3HQCA

Crystal structure of phosphotyrosine-binding domain from the human tensin-like c1 domain-containing phosphatase (tenc1)
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
143
structure length
140
Chain Sequence
b'STAADLLRQGAACSVLYLTSVETESLTGPQAVARASSAALSCSTPAVVHFKVSAQGITLTDNQRKLFFRRHYPVNSITFSSTDPQDRRWTNPDGTTSKIFGFVAKKPGSPWENVCHLFAELDPDQPAGAIVTFITKVMLG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Tensin-like C1 domain-containing phosphatase
publication title Crystal structure of Phosphotyrosine-binding domain from the Human Tensin-like C1 domain-containing phosphatase (TENC1)
rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 30
structure length 140
sequence length 143
ec nomenclature ec 3.1.3.-:
pdb deposition date 2009-06-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08416 PTB Phosphotyrosine-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 3hqcA00
1BAKA 1ZC3B 2EMTA 3VOQA 4F7GA 1EGXA 2KGXB 2COCA 2D11A 3QWMA 3TVVA 1FB8A 2UZRA 2DKQA 1DDWA 2J0MA 2MFQA 3TFMA 2L2IA 2COAA 1OMWA 2V76A 1V5PA 1WJ1A 2DYQA 4D0NB 2LG1A 2ROZB 1W1DA 2I5CA 2G35A 1UNPA 4HAXB 4K17A 4KHBB 5D3YA 1EF1A 2W2XD 4IFSA 5CLLB 4F7HA 1J19A 2CODA 2K00A 3LJUX 2P0FA 3P6AA 3M1IB 5KCVA 1BTNA 2DTCA 4GN1A 4GXBA 2RNRB 2KCJA 3KY9A 2ADZA 4F7UP 4P7IA 1LW3A 1QC6A 2M14A 4Y94A 2E2XA 1DBHA 1MK9B 1U29A 2ELBA 2GCLA 2DN6A 5DI9B 5FI1A 2NMBA 3PVWA 4HB2B 4HDQA 1RJ2A 5JHHA 3TO1A 4WJ7A 2R09A 2Z0OA 1OY2A 3PVLA 1I7AA 3CXBB 3NSUA 2QKMA 3U8ZA 3MPXA 1DYNA 1EAZA 3SUZA 1W1HA 5HE0A 5LOPB 2QKLA 1K5GB 2P8VA 5CLQB 3PEGA 5HE1A 2IYBA 1Z87A 2CY5A 4HB3B 1WGQA 3FSSA 4KHOA 3HW2B 2YS1A 2N23A 1U5GA 2K2JA 1MAIA 5KQ4A 5EFXA 5J3YA 1UNQA 5D3WA 3PZDA 4NSWA 5C5BA 1KI1B 2EMSA 2P0HA 1V88A 1ZSQA 3X23A 5L81A 1SHCA 2Y8FA 4IOYX 3HQCA 2DA0A 3F0WA 2DHJA 2DHIA 2LULA 2YVCA 3OANA 1KZ7A 4MY6A 3PP2A 4A6KA 2RGNB 1EVHA 4KHAA 