3HQCA

Crystal structure of phosphotyrosine-binding domain from the human tensin-like c1 domain-containing phosphatase (tenc1)
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
143
structure length
140
Chain Sequence
STAADLLRQGAACSVLYLTSVETESLTGPQAVARASSAALSCSTPAVVHFKVSAQGITLTDNQRKLFFRRHYPVNSITFSSTDPQDRRWTNPDGTTSKIFGFVAKKPGSPWENVCHLFAELDPDQPAGAIVTFITKVMLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords Tensin-like C1 domain-containing phosphatase
publication title Crystal structure of Phosphotyrosine-binding domain from the Human Tensin-like C1 domain-containing phosphatase (TENC1)
rcsb
source organism Homo sapiens
total genus 30
structure length 140
sequence length 143
ec nomenclature ec 3.1.3.-:
pdb deposition date 2009-06-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08416 PTB Phosphotyrosine-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 3hqcA00
4KVGB 1LW3A 1XD4A 1UPRA 2BCJA 2D9XA 2LYDA 1KZGA 2DFKA 1E5WA 5DH9B 2G35A 1ZSQA 3ODWA 2I5CA 4KHBB 4GN1A 4D0NB 3QIJA 3AU4A 1B55A 1MPHA 2YVCA 4GMXB 1EF1A 2CRFA 2W2WA 4B6HA 2LULA 3F0WA 2DX1A 4HDOA 1ZC3B 5HE3A 5C79A 3PVWA 1V5UA 1NTVA 2Z0OA 2W2XD 2DYNA 1XX0A 1J0WA 2GCLA 1X1FA 2DHKA 2Y7BA 2QKMA 3TW1A 2MFQA 4HAYB 3SYXA 2YT0A 5D3VA 2M14A 1KI1B 2HTHB 3CIKA 1BWNA 3TVVA 2H7DA 1XR0B 2Q13A 3V5WA 2QKLA 2R09A 3SNHA 2H7EA 3KY9A 3HQCA 4H8SA 2D11A 2N0YA 1WGUA 2YSZA 2GS0A 1GG3A 4WJ7A 4GZUA 4HAVB 2D9YA 4PQ0A 3WA0A 5GOWB 4ZRIA 2YRYA 2J59M 4L6EA 1MAIA 2RVBB 2V76A 3DXEA 3ML4A 4HAXB 2ELBA 3T06A 2P0FA 2IYBA 3ZVRA 4KHOA 2R0DA 2UZSA 2FJLA 2I1JA 3D8FA 1V61A 3SO6A 2J0MA 4DX8A 2LG1A 1FGYA 4DX90 1X86A 3VOQA 1N3HA 2DTCA 3CXBB 1Q67A 4Z2NA 5KCVA 2MKRA 2W2XC 3HW2B 3F5RA 3TFMA 1RJ2A 2D10A 3U8ZA 5DHFB 1BAKA 1GC6A 4XWXA 1UNRA 4CHJA 2IFSA 2ZPYA 1Y19B 1W1DA 4K81A 4C0AA 3D8DA 3M1IB 2E2XA 1FHXA 3GYOA 1V88A 2XQNM 1FOEA 5C16A 2Y8FA 2EMSA 4ZRJA 1P3RA 1H4RA 2HE7A 4F7UP 1BTKA 1WG7A 1M7RA 2LKOA 4K17A 1LB1A 2YS5A 5D3YA 4TYZA 1NI2A 4MK0A 1EGXA 3NSUA 2RSGA 4HB0B 2D9VA 3ODXA 4A6FB 1DDMA 2D4QA 2AEHA 2YS1A 2RNRB 1P6SA 1SGHA 2P0DA 3DXDA 1TQZA 5DIFB 2YT1A 4K2PA 1Z87A 3UZTA 2DLWA 3N7CA 4NY0A 1ZC4B 2MWNB 1X05A 1BTNA 3SV1A 1U29A 2DKQA 1P5TA 1UNPA 2AL6A 4HDQA 2CY4A 3HK0A 1NU2A 1AWEA 2DA0A 2MDXA 1MK7B 2N23A 1KZ7A 3PVUA 3MDBC 3ODOA 1U27A 1SHCA 4EJNA 2RGNB 3GYPA 1OY2A 1MIZB 3A8QA 2Y8GA 2KCJA 2ROZB 1DYNA 4WVFB 1WVHA 5L81A 2ROVA 3QWMA 1PFJA 4KHAA 1X11A 1M7EA 5KQ4A 2K2JA 1W1GA 1OQNA 2P8VA 3KRWA 2L1CA 2COFA 2L2IA 1UNQA 1ZM0A 4Z2MB 5D27A 3KSYA 5FI1A 3PEGA 4IAPA 4P7IA 2LOZA 3SUZA 1U5DA 5J3TA 4YL8A 1DDVA 3PP2A 2EMTA 3DXCA 5JHHA 3FM8C 2PZ1A 4DXAB 1XODA 3D8EA 1AQCA 3TCAA 1PLSA 4MY6A 3X23A 2UVMA 1W1HA 3OANA 2EJ8A 4F7HA 5JP4A 3P6AA 3PZDA 1EVHA 3RCPA 3AU5A 1UPQA 4YONA 2LOXA 4K2OA 5J3YA 2J0JA 2EC1A 2ELAA 2J0KA 1U2BA 3PSCA 2DX5A 1IRSA 5LOPB 3WYFB 4A5KA 1QQGA 5CLLB 2YF0A 3IVFA 5JHGA 4HB4B 1FHWA 2VSZA 3O96A 4EMOA 1V5PA 2UZRA 5HE2A 5C5BA 2RLOA 3BJIA 4GMVA 1I2HA 1WGQA 1V5MA 3U7DA 1DDWA 