHXA 1TXDA 1MIZB 1U5DA 3X23A 3PVUA 3LJUX 2OQBA 2EMSA 4IAPA 5DIFB 4PNKA 1FHOA 3IVFA 2YSZA 2W2XC 1Y5OA 2CODA 2LOXA 3WA0A 2D4QA 2CY5A 5C5BB 5KQ1A 1WG7A 2Y8FA 2AEHA 1ZM0A 4K81A 3DXEA 3A98B 3D8EA 5CLQB 1U5EA 4MK0A 5C16A 1PFJA 2LKOA 2I1JA 1ZVRA 4KHBB 1XODA 1OQNA 2L1CA 5KCVA 5DI9B 4GZUA 1MKEA 2MFQA 5HE1A 4DX90 2DYQA 2J0MA 1U2BA 1W1GA 2FJLA 2D9YA 2H7DA 4IFSA 2KCJA 2RVBB 1XX0A 1TQZA 2P8VA 4A6HA 5D3XA 2QKLA 4GXBA 4A6FA 3NSUA
chains in the Genus database with same CATH superfamily
2DN6A 2YS3A 4YONA 2CRFA 5HE0A 1FHWA 1WI1A 1QC6A 2VKIA 4HB3B 1RRPB 1K5DB 2D10A 2N23A 2GJYA 1P3RA 5D3WA 1DBHA 2K8EA 2KIGA 4HAYB 4WSFA 1NTVA 2YT1A 3VIAA 2CY4A 1V88A 2Z13A 2DX1A 3DXCA 4L6EA 3ODOA 5J3YA 3KZ1A 3ODXA 2GS0A 4EKUA 3TO1A 5JHHA 1ZSQA 4A6FB 1WGUA 3GYPA 4CYEA 3NSUA 2DFKA 2ELBA 1V5UA 2ELAA 1DROA 4P7IA 2AL6A 1SHCA 1EVHA 1DDVA 2Z14A 2KUQA 1MPHA 2M38A 4GPTB 4A6KA 2I1KA 1B55A 3QBVB 2HTHB 4EJNA 2PZ1A 2J0JA 3RCPA 5FI0A 2MWNB 3TW1A 1RJ2A 3SNHA 2K2UA 1U5GA 2H7EA 3KSYA 1UPQA 3AJ4A 4HHVA 3QWMA 2D9VA 2YS1A 4HB2B 2D9WA 2IYBA 4CSQA 1Z87A 1FGZA 3FEHA 3P7ZA 5FI1A 2RRFA 3V5WA 3NWDA 2KUPA 2D11A 2Y7BA 1XR0B 2D9XA 2KR0A 1X86A 3N7CA 5CLLB 5DH9B 1KI1B 5C79A 1OMWA 3A8PA 1EF1A 1GG3A 1U27A 3CXBB 3PEGA 5HE2A 3ZDTA 2W2XD 1TJ6A 2DYNA 2YS5A 2IFSA 1UPRA 3ODWA 4ZRKA 2RUKB 3U8ZA 4KVGB 1K5GB 2RSGA 1FB8A 1QQGA 2Z0OA 1UNPA 1V61A 4OT1A 4CHMA 2YF0A 4KAXB 2R2YA 3KRXA 3CIKA 4IOYX 3M1IB 2E2XA 4YL8A 1X05A 2R0DA 2COAA 4HAUB 3PSCA 4DXAB 3NWFA 3VOQA 4B6HA 1FOEA 1ISNA 4HB0B 4HSIA 4QXAB 2W2WA 3MPXA 4C0AA 3ULCA 4WVFB 1N3HA 1GC6A 1EAZA 2ZPYA 1P5TA 1DYNA 2GCLA 2MDXA 1E5WA 2D2QA 3T06A 3SO6A 2DA0A 2Y8GA 1X1FA 3D8DA 4A5KA 4HAXB 2G35A 4GNKB 4OSNA 3U12A 1BTKA 1NU2A 2DTCA 4HDQA 4K2OA 5M4YB 2R09A 5KQ4A 2YVCA 2YRYA 4KHAA 4HAZB 2KIEA 4F7GA 2P0FA 2I5CA 2K49A 4XWXA 1ZC3B 1WVHA 3WYFB 2RGNB 1DDWA 1MK7B 3P6AA 3DCXA 3PG7A 4QJ3B 5LOPB 5EFXA 4MT7A 2UVMA 4Z2MB 3HIEA 3PVWA 5JP4A 1GC7A 3SV1A 4F7UP 2ROVA 5HE3A 1J0WA 5GOWB 1UNRA 4GOUA 3PVLA 3G9WA 1ZC4B 1U5FA 3TVVA 3B77A 3AU5A 1U29A 2QKMA 3FVCA 5DHFB 3KRWA 1W1DA 3F5RA 2D9ZA 3NWAA 5D3VA 3HQCA 4H8SA 3BJIA 3ULBA 2EC1A 1LW3A 1EGXA 4CHJA 2OTXA 1IRSA 3A58A 3F0WA 1KZGA 2HE7A 1WJ1A 1OY2A 1KZ7A 4TYZA 1BWNA 2LYDA 5I2MA 4KHBA 2BCJA 1M7RA 1LB1A 2COFA 2ZKMX 2UZRA 2M14A 2Z0PA 3HW2B 2DLWA 2LG1A 2NZ8B 2LOZA 1MAIA 4HAVB 5J3TA 3MDBC 2P0DA 2YT2A 3U7DA 2KGXB 4ZRJA 4TKNA 3ML4A 5D27A 2K2JA 2DHKA 1XD4A 4QJ5B 1Q67A 3OHMB 3TFMA 5J3QA 1V89A 4DBBA 2DX5A 1PLSA 2RNRB 4Y94A 1DDMA 1NI2A 2J0KA 1AQCA 4HDOA 2JP2A 1V5PA 1AWEA 4WJ7A 1SGHA 4MY6A 2EJ8A 5JLJB 4Z2NA 3FSSA 