4B6HA 4HHVA 3AU5A 1NTYA 2YS5A 3FEHA 4C0AA 1P3RA 2LOZA 1Y5OA 2W2WA 2GCJA 2L1CA 1V5UA 1FHOA 2FJLA 3PVUA 1MPHA 2CAYA 1TQZA 4HDOA 3ULBA 1MK7B 1I2HA 2LKOA 4A6FA 2DKPA 1UPQA 1MKEA 1NTVA 1V5MA 4EJNA 3TW1A 1FHXA 2JP2A 2AL6A 2DLWA 4DX90 4EKUA 2IFSA 1AQCA 4HAWB 4TYZA 4MK0A 2YF0A 2H7EA 2R0DA 1U2BA 3AJ4A 4A5KA 3A98B 3PG7A 3DXEA 2OQBA 3WYFB 1WI1A 4HB4B 4YL8A 1OQNA 1H4RA 2YSZA 2VKIA 5DIFB 3ML4A 1K5DB 5J3TA 2D2QA 3F5RA 5C6RA 1RRPB 3D8DA 4HATB 2LOXA 4HAVB 1WJMA 5C16A 4Z2NA 1XD4A 2GJYA 5FI0A 5C5BB 2DX5A 2RSGA 3QIJA 1PLSA 5JLJB 1ZVRA 2UVMA 1XCGA 5D3XA 5D3VA 4TKNA 4HB0B 3SNHA 4MT7A 1UPRA 4HAYB 1X1FA 4GPTB 4PNKA 4WSFA 1H10A 2VSZA 1XR0B 3A8PA 3QBVB 2RLOA 1V61A 1X1GA 4YONA 5DH9B 2K2UA 1BWNA 1MIXA 5GOWB 3GYPA 3KRWA 1ZM0A 1IRSA 3FM8C 1GC6A 1W1GA 2Q13A 2AEHA 4XWXA 4A6FB 3SYXA 3T06A 1GG3A 2P0DA 3PSCA 4HAZB 2J0JA 2N0YA 3ZDTA 1NI2A 2EJ8A 4DXAB 4L6EA 4ZRJA 2BCJA 4PQ0A 5HE3A 3MDBC 1Y19B 2NZ8B 2OTXA 2ZPYA 1U27A 1J0WA 3A8QA 1AWEA 2YS3A 3CIKA 2RVBB 2YT0A 2I1JA 1GC7A 2D9VA 4ZRKA 4BBKA 3WA0A 3D8EA 5C79A 5LONB 5J3QA 1DROA 3HK0A 2GS0A 2PZ1A 3P7ZA 1FHWA 1M7RA 4DBBA 1U5FA 3IVFA 1XODA 2MKRA 4GZUA 5HE2A 2I1KA 4EMOA 4GMXB 4NY0A 4H8SA 1WGUA 3G9WA 3SO6A 4CYEA 3ZVRA 2Z0QA 3SV1A 5DHFB 3O96A 4A6HA 1TXDA 1NU2A 2D9YA 2J0KA 1UNRA 2ELAA 2W2XC 2DHKA 2D4QA 3N7CA 5DHAB 1MIZB 5JP4A 4IAPA 4HAUB 3BINA 3ULCA 1FOEA 4CHJA 1PFJA 1X86A 2Z0PA 1ZC4B 1B55A 2ROVA 2LYDA 2COFA 1SGHA 4K2PA 1PMSA 2Y7BA 2YT1A 3KZ1A 2CY4A 2D9WA 2DFKA 1U5DA 3KSYA 1KZGA 2MDXA 3U7DA 1P5TA 1E5WA 2UZSA 3BJIA 2HE7A 4K2OA 1LB1A 3DXCA 3DXDA 3TCAA 1UEFA 3D8FA 2RUKB 4KVGB 3RCPA 3VIAA 2DYNA 2CRFA 2DX1A 4K81A 3ODOA 1FAOA 1TJ6A 4DX8A 1QQGA 3ODWA 2J59M 1M7EA 2EC1A 1XKEA 5D27A 4WVFB 1FGYA 1FGZA 1V89A 5KQ1A 1DDVA 1WG7A 4Z2MB 2D10A 1N3HA 2KUPA 2HTHB 3GYOA 1DDMA 1Q67A 2X18A 2MWNB 1P6SA 2D9ZA 3V5WA 2Y8GA 3AU4A 1X11A 1BTKA 3ODXA 2H7DA 2D9XA 1ISNA 2XQNM 2YRYA 1WVHA 4GMVA 3KRXA 3UZTA 2M38A 4ZRIA 1U5EA 5JHGA 1XX0A 2I5FA 4CHMA 1X05A 2VRWB 4KAXB
