3HQCA

Crystal structure of phosphotyrosine-binding domain from the human tensin-like c1 domain-containing phosphatase (tenc1)
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
143
structure length
140
Chain Sequence
STAADLLRQGAACSVLYLTSVETESLTGPQAVARASSAALSCSTPAVVHFKVSAQGITLTDNQRKLFFRRHYPVNSITFSSTDPQDRRWTNPDGTTSKIFGFVAKKPGSPWENVCHLFAELDPDQPAGAIVTFITKVMLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Tensin-like C1 domain-containing phosphatase
publication title Crystal structure of Phosphotyrosine-binding domain from the Human Tensin-like C1 domain-containing phosphatase (TENC1)
rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 30
structure length 140
sequence length 143
ec nomenclature ec 3.1.3.-:
pdb deposition date 2009-06-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08416 PTB Phosphotyrosine-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 3hqcA00
1UNQA 1FOEA 3ODXA 1TJ6A 4HAWB 4GPTB 4HAYB 2MFQA 2I1JA 5JP4A 1Q67A 3TCAA 4GMVA 1U27A 1NTVA 1V5MA 3PP2A 3SV1A 3V5WA 1MK9B 1DYNA 2R0DA 3SNHA 4ZRIA 4A6FA 3X23A 2X18A 3F0WA 4MY6A 2NMBA 3VOQA 1KZGA 1GC7A 2RNRB 1SGHA 1W1HA 4IOYX 5CLLB 5DHAB 4CYEA 5LONB 3O96A 4D0NB 1U29A 3VIAA 2J0MA 3IVFA 1V5PA 2K2JA 4F7UP 2D9WA 4MK0A 1UNRA 3PZDA 2YF0A 3A8PA 1GG3A 3PSCA 1J0WA 2ZPYA 4GXBA 2R09A 4GZUA 1GC6A 1UNPA 3MDBC 1N3HA 1X11A 2I5CA 5JLJB 2FJLA 2DYQA 2COAA 1EVHA 1ZM0A 1U5EA 4PQ0A 2MDXA 5D27A 1TXDA 2LOXA 2Y8GA 4KVGB 2D9YA 2YS5A 3P6AA 2IFSA 1FGZA 1ZVRA 1PLSA 1XX0A 5KCVA 4GN1A 4HB2B 4ZRKA 2H7EA 2HE7A 4ZRJA 1P5TA 2J0KA 2P8VA 4K17A 2GCJA 5FI0A 5C5BB 2D4QA 2H7DA 4KHAA 5EFXA 4A6KA 3DXCA 1U5DA 2W2WA 1RJ2A 2D11A 1KZ7A 3M1IB 2D10A 2W2XD 2RLOA 3KZ1A 2Z0OA 2D9XA 2LULA 2ADZA 5HE3A 1V5UA 1WJ1A 5D3YA 1ZC3B 1MK7B 3FM8C 4EJNA 4IFSA 5C16A 2GS0A 4DX90 3MPXA 5D3VA 4HB3B 1P6SA 2Z0QA 1QQGA 3P7ZA 4YL8A 1MKEA 3QWMA 2D9ZA 2CY4A 2P0DA 1H4RA 2DHKA 3SO6A 1U5FA 1MIZB 3KRWA 2EC1A 2EJ8A 2PZ1A 4KHOA 2RVBB 3DXDA 3HK0A 2GCLA 2UZSA 5C5BA 5KQ4A 3TW1A 4A6HA 1PFJA 5DH9B 2XQNM 2YS1A 2ROZB 3WYFB 1BAKA 1AQCA 2HTHB 4HDOA 2EMSA 1RRPB 1WJMA 2RUKB 1WGUA 2P0HA 4A5KA 5D3WA 1MAIA 3HQCA 1Y5OA 2EMTA 2DLWA 1UPRA 4NSWA 4EKUA 2DFKA 3ODWA 1WGQA 4Y94A 3D8FA 2I5FA 1X1GA 1K5GB 1X1FA 1J19A 4PNKA 2K2UA 1K5DB 2Q13A 3PVLA 3BJIA 2RGNB 3ML4A 3DXEA 4C0AA 2KGXB 1ZSQA 3TO1A 2AEHA 1FHOA 1EGXA 2CAYA 2I1KA 4DBBA 1XCGA 2G35A 1LW3A 1BTKA 2VSZA 2QKMA 2RSGA 1FHXA 2N0YA 1UEFA 4K2PA 1SHCA 2Y8FA 2VRWB 2LG1A 1I7AA 3AU4A 1EF1A 1U2BA 2M38A 1M7RA 1P3RA 1OQNA 3KSYA 4KHBB 4GMXB 3TFMA 4F7HA 3D8DA 2Y7BA 4H8SA 3NSUA 4TYZA 1BWNA 4HAUB 3SYXA 3ZDTA 1W1DA 2P0FA 2JP2A 4MT7A 2BCJA 4F7GA 1NU2A 1W1GA 2DKPA 2DTCA 2YVCA 4K2OA 3OANA 2YT0A 2N23A 2ELAA 1MPHA 1OMWA 5J3QA 3F5RA 4CHJA 4Z2MB 5L81A 1UPQA 1U5GA 1IRSA 4HHVA 5C79A 2M14A 1DDWA 1Y19B 2KUPA 4HDQA 1DBHA 3ZVRA 1DDMA 5C6RA 2K00A 1V88A 2AL6A 1Z87A 4B6HA 4DXAB 3ODOA 5DHFB 1M7EA 3FEHA 3QIJA 4HAVB 2DA0A 2MWNB 3KRXA 4IAPA 3GYPA 2LYDA 5HE0A 4EMOA 5JHHA 3U7DA 1XD4A 3U8ZA 3BINA 