4ZRIA 1Y19B 2K00A 3O96A 5L81A 2GCJA 2DKPA 2XQNM 2Q13A 2NMBA 1X1GA 2VSZA 3PZDA 1XKEA 3SYXA 5DHAB 5LONB 3BINA 4BBKA 3HSAA 4F7HA 4HB4B 1X11A 3ZVRA 1BAKA 4D0NB 2CAYA 4K17A 2ROZB 4DX8A 3DXDA 4EMOA 1NTYA 1WGQA 2Z4DA 1UNQA 4HATB 2Z0QA 1MK9B 2VRWB 5D3YA 1H4RA 1I2HA 1BTNA 2NBVA 5LG4B 4NSWA 1P6SA 1V5MA 1W1HA 3HK0A 5JHGA 4GMVA 2V76A 2DHJA 4PQ0A 3FM8C 3OANA 1I7AA 2ADZA 3AU4A 1XCGA 4HAWB 1ZYIA 3QIJA 1UEFA 2UZSA 4NY0A 3UZTA 2DHIA 2RLOA 3A8QA 2P0HA 2YT0A 2COCA 4GMXB 1J19A 2X18A 2N0YA 1MIXA 2EMTA 3KY9A 3PP2A 4GN1A 3GYOA 2DKQA 1FAOA 5C6RA 3D8FA 5C5BA 1H10A 1M7EA 2J59M 2L2IA 4KHOA 1PMSA 2MKRA 1FGYA 2LULA 3SUZA 4K2PA 5I2SA 3TCAA 2I5FA 4DIXA 1WJMA 1TXDA 1FHXA 1T77A 1MIZB 1U5DA 3X23A 3PVUA 3LJUX 2OQBA 2EMSA 4IAPA 5DIFB 4PNKA 1FHOA 2Z59A 3IVFA 2YSZA 2W2XC 1Y5OA 2CODA 2LOXA 3WA0A 2D4QA 2CY5A 2GUMA 5C5BB 5KQ1A 1WG7A 2Y8FA 2AEHA 1ZM0A 4K81A 3DXEA 4L1RA 3A98B 3D8EA 5CLQB 1U5EA 4MK0A 4D6WA 5C16A 1PFJA 2LKOA 2FJUB 2I1JA 1ZVRA 4KHBB 1XODA 1OQNA 2L1CA 5KCVA 5DI9B 4GZUA 1MKEA 2MFQA 5HE1A 4DX90 2DYQA 2J0MA 1U2BA 1W1GA 2FJLA 2D9YA 3NW8A 4QJ4B 2H7DA 4IFSA 2KCJA 2RVBB 1XX0A 1TQZA 2P8VA 4A6HA 5D3XA 2QKLA 4GXBA 4A6FA 5IRSA 1MI1A
chains in the Genus database with same CATH topology
2DN6A 2YS3A 4YONA 2CRFA 5HE0A 1FHWA 1WI1A 1QC6A 2VKIA 4HB3B 1RRPB 1K5DB 2D10A 2N23A 2GJYA 1P3RA 5D3WA 1DBHA 4HAYB 4WSFA 1NTVA 2YT1A 3VIAA 2CY4A 1V88A 3DXCA 2DX1A 4L6EA 3ODOA 5J3YA 3KZ1A 3ODXA 2GS0A 4EKUA 3TO1A 5JHHA 1ZSQA 4A6FB 1WGUA 3GYPA 4CYEA 2DFKA 2ELBA 1V5UA 2ELAA 1DROA 4P7IA 2AL6A 1SHCA 1EVHA 1DDVA 1MPHA 2M38A 4GPTB 4A6KA 2I1KA 1B55A 3QBVB 2HTHB 4EJNA 2PZ1A 2J0JA 3RCPA 5FI0A 2MWNB 3TW1A 1RJ2A 3SNHA 2K2UA 1U5GA 2H7EA 3KSYA 1UPQA 3AJ4A 4HHVA 3QWMA 2D9VA 2YS1A 4HB2B 2D9WA 2IYBA 1Z87A 1FGZA 3FEHA 3P7ZA 5FI1A 3V5WA 2KUPA 2D11A 2Y7BA 1XR0B 2D9XA 1X86A 3N7CA 5CLLB 5DH9B 1KI1B 5C79A 1OMWA 3A8PA 1EF1A 1GG3A 1U27A 3CXBB 3PEGA 5HE2A 3ZDTA 2W2XD 1TJ6A 2DYNA 2YS5A 2IFSA 1UPRA 3ODWA 4ZRKA 2RUKB 3U8ZA 4KVGB 1K5GB 2RSGA 1FB8A 1QQGA 2Z0OA 1UNPA 1V61A 4CHMA 2YF0A 4KAXB 3KRXA 3CIKA 4IOYX 3M1IB 2E2XA 4YL8A 1X05A 2R0DA 2COAA 4HAUB 3PSCA 4DXAB 3VOQA 4B6HA 1FOEA 1ISNA 4HB0B 2W2WA 3MPXA 4C0AA 3ULCA 4WVFB 1N3HA 1GC6A 1EAZA 2ZPYA 1P5TA 1DYNA 2GCLA 2MDXA 1E5WA 2D2QA 3T06A 3SO6A 2DA0A 2Y8GA 1X1FA 3D8DA 4A5KA 4HAXB 2G35A 1BTKA 1NU2A 2DTCA 4HDQA 4K2OA 2R09A 5KQ4A 2YVCA 2YRYA 4KHAA 4HAZB 4F7GA 2P0FA 2I5CA 4XWXA 1ZC3B 1WVHA 3WYFB 2RGNB 1DDWA 1MK7B 3P6AA 3PG7A 5LOPB 5EFXA 4MT7A 2UVMA 4Z2MB 3PVWA 5JP4A 1GC7A 3SV1A 4F7UP 2ROVA 5HE3A 1J0WA 5GOWB 1UNRA 3PVLA 3G9WA 1ZC4B 1U5FA 