chains in the Genus database with same CATH superfamily
1BAKA 1ZC3B 2EMTA 3VOQA 4F7GA 1EGXA 1ZYIA 2KGXB 2COCA 2D11A 3QWMA 3TVVA 5M4YB 1FB8A 2UZRA 2DKQA 1DDWA 2J0MA 2MFQA 3TFMA 2L2IA 2COAA 1OMWA 2V76A 1V5PA 1WJ1A 2DYQA 4D0NB 2LG1A 2ROZB 1W1DA 2I5CA 2G35A 1UNPA 4HAXB 4K17A 2Z13A 4KHBB 5D3YA 1EF1A 2W2XD 4IFSA 5CLLB 3FVCA 4F7HA 1J19A 2YT2A 2CODA 2K00A 3LJUX 2P0FA 3P6AA 3M1IB 5KCVA 2Z59A 1BTNA 2DTCA 4GN1A 4GXBA 2RNRB 2KCJA 3KY9A 2ADZA 4F7UP 4P7IA 1LW3A 1QC6A 2M14A 4Y94A 4QJ5B 2E2XA 1DBHA 1MK9B 1U29A 2ELBA 2GCLA 2DN6A 5DI9B 5FI1A 2NMBA 4QXAB 3PVWA 4HB2B 2KIGA 4HDQA 1RJ2A 4QJ4B 3TO1A 5JHHA 4WJ7A 2R09A 2Z0OA 3A58A 1OY2A 3PVLA 5I2MA 1I7AA 3CXBB 2ZKMX 3NSUA 2QKMA 3U8ZA 3MPXA 1DYNA 1EAZA 3SUZA 1W1HA 5HE0A 5LOPB 2QKLA 1K5GB 2P8VA 2K8EA 5CLQB 3PEGA 5HE1A 2IYBA 1Z87A 2CY5A 4HB3B 1WGQA 3FSSA 4KHOA 2RRFA 3HW2B 2YS1A 4HSIA 2N23A 3NWAA 1U5GA 2K2JA 2Z4DA 1MAIA 5KQ4A 5EFXA 5J3YA 1UNQA 5D3WA 3PZDA 4NSWA 5C5BA 1KI1B 2EMSA 2P0HA 1V88A 1ZSQA 3X23A 5L81A 1SHCA 2Y8FA 4IOYX 3HQCA 2DA0A 3F0WA 2DHJA 3U12A 2DHIA 2LULA 2R2YA 2YVCA 3OHMB 2K49A 3OANA 1KZ7A 4MY6A 3PP2A 4A6KA 2RGNB 1EVHA 3HIEA 4KHAA 4B6HA 4HHVA 3AU5A 1NTYA 2YS5A 3FEHA 4C0AA 1P3RA 2LOZA 1Y5OA 2W2WA 2GCJA 4QJ3B 2L1CA 1V5UA 1FHOA 2FJLA 3PVUA 1MPHA 2CAYA 1TQZA 4HDOA 3ULBA 1MK7B 1I2HA 2LKOA 4A6FA 2DKPA 1UPQA 1MKEA 1NTVA 1T77A 1V5MA 4EJNA 3TW1A 2KR0A 1FHXA 2JP2A 2AL6A 2DLWA 4DX90 4EKUA 2IFSA 1AQCA 4HAWB 4TYZA 4MK0A 2YF0A 2H7EA 2R0DA 1U2BA 3AJ4A 2KIEA 4A5KA 3A98B 3PG7A 3DXEA 2OQBA 3WYFB 1WI1A 4HB4B 4YL8A 1OQNA 1H4RA 2YSZA 2VKIA 5DIFB 3ML4A 1K5DB 5J3TA 2D2QA 3F5RA 5C6RA 1RRPB 3D8DA 4HATB 2LOXA 4HAVB 1WJMA 5C16A 4Z2NA 1XD4A 2GJYA 5FI0A 5C5BB 2DX5A 2RSGA 3QIJA 1PLSA 5JLJB 1ZVRA 2UVMA 1XCGA 2KUQA 5D3XA 5D3VA 4TKNA 4HB0B 3SNHA 3HSAA 4MT7A 4CSQA 