1I7AA 2CAYA 2VRWB 3ZDTA 3QBVB 5EFXA 2DN6A 1MK9B 3BINA 2D2QA 1WJ1A 2ADZA 4HAZB 4HAUB 1OMWA 1NTYA 1MKEA 3LJUX 3G9WA 3KRXA 2OQBA 2I1KA 5KQ1A 1U5GA 4F7GA 2DYQA 1U5FA 5JLJB 2GCJA 1K5GB 5LONB 3AJ4A 1FAOA 2VKIA 4PNKA 2DKPA 4GPTB 1EAZA 1U5EA 4KAXB 2NZ8B 1TXDA 1K5DB 5HE1A 4ZRKA 5FI0A 4HAWB 4IOYX 1DROA 1FGZA 5C5BB 5D3WA 1WJMA 2YS3A 2X18A 4NSWA 1V89A 1XKEA 1RRPB 4GXBA 4HATB 1QC6A 5J3QA 2JP2A 2K2UA 2COCA 5CLQB 2OTXA 2M38A 1FHOA 2CODA 4A6FA 1H10A 4WSFA 3A8PA 4HB3B 4HHVA 5DHAB 2KUPA 2KGXB 1FB8A 1XCGA 4MT7A 1ISNA 3ULBA 1UEFA 2DHJA 5HE0A 2Z0QA 3FEHA 4Y94A 5DI9B 4EKUA 2DHIA 2I5FA 3KZ1A 3P7ZA 2P0HA 1WI1A 2NMBA 4TKNA 2GJYA 1Y5OA 3PVLA 2K00A 4CHMA 2CY5A 3FSSA 1PMSA 3TO1A 4BBKA 4HB2B 1J19A 2RUKB 5C6RA 3VIAA 4A6KA 3MPXA 1GC7A 2Z0PA 2D9WA 1X1GA 4A6HA 1ZVRA 2COAA 5D3XA 3A98B 1TJ6A 3PG7A 4DBBA 4IFSA 3ULCA 4CYEA 1DBHA 1MIXA 2D9ZA
chains in the Genus database with same CATH superfamily
4KVGB 1LW3A 1XD4A 1UPRA 2BCJA 2D9XA 2KIGA 3NWAA 2LYDA 1KZGA 2DFKA 1E5WA 5DH9B 2G35A 1ZSQA 3ODWA 2I5CA 4KHBB 4GN1A 4D0NB 3QIJA 3AU4A 1B55A 1MPHA 2YVCA 4GMXB 1EF1A 2CRFA 2W2WA 4B6HA 2LULA 3F0WA 2YT2A 2DX1A 4HDOA 1ZC3B 5HE3A 5C79A 3PVWA 1V5UA 1NTVA 2Z0OA 5I2MA 5I2SA 2W2XD 2DYNA 1XX0A 1J0WA 2GCLA 1X1FA 2DHKA 2Y7BA 2QKMA 3TW1A 2MFQA 4HAYB 3SYXA 2YT0A 5D3VA 2M14A 1KI1B 2HTHB 3CIKA 1BWNA 3TVVA 2H7DA 1XR0B 2Q13A 4CSQA 3V5WA 2QKLA 2R09A 3SNHA 2H7EA 3KY9A 3HQCA 4H8SA 2D11A 2N0YA 1WGUA 2YSZA 2GS0A 1GG3A 3HIEA 3OHMB 4WJ7A 4GZUA 4HAVB 2D9YA 4PQ0A 3WA0A 5GOWB 4ZRIA 3A58A 2YRYA 2J59M 4L6EA 1MAIA 2GUMA 4QJ3B 2RVBB 2V76A 3DXEA 3ML4A 4HAXB 2ELBA 3T06A 2P0FA 2IYBA 3ZVRA 4QJ5B 4KHOA 2R0DA 2UZSA 2FJLA 2I1JA 3D8FA 1V61A 3SO6A 4HSIA 2J0MA 4DX8A 3NWFA 2LG1A 4D6WA 4KHBA 1FGYA 4DX90 1X86A 3VOQA 1N3HA 2DTCA 3CXBB 1Q67A 4Z2NA 5KCVA 2MKRA 2W2XC 3HW2B 3F5RA 3TFMA 1RJ2A 2D10A 3U8ZA 5DHFB 4OSNA 1BAKA 1GC6A 4XWXA 1UNRA 4CHJA 2IFSA 2ZPYA 1Y19B 1W1DA 4K81A 4C0AA 3D8DA 4DIXA 3DCXA 3M1IB 2E2XA 1FHXA 3GYOA 1V88A 2XQNM 1FOEA 5C16A 2Y8FA 2EMSA 4ZRJA 1P3RA 1H4RA 2HE7A 4F7UP 1BTKA 1WG7A 1M7RA 2LKOA 3HSAA 4K17A 1LB1A 2YS5A 5D3YA 4TYZA 1NI2A 4MK0A 2FJUB 1EGXA 3NSUA 2RSGA 4HB0B 2D9VA 3ODXA 4A6FB 1DDMA 4L1RA 2D4QA 2Z13A 2AEHA 2NBVA 4QXAB 2YS1A 2RNRB 3B77A 4GNKB 3NWDA 1P6SA 1SGHA 2P0DA 3DXDA 1TQZA 2K8EA 5DIFB 2YT1A 4K2PA 1Z87A 2Z4DA 3UZTA 2DLWA 3N7CA 4NY0A 1ZC4B 2MWNB 1X05A 1BTNA 3SV1A 1U29A 2DKQA 1P5TA 1UNPA 2AL6A 3NW8A 4HDQA 2CY4A 2R2YA 3HK0A 1NU2A 1AWEA 2DA0A 2MDXA 2KR0A 1MK7B 2N23A 1KZ7A 3PVUA 3MDBC 5M4YB 1MI1A 3ODOA 1U27A 1SHCA 4EJNA 2RGNB 3GYPA 1OY2A 1MIZB 3A8QA 2Y8GA 2KCJA 2ROZB 1DYNA 4WVFB 1WVHA 5L81A 2ROVA 3QWMA 1PFJA 4KHAA 1X11A 1M7EA 1T77A 5KQ4A 2K2JA 1W1GA 1OQNA 2P8VA 3KRWA 2Z14A 2L1CA 2K49A 4GOUA 2COFA 2L2IA 1UNQA 1ZM0A 4Z2MB 5D27A 3KSYA 5FI1A 3PEGA 4IAPA 4P7IA 2LOZA 3SUZA 1U5DA 5J3TA 4YL8A 1DDVA 3PP2A 2EMTA 3DXCA 5JHHA 3FM8C 2PZ1A 4DXAB 1XODA 3D8EA 1AQCA 3TCAA 1PLSA 4MY6A 3X23A 2UVMA 1W1HA 3OANA 2EJ8A 4F7HA 5JP4A 3P6AA 3PZDA 1EVHA 3RCPA 3AU5A 1UPQA 4YONA 