3TVVA 3AU5A 1U29A 2QKMA 5DHFB 3KRWA 1W1DA 3F5RA 2D9ZA 5D3VA 3HQCA 4H8SA 3BJIA 3ULBA 2EC1A 1LW3A 1EGXA 4CHJA 2OTXA 1IRSA 3F0WA 1KZGA 2HE7A 1WJ1A 1OY2A 1KZ7A 4TYZA 1BWNA 2LYDA 2BCJA 1M7RA 1LB1A 2COFA 3HW2B 2UZRA 2M14A 2Z0PA 2DLWA 2LG1A 2NZ8B 2LOZA 1MAIA 4HAVB 5J3TA 3MDBC 2P0DA 3U7DA 2KGXB 4ZRJA 4TKNA 3ML4A 5D27A 2K2JA 2DHKA 1XD4A 1Q67A 3TFMA 5J3QA 1V89A 4DBBA 2DX5A 1PLSA 2RNRB 4Y94A 1DDMA 1NI2A 2J0KA 1AQCA 4HDOA 2JP2A 1V5PA 1AWEA 4WJ7A 1SGHA 4MY6A 2EJ8A 5JLJB 4Z2NA 3FSSA 4ZRIA 1Y19B 2K00A 3O96A 5L81A 2GCJA 2DKPA 2XQNM 2Q13A 2NMBA 1X1GA 2VSZA 3PZDA 1XKEA 3SYXA 5DHAB 5LONB 3BINA 4BBKA 4F7HA 4HB4B 1X11A 3ZVRA 1BAKA 4D0NB 2CAYA 4K17A 2ROZB 4DX8A 3DXDA 4EMOA 1NTYA 1WGQA 1UNQA 4HATB 2Z0QA 1MK9B 2VRWB 5D3YA 1H4RA 1I2HA 1BTNA 4NSWA 1P6SA 1V5MA 1W1HA 3HK0A 5JHGA 4GMVA 2V76A 2DHJA 4PQ0A 3FM8C 3OANA 1I7AA 2ADZA 3AU4A 1XCGA 4HAWB 3QIJA 1UEFA 2UZSA 4NY0A 3UZTA 2DHIA 2RLOA 3A8QA 2P0HA 2YT0A 2COCA 4GMXB 1J19A 2X18A 2N0YA 1MIXA 2EMTA 3KY9A 3PP2A 4GN1A 3GYOA 2DKQA 1FAOA 5C6RA 3D8FA 5C5BA 1H10A 1M7EA 2J59M 2L2IA 4KHOA 1PMSA 2MKRA 1FGYA 2LULA 3SUZA 4K2PA 3TCAA 2I5FA 1WJMA 1FHXA 1TXDA 1MIZB 1U5DA 3X23A 3PVUA 3LJUX 2OQBA 2EMSA 4IAPA 5DIFB 4PNKA 1FHOA 3IVFA 2YSZA 2W2XC 1Y5OA 2CODA 2LOXA 3WA0A 2D4QA 2CY5A 5C5BB 5KQ1A 1WG7A 2Y8FA 2AEHA 1ZM0A 4K81A 3DXEA 3A98B 3D8EA 5CLQB 1U5EA 4MK0A 5C16A 1PFJA 2LKOA 2I1JA 1ZVRA 4KHBB 1XODA 1OQNA 2L1CA 5KCVA 5DI9B 4GZUA 1MKEA 2MFQA 5HE1A 4DX90 2DYQA 2J0MA 1U2BA 1W1GA 2FJLA 2D9YA 2H7DA 4IFSA 2KCJA 2RVBB 1XX0A 1TQZA 2P8VA 4A6HA 5D3XA 2QKLA 4GXBA 4A6FA 3NSUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DN6 A;  2YS3 A;  4YON A;  2CRF A;  5HE0 A;  1FHW A;  1WI1 A;  1QC6 A;  2VKI A;  4HB3 B;  1RRP B;  1K5D B;  2D10 A;  2N23 A;  2GJY A;  1P3R A;  5D3W A;  1DBH A;  4HAY B;  4WSF A;  1NTV A;  2YT1 A;  3VIA A;  2CY4 A;  1V88 A;  3DXC A;  2DX1 A;  4L6E A;  3ODO A;  5J3Y A;  3KZ1 A;  3ODX A;  2GS0 A;  4EKU A;  3TO1 A;  5JHH A;  1ZSQ A;  4A6F B;  1WGU A;  3GYP A;  4CYE A;  2DFK A;  2ELB A;  1V5U A;  2ELA A;  1DRO A;  4P7I A;  2AL6 A;  1SHC A;  1EVH A;  1DDV A;  1MPH A;  2M38 A;  4GPT B;  4A6K A;  2I1K A;  1B55 A;  3QBV B;  2HTH B;  4EJN A;  2PZ1 A;  2J0J A;  3RCP A;  5FI0 A;  2MWN B;  3TW1 A;  1RJ2 A;  3SNH A;  2K2U A;  1U5G A;  2H7E A;  3KSY A;  1UPQ A;  3AJ4 A;  4HHV A;  3QWM A;  2D9V A;  2YS1 A;  4HB2 B;  2D9W A;  2IYB A;  1Z87 A;  1FGZ A;  3FEH A;  3P7Z A;  5FI1 A;  3V5W A;  2KUP A;  2D11 A;  2Y7B A;  1XR0 B;  2D9X A;  1X86 A;  3N7C A;  5CLL B;  5DH9 B;  1KI1 B;  5C79 A;  1OMW