1UPRA 4HAYB 1X1FA 4GPTB 4PNKA 4WSFA 1H10A 2VSZA 1XR0B 3A8PA 3QBVB 2RLOA 1V61A 1X1GA 4YONA 5DH9B 2K2UA 1BWNA 3NW8A 1MIXA 5GOWB 3GYPA 3KRWA 1ZM0A 1IRSA 3FM8C 1GC6A 1W1GA 2Q13A 2AEHA 4XWXA 4A6FB 3SYXA 3T06A 1GG3A 2P0DA 3PSCA 4HAZB 2J0JA 3NWDA 2N0YA 3DCXA 3ZDTA 1NI2A 2EJ8A 4DXAB 4L6EA 4ZRJA 2BCJA 4PQ0A 5HE3A 3MDBC 1Y19B 2NZ8B 2OTXA 2ZPYA 1U27A 1J0WA 3A8QA 1AWEA 2YS3A 3CIKA 4OT1A 2RVBB 2Z14A 2YT0A 2I1JA 4OSNA 1GC7A 2D9VA 4ZRKA 4BBKA 3WA0A 3D8EA 5C79A 5LONB 5J3QA 4DIXA 1DROA 3HK0A 2GS0A 2PZ1A 3P7ZA 1FHWA 1M7RA 4DBBA 1U5FA 3IVFA 1XODA 2MKRA 4GZUA 5HE2A 2I1KA 4EMOA 4GMXB 4NY0A 4H8SA 1WGUA 3G9WA 3SO6A 4CYEA 4D6WA 3ZVRA 2Z0QA 2GUMA 3SV1A 5DHFB 3O96A 4A6HA 1TXDA 1NU2A 2D9YA 2J0KA 1UNRA 2ELAA 2W2XC 4GOUA 2DHKA 2D4QA 3N7CA 3B77A 5DHAB 1MIZB 5JP4A 4IAPA 4HAUB 5IRSA 3BINA 3ULCA 1FOEA 4CHJA 5I2SA 1PFJA 1X86A 3NWFA 2Z0PA 1ZC4B 5LG4B 1B55A 2ROVA 4GNKB 2LYDA 4KHBA 2COFA 1SGHA 4K2PA 1PMSA 2Y7BA 2YT1A 3KZ1A 2CY4A 2D9WA 2DFKA 1U5DA 3KSYA 1KZGA 2MDXA 3U7DA 2NBVA 1P5TA 1E5WA 2UZSA 3BJIA 1MI1A 2HE7A 4K2OA 1LB1A 3DXCA 3DXDA 3TCAA 1UEFA 3D8FA 2RUKB 4KVGB 3RCPA 3VIAA 2DYNA 2CRFA 2DX1A 4K81A 3ODOA 1FAOA 1TJ6A 4DX8A 1QQGA 3ODWA 2J59M 1M7EA 2EC1A 1XKEA 5D27A 4WVFB 1FGYA 1FGZA 1V89A 5KQ1A 1DDVA 1WG7A 4Z2MB 2D10A 1N3HA 2KUPA 2HTHB 3GYOA 1DDMA 1Q67A 2X18A 2MWNB 1P6SA 2D9ZA 3V5WA 2Y8GA 3AU4A 1X11A 1BTKA 2H7DA 3ODXA 2D9XA 1ISNA 2XQNM 2YRYA 1WVHA 4GMVA 3KRXA 3UZTA 2FJUB 2M38A 4ZRIA 1U5EA 5JHGA 4L1RA 1XX0A 2I5FA 4CHMA 1X05A 2VRWB 4KAXB
chains in the Genus database with same CATH topology
1BAKA 1ZC3B 2EMTA 3VOQA 4F7GA 1EGXA 2KGXB 2COCA 2D11A 3QWMA 3TVVA 1FB8A 2UZRA 2DKQA 1DDWA 2J0MA 2MFQA 3TFMA 2L2IA 2COAA 1OMWA 2V76A 1V5PA 1WJ1A 2DYQA 4D0NB 2LG1A 2ROZB 1W1DA 2I5CA 2G35A 1UNPA 4HAXB 4K17A 4KHBB 5D3YA 1EF1A 2W2XD 4IFSA 5CLLB 4F7HA 1J19A 2CODA 2K00A 3LJUX 2P0FA 3P6AA 3M1IB 5KCVA 1BTNA 2DTCA 4GN1A 