2LOXA 4K2OA 5J3YA 2J0JA 2EC1A 2ELAA 2J0KA 1U2BA 3PSCA 2DX5A 1IRSA 5LOPB 4QJ4B 3WYFB 2KUQA 4A5KA 1QQGA 5CLLB 2YF0A 3IVFA 5JHGA 4HB4B 1FHWA 1ZYIA 2VSZA 3O96A 4EMOA 5LG4B 1V5PA 2UZRA 5HE2A 5C5BA 2RLOA 3BJIA 4GMVA 1I2HA 1WGQA 1V5MA 3U7DA 1DDWA 2RRFA 1I7AA 2CAYA 2VRWB 3ZDTA 3QBVB 5EFXA 2DN6A 1MK9B 3BINA 2D2QA 1WJ1A 2ADZA 4HAZB 4HAUB 1OMWA 1NTYA 1MKEA 3LJUX 3G9WA 3KRXA 2OQBA 2I1KA 5KQ1A 1U5GA 4F7GA 2DYQA 1U5FA 3FVCA 5JLJB 2GCJA 1K5GB 5LONB 3AJ4A 1FAOA 2VKIA 4PNKA 2DKPA 4GPTB 1EAZA 1U5EA 4KAXB 2NZ8B 2ZKMX 1TXDA 1K5DB 5HE1A 4ZRKA 5FI0A 4HAWB 4IOYX 4OT1A 1DROA 1FGZA 5C5BB 5D3WA 5IRSA 1WJMA 2YS3A 2X18A 4NSWA 1V89A 1XKEA 1RRPB 4GXBA 4HATB 1QC6A 5J3QA 2JP2A 2K2UA 2COCA 5CLQB 2OTXA 3U12A 2M38A 1FHOA 2CODA 4A6FA 1H10A 4WSFA 3A8PA 4HB3B 4HHVA 2Z59A 5DHAB 2KUPA 2KGXB 1FB8A 1XCGA 4MT7A 1ISNA 3ULBA 1UEFA 2DHJA 5HE0A 2Z0QA 3FEHA 4Y94A 5DI9B 4EKUA 2DHIA 2I5FA 3KZ1A 3P7ZA 2P0HA 1WI1A 2NMBA 4TKNA 2GJYA 1Y5OA 3PVLA 2K00A 4CHMA 2CY5A 3FSSA 1PMSA 3TO1A 4BBKA 4HB2B 1J19A 2RUKB 5C6RA 3VIAA 4A6KA 3MPXA 1GC7A 2Z0PA 2D9WA 1X1GA 4A6HA 1ZVRA 2COAA 5D3XA 3A98B 1TJ6A 2KIEA 3PG7A 4DBBA 4IFSA 3ULCA 4CYEA 1DBHA 1MIXA 2D9ZA
chains in the Genus database with same CATH topology
4KVGB 1LW3A 1XD4A 1UPRA 2BCJA 2D9XA 2LYDA 1KZGA 2DFKA 1E5WA 5DH9B 2G35A 1ZSQA 3ODWA 2I5CA 4KHBB 4GN1A 4D0NB 3QIJA 3AU4A 1B55A 1MPHA 2YVCA 4GMXB 1EF1A 2CRFA 2W2WA 4B6HA 2LULA 3F0WA 2DX1A 4HDOA 1ZC3B 5HE3A 5C79A 3PVWA 1V5UA 1NTVA 2Z0OA 2W2XD 2DYNA 1XX0A 1J0WA 2GCLA 1X1FA 2DHKA 2Y7BA 2QKMA 3TW1A 2MFQA 4HAYB 3SYXA 2YT0A 5D3VA 2M14A 1KI1B 2HTHB 3CIKA 1BWNA 3TVVA 2H7DA 1XR0B 2Q13A 3V5WA 2QKLA 2R09A 3SNHA 2H7EA 3KY9A 3HQCA 4H8SA 2D11A 2N0YA 1WGUA 2YSZA 2GS0A 1GG3A 4WJ7A 4GZUA 4HAVB 2D9YA 4PQ0A 3WA0A 5GOWB 4ZRIA 2YRYA 2J59M 4L6EA 1MAIA 2RVBB 2V76A 3DXEA 3ML4A 4HAXB 2ELBA 3T06A 2P0FA 2IYBA 3ZVRA 4KHOA 2R0DA 2UZSA 2FJLA 2I1JA 3D8FA 1V61A 3SO6A 2J0MA 4DX8A 2LG1A 1FGYA 4DX90 1X86A 3VOQA 1N3HA 2DTCA 3CXBB 1Q67A 4Z2NA 5KCVA 2MKRA 2W2XC 3HW2B 3F5RA 3TFMA 1RJ2A 2D10A 3U8ZA 5DHFB 1BAKA 1GC6A 4XWXA 1UNRA 4CHJA 2IFSA 2ZPYA 1Y19B 1W1DA 4K81A 4C0AA 3D8DA 3M1IB 2E2XA 1FHXA 3GYOA 1V88A 2XQNM 1FOEA 5C16A 2Y8FA 2EMSA 4ZRJA 1P3RA 1H4RA 2HE7A 4F7UP 1BTKA 1WG7A 1M7RA 2LKOA 4K17A 1LB1A 2YS5A 5D3YA 4TYZA 1NI2A 4MK0A 1EGXA 3NSUA 2RSGA 4HB0B 2D9VA 3ODXA 4A6FB 1DDMA 2D4QA 2AEHA 2YS1A 2RNRB 1P6SA 1SGHA 2P0DA 3DXDA 1TQZA 5DIFB 2YT1A 4K2PA 1Z87A 3UZTA 2DLWA 3N7CA 4NY0A 1ZC4B 2MWNB 1X05A 1BTNA 3SV1A 1U29A 2DKQA 1P5TA 1UNPA 2AL6A 4HDQA 2CY4A 3HK0A 1NU2A 1AWEA 2DA0A 2MDXA 1MK7B 2N23A 1KZ7A 3PVUA 3MDBC 3ODOA 1U27A 1SHCA 4EJNA 2RGNB 3GYPA 1OY2A 1MIZB 3A8QA 2Y8GA 2KCJA 2ROZB 1DYNA 4WVFB 1WVHA 5L81A 2ROVA 3QWMA 1PFJA 4KHAA 1X11A 1M7EA 5KQ4A 2K2JA 1W1GA 1OQNA 2P8VA 3KRWA 2L1CA 2COFA 2L2IA 1UNQA 1ZM0A 4Z2MB 5D27A 3KSYA 5FI1A 3PEGA 4IAPA 4P7IA 2LOZA 3SUZA 1U5DA 5J3TA 4YL8A 1DDVA 3PP2A 2EMTA 3DXCA 5JHHA 3FM8C 2PZ1A 4DXAB 1XODA 3D8EA 1AQCA 3TCAA 1PLSA 4MY6A 3X23A 2UVMA 1W1HA 3OANA 2EJ8A 4F7HA 