A;  3A8P A;  1EF1 A;  1GG3 A;  1U27 A;  3CXB B;  3PEG A;  5HE2 A;  3ZDT A;  2W2X D;  1TJ6 A;  2DYN A;  2YS5 A;  2IFS A;  1UPR A;  3ODW A;  4ZRK A;  2RUK B;  3U8Z A;  4KVG B;  1K5G B;  2RSG A;  1FB8 A;  1QQG A;  2Z0O A;  1UNP A;  1V61 A;  4CHM A;  2YF0 A;  4KAX B;  3KRX A;  3CIK A;  4IOY X;  3M1I B;  2E2X A;  4YL8 A;  1X05 A;  2R0D A;  2COA A;  4HAU B;  3PSC A;  4DXA B;  3VOQ A;  4B6H A;  1FOE A;  1ISN A;  4HB0 B;  2W2W A;  3MPX A;  4C0A A;  3ULC A;  4WVF B;  1N3H A;  1GC6 A;  1EAZ A;  2ZPY A;  1P5T A;  1DYN A;  2GCL A;  2MDX A;  1E5W A;  2D2Q A;  3T06 A;  3SO6 A;  2DA0 A;  2Y8G A;  1X1F A;  3D8D A;  4A5K A;  4HAX B;  2G35 A;  1BTK A;  1NU2 A;  2DTC A;  4HDQ A;  4K2O A;  2R09 A;  5KQ4 A;  2YVC A;  2YRY A;  4KHA A;  4HAZ B;  4F7G A;  2P0F A;  2I5C A;  4XWX A;  1ZC3 B;  1WVH A;  3WYF B;  2RGN B;  1DDW A;  1MK7 B;  3P6A A;  3PG7 A;  5LOP B;  5EFX A;  4MT7 A;  2UVM A;  4Z2M B;  3PVW A;  5JP4 A;  1GC7 A;  3SV1 A;  4F7U P;  2ROV A;  5HE3 A;  1J0W A;  5GOW B;  1UNR A;  3PVL A;  3G9W A;  1ZC4 B;  1U5F A;  3TVV A;  3AU5 A;  1U29 A;  2QKM A;  5DHF B;  3KRW A;  1W1D A;  3F5R A;  2D9Z A;  5D3V A;  3HQC A;  4H8S A;  3BJI A;  3ULB A;  2EC1 A;  1LW3 A;  1EGX A;  4CHJ A;  2OTX A;  1IRS A;  3F0W A;  1KZG A;  2HE7 A;  1WJ1 A;  1OY2 A;  1KZ7 A;  4TYZ A;  1BWN A;  2LYD A;  2BCJ A;  1M7R A;  1LB1 A;  2COF A;  3HW2 B;  2UZR A;  2M14 A;  2Z0P A;  2DLW A;  2LG1 A;  2NZ8 B;  2LOZ A;  1MAI A;  4HAV B;  5J3T A;  3MDB C;  2P0D A;  3U7D A;  2KGX B;  4ZRJ A;  4TKN A;  3ML4 A;  5D27 A;  2K2J A;  2DHK A;  1XD4 A;  1Q67 A;  3TFM A;  5J3Q A;  1V89 A;  4DBB A;  2DX5 A;  1PLS A;  2RNR B;  4Y94 A;  1DDM A;  1NI2 A;  2J0K A;  1AQC A;  4HDO A;  2JP2 A;  1V5P A;  1AWE A;  4WJ7 A;  1SGH A;  4MY6 A;  2EJ8 A;  5JLJ B;  4Z2N A;  3FSS A;  4ZRI A;  1Y19 B;  2K00 A;  3O96 A;  5L81 A;  2GCJ A;  2DKP A;  2XQN M;  2Q13 A;  2NMB A;  1X1G A;  2VSZ A;  3PZD A;  1XKE A;  3SYX A;  5DHA B;  5LON B;  3BIN A;  4BBK A;  4F7H A;  4HB4 B;  1X11 A;  3ZVR A;  1BAK A;  4D0N B;  2CAY A;  4K17 A;  2ROZ B;  4DX8 A;  3DXD A;  4EMO A;  1NTY A;  1WGQ A;  1UNQ A;  4HAT B;  2Z0Q A;  1MK9 B;  2VRW B;  5D3Y A;  1H4R A;  1I2H A;  1BTN A;  4NSW A;  1P6S A;  1V5M A;  1W1H A;  3HK0 A;  5JHG A;  4GMV A;  2V76 A;  2DHJ A;  4PQ0 A;  3FM8 C;  3OAN A;  1I7A A;  2ADZ A;  3AU4 A;  1XCG A;  4HAW B;  3QIJ A;  1UEF A;  2UZS A;  4NY0 A;  3UZT A;  2DHI A;  2RLO A;  3A8Q A;  2P0H A;  2YT0 A;  2COC A;  4GMX B;  1J19 A;  2X18 A;  2N0Y A;  1MIX A;  2EMT A;  3KY9 A;  3PP2 A;  