2LOZA 4Z2NA 4WVFB 1PMSA 2DHIA 1TQZA 3AU5A 1BTNA 3KY9A 3T06A 5J3TA 2YSZA 1FB8A 3CIKA 5JHGA 4HB4B 2UZRA 5HE1A 1XR0B 2ELBA 2COFA 4CHMA 2J0JA 4L6EA 1FAOA 1ZC4B 2CRFA 3A98B 3FSSA 1OY2A 1V61A 1WI1A 2MKRA 5LOPB 2Z0PA 4P7IA 1X86A 1FGYA 3D8EA 2W2XC 5DI9B 2DX5A 4TKNA 2VKIA 4HATB 2D2QA 1NTYA 1H10A 4HAXB 2NZ8B 3ULCA 2YS3A 2QKLA 3SUZA 1E5WA 4K81A 3PVUA 1XKEA 1WVHA 5HE2A 1DROA 3PVWA 4NY0A 4BBKA 2DN6A 1QC6A 2YRYA 3AJ4A 2L1CA 2D9VA 5FI1A 3WA0A 3G9WA 1FHWA 2DKQA 2GJYA 1NI2A 1I2HA 1ISNA 2CY5A 1AWEA 5D3XA 2E2XA 2IYBA 3PEGA 5GOWB 3ULBA 3HW2B 3A8QA 2KCJA 5DIFB 3LJUX 4YONA 1DDVA 3QBVB 2DHJA 2COCA 4HB0B 3UZTA 1V89A 4DX8A 3N7CA 1KI1B 1MIXA 4A6FB 2OTXA 2L2IA 3GYOA 2YT1A 3PG7A 4XWXA 2DYNA 4KAXB 5CLQB 3CXBB 2OQBA 2UVMA 2V76A 5KQ1A 1WG7A 4WSFA 3TVVA 2LKOA 1LB1A 4HAZB 5J3YA 1B55A 2ROVA 2J59M 1X05A 4WJ7A 2DX1A 2CODA 3RCPA 1XODA 1EAZA
chains in the Genus database with same CATH superfamily
1UNQA 1FOEA 3ODXA 1TJ6A 4HAWB 4GPTB 4L1RA 4HAYB 2MFQA 2I1JA 5JP4A 1Q67A 3TCAA 4GMVA 1U27A 1NTVA 1V5MA 3PP2A 3SV1A 3V5WA 1MK9B 1DYNA 2R0DA 3SNHA 4ZRIA 4A6FA 3X23A 2X18A 3F0WA 4MY6A 2NMBA 3VOQA 1KZGA 1GC7A 2RNRB 1SGHA 1W1HA 4IOYX 5CLLB 5DHAB 4CYEA 5LONB 3O96A 4D0NB 1U29A 4QJ5B 3VIAA 2J0MA 3IVFA 1V5PA 2K2JA 4F7UP 2D9WA 4MK0A 1UNRA 3PZDA 2YF0A 3A8PA 1GG3A 3PSCA 1J0WA 2ZPYA 2KIGA 4GXBA 2R09A 4GZUA 1GC6A 1UNPA 3MDBC 1N3HA 1X11A 2I5CA 5JLJB 2FJLA 2DYQA 2COAA 1EVHA 1ZM0A 1U5EA 4PQ0A 2MDXA 5D27A 1TXDA 2LOXA 2Y8GA 4KVGB 2D9YA 2YS5A 3P6AA 2IFSA 1FGZA 1ZVRA 1PLSA 4QXAB 1XX0A 3OHMB 5KCVA 4GN1A 4HB2B 4ZRKA 2H7EA 2HE7A 2GUMA 4ZRJA 1P5TA 2J0KA 2P8VA 4K17A 2GCJA 5FI0A 5C5BB 2D4QA 2H7DA 4KHAA 5EFXA 4A6KA 3DXCA 1U5DA 2W2WA 1RJ2A 2D11A 4GOUA 1KZ7A 3M1IB 2D10A 2W2XD 2RLOA 3KZ1A 2Z0OA 2D9XA 2LULA 3NWFA 2ADZA 5HE3A 1V5UA 1WJ1A 5D3YA 1ZC3B 1MK7B 3FM8C 4EJNA 2NBVA 4IFSA 5C16A 2GS0A 4DX90 3MPXA 5D3VA 4HB3B 1P6SA 2Z0QA 1QQGA 3P7ZA 4YL8A 1MKEA 3QWMA 2D9ZA 2CY4A 2P0DA 1H4RA 2DHKA 3SO6A 1U5FA 1MIZB 3KRWA 2Z4DA 2EC1A 2EJ8A 2PZ1A 4KHOA 2RVBB 3DXDA 3HK0A 2GCLA 2UZSA 5C5BA 3FVCA 5KQ4A 3TW1A 4A6HA 4GNKB 1MI1A 1PFJA 5DH9B 2XQNM 2YS1A 2ROZB 3WYFB 1BAKA 1AQCA 2HTHB 4HDOA 2EMSA 2RRFA 1RRPB 1WJMA 2RUKB 1WGUA 2P0HA 2Z59A 4A5KA 5D3WA 1MAIA 3HQCA 1Y5OA 2EMTA 2DLWA 1UPRA 4NSWA 4EKUA 2DFKA 1WGQA 3ODWA 2FJUB 1ZYIA 4Y94A 3D8FA 4HSIA 5LG4B 2I5FA 1X1GA 1K5GB 1X1FA 1J19A 4PNKA 2K2UA 1K5DB 2Q13A 2R2YA 3PVLA 3BJIA 2RGNB 3ML4A 3DXEA 2ZKMX 4C0AA 2KGXB 1ZSQA 3TO1A 2AEHA 1FHOA 4QJ3B 3NWDA 2YT2A 1EGXA 2CAYA 2I1KA 4DBBA 1XCGA 5M4YB 2G35A 1LW3A 1BTKA 2VSZA 2QKMA 2RSGA 1FHXA 2N0YA 1UEFA 4K2PA 1SHCA 2Y8FA 2VRWB 2LG1A 1I7AA 3AU4A 1EF1A 1U2BA 2M38A 1M7RA 1P3RA 1OQNA 3KSYA 4KHBB 4GMXB 3TFMA 4F7HA 3D8DA 2Y7BA 4H8SA 5I2MA 4QJ4B 3NSUA 4TYZA 1BWNA 3B77A 4HAUB 3SYXA 3ZDTA 1W1DA 2P0FA 5IRSA 2JP2A 4MT7A 2BCJA 4F7GA 1NU2A 2K49A 1W1GA 2KR0A 2DKPA 3HSAA 2DTCA 2YVCA 4K2OA 3OANA 2YT0A 2N23A 2ELAA 1MPHA 1OMWA 5J3QA 3F5RA 4CHJA 4Z2MB 5L81A 1UPQA 1U5GA 1IRSA 4HHVA 5C79A 2M14A 1DDWA 1Y19B 2KUPA 4HDQA 