5JP4A 3P6AA 3PZDA 1EVHA 3RCPA 3AU5A 1UPQA 4YONA 2LOXA 4K2OA 5J3YA 2J0JA 2EC1A 2ELAA 2J0KA 1U2BA 3PSCA 2DX5A 1IRSA 5LOPB 3WYFB 4A5KA 1QQGA 5CLLB 2YF0A 3IVFA 5JHGA 4HB4B 1FHWA 2VSZA 3O96A 4EMOA 1V5PA 2UZRA 5HE2A 5C5BA 2RLOA 3BJIA 4GMVA 1I2HA 1WGQA 1V5MA 3U7DA 1DDWA 1I7AA 2CAYA 2VRWB 3ZDTA 3QBVB 5EFXA 2DN6A 1MK9B 3BINA 2D2QA 1WJ1A 2ADZA 4HAZB 4HAUB 1OMWA 1NTYA 1MKEA 3LJUX 3G9WA 3KRXA 2OQBA 2I1KA 5KQ1A 1U5GA 4F7GA 2DYQA 1U5FA 5JLJB 2GCJA 1K5GB 5LONB 3AJ4A 1FAOA 2VKIA 4PNKA 2DKPA 4GPTB 1EAZA 1U5EA 4KAXB 2NZ8B 1TXDA 1K5DB 5HE1A 4ZRKA 5FI0A 4HAWB 4IOYX 1DROA 1FGZA 5C5BB 5D3WA 1WJMA 2YS3A 2X18A 4NSWA 1V89A 1XKEA 1RRPB 4GXBA 4HATB 1QC6A 5J3QA 2JP2A 2K2UA 2COCA 5CLQB 2OTXA 2M38A 1FHOA 2CODA 4A6FA 1H10A 4WSFA 3A8PA 4HB3B 4HHVA 5DHAB 2KUPA 2KGXB 1FB8A 1XCGA 4MT7A 1ISNA 3ULBA 1UEFA 2DHJA 5HE0A 2Z0QA 3FEHA 4Y94A 5DI9B 4EKUA 2DHIA 2I5FA 3KZ1A 3P7ZA 2P0HA 1WI1A 2NMBA 4TKNA 2GJYA 1Y5OA 3PVLA 2K00A 4CHMA 2CY5A 3FSSA 1PMSA 3TO1A 4BBKA 4HB2B 1J19A 2RUKB 5C6RA 3VIAA 4A6KA 3MPXA 1GC7A 2Z0PA 2D9WA 1X1GA 4A6HA 1ZVRA 2COAA 5D3XA 3A98B 1TJ6A 3PG7A 4DBBA 4IFSA 3ULCA 4CYEA 1DBHA 1MIXA 2D9ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KVG B;  1LW3 A;  1XD4 A;  1UPR A;  2BCJ A;  2D9X A;  2LYD A;  1KZG A;  2DFK A;  1E5W A;  5DH9 B;  2G35 A;  1ZSQ A;  3ODW A;  2I5C A;  4KHB B;  4GN1 A;  4D0N B;  3QIJ A;  3AU4 A;  1B55 A;  1MPH A;  2YVC A;  4GMX B;  1EF1 A;  2CRF A;  2W2W A;  4B6H A;  2LUL A;  3F0W A;  2DX1 A;  4HDO A;  1ZC3 B;  5HE3 A;  5C79 A;  3PVW A;  1V5U A;  1NTV A;  2Z0O A;  2W2X D;  2DYN A;  1XX0 A;  1J0W A;  2GCL A;  1X1F A;  2DHK A;  2Y7B A;  2QKM A;  3TW1 A;  2MFQ A;  4HAY B;  3SYX A;  2YT0 A;  5D3V A;  2M14 A;  1KI1 B;  2HTH B;  3CIK A;  1BWN A;  3TVV A;  2H7D A;  1XR0 B;  2Q13 A;  3V5W A;  2QKL A;  2R09 A;  3SNH A;  2H7E A;  3KY9 A;  3HQC A;  4H8S A;  2D11 A;  2N0Y A;  1WGU A;  2YSZ A;  2GS0 A;  1GG3 A;  4WJ7 A;  4GZU A;  4HAV B;  2D9Y A;  4PQ0 A;  3WA0 A;  5GOW B;  4ZRI A;  2YRY A;  2J59 M;  4L6E A;  1MAI A;  2RVB B;  2V76 A;  3DXE A;  3ML4 A;  4HAX B;  2ELB A;  3T06 A;  2P0F A;  2IYB A;  3ZVR A;  4KHO A;  2R0D A;  2UZS A;  2FJL A;  2I1J A;  3D8F A;  1V61 A;  3SO6 A;  2J0M A;  4DX8 A;  2LG1 A;  1FGY A;  4DX9 0;  1X86 A;  3VOQ A;  1N3H A;  2DTC A;  3CXB B;  1Q67 A;  4Z2N A;  5KCV A;  2MKR A;  2W2X C;  3HW2 B;  3F5R A;  3TFM A;  1RJ2 A;  2D10 A;  3U8Z A;  5DHF B;  1BAK A;  1GC6 A;  4XWX A;  1UNR A;  4CHJ A;  2IFS A;  2ZPY A;  1Y19 B;  1W1D A;  4K81 A;  4C0A A;  3D8D A;  3M1I B;  2E2X A;  1FHX A;  3GYO A;  1V88 A;  2XQN M;  1FOE A;  5C16 A;  2Y8F A;  2EMS A;  4ZRJ A;  1P3R A;  1H4R A;  2HE7 A;  4F7U P;  1BTK A;  1WG7 A;  1M7R A;  2LKO A;  4K17 A;  1LB1 A;  2YS5 A;  5D3Y A;  4TYZ A;  1NI2 A;  4MK0 A;  1EGX A;  3NSU A;  2RSG A;  4HB0 B;  2D9V A;  3ODX A;  4A6F B;  1DDM A;  2D4Q A;  2AEH A;  2YS1 A;  2RNR B;  1P6S A;  1SGH A;  2P0D A;  3DXD A;  1TQZ A;  5DIF B;  2YT1 A;  4K2P A;  1Z87 A;  3UZT