4GN1 A;  3GYO A;  2DKQ A;  1FAO A;  5C6R A;  3D8F A;  5C5B A;  1H10 A;  1M7E A;  2J59 M;  2L2I A;  4KHO A;  1PMS A;  2MKR A;  1FGY A;  2LUL A;  3SUZ A;  4K2P A;  3TCA A;  2I5F A;  1WJM A;  1FHX A;  1TXD A;  1MIZ B;  1U5D A;  3X23 A;  3PVU A;  3LJU X;  2OQB A;  2EMS A;  4IAP A;  5DIF B;  4PNK A;  1FHO A;  3IVF A;  2YSZ A;  2W2X C;  1Y5O A;  2COD A;  2LOX A;  3WA0 A;  2D4Q A;  2CY5 A;  5C5B B;  5KQ1 A;  1WG7 A;  2Y8F A;  2AEH A;  1ZM0 A;  4K81 A;  3DXE A;  3A98 B;  3D8E A;  5CLQ B;  1U5E A;  4MK0 A;  5C16 A;  1PFJ A;  2LKO A;  2I1J A;  1ZVR A;  4KHB B;  1XOD A;  1OQN A;  2L1C A;  5KCV A;  5DI9 B;  4GZU A;  1MKE A;  2MFQ A;  5HE1 A;  4DX9 0;  2DYQ A;  2J0M A;  1U2B A;  1W1G A;  2FJL A;  2D9Y A;  2H7D A;  4IFS A;  2KCJ A;  2RVB B;  1XX0 A;  1TQZ A;  2P8V A;  4A6H A;  5D3X A;  2QKL A;  4GXB A;  4A6F A;  3NSU A; 
#chains in the Genus database with same CATH topology
 2DN6 A;  2YS3 A;  4YON A;  2CRF A;  5HE0 A;  1FHW A;  1WI1 A;  1QC6 A;  2VKI A;  4HB3 B;  1RRP B;  1K5D B;  2D10 A;  2N23 A;  2GJY A;  1P3R A;  5D3W A;  1DBH A;  2K8E A;  2KIG A;  4HAY B;  4WSF A;  1NTV A;  2YT1 A;  3VIA A;  2CY4 A;  1V88 A;  2Z13 A;  2DX1 A;  3DXC A;  4L6E A;  3ODO A;  5J3Y A;  3KZ1 A;  3ODX A;  2GS0 A;  4EKU A;  3TO1 A;  5JHH A;  1ZSQ A;  4A6F B;  1WGU A;  3GYP A;  4CYE A;  3NSU A;  2DFK A;  2ELB A;  1V5U A;  2ELA A;  1DRO A;  4P7I A;  2AL6 A;  1SHC A;  1EVH A;  1DDV A;  2Z14 A;  2KUQ A;  1MPH A;  2M38 A;  4GPT B;  4A6K A;  2I1K A;  1B55 A;  3QBV B;  2HTH B;  4EJN A;  2PZ1 A;  2J0J A;  3RCP A;  5FI0 A;  2MWN B;  3TW1 A;  1RJ2 A;  3SNH A;  2K2U A;  1U5G A;  2H7E A;  3KSY A;  1UPQ A;  3AJ4 A;  4HHV A;  3QWM A;  2D9V A;  2YS1 A;  4HB2 B;  2D9W A;  2IYB A;  4CSQ A;  1Z87 A;  1FGZ A;  3FEH A;  3P7Z A;  5FI1 A;  2RRF A;  3V5W A;  3NWD A;  2KUP A;  2D11 A;  2Y7B A;  1XR0 B;  2D9X A;  2KR0 A;  1X86 A;  3N7C A;  5CLL B;  5DH9 B;  1KI1 B;  5C79 A;  1OMW A;  3A8P A;  1EF1 A;  1GG3 A;  1U27 A;  3CXB B;  3PEG A;  5HE2 A;  3ZDT A;  2W2X D;  1TJ6 A;  2DYN A;  2YS5 A;  2IFS A;  1UPR A;  3ODW A;  4ZRK A;  2RUK B;  3U8Z A;  4KVG B;  1K5G B;  2RSG A;  1FB8 A;  1QQG A;  2Z0O A;  1UNP A;  1V61 A;  4OT1 A;  4CHM A;  2YF0 A;  4KAX B;  2R2Y A;  3KRX A;  3CIK A;  4IOY X;  3M1I B;  2E2X A;  4YL8 A;  1X05 A;  2R0D A;  2COA A;  4HAU B;  3PSC A;  4DXA B;  3NWF A;  3VOQ A;  4B6H A;  1FOE A;  1ISN A;  4HB0 B;  4HSI A;  4QXA B;  2W2W A;  3MPX A;  4C0A A;  3ULC A;  4WVF B;  1N3H A;  1GC6 A;  1EAZ A;  2ZPY A;  1P5T A;  1DYN A;  2GCL A;  