1DBHA 3ZVRA 1DDMA 5C6RA 2K00A 1V88A 2AL6A 1Z87A 4B6HA 4DXAB 3ODOA 5DHFB 1M7EA 3FEHA 3QIJA 4OSNA 3DCXA 4HAVB 2Z14A 2DA0A 2MWNB 3KRXA 4IAPA 3GYPA 2LYDA 5HE0A 4EMOA 5JHHA 3U7DA 1XD4A 3U8ZA 3BINA 2LOZA 4Z2NA 4WVFB 3NWAA 1PMSA 2DHIA 1TQZA 3AU5A 1BTNA 3KY9A 4CSQA 3T06A 5J3TA 2YSZA 4DIXA 1FB8A 3CIKA 5JHGA 4HB4B 2UZRA 5HE1A 1XR0B 2ELBA 2COFA 1T77A 3U12A 4CHMA 2J0JA 4L6EA 1FAOA 1ZC4B 2CRFA 3A98B 3FSSA 1OY2A 1V61A 1WI1A 2MKRA 5LOPB 2Z13A 2Z0PA 4P7IA 1X86A 1FGYA 3D8EA 2W2XC 5DI9B 2DX5A 3A58A 4TKNA 2VKIA 4HATB 2D2QA 1NTYA 5I2SA 1H10A 4HAXB 2NZ8B 3ULCA 2YS3A 2QKLA 3SUZA 1E5WA 4K81A 3PVUA 1XKEA 1WVHA 5HE2A 1DROA 3PVWA 4NY0A 4BBKA 2KUQA 2K8EA 2DN6A 1QC6A 2YRYA 3AJ4A 2L1CA 2D9VA 5FI1A 4OT1A 3WA0A 3G9WA 1FHWA 2DKQA 2GJYA 1NI2A 3HIEA 1I2HA 1ISNA 2CY5A 1AWEA 5D3XA 2E2XA 2IYBA 3PEGA 5GOWB 3ULBA 3HW2B 3A8QA 2KCJA 5DIFB 3LJUX 3NW8A 4YONA 1DDVA 3QBVB 2DHJA 2COCA 4HB0B 4D6WA 3UZTA 1V89A 4DX8A 3N7CA 1KI1B 1MIXA 4A6FB 2OTXA 2L2IA 3GYOA 2YT1A 3PG7A 4XWXA 2DYNA 4KAXB 5CLQB 3CXBB 2OQBA 2UVMA 2V76A 5KQ1A 1WG7A 4WSFA 3TVVA 2LKOA 1LB1A 2KIEA 4HAZB 5J3YA 1B55A 2ROVA 2J59M 1X05A 4WJ7A 2DX1A 2CODA 3RCPA 1XODA 4KHBA 1EAZA
chains in the Genus database with same CATH topology
1UNQA 1FOEA 3ODXA 1TJ6A 4HAWB 4GPTB 4HAYB 2MFQA 2I1JA 5JP4A 1Q67A 3TCAA 4GMVA 1U27A 1NTVA 1V5MA 3PP2A 3SV1A 3V5WA 1MK9B 1DYNA 2R0DA 3SNHA 4ZRIA 4A6FA 3X23A 2X18A 3F0WA 4MY6A 2NMBA 3VOQA 1KZGA 1GC7A 2RNRB 1SGHA 1W1HA 4IOYX 5CLLB 5DHAB 4CYEA 5LONB 3O96A 4D0NB 1U29A 3VIAA 2J0MA 3IVFA 1V5PA 2K2JA 4F7UP 2D9WA 4MK0A 1UNRA 3PZDA 2YF0A 3A8PA 1GG3A 3PSCA 1J0WA 2ZPYA 4GXBA 2R09A 4GZUA 1GC6A 1UNPA 3MDBC 1N3HA 1X11A 2I5CA 5JLJB 2FJLA 2DYQA 2COAA 1EVHA 1ZM0A 1U5EA 4PQ0A 2MDXA 5D27A 1TXDA 2LOXA 2Y8GA 4KVGB 2D9YA 2YS5A 3P6AA 2IFSA 1FGZA 1ZVRA 1PLSA 1XX0A 5KCVA 4GN1A 4HB2B 4ZRKA 2H7EA 2HE7A 4ZRJA 1P5TA 2J0KA 2P8VA 4K17A 2GCJA 5FI0A 5C5BB 2D4QA 2H7DA 4KHAA 5EFXA 4A6KA 3DXCA 1U5DA 2W2WA 1RJ2A 2D11A 1KZ7A 3M1IB 2D10A 2W2XD 2RLOA 3KZ1A 2Z0OA 2D9XA 2LULA 2ADZA 5HE3A 1V5UA 1WJ1A 5D3YA 1ZC3B 1MK7B 3FM8C 4EJNA 4IFSA 5C16A 2GS0A 4DX90 3MPXA 5D3VA 4HB3B 1P6SA 2Z0QA 1QQGA 3P7ZA 4YL8A 1MKEA 3QWMA 2D9ZA 2CY4A 2P0DA 1H4RA 2DHKA 3SO6A 1U5FA 1MIZB 3KRWA 2EC1A 2EJ8A 2PZ1A 4KHOA 2RVBB 3DXDA 3HK0A 2GCLA 2UZSA 5C5BA 5KQ4A 3TW1A 4A6HA 1PFJA 5DH9B 2XQNM 2YS1A 2ROZB 3WYFB 1BAKA 1AQCA 2HTHB 4HDOA 2EMSA 1RRPB 1WJMA 2RUKB 1WGUA 2P0HA 4A5KA 5D3WA 1MAIA 3HQCA 1Y5OA 2EMTA 2DLWA 1UPRA 4NSWA 4EKUA 2DFKA 3ODWA 1WGQA 4Y94A 3D8FA 2I5FA 1X1GA 1K5GB 1X1FA 1J19A 4PNKA 2K2UA 1K5DB 2Q13A 3PVLA 3BJIA 2RGNB 3ML4A 3DXEA 4C0AA 2KGXB 1ZSQA 3TO1A 2AEHA 1FHOA 1EGXA 2CAYA 2I1KA 4DBBA 1XCGA 2G35A 1LW3A 1BTKA 2VSZA 2QKMA 2RSGA 1FHXA 2N0YA 1UEFA 4K2PA 1SHCA 2Y8FA 2VRWB 2LG1A 1I7AA 3AU4A 1EF1A 1U2BA 2M38A 1M7RA 1P3RA 1OQNA 3KSYA 4KHBB 4GMXB 3TFMA 4F7HA 3D8DA 2Y7BA 4H8SA 3NSUA 4TYZA 1BWNA 4HAUB 3SYXA 3ZDTA 1W1DA 2P0FA 2JP2A 4MT7A 2BCJA 4F7GA 1NU2A 1W1GA 2DKPA 2DTCA 2YVCA 4K2OA 3OANA 2YT0A 2N23A 2ELAA 1MPHA 1OMWA 