A;  2DLW A;  3N7C A;  4NY0 A;  1ZC4 B;  2MWN B;  1X05 A;  1BTN A;  3SV1 A;  1U29 A;  2DKQ A;  1P5T A;  1UNP A;  2AL6 A;  4HDQ A;  2CY4 A;  3HK0 A;  1NU2 A;  1AWE A;  2DA0 A;  2MDX A;  1MK7 B;  2N23 A;  1KZ7 A;  3PVU A;  3MDB C;  3ODO A;  1U27 A;  1SHC A;  4EJN A;  2RGN B;  3GYP A;  1OY2 A;  1MIZ B;  3A8Q A;  2Y8G A;  2KCJ A;  2ROZ B;  1DYN A;  4WVF B;  1WVH A;  5L81 A;  2ROV A;  3QWM A;  1PFJ A;  4KHA A;  1X11 A;  1M7E A;  5KQ4 A;  2K2J A;  1W1G A;  1OQN A;  2P8V A;  3KRW A;  2L1C A;  2COF A;  2L2I A;  1UNQ A;  1ZM0 A;  4Z2M B;  5D27 A;  3KSY A;  5FI1 A;  3PEG A;  4IAP A;  4P7I A;  2LOZ A;  3SUZ A;  1U5D A;  5J3T A;  4YL8 A;  1DDV A;  3PP2 A;  2EMT A;  3DXC A;  5JHH A;  3FM8 C;  2PZ1 A;  4DXA B;  1XOD A;  3D8E A;  1AQC A;  3TCA A;  1PLS A;  4MY6 A;  3X23 A;  2UVM A;  1W1H A;  3OAN A;  2EJ8 A;  4F7H A;  5JP4 A;  3P6A A;  3PZD A;  1EVH A;  3RCP A;  3AU5 A;  1UPQ A;  4YON A;  2LOX A;  4K2O A;  5J3Y A;  2J0J A;  2EC1 A;  2ELA A;  2J0K A;  1U2B A;  3PSC A;  2DX5 A;  1IRS A;  5LOP B;  3WYF B;  4A5K A;  1QQG A;  5CLL B;  2YF0 A;  3IVF A;  5JHG A;  4HB4 B;  1FHW A;  2VSZ A;  3O96 A;  4EMO A;  1V5P A;  2UZR A;  5HE2 A;  5C5B A;  2RLO A;  3BJI A;  4GMV A;  1I2H A;  1WGQ A;  1V5M A;  3U7D A;  1DDW A;  1I7A A;  2CAY A;  2VRW B;  3ZDT A;  3QBV B;  5EFX A;  2DN6 A;  1MK9 B;  3BIN A;  2D2Q A;  1WJ1 A;  2ADZ A;  4HAZ B;  4HAU B;  1OMW A;  1NTY A;  1MKE A;  3LJU X;  3G9W A;  3KRX A;  2OQB A;  2I1K A;  5KQ1 A;  1U5G A;  4F7G A;  2DYQ A;  1U5F A;  5JLJ B;  2GCJ A;  1K5G B;  5LON B;  3AJ4 A;  1FAO A;  2VKI A;  4PNK A;  2DKP A;  4GPT B;  1EAZ A;  1U5E A;  4KAX B;  2NZ8 B;  1TXD A;  1K5D B;  5HE1 A;  4ZRK A;  5FI0 A;  4HAW B;  4IOY X;  1DRO A;  1FGZ A;  5C5B B;  5D3W A;  1WJM A;  2YS3 A;  2X18 A;  4NSW A;  1V89 A;  1XKE A;  1RRP B;  4GXB A;  4HAT B;  1QC6 A;  5J3Q A;  2JP2 A;  2K2U A;  2COC A;  5CLQ B;  2OTX A;  2M38 A;  1FHO A;  2COD A;  4A6F A;  1H10 A;  4WSF A;  3A8P A;  4HB3 B;  4HHV A;  5DHA B;  2KUP A;  2KGX B;  1FB8 A;  1XCG A;  4MT7 A;  1ISN A;  3ULB A;  1UEF A;  2DHJ A;  5HE0 A;  2Z0Q A;  3FEH A;  4Y94 A;  5DI9 B;  4EKU A;  2DHI A;  2I5F A;  3KZ1 A;  3P7Z A;  2P0H A;  1WI1 A;  2NMB A;  4TKN A;  2GJY A;  1Y5O A;  3PVL A;  2K00 A;  4CHM A;  2CY5 A;  3FSS A;  1PMS A;  3TO1 A;  4BBK A;  4HB2 B;  1J19 A;  2RUK B;  5C6R A;  3VIA A;  4A6K A;  3MPX A;  1GC7 A;  2Z0P A;  2D9W A;  1X1G A;  4A6H A;  1ZVR A;  2COA A;  5D3X A;  3A98 B;  1TJ6 A;  3PG7 A;  4DBB A;  4IFS A;  3ULC A;  4CYE A;  1DBH A;  1MIX A;  2D9Z A; 
#chains in the Genus database with same CATH topology