2MDX A;  1E5W A;  2D2Q A;  3T06 A;  3SO6 A;  2DA0 A;  2Y8G A;  1X1F A;  3D8D A;  4A5K A;  4HAX B;  2G35 A;  4GNK B;  4OSN A;  3U12 A;  1BTK A;  1NU2 A;  2DTC A;  4HDQ A;  4K2O A;  5M4Y B;  2R09 A;  5KQ4 A;  2YVC A;  2YRY A;  4KHA A;  4HAZ B;  2KIE A;  4F7G A;  2P0F A;  2I5C A;  2K49 A;  4XWX A;  1ZC3 B;  1WVH A;  3WYF B;  2RGN B;  1DDW A;  1MK7 B;  3P6A A;  3DCX A;  3PG7 A;  4QJ3 B;  5LOP B;  5EFX A;  4MT7 A;  2UVM A;  4Z2M B;  3HIE A;  3PVW A;  5JP4 A;  1GC7 A;  3SV1 A;  4F7U P;  2ROV A;  5HE3 A;  1J0W A;  5GOW B;  1UNR A;  4GOU A;  3PVL A;  3G9W A;  1ZC4 B;  1U5F A;  3TVV A;  3B77 A;  3AU5 A;  1U29 A;  2QKM A;  3FVC A;  5DHF B;  3KRW A;  1W1D A;  3F5R A;  2D9Z A;  3NWA A;  5D3V A;  3HQC A;  4H8S A;  3BJI A;  3ULB A;  2EC1 A;  1LW3 A;  1EGX A;  4CHJ A;  2OTX A;  1IRS A;  3A58 A;  3F0W A;  1KZG A;  2HE7 A;  1WJ1 A;  1OY2 A;  1KZ7 A;  4TYZ A;  1BWN A;  2LYD A;  5I2M A;  4KHB A;  2BCJ A;  1M7R A;  1LB1 A;  2COF A;  2ZKM X;  2UZR A;  2M14 A;  2Z0P A;  3HW2 B;  2DLW A;  2LG1 A;  2NZ8 B;  2LOZ A;  1MAI A;  4HAV B;  5J3T A;  3MDB C;  2P0D A;  2YT2 A;  3U7D A;  2KGX B;  4ZRJ A;  4TKN A;  3ML4 A;  5D27 A;  2K2J A;  2DHK A;  1XD4 A;  4QJ5 B;  1Q67 A;  3OHM B;  3TFM A;  5J3Q A;  1V89 A;  4DBB A;  2DX5 A;  1PLS A;  2RNR B;  4Y94 A;  1DDM A;  1NI2 A;  2J0K A;  1AQC A;  4HDO A;  2JP2 A;  1V5P A;  1AWE A;  4WJ7 A;  1SGH A;  4MY6 A;  2EJ8 A;  5JLJ B;  4Z2N A;  3FSS A;  4ZRI A;  1Y19 B;  2K00 A;  3O96 A;  5L81 A;  2GCJ A;  2DKP A;  2XQN M;  2Q13 A;  2NMB A;  1X1G A;  2VSZ A;  3PZD A;  1XKE A;  3SYX A;  5DHA B;  5LON B;  3BIN A;  4BBK A;  3HSA A;  4F7H A;  4HB4 B;  1X11 A;  3ZVR A;  1BAK A;  4D0N B;  2CAY A;  4K17 A;  2ROZ B;  4DX8 A;  3DXD A;  4EMO A;  1NTY A;  1WGQ A;  2Z4D A;  1UNQ A;  4HAT B;  2Z0Q A;  1MK9 B;  2VRW B;  5D3Y A;  1H4R A;  1I2H A;  1BTN A;  2NBV A;  5LG4 B;  4NSW A;  1P6S A;  1V5M A;  1W1H A;  3HK0 A;  5JHG A;  4GMV A;  2V76 A;  2DHJ A;  4PQ0 A;  3FM8 C;  3OAN A;  1I7A A;  2ADZ A;  3AU4 A;  1XCG A;  4HAW B;  1ZYI A;  3QIJ A;  1UEF A;  2UZS A;  4NY0 A;  3UZT A;  2DHI A;  2RLO A;  3A8Q A;  2P0H A;  2YT0 A;  2COC A;  4GMX B;  1J19 A;  2X18 A;  2N0Y A;  1MIX A;  2EMT A;  3KY9 A;  3PP2 A;  4GN1 A;  3GYO A;  2DKQ A;  1FAO A;  5C6R A;  3D8F A;  5C5B A;  1H10 A;  1M7E A;  2J59 M;  2L2I A;  4KHO A;  1PMS A;  2MKR A;  1FGY A;  2LUL A;  3SUZ A;  4K2P A;  5I2S A;  3TCA A;  2I5F A;  4DIX A;  1WJM A;  1TXD A;  1FHX A;  1T77 A;  1MIZ B;  1U5D A;  3X23 A;  3PVU A;  3LJU X;  2OQB A;  2EMS A;  4IAP