5J3QA 3F5RA 4CHJA 4Z2MB 5L81A 1UPQA 1U5GA 1IRSA 4HHVA 5C79A 2M14A 1DDWA 1Y19B 2KUPA 4HDQA 1DBHA 3ZVRA 1DDMA 5C6RA 2K00A 1V88A 2AL6A 1Z87A 4B6HA 4DXAB 3ODOA 5DHFB 1M7EA 3FEHA 3QIJA 4HAVB 2DA0A 2MWNB 3KRXA 4IAPA 3GYPA 2LYDA 5HE0A 4EMOA 5JHHA 3U7DA 1XD4A 3U8ZA 3BINA 2LOZA 4Z2NA 4WVFB 1PMSA 2DHIA 1TQZA 3AU5A 1BTNA 3KY9A 3T06A 5J3TA 2YSZA 1FB8A 3CIKA 5JHGA 4HB4B 2UZRA 5HE1A 1XR0B 2ELBA 2COFA 4CHMA 2J0JA 4L6EA 1FAOA 1ZC4B 2CRFA 3A98B 3FSSA 1OY2A 1V61A 1WI1A 2MKRA 5LOPB 2Z0PA 4P7IA 1X86A 1FGYA 3D8EA 2W2XC 5DI9B 2DX5A 4TKNA 2VKIA 4HATB 2D2QA 1NTYA 1H10A 4HAXB 2NZ8B 3ULCA 2YS3A 2QKLA 3SUZA 1E5WA 4K81A 3PVUA 1XKEA 1WVHA 5HE2A 1DROA 3PVWA 4NY0A 4BBKA 2DN6A 1QC6A 2YRYA 3AJ4A 2L1CA 2D9VA 5FI1A 3WA0A 3G9WA 1FHWA 2DKQA 2GJYA 1NI2A 1I2HA 1ISNA 2CY5A 1AWEA 5D3XA 2E2XA 2IYBA 3PEGA 5GOWB 3ULBA 3HW2B 3A8QA 2KCJA 5DIFB 3LJUX 4YONA 1DDVA 3QBVB 2DHJA 2COCA 4HB0B 3UZTA 1V89A 4DX8A 3N7CA 1KI1B 1MIXA 4A6FB 2OTXA 2L2IA 3GYOA 2YT1A 3PG7A 4XWXA 2DYNA 4KAXB 5CLQB 3CXBB 2OQBA 2UVMA 2V76A 5KQ1A 1WG7A 4WSFA 3TVVA 2LKOA 1LB1A 4HAZB 5J3YA 1B55A 2ROVA 2J59M 1X05A 4WJ7A 2DX1A 2CODA 3RCPA 1XODA 1EAZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UNQ A;  1FOE A;  3ODX A;  1TJ6 A;  4HAW B;  4GPT B;  4HAY B;  2MFQ A;  2I1J A;  5JP4 A;  1Q67 A;  3TCA A;  4GMV A;  1U27 A;  1NTV A;  1V5M A;  3PP2 A;  3SV1 A;  3V5W A;  1MK9 B;  1DYN A;  2R0D A;  3SNH A;  4ZRI A;  4A6F A;  3X23 A;  2X18 A;  3F0W A;  4MY6 A;  2NMB A;  3VOQ A;  1KZG A;  1GC7 A;  2RNR B;  1SGH A;  1W1H A;  4IOY X;  5CLL B;  5DHA B;  4CYE A;  5LON B;  3O96 A;  4D0N B;  1U29 A;  3VIA A;  2J0M A;  3IVF A;  1V5P A;  2K2J A;  4F7U P;  2D9W A;  4MK0 A;  1UNR A;  3PZD A;  2YF0 A;  3A8P A;  1GG3 A;  3PSC A;  1J0W A;  2ZPY A;  4GXB A;  2R09 A;  4GZU A;  1GC6 A;  1UNP A;  3MDB C;  1N3H A;  1X11 A;  2I5C A;  5JLJ B;  2FJL A;  2DYQ A;  2COA A;  1EVH A;  1ZM0 A;  1U5E A;  4PQ0 A;  2MDX A;  5D27 A;  1TXD A;  2LOX A;  2Y8G A;  4KVG B;  2D9Y A;  2YS5 A;  3P6A A;  2IFS A;  1FGZ A;  1ZVR A;  1PLS A;  1XX0 A;  5KCV A;  4GN1 A;  4HB2 B;  4ZRK A;  2H7E A;  2HE7 A;  4ZRJ A;  1P5T A;  2J0K A;  2P8V A;  4K17 A;  2GCJ A;  5FI0 A;  5C5B B;  2D4Q A;  2H7D A;  4KHA A;  5EFX A;  4A6K A;  3DXC A;  1U5D A;  2W2W A;  1RJ2 A;  2D11 A;  1KZ7 A;  3M1I B;  2D10 A;  2W2X D;  2RLO A;  3KZ1 A;  2Z0O A;  2D9X A;  2LUL A;  2ADZ A;  5HE3 A;  1V5U A;  1WJ1 A;  5D3Y A;  1ZC3 B;  1MK7 B;  3FM8 C;  4EJN A;  4IFS A;  5C16 A;  2GS0 A;  4DX9 0;  3MPX A;  5D3V A;  4HB3 B;  1P6S A;  2Z0Q A;  1QQG A;  3P7Z A;  4YL8 A;  1MKE A;  3QWM A;  2D9Z A;  2CY4 A;  2P0D A;  1H4R A;  2DHK A;  3SO6 A;  1U5F A;  1MIZ B;  3KRW A;  2EC1 A;  2EJ8 A;  2PZ1 A;  4KHO A;  2RVB B;  3DXD A;  3HK0 A;  2GCL A;  2UZS A;  5C5B A;  5KQ4 A;  3TW1 A;  4A6H A;  1PFJ A;  5DH9 B;  2XQN M;  2YS1 A;  2ROZ B;  3WYF B;  1BAK A;  1AQC A;  2HTH B;  4HDO A;  2EMS A;  1RRP B;  1WJM A;  2RUK B;  1WGU A;  2P0H A;  4A5K A;  5D3W A;  1MAI A;  3HQC