 4KVG B;  1LW3 A;  1XD4 A;  1UPR A;  2BCJ A;  2D9X A;  2KIG A;  3NWA A;  2LYD A;  1KZG A;  2DFK A;  1E5W A;  5DH9 B;  2G35 A;  1ZSQ A;  3ODW A;  2I5C A;  4KHB B;  4GN1 A;  4D0N B;  3QIJ A;  3AU4 A;  1B55 A;  1MPH A;  2YVC A;  4GMX B;  1EF1 A;  2CRF A;  2W2W A;  4B6H A;  2LUL A;  3F0W A;  2YT2 A;  2DX1 A;  4HDO A;  1ZC3 B;  5HE3 A;  5C79 A;  3PVW A;  1V5U A;  1NTV A;  2Z0O A;  5I2M A;  5I2S A;  2W2X D;  2DYN A;  1XX0 A;  1J0W A;  2GCL A;  1X1F A;  2DHK A;  2Y7B A;  2QKM A;  3TW1 A;  2MFQ A;  4HAY B;  3SYX A;  2YT0 A;  5D3V A;  2M14 A;  1KI1 B;  2HTH B;  3CIK A;  1BWN A;  3TVV A;  2H7D A;  1XR0 B;  2Q13 A;  4CSQ A;  3V5W A;  2QKL A;  2R09 A;  3SNH A;  2H7E A;  3KY9 A;  3HQC A;  4H8S A;  2D11 A;  2N0Y A;  1WGU A;  2YSZ A;  2GS0 A;  1GG3 A;  3HIE A;  3OHM B;  4WJ7 A;  4GZU A;  4HAV B;  2D9Y A;  4PQ0 A;  3WA0 A;  5GOW B;  4ZRI A;  3A58 A;  2YRY A;  2J59 M;  4L6E A;  1MAI A;  2GUM A;  4QJ3 B;  2RVB B;  2V76 A;  3DXE A;  3ML4 A;  4HAX B;  2ELB A;  3T06 A;  2P0F A;  2IYB A;  3ZVR A;  4QJ5 B;  4KHO A;  2R0D A;  2UZS A;  2FJL A;  2I1J A;  3D8F A;  1V61 A;  3SO6 A;  4HSI A;  2J0M A;  4DX8 A;  3NWF A;  2LG1 A;  4D6W A;  4KHB A;  1FGY A;  4DX9 0;  1X86 A;  3VOQ A;  1N3H A;  2DTC A;  3CXB B;  1Q67 A;  4Z2N A;  5KCV A;  2MKR A;  2W2X C;  3HW2 B;  3F5R A;  3TFM A;  1RJ2 A;  2D10 A;  3U8Z A;  5DHF B;  4OSN A;  1BAK A;  1GC6 A;  4XWX A;  1UNR A;  4CHJ A;  2IFS A;  2ZPY A;  1Y19 B;  1W1D A;  4K81 A;  4C0A A;  3D8D A;  4DIX A;  3DCX A;  3M1I B;  2E2X A;  1FHX A;  3GYO A;  1V88 A;  2XQN M;  1FOE A;  5C16 A;  2Y8F A;  2EMS A;  4ZRJ A;  1P3R A;  1H4R A;  2HE7 A;  4F7U P;  1BTK A;  1WG7 A;  1M7R A;  2LKO A;  3HSA A;  4K17 A;  1LB1 A;  2YS5 A;  5D3Y A;  4TYZ A;  1NI2 A;  4MK0 A;  2FJU B;  1EGX A;  3NSU A;  2RSG A;  4HB0 B;  2D9V A;  3ODX A;  4A6F B;  1DDM A;  4L1R A;  2D4Q A;  2Z13 A;  2AEH A;  2NBV A;  4QXA B;  2YS1 A;  2RNR B;  3B77 A;  4GNK B;  3NWD A;  1P6S A;  1SGH A;  2P0D A;  3DXD A;  1TQZ A;  2K8E A;  5DIF B;  2YT1 A;  4K2P A;  1Z87 A;  2Z4D A;  3UZT A;  2DLW A;  3N7C A;  4NY0 A;  1ZC4 B;  2MWN B;  1X05 A;  1BTN A;  3SV1 A;  1U29 A;  2DKQ A;  1P5T A;  1UNP A;  2AL6 A;  3NW8 A;  4HDQ A;  2CY4 A;  2R2Y A;  3HK0 A;  1NU2 A;  1AWE A;  2DA0 A;  2MDX A;  2KR0 A;  1MK7 B;  2N23 A;  1KZ7 A;  3PVU A;  3MDB C;  5M4Y B;  1MI1 A;  3ODO A;  1U27 A;  1SHC A;  4EJN A;  2RGN B;  3GYP A;  1OY2 A;  1MIZ B;  3A8Q A;  2Y8G A;  2KCJ A;  2ROZ B;  1DYN A;  4WVF B;  1WVH A;  5L81 A;  2ROV A;  3QWM A;  1PFJ A;  4KHA A;  1X11 A;  1M7E A;  1T77 A;  5KQ4 A;  2K2J A;  1W1G A;  1OQN A;  2P8V A;  3KRW A;  2Z14 A;  2L1C A;  2K49 A;  4GOU A;  2COF A;  2L2I A;  1UNQ A;  1ZM0 A;  4Z2M B;  5D27 A;  3KSY A;  5FI1 A;  3PEG A;  4IAP A;  4P7I A;  2LOZ A;  3SUZ A;  1U5D A;  5J3T A;  4YL8 A;  1DDV A;  3PP2 A;  2EMT A;  3DXC A;  5JHH A;  3FM8 C;  2PZ1 A;  4DXA B;  1XOD A;  3D8E A;  1AQC A;  3TCA A;  1PLS A;  4MY6 A;  3X23 A;  2UVM A;  1W1H A;  3OAN A;  2EJ8 A;  4F7H A;  5JP4 A;  3P6A A;  3PZD A;  1EVH A;  3RCP A;  3AU5 A;  1UPQ A;  4YON A;  2LOX A;  4K2O A;  5J3Y A;  2J0J A;  2EC1 A;  2ELA A;  2J0K A;  1U2B A;  3PSC A;  2DX5 A;  1IRS A;  5LOP B;  4QJ4 B;  3WYF B;  2KUQ A;  4A5K A;  1QQG A;  5CLL B;  2YF0 A;  3IVF A;  5JHG A;  4HB4 B;  1FHW A;  1ZYI A;  2VSZ A;  3O96 A;  