4GXBA 2RNRB 2KCJA 3KY9A 2ADZA 4F7UP 4P7IA 1LW3A 1QC6A 2M14A 4Y94A 2E2XA 1DBHA 1MK9B 1U29A 2ELBA 2GCLA 2DN6A 5DI9B 5FI1A 2NMBA 3PVWA 4HB2B 4HDQA 1RJ2A 5JHHA 3TO1A 4WJ7A 2R09A 2Z0OA 1OY2A 3PVLA 1I7AA 3CXBB 3NSUA 2QKMA 3U8ZA 3MPXA 1DYNA 1EAZA 3SUZA 1W1HA 5HE0A 5LOPB 2QKLA 1K5GB 2P8VA 5CLQB 3PEGA 5HE1A 2IYBA 1Z87A 2CY5A 4HB3B 1WGQA 3FSSA 4KHOA 3HW2B 2YS1A 2N23A 1U5GA 2K2JA 1MAIA 5KQ4A 5EFXA 5J3YA 1UNQA 5D3WA 3PZDA 4NSWA 5C5BA 1KI1B 2EMSA 2P0HA 1V88A 1ZSQA 3X23A 5L81A 1SHCA 2Y8FA 4IOYX 3HQCA 2DA0A 3F0WA 2DHJA 2DHIA 2LULA 2YVCA 3OANA 1KZ7A 4MY6A 3PP2A 4A6KA 2RGNB 1EVHA 4KHAA 4B6HA 4HHVA 3AU5A 1NTYA 2YS5A 3FEHA 4C0AA 1P3RA 2LOZA 1Y5OA 2W2WA 2GCJA 2L1CA 1V5UA 1FHOA 2FJLA 3PVUA 1MPHA 2CAYA 1TQZA 4HDOA 3ULBA 1MK7B 1I2HA 2LKOA 4A6FA 2DKPA 1UPQA 1MKEA 1NTVA 1V5MA 4EJNA 3TW1A 1FHXA 2JP2A 2AL6A 2DLWA 4DX90 4EKUA 2IFSA 1AQCA 4HAWB 4TYZA 4MK0A 2YF0A 2H7EA 2R0DA 1U2BA 3AJ4A 4A5KA 3A98B 3PG7A 3DXEA 2OQBA 3WYFB 1WI1A 4HB4B 4YL8A 1OQNA 1H4RA 2YSZA 2VKIA 5DIFB 3ML4A 1K5DB 5J3TA 2D2QA 3F5RA 5C6RA 1RRPB 3D8DA 4HATB 2LOXA 4HAVB 1WJMA 5C16A 4Z2NA 1XD4A 2GJYA 5FI0A 5C5BB 2DX5A 2RSGA 3QIJA 1PLSA 5JLJB 1ZVRA 2UVMA 1XCGA 5D3XA 5D3VA 4TKNA 4HB0B 3SNHA 4MT7A 1UPRA 4HAYB 1X1FA 4GPTB 4PNKA 4WSFA 1H10A 2VSZA 1XR0B 3A8PA 3QBVB 2RLOA 1V61A 1X1GA 4YONA 5DH9B 2K2UA 1BWNA 1MIXA 5GOWB 3GYPA 3KRWA 1ZM0A 1IRSA 3FM8C 1GC6A 1W1GA 2Q13A 2AEHA 4XWXA 4A6FB 3SYXA 3T06A 1GG3A 2P0DA 3PSCA 4HAZB 2J0JA 2N0YA 3ZDTA 1NI2A 2EJ8A 4DXAB 4L6EA 4ZRJA 2BCJA 4PQ0A 5HE3A 3MDBC 1Y19B 2NZ8B 2OTXA 2ZPYA 1U27A 1J0WA 3A8QA 1AWEA 2YS3A 3CIKA 2RVBB 2YT0A 2I1JA 1GC7A 2D9VA 4ZRKA 4BBKA 3WA0A 3D8EA 5C79A 5LONB 5J3QA 1DROA 3HK0A 2GS0A 2PZ1A 3P7ZA 1FHWA 1M7RA 4DBBA 1U5FA 3IVFA 1XODA 2MKRA 4GZUA 5HE2A 2I1KA 4EMOA 4GMXB 4NY0A 4H8SA 1WGUA 3G9WA 3SO6A 4CYEA 3ZVRA 2Z0QA 3SV1A 5DHFB 3O96A 4A6HA 1TXDA 1NU2A 2D9YA 2J0KA 1UNRA 2ELAA 