A;  1Y5O A;  2EMT A;  2DLW A;  1UPR A;  4NSW A;  4EKU A;  2DFK A;  3ODW A;  1WGQ A;  4Y94 A;  3D8F A;  2I5F A;  1X1G A;  1K5G B;  1X1F A;  1J19 A;  4PNK A;  2K2U A;  1K5D B;  2Q13 A;  3PVL A;  3BJI A;  2RGN B;  3ML4 A;  3DXE A;  4C0A A;  2KGX B;  1ZSQ A;  3TO1 A;  2AEH A;  1FHO A;  1EGX A;  2CAY A;  2I1K A;  4DBB A;  1XCG A;  2G35 A;  1LW3 A;  1BTK A;  2VSZ A;  2QKM A;  2RSG A;  1FHX A;  2N0Y A;  1UEF A;  4K2P A;  1SHC A;  2Y8F A;  2VRW B;  2LG1 A;  1I7A A;  3AU4 A;  1EF1 A;  1U2B A;  2M38 A;  1M7R A;  1P3R A;  1OQN A;  3KSY A;  4KHB B;  4GMX B;  3TFM A;  4F7H A;  3D8D A;  2Y7B A;  4H8S A;  3NSU A;  4TYZ A;  1BWN A;  4HAU B;  3SYX A;  3ZDT A;  1W1D A;  2P0F A;  2JP2 A;  4MT7 A;  2BCJ A;  4F7G A;  1NU2 A;  1W1G A;  2DKP A;  2DTC A;  2YVC A;  4K2O A;  3OAN A;  2YT0 A;  2N23 A;  2ELA A;  1MPH A;  1OMW A;  5J3Q A;  3F5R A;  4CHJ A;  4Z2M B;  5L81 A;  1UPQ A;  1U5G A;  1IRS A;  4HHV A;  5C79 A;  2M14 A;  1DDW A;  1Y19 B;  2KUP A;  4HDQ A;  1DBH A;  3ZVR A;  1DDM A;  5C6R A;  2K00 A;  1V88 A;  2AL6 A;  1Z87 A;  4B6H A;  4DXA B;  3ODO A;  5DHF B;  1M7E A;  3FEH A;  3QIJ A;  4HAV B;  2DA0 A;  2MWN B;  3KRX A;  4IAP A;  3GYP A;  2LYD A;  5HE0 A;  4EMO A;  5JHH A;  3U7D A;  1XD4 A;  3U8Z A;  3BIN A;  2LOZ A;  4Z2N A;  4WVF B;  1PMS A;  2DHI A;  1TQZ A;  3AU5 A;  1BTN A;  3KY9 A;  3T06 A;  5J3T A;  2YSZ A;  1FB8 A;  3CIK A;  5JHG A;  4HB4 B;  2UZR A;  5HE1 A;  1XR0 B;  2ELB A;  2COF A;  4CHM A;  2J0J A;  4L6E A;  1FAO A;  1ZC4 B;  2CRF A;  3A98 B;  3FSS A;  1OY2 A;  1V61 A;  1WI1 A;  2MKR A;  5LOP B;  2Z0P A;  4P7I A;  1X86 A;  1FGY A;  3D8E A;  2W2X C;  5DI9 B;  2DX5 A;  4TKN A;  2VKI A;  4HAT B;  2D2Q A;  1NTY A;  1H10 A;  4HAX B;  2NZ8 B;  3ULC A;  2YS3 A;  2QKL A;  3SUZ A;  1E5W A;  4K81 A;  3PVU A;  1XKE A;  1WVH A;  5HE2 A;  1DRO A;  3PVW A;  4NY0 A;  4BBK A;  2DN6 A;  1QC6 A;  2YRY A;  3AJ4 A;  2L1C A;  2D9V A;  5FI1 A;  3WA0 A;  3G9W A;  1FHW A;  2DKQ A;  2GJY A;  1NI2 A;  1I2H A;  1ISN A;  2CY5 A;  1AWE A;  5D3X A;  2E2X A;  2IYB A;  3PEG A;  5GOW B;  3ULB A;  3HW2 B;  3A8Q A;  2KCJ A;  5DIF B;  3LJU X;  4YON A;  1DDV A;  3QBV B;  2DHJ A;  2COC A;  4HB0 B;  3UZT A;  1V89 A;  4DX8 A;  3N7C A;  1KI1 B;  1MIX A;  4A6F B;  2OTX A;  2L2I A;  3GYO A;  2YT1 A;  3PG7 A;  4XWX A;  2DYN A;  4KAX B;  5CLQ B;  3CXB B;  2OQB A;  2UVM A;  2V76 A;  5KQ1 A;  1WG7 A;  4WSF A;  3TVV A;  2LKO A;  1LB1 A;  4HAZ B;  5J3Y A;  1B55 A;  2ROV A;  2J59 M;  1X05 A;  4WJ7 A;  2DX1 A;  2COD A;  3RCP A;  1XOD A;  1EAZ A; 
#chains in the Genus database with same CATH topology