A;  5DIF B;  4PNK A;  1FHO A;  2Z59 A;  3IVF A;  2YSZ A;  2W2X C;  1Y5O A;  2COD A;  2LOX A;  3WA0 A;  2D4Q A;  2CY5 A;  2GUM A;  5C5B B;  5KQ1 A;  1WG7 A;  2Y8F A;  2AEH A;  1ZM0 A;  4K81 A;  3DXE A;  4L1R A;  3A98 B;  3D8E A;  5CLQ B;  1U5E A;  4MK0 A;  4D6W A;  5C16 A;  1PFJ A;  2LKO A;  2FJU B;  2I1J A;  1ZVR A;  4KHB B;  1XOD A;  1OQN A;  2L1C A;  5KCV A;  5DI9 B;  4GZU A;  1MKE A;  2MFQ A;  5HE1 A;  4DX9 0;  2DYQ A;  2J0M A;  1U2B A;  1W1G A;  2FJL A;  2D9Y A;  3NW8 A;  4QJ4 B;  2H7D A;  4IFS A;  2KCJ A;  2RVB B;  1XX0 A;  1TQZ A;  2P8V A;  4A6H A;  5D3X A;  2QKL A;  4GXB A;  4A6F A;  5IRS A;  1MI1 A; 
#chains in the Genus database with same CATH homology
 2DN6 A;  2YS3 A;  4YON A;  2CRF A;  5HE0 A;  1FHW A;  1WI1 A;  1QC6 A;  2VKI A;  4HB3 B;  1RRP B;  1K5D B;  2D10 A;  2N23 A;  2GJY A;  1P3R A;  5D3W A;  1DBH A;  4HAY B;  4WSF A;  1NTV A;  2YT1 A;  3VIA A;  2CY4 A;  1V88 A;  3DXC A;  2DX1 A;  4L6E A;  3ODO A;  5J3Y A;  3KZ1 A;  3ODX A;  2GS0 A;  4EKU A;  3TO1 A;  5JHH A;  1ZSQ A;  4A6F B;  1WGU A;  3GYP A;  4CYE A;  2DFK A;  2ELB A;  1V5U A;  2ELA A;  1DRO A;  4P7I A;  2AL6 A;  1SHC A;  1EVH A;  1DDV A;  1MPH A;  2M38 A;  4GPT B;  4A6K A;  2I1K A;  1B55 A;  3QBV B;  2HTH B;  4EJN A;  2PZ1 A;  2J0J A;  3RCP A;  5FI0 A;  2MWN B;  3TW1 A;  1RJ2 A;  3SNH A;  2K2U A;  1U5G A;  2H7E A;  3KSY A;  1UPQ A;  3AJ4 A;  4HHV A;  3QWM A;  2D9V A;  2YS1 A;  4HB2 B;  2D9W A;  2IYB A;  1Z87 A;  1FGZ A;  3FEH A;  3P7Z A;  5FI1 A;  3V5W A;  2KUP A;  2D11 A;  2Y7B A;  1XR0 B;  2D9X A;  1X86 A;  3N7C A;  5CLL B;  5DH9 B;  1KI1 B;  5C79 A;  1OMW A;  3A8P A;  1EF1 A;  1GG3 A;  1U27 A;  3CXB B;  3PEG A;  5HE2 A;  3ZDT A;  2W2X D;  1TJ6 A;  2DYN A;  2YS5 A;  2IFS A;  1UPR A;  3ODW A;  4ZRK A;  2RUK B;  3U8Z A;  4KVG B;  1K5G B;  2RSG A;  1FB8 A;  1QQG A;  2Z0O A;  1UNP A;  1V61 A;  4CHM A;  2YF0 A;  4KAX B;  3KRX A;  3CIK A;  4IOY X;  3M1I B;  2E2X A;  4YL8 A;  1X05 A;  2R0D A;  2COA A;  4HAU B;  3PSC A;  4DXA B;  3VOQ A;  4B6H A;  1FOE A;  1ISN A;  4HB0 B;  2W2W A;  3MPX A;  4C0A A;  3ULC A;  4WVF B;  1N3H A;  1GC6 A;  1EAZ A;  2ZPY A;  1P5T A;  1DYN A;  2GCL A;  2MDX A;  1E5W A;  2D2Q A;  3T06 A;  3SO6 A;  2DA0 A;  2Y8G A;  1X1F A;  3D8D A;  4A5K A;  4HAX B;  2G35 A;  1BTK A;  1NU2 A;  2DTC A;  4HDQ A;  4K2O A;  2R09 A;  5KQ4 A;  2YVC A;  2YRY A;  4KHA A;  4HAZ B;  4F7G A;  2P0F A;  2I5C A;  4XWX A;  1ZC3 B;  1WVH A;  3WYF B;  2RGN B;  1DDW A;  1MK7 B;  3P6A A;  3PG7 A;  5LOP B;  5EFX A;  4MT7 A;  