4EMO A;  5LG4 B;  1V5P A;  2UZR A;  5HE2 A;  5C5B A;  2RLO A;  3BJI A;  4GMV A;  1I2H A;  1WGQ A;  1V5M A;  3U7D A;  1DDW A;  2RRF A;  1I7A A;  2CAY A;  2VRW B;  3ZDT A;  3QBV B;  5EFX A;  2DN6 A;  1MK9 B;  3BIN A;  2D2Q A;  1WJ1 A;  2ADZ A;  4HAZ B;  4HAU B;  1OMW A;  1NTY A;  1MKE A;  3LJU X;  3G9W A;  3KRX A;  2OQB A;  2I1K A;  5KQ1 A;  1U5G A;  4F7G A;  2DYQ A;  1U5F A;  3FVC A;  5JLJ B;  2GCJ A;  1K5G B;  5LON B;  3AJ4 A;  1FAO A;  2VKI A;  4PNK A;  2DKP A;  4GPT B;  1EAZ A;  1U5E A;  4KAX B;  2NZ8 B;  2ZKM X;  1TXD A;  1K5D B;  5HE1 A;  4ZRK A;  5FI0 A;  4HAW B;  4IOY X;  4OT1 A;  1DRO A;  1FGZ A;  5C5B B;  5D3W A;  5IRS A;  1WJM A;  2YS3 A;  2X18 A;  4NSW A;  1V89 A;  1XKE A;  1RRP B;  4GXB A;  4HAT B;  1QC6 A;  5J3Q A;  2JP2 A;  2K2U A;  2COC A;  5CLQ B;  2OTX A;  3U12 A;  2M38 A;  1FHO A;  2COD A;  4A6F A;  1H10 A;  4WSF A;  3A8P A;  4HB3 B;  4HHV A;  2Z59 A;  5DHA B;  2KUP A;  2KGX B;  1FB8 A;  1XCG A;  4MT7 A;  1ISN A;  3ULB A;  1UEF A;  2DHJ A;  5HE0 A;  2Z0Q A;  3FEH A;  4Y94 A;  5DI9 B;  4EKU A;  2DHI A;  2I5F A;  3KZ1 A;  3P7Z A;  2P0H A;  1WI1 A;  2NMB A;  4TKN A;  2GJY A;  1Y5O A;  3PVL A;  2K00 A;  4CHM A;  2CY5 A;  3FSS A;  1PMS A;  3TO1 A;  4BBK A;  4HB2 B;  1J19 A;  2RUK B;  5C6R A;  3VIA A;  4A6K A;  3MPX A;  1GC7 A;  2Z0P A;  2D9W A;  1X1G A;  4A6H A;  1ZVR A;  2COA A;  5D3X A;  3A98 B;  1TJ6 A;  2KIE A;  3PG7 A;  4DBB A;  4IFS A;  3ULC A;  4CYE A;  1DBH A;  1MIX A;  2D9Z A; 
#chains in the Genus database with same CATH homology
 4KVG B;  1LW3 A;  1XD4 A;  1UPR A;  2BCJ A;  2D9X A;  2LYD A;  1KZG A;  2DFK A;  1E5W A;  5DH9 B;  2G35 A;  1ZSQ A;  3ODW A;  2I5C A;  4KHB B;  4GN1 A;  4D0N B;  3QIJ A;  3AU4 A;  1B55 A;  1MPH A;  2YVC A;  4GMX B;  1EF1 A;  2CRF A;  2W2W A;  4B6H A;  2LUL A;  3F0W A;  2DX1 A;  4HDO A;  1ZC3 B;  5HE3 A;  5C79 A;  3PVW A;  1V5U A;  1NTV A;  2Z0O A;  2W2X D;  2DYN A;  1XX0 A;  1J0W A;  2GCL A;  1X1F A;  2DHK A;  2Y7B A;  2QKM A;  3TW1 A;  2MFQ A;  4HAY B;  3SYX A;  2YT0 A;  5D3V A;  2M14 A;  1KI1 B;  2HTH B;  3CIK A;  1BWN A;  3TVV A;  2H7D A;  1XR0 B;  2Q13 A;  3V5W A;  2QKL A;  2R09 A;  3SNH A;  2H7E A;  3KY9 A;  3HQC A;  4H8S A;  2D11 A;  2N0Y A;  1WGU A;  2YSZ A;  2GS0 A;  1GG3 A;  4WJ7 A;  4GZU A;  4HAV B;  2D9Y A;  4PQ0 A;  3WA0 A;  5GOW B;  4ZRI A;  2YRY A;  2J59 M;  4L6E A;  1MAI A;  2RVB B;  2V76 A;  3DXE A;  3ML4 A;  4HAX B;  2ELB A;  3T06 A;  2P0F A;  2IYB A;  3ZVR A;  4KHO A;  2R0D A;  2UZS A;  2FJL A;  2I1J A;  3D8F A;  1V61 A;  3SO6 A;  2J0M A;  4DX8 A;  2LG1 A;  1FGY A;  4DX9 0;  1X86 A;  3VOQ A;  1N3H A;  2DTC A;  3CXB B;  1Q67 A;  4Z2N A;  5KCV A;  2MKR A;  2W2X C;  3HW2 B;  3F5R A;  3TFM A;  1RJ2 A;  2D10 A;  3U8Z A;  5DHF B;  1BAK A;  1GC6 A;  4XWX A;  1UNR A;  4CHJ A;  2IFS A;  2ZPY A;  1Y19 B;  1W1D A;  4K81 A;  4C0A A;  3D8D A;  3M1I B;  2E2X A;  1FHX A;  3GYO A;  1V88 A;  2XQN M;  1FOE A;  5C16 A;  2Y8F A;  2EMS