 1UNQ A;  1FOE A;  3ODX A;  1TJ6 A;  4HAW B;  4GPT B;  4L1R A;  4HAY B;  2MFQ A;  2I1J A;  5JP4 A;  1Q67 A;  3TCA A;  4GMV A;  1U27 A;  1NTV A;  1V5M A;  3PP2 A;  3SV1 A;  3V5W A;  1MK9 B;  1DYN A;  2R0D A;  3SNH A;  4ZRI A;  4A6F A;  3X23 A;  2X18 A;  3F0W A;  4MY6 A;  2NMB A;  3VOQ A;  1KZG A;  1GC7 A;  2RNR B;  1SGH A;  1W1H A;  4IOY X;  5CLL B;  5DHA B;  4CYE A;  5LON B;  3O96 A;  4D0N B;  1U29 A;  4QJ5 B;  3VIA A;  2J0M A;  3IVF A;  1V5P A;  2K2J A;  4F7U P;  2D9W A;  4MK0 A;  1UNR A;  3PZD A;  2YF0 A;  3A8P A;  1GG3 A;  3PSC A;  1J0W A;  2ZPY A;  2KIG A;  4GXB A;  2R09 A;  4GZU A;  1GC6 A;  1UNP A;  3MDB C;  1N3H A;  1X11 A;  2I5C A;  5JLJ B;  2FJL A;  2DYQ A;  2COA A;  1EVH A;  1ZM0 A;  1U5E A;  4PQ0 A;  2MDX A;  5D27 A;  1TXD A;  2LOX A;  2Y8G A;  4KVG B;  2D9Y A;  2YS5 A;  3P6A A;  2IFS A;  1FGZ A;  1ZVR A;  1PLS A;  4QXA B;  1XX0 A;  3OHM B;  5KCV A;  4GN1 A;  4HB2 B;  4ZRK A;  2H7E A;  2HE7 A;  2GUM A;  4ZRJ A;  1P5T A;  2J0K A;  2P8V A;  4K17 A;  2GCJ A;  5FI0 A;  5C5B B;  2D4Q A;  2H7D A;  4KHA A;  5EFX A;  4A6K A;  3DXC A;  1U5D A;  2W2W A;  1RJ2 A;  2D11 A;  4GOU A;  1KZ7 A;  3M1I B;  2D10 A;  2W2X D;  2RLO A;  3KZ1 A;  2Z0O A;  2D9X A;  2LUL A;  3NWF A;  2ADZ A;  5HE3 A;  1V5U A;  1WJ1 A;  5D3Y A;  1ZC3 B;  1MK7 B;  3FM8 C;  4EJN A;  2NBV A;  4IFS A;  5C16 A;  2GS0 A;  4DX9 0;  3MPX A;  5D3V A;  4HB3 B;  1P6S A;  2Z0Q A;  1QQG A;  3P7Z A;  4YL8 A;  1MKE A;  3QWM A;  2D9Z A;  2CY4 A;  2P0D A;  1H4R A;  2DHK A;  3SO6 A;  1U5F A;  1MIZ B;  3KRW A;  2Z4D A;  2EC1 A;  2EJ8 A;  2PZ1 A;  4KHO A;  2RVB B;  3DXD A;  3HK0 A;  2GCL A;  2UZS A;  5C5B A;  3FVC A;  5KQ4 A;  3TW1 A;  4A6H A;  4GNK B;  1MI1 A;  1PFJ A;  5DH9 B;  2XQN M;  2YS1 A;  2ROZ B;  3WYF B;  1BAK A;  1AQC A;  2HTH B;  4HDO A;  2EMS A;  2RRF A;  1RRP B;  1WJM A;  2RUK B;  1WGU A;  2P0H A;  2Z59 A;  4A5K A;  5D3W A;  1MAI A;  3HQC A;  1Y5O A;  2EMT A;  2DLW A;  1UPR A;  4NSW A;  4EKU A;  2DFK A;  1WGQ A;  3ODW A;  2FJU B;  1ZYI A;  4Y94 A;  3D8F A;  4HSI A;  5LG4 B;  2I5F A;  1X1G A;  1K5G B;  1X1F A;  1J19 A;  4PNK A;  2K2U A;  1K5D B;  2Q13 A;  2R2Y A;  3PVL A;  3BJI A;  2RGN B;  3ML4 A;  3DXE A;  2ZKM X;  4C0A A;  2KGX B;  1ZSQ A;  3TO1 A;  2AEH A;  1FHO A;  4QJ3 B;  3NWD A;  2YT2 A;  1EGX A;  2CAY A;  2I1K A;  4DBB A;  1XCG A;  5M4Y B;  2G35 A;  1LW3 A;  1BTK A;  2VSZ A;  2QKM A;  2RSG A;  1FHX A;  2N0Y A;  1UEF A;  4K2P A;  1SHC A;  2Y8F A;  2VRW B;  2LG1 A;  1I7A A;  3AU4 A;  1EF1 A;  1U2B A;  2M38 A;  1M7R A;  1P3R A;  1OQN A;  3KSY A;  4KHB B;  4GMX B;  3TFM A;  4F7H A;  3D8D A;  2Y7B A;  4H8S A;  5I2M A;  4QJ4 B;  3NSU A;  4TYZ A;  1BWN A;  3B77 A;  4HAU B;  3SYX A;  3ZDT A;  1W1D A;  2P0F A;  5IRS A;  2JP2 A;  4MT7 A;  2BCJ A;  4F7G A;  1NU2 A;  2K49 A;  1W1G A;  2KR0 A;  2DKP A;  3HSA A;  2DTC A;  2YVC A;  4K2O A;  3OAN A;  2YT0 A;  2N23 A;  2ELA A;  1MPH A;  1OMW A;  5J3Q A;  3F5R A;  4CHJ A;  4Z2M B;  5L81 A;  1UPQ A;  1U5G A;  1IRS A;  4HHV A;  5C79 A;  2M14 A;  1DDW A;  1Y19 B;  2KUP A;  4HDQ A;  1DBH A;  3ZVR A;  1DDM A;  5C6R A;  2K00 A;  1V88 A;  2AL6 A;  1Z87 A;  4B6H A;  4DXA B;  3ODO A;  5DHF B;  1M7E A;  3FEH A;  3QIJ A;  4OSN A;  3DCX A;  4HAV B;  2Z14 A;  2DA0 A;  2MWN B;  3KRX A;  4IAP A;  3GYP A;  2LYD A;  5HE0 A;  