2UVM A;  4Z2M B;  3PVW A;  5JP4 A;  1GC7 A;  3SV1 A;  4F7U P;  2ROV A;  5HE3 A;  1J0W A;  5GOW B;  1UNR A;  3PVL A;  3G9W A;  1ZC4 B;  1U5F A;  3TVV A;  3AU5 A;  1U29 A;  2QKM A;  5DHF B;  3KRW A;  1W1D A;  3F5R A;  2D9Z A;  5D3V A;  3HQC A;  4H8S A;  3BJI A;  3ULB A;  2EC1 A;  1LW3 A;  1EGX A;  4CHJ A;  2OTX A;  1IRS A;  3F0W A;  1KZG A;  2HE7 A;  1WJ1 A;  1OY2 A;  1KZ7 A;  4TYZ A;  1BWN A;  2LYD A;  2BCJ A;  1M7R A;  1LB1 A;  2COF A;  3HW2 B;  2UZR A;  2M14 A;  2Z0P A;  2DLW A;  2LG1 A;  2NZ8 B;  2LOZ A;  1MAI A;  4HAV B;  5J3T A;  3MDB C;  2P0D A;  3U7D A;  2KGX B;  4ZRJ A;  4TKN A;  3ML4 A;  5D27 A;  2K2J A;  2DHK A;  1XD4 A;  1Q67 A;  3TFM A;  5J3Q A;  1V89 A;  4DBB A;  2DX5 A;  1PLS A;  2RNR B;  4Y94 A;  1DDM A;  1NI2 A;  2J0K A;  1AQC A;  4HDO A;  2JP2 A;  1V5P A;  1AWE A;  4WJ7 A;  1SGH A;  4MY6 A;  2EJ8 A;  5JLJ B;  4Z2N A;  3FSS A;  4ZRI A;  1Y19 B;  2K00 A;  3O96 A;  5L81 A;  2GCJ A;  2DKP A;  2XQN M;  2Q13 A;  2NMB A;  1X1G A;  2VSZ A;  3PZD A;  1XKE A;  3SYX A;  5DHA B;  5LON B;  3BIN A;  4BBK A;  4F7H A;  4HB4 B;  1X11 A;  3ZVR A;  1BAK A;  4D0N B;  2CAY A;  4K17 A;  2ROZ B;  4DX8 A;  3DXD A;  4EMO A;  1NTY A;  1WGQ A;  1UNQ A;  4HAT B;  2Z0Q A;  1MK9 B;  2VRW B;  5D3Y A;  1H4R A;  1I2H A;  1BTN A;  4NSW A;  1P6S A;  1V5M A;  1W1H A;  3HK0 A;  5JHG A;  4GMV A;  2V76 A;  2DHJ A;  4PQ0 A;  3FM8 C;  3OAN A;  1I7A A;  2ADZ A;  3AU4 A;  1XCG A;  4HAW B;  3QIJ A;  1UEF A;  2UZS A;  4NY0 A;  3UZT A;  2DHI A;  2RLO A;  3A8Q A;  2P0H A;  2YT0 A;  2COC A;  4GMX B;  1J19 A;  2X18 A;  2N0Y A;  1MIX A;  2EMT A;  3KY9 A;  3PP2 A;  4GN1 A;  3GYO A;  2DKQ A;  1FAO A;  5C6R A;  3D8F A;  5C5B A;  1H10 A;  1M7E A;  2J59 M;  2L2I A;  4KHO A;  1PMS A;  2MKR A;  1FGY A;  2LUL A;  3SUZ A;  4K2P A;  3TCA A;  2I5F A;  1WJM A;  1FHX A;  1TXD A;  1MIZ B;  1U5D A;  3X23 A;  3PVU A;  3LJU X;  2OQB A;  2EMS A;  4IAP A;  5DIF B;  4PNK A;  1FHO A;  3IVF A;  2YSZ A;  2W2X C;  1Y5O A;  2COD A;  2LOX A;  3WA0 A;  2D4Q A;  2CY5 A;  5C5B B;  5KQ1 A;  1WG7 A;  2Y8F A;  2AEH A;  1ZM0 A;  4K81 A;  3DXE A;  3A98 B;  3D8E A;  5CLQ B;  1U5E A;  4MK0 A;  5C16 A;  1PFJ A;  2LKO A;  2I1J A;  1ZVR A;  4KHB B;  1XOD A;  1OQN A;  2L1C A;  5KCV A;  5DI9 B;  4GZU A;  1MKE A;  2MFQ A;  5HE1 A;  4DX9 0;  2DYQ A;  2J0M A;  1U2B A;  1W1G A;  2FJL A;  2D9Y A;  2H7D A;  4IFS A;  2KCJ A;  2RVB B;  1XX0 A;  1TQZ A;  2P8V A;  4A6H A;  5D3X A;  2QKL A;  4GXB A;  4A6F A;  3NSU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...