A;  4ZRJ A;  1P3R A;  1H4R A;  2HE7 A;  4F7U P;  1BTK A;  1WG7 A;  1M7R A;  2LKO A;  4K17 A;  1LB1 A;  2YS5 A;  5D3Y A;  4TYZ A;  1NI2 A;  4MK0 A;  1EGX A;  3NSU A;  2RSG A;  4HB0 B;  2D9V A;  3ODX A;  4A6F B;  1DDM A;  2D4Q A;  2AEH A;  2YS1 A;  2RNR B;  1P6S A;  1SGH A;  2P0D A;  3DXD A;  1TQZ A;  5DIF B;  2YT1 A;  4K2P A;  1Z87 A;  3UZT A;  2DLW A;  3N7C A;  4NY0 A;  1ZC4 B;  2MWN B;  1X05 A;  1BTN A;  3SV1 A;  1U29 A;  2DKQ A;  1P5T A;  1UNP A;  2AL6 A;  4HDQ A;  2CY4 A;  3HK0 A;  1NU2 A;  1AWE A;  2DA0 A;  2MDX A;  1MK7 B;  2N23 A;  1KZ7 A;  3PVU A;  3MDB C;  3ODO A;  1U27 A;  1SHC A;  4EJN A;  2RGN B;  3GYP A;  1OY2 A;  1MIZ B;  3A8Q A;  2Y8G A;  2KCJ A;  2ROZ B;  1DYN A;  4WVF B;  1WVH A;  5L81 A;  2ROV A;  3QWM A;  1PFJ A;  4KHA A;  1X11 A;  1M7E A;  5KQ4 A;  2K2J A;  1W1G A;  1OQN A;  2P8V A;  3KRW A;  2L1C A;  2COF A;  2L2I A;  1UNQ A;  1ZM0 A;  4Z2M B;  5D27 A;  3KSY A;  5FI1 A;  3PEG A;  4IAP A;  4P7I A;  2LOZ A;  3SUZ A;  1U5D A;  5J3T A;  4YL8 A;  1DDV A;  3PP2 A;  2EMT A;  3DXC A;  5JHH A;  3FM8 C;  2PZ1 A;  4DXA B;  1XOD A;  3D8E A;  1AQC A;  3TCA A;  1PLS A;  4MY6 A;  3X23 A;  2UVM A;  1W1H A;  3OAN A;  2EJ8 A;  4F7H A;  5JP4 A;  3P6A A;  3PZD A;  1EVH A;  3RCP A;  3AU5 A;  1UPQ A;  4YON A;  2LOX A;  4K2O A;  5J3Y A;  2J0J A;  2EC1 A;  2ELA A;  2J0K A;  1U2B A;  3PSC A;  2DX5 A;  1IRS A;  5LOP B;  3WYF B;  4A5K A;  1QQG A;  5CLL B;  2YF0 A;  3IVF A;  5JHG A;  4HB4 B;  1FHW A;  2VSZ A;  3O96 A;  4EMO A;  1V5P A;  2UZR A;  5HE2 A;  5C5B A;  2RLO A;  3BJI A;  4GMV A;  1I2H A;  1WGQ A;  1V5M A;  3U7D A;  1DDW A;  1I7A A;  2CAY A;  2VRW B;  3ZDT A;  3QBV B;  5EFX A;  2DN6 A;  1MK9 B;  3BIN A;  2D2Q A;  1WJ1 A;  2ADZ A;  4HAZ B;  4HAU B;  1OMW A;  1NTY A;  1MKE A;  3LJU X;  3G9W A;  3KRX A;  2OQB A;  2I1K A;  5KQ1 A;  1U5G A;  4F7G A;  2DYQ A;  1U5F A;  5JLJ B;  2GCJ A;  1K5G B;  5LON B;  3AJ4 A;  1FAO A;  2VKI A;  4PNK A;  2DKP A;  4GPT B;  1EAZ A;  1U5E A;  4KAX B;  2NZ8 B;  1TXD A;  1K5D B;  5HE1 A;  4ZRK A;  5FI0 A;  4HAW B;  4IOY X;  1DRO A;  1FGZ A;  5C5B B;  5D3W A;  1WJM A;  2YS3 A;  2X18 A;  4NSW A;  1V89 A;  1XKE A;  1RRP B;  4GXB A;  4HAT B;  1QC6 A;  5J3Q A;  2JP2 A;  2K2U A;  2COC A;  5CLQ B;  2OTX A;  2M38 A;  1FHO A;  2COD A;  4A6F A;  1H10 A;  4WSF A;  3A8P A;  4HB3 B;  4HHV A;  5DHA B;  2KUP A;  2KGX B;  1FB8 A;  1XCG A;  4MT7 A;  1ISN A;  3ULB A;  1UEF A;  2DHJ A;  5HE0 A;  2Z0Q A;  3FEH A;  4Y94 A;  5DI9 B;  4EKU A;  2DHI A;  2I5F A;  3KZ1 A;  3P7Z A;  2P0H A;  1WI1 A;  2NMB A;  4TKN A;  2GJY A;  1Y5O A;  3PVL A;  2K00 A;  4CHM A;  2CY5 A;  3FSS A;  1PMS A;  3TO1 A;  4BBK A;  4HB2 B;  1J19 A;  2RUK B;  5C6R A;  3VIA A;  4A6K A;  3MPX A;  1GC7 A;  2Z0P A;  2D9W A;  1X1G A;  4A6H A;  1ZVR A;  2COA A;  5D3X A;  3A98 B;  1TJ6 A;  3PG7 A;  4DBB A;  4IFS A;  3ULC A;  4CYE A;  1DBH A;  1MIX A;  2D9Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...