4EMO A;  5JHH A;  3U7D A;  1XD4 A;  3U8Z A;  3BIN A;  2LOZ A;  4Z2N A;  4WVF B;  3NWA A;  1PMS A;  2DHI A;  1TQZ A;  3AU5 A;  1BTN A;  3KY9 A;  4CSQ A;  3T06 A;  5J3T A;  2YSZ A;  4DIX A;  1FB8 A;  3CIK A;  5JHG A;  4HB4 B;  2UZR A;  5HE1 A;  1XR0 B;  2ELB A;  2COF A;  1T77 A;  3U12 A;  4CHM A;  2J0J A;  4L6E A;  1FAO A;  1ZC4 B;  2CRF A;  3A98 B;  3FSS A;  1OY2 A;  1V61 A;  1WI1 A;  2MKR A;  5LOP B;  2Z13 A;  2Z0P A;  4P7I A;  1X86 A;  1FGY A;  3D8E A;  2W2X C;  5DI9 B;  2DX5 A;  3A58 A;  4TKN A;  2VKI A;  4HAT B;  2D2Q A;  1NTY A;  5I2S A;  1H10 A;  4HAX B;  2NZ8 B;  3ULC A;  2YS3 A;  2QKL A;  3SUZ A;  1E5W A;  4K81 A;  3PVU A;  1XKE A;  1WVH A;  5HE2 A;  1DRO A;  3PVW A;  4NY0 A;  4BBK A;  2KUQ A;  2K8E A;  2DN6 A;  1QC6 A;  2YRY A;  3AJ4 A;  2L1C A;  2D9V A;  5FI1 A;  4OT1 A;  3WA0 A;  3G9W A;  1FHW A;  2DKQ A;  2GJY A;  1NI2 A;  3HIE A;  1I2H A;  1ISN A;  2CY5 A;  1AWE A;  5D3X A;  2E2X A;  2IYB A;  3PEG A;  5GOW B;  3ULB A;  3HW2 B;  3A8Q A;  2KCJ A;  5DIF B;  3LJU X;  3NW8 A;  4YON A;  1DDV A;  3QBV B;  2DHJ A;  2COC A;  4HB0 B;  4D6W A;  3UZT A;  1V89 A;  4DX8 A;  3N7C A;  1KI1 B;  1MIX A;  4A6F B;  2OTX A;  2L2I A;  3GYO A;  2YT1 A;  3PG7 A;  4XWX A;  2DYN A;  4KAX B;  5CLQ B;  3CXB B;  2OQB A;  2UVM A;  2V76 A;  5KQ1 A;  1WG7 A;  4WSF A;  3TVV A;  2LKO A;  1LB1 A;  2KIE A;  4HAZ B;  5J3Y A;  1B55 A;  2ROV A;  2J59 M;  1X05 A;  4WJ7 A;  2DX1 A;  2COD A;  3RCP A;  1XOD A;  4KHB A;  1EAZ A; 
#chains in the Genus database with same CATH homology
 1UNQ A;  1FOE A;  3ODX A;  1TJ6 A;  4HAW B;  4GPT B;  4HAY B;  2MFQ A;  2I1J A;  5JP4 A;  1Q67 A;  3TCA A;  4GMV A;  1U27 A;  1NTV A;  1V5M A;  3PP2 A;  3SV1 A;  3V5W A;  1MK9 B;  1DYN A;  2R0D A;  3SNH A;  4ZRI A;  4A6F A;  3X23 A;  2X18 A;  3F0W A;  4MY6 A;  2NMB A;  3VOQ A;  1KZG A;  1GC7 A;  2RNR B;  1SGH A;  1W1H A;  4IOY X;  5CLL B;  5DHA B;  4CYE A;  5LON B;  3O96 A;  4D0N B;  1U29 A;  3VIA A;  2J0M A;  3IVF A;  1V5P A;  2K2J A;  4F7U P;  2D9W A;  4MK0 A;  1UNR A;  3PZD A;  2YF0 A;  3A8P A;  1GG3 A;  3PSC A;  1J0W A;  2ZPY A;  4GXB A;  2R09 A;  4GZU A;  1GC6 A;  1UNP A;  3MDB C;  1N3H A;  1X11 A;  2I5C A;  5JLJ B;  2FJL A;  2DYQ A;  2COA A;  1EVH A;  1ZM0 A;  1U5E A;  4PQ0 A;  2MDX A;  5D27 A;  1TXD A;  2LOX A;  2Y8G A;  4KVG B;  2D9Y A;  2YS5 A;  3P6A A;  2IFS A;  1FGZ A;  1ZVR A;  1PLS A;  1XX0 A;  5KCV A;  4GN1 A;  4HB2 B;  4ZRK A;  2H7E A;  2HE7 A;  4ZRJ A;  1P5T A;  2J0K A;  2P8V A;  4K17 A;  2GCJ A;  5FI0 A;  5C5B B;  2D4Q A;  2H7D A;  4KHA A;  5EFX A;  4A6K A;  3DXC A;  1U5D A;  2W2W A;  1RJ2 A;  2D11 A;  1KZ7 A;  3M1I B;  2D10 A;  2W2X D;  2RLO A;  3KZ1 A;  2Z0O A;  2D9X A;  2LUL A;  2ADZ A;  5HE3 A;  1V5U A;  1WJ1 A;  5D3Y A;  1ZC3 B;  1MK7 B;  3FM8 C;  4EJN A;  4IFS A;  5C16 A;  2GS0 A;  4DX9 0;  3MPX A;  5D3V A;  4HB3 B;  1P6S A;  2Z0Q A;  1QQG A;  3P7Z A;  4YL8 A;  1MKE A;  3QWM A;  2D9Z A;  2CY4 A;  2P0D A;  1H4R A;  2DHK A;  3SO6 A;  1U5F A;  1MIZ B;  3KRW A;  2EC1 A;  2EJ8 A;  2PZ1 A;  4KHO A;  2RVB B;  3DXD A;  3HK0 A;  2GCL A;  2UZS A;  5C5B A;  5KQ4 A;  3TW1 A;  4A6H A;  1PFJ A;  5DH9 B;  2XQN M;  2YS1 A;  2ROZ B;  3WYF B;  1BAK A;  1AQC A;  2HTH B;  4HDO A;  2EMS A;  1RRP B;  1WJM A;  2RUK B;  1WGU A;  2P0H A;  4A5K A;  5D3W A;  1MAI A;  3HQC A;  1Y5O A;  2EMT A;  2DLW A;  1UPR A;  4NSW A;  4EKU A;  2DFK A;  3ODW A;  1WGQ A;  4Y94 A;  3D8F A;  2I5F A;  1X1G A;  1K5G B;  1X1F A;  1J19 A;  4PNK A;  2K2U A;  1K5D B;  2Q13 A;  3PVL A;  3BJI A;  2RGN B;  3ML4 A;  3DXE A;  4C0A A;  2KGX B;  1ZSQ A;  3TO1 A;  2AEH A;  1FHO A;  1EGX A;  2CAY A;  2I1K A;  4DBB A;  1XCG A;  2G35 A;  1LW3 A;  1BTK A;  2VSZ A;  2QKM A;  2RSG A;  1FHX A;  2N0Y A;  1UEF A;  4K2P A;  1SHC A;  2Y8F A;  2VRW B;  2LG1 A;  1I7A A;  3AU4 A;  1EF1 A;  1U2B A;  2M38 A;  1M7R A;  1P3R A;  1OQN A;  3KSY A;  4KHB B;  4GMX B;  3TFM A;  4F7H A;  3D8D A;  2Y7B A;  4H8S A;  3NSU A;  4TYZ A;  1BWN A;  4HAU B;  3SYX A;  3ZDT A;  1W1D A;  2P0F A;  2JP2 A;  4MT7 A;  2BCJ A;  4F7G A;  1NU2 A;  1W1G A;  2DKP A;  2DTC A;  2YVC A;  4K2O A;  3OAN A;  2YT0 A;  2N23 A;  2ELA A;  1MPH A;  1OMW A;  5J3Q A;  3F5R A;  4CHJ A;  4Z2M B;  5L81 A;  1UPQ A;  1U5G A;  1IRS A;  4HHV A;  5C79 A;  2M14 A;  1DDW A;  1Y19 B;  2KUP A;  4HDQ A;  1DBH A;  3ZVR A;  1DDM A;  5C6R A;  2K00 A;  1V88 A;  2AL6 A;  1Z87 A;  4B6H A;  4DXA B;  3ODO A;  5DHF B;  1M7E A;  3FEH A;  3QIJ A;  4HAV B;  2DA0 A;  2MWN B;  3KRX A;  4IAP A;  3GYP A;  2LYD A;  5HE0 A;  4EMO A;  5JHH A;  3U7D A;  1XD4 A;  3U8Z A;  3BIN A;  2LOZ A;  4Z2N A;  4WVF B;  1PMS A;  2DHI A;  1TQZ A;  3AU5 A;  1BTN A;  3KY9 A;  3T06 A;  5J3T A;  2YSZ A;  1FB8 A;  3CIK A;  5JHG A;  4HB4 B;  2UZR A;  5HE1 A;  1XR0 B;  2ELB A;  2COF A;  4CHM A;  2J0J A;  4L6E A;  1FAO A;  1ZC4 B;  2CRF A;  3A98 B;  3FSS A;  1OY2 A;  1V61 A;  1WI1 A;  2MKR A;  5LOP B;  2Z0P A;  4P7I A;  1X86 A;  1FGY A;  3D8E A;  2W2X C;  5DI9 B;  2DX5 A;  4TKN A;  2VKI A;  4HAT B;  2D2Q A;  1NTY A;  1H10 A;  4HAX B;  2NZ8 B;  3ULC A;  2YS3 A;  2QKL A;  3SUZ A;  1E5W A;  4K81 A;  3PVU A;  1XKE A;  1WVH A;  5HE2 A;  1DRO A;  3PVW A;  4NY0 A;  4BBK A;  2DN6 A;  1QC6 A;  2YRY A;  3AJ4 A;  2L1C A;  2D9V A;  5FI1 A;  3WA0 A;  3G9W A;  1FHW A;  2DKQ A;  2GJY A;  1NI2 A;  1I2H A;  1ISN A;  2CY5 A;  1AWE A;  5D3X A;  2E2X A;  2IYB A;  3PEG A;  5GOW B;  3ULB A;  3HW2 B;  3A8Q A;  2KCJ A;  5DIF B;  3LJU X;  4YON A;  1DDV A;  3QBV B;  2DHJ A;  2COC A;  4HB0 B;  3UZT A;  1V89 A;  4DX8 A;  3N7C A;  1KI1 B;  1MIX A;  4A6F B;  2OTX A;  2L2I A;  3GYO A;  2YT1 A;  3PG7 A;  4XWX A;  2DYN A;  4KAX B;  5CLQ B;  3CXB B;  2OQB A;  2UVM A;  2V76 A;  5KQ1 A;  1WG7 A;  4WSF A;  3TVV A;  2LKO A;  1LB1 A;  4HAZ B;  5J3Y A;  1B55 A;  2ROV A;  2J59 M;  1X05 A;  4WJ7 A;  2DX1 A;  2COD A;  3RCP A;  1XOD A;  1EAZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...