2W2XC 2DHKA 2D4QA 3N7CA 5DHAB 1MIZB 5JP4A 4IAPA 4HAUB 3BINA 3ULCA 1FOEA 4CHJA 1PFJA 1X86A 2Z0PA 1ZC4B 1B55A 2ROVA 2LYDA 2COFA 1SGHA 4K2PA 1PMSA 2Y7BA 2YT1A 3KZ1A 2CY4A 2D9WA 2DFKA 1U5DA 3KSYA 1KZGA 2MDXA 3U7DA 1P5TA 1E5WA 2UZSA 3BJIA 2HE7A 4K2OA 1LB1A 3DXCA 3DXDA 3TCAA 1UEFA 3D8FA 2RUKB 4KVGB 3RCPA 3VIAA 2DYNA 2CRFA 2DX1A 4K81A 3ODOA 1FAOA 1TJ6A 4DX8A 1QQGA 3ODWA 2J59M 1M7EA 2EC1A 1XKEA 5D27A 4WVFB 1FGYA 1FGZA 1V89A 5KQ1A 1DDVA 1WG7A 4Z2MB 2D10A 1N3HA 2KUPA 2HTHB 3GYOA 1DDMA 1Q67A 2X18A 2MWNB 1P6SA 2D9ZA 3V5WA 2Y8GA 3AU4A 1X11A 1BTKA 3ODXA 2H7DA 2D9XA 1ISNA 2XQNM 2YRYA 1WVHA 4GMVA 3KRXA 3UZTA 2M38A 4ZRIA 1U5EA 5JHGA 1XX0A 2I5FA 4CHMA 1X05A 2VRWB 4KAXB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BAK A;  1ZC3 B;  2EMT A;  3VOQ A;  4F7G A;  1EGX A;  2KGX B;  2COC A;  2D11 A;  3QWM A;  3TVV A;  1FB8 A;  2UZR A;  2DKQ A;  1DDW A;  2J0M A;  2MFQ A;  3TFM A;  2L2I A;  2COA A;  1OMW A;  2V76 A;  1V5P A;  1WJ1 A;  2DYQ A;  4D0N B;  2LG1 A;  2ROZ B;  1W1D A;  2I5C A;  2G35 A;  1UNP A;  4HAX B;  4K17 A;  4KHB B;  5D3Y A;  1EF1 A;  2W2X D;  4IFS A;  5CLL B;  4F7H A;  1J19 A;  2COD A;  2K00 A;  3LJU X;  2P0F A;  3P6A A;  3M1I B;  5KCV A;  1BTN A;  2DTC A;  4GN1 A;  4GXB A;  2RNR B;  2KCJ A;  3KY9 A;  2ADZ A;  4F7U P;  4P7I A;  1LW3 A;  1QC6 A;  2M14 A;  4Y94 A;  2E2X A;  1DBH A;  1MK9 B;  1U29 A;  2ELB A;  2GCL A;  2DN6 A;  5DI9 B;  5FI1 A;  2NMB A;  3PVW A;  4HB2 B;  4HDQ A;  1RJ2 A;  5JHH A;  3TO1 A;  4WJ7 A;  2R09 A;  2Z0O A;  1OY2 A;  3PVL A;  1I7A A;  3CXB B;  3NSU A;  2QKM A;  3U8Z A;  3MPX A;  1DYN A;  1EAZ A;  3SUZ A;  1W1H A;  5HE0 A;  5LOP B;  2QKL A;  1K5G B;  2P8V A;  5CLQ B;  3PEG A;  5HE1 A;  2IYB A;  1Z87 A;  2CY5 A;  4HB3 B;  1WGQ A;  3FSS A;  4KHO A;  3HW2 B;  2YS1 A;  2N23 A;  1U5G A;  2K2J A;  1MAI A;  5KQ4 A;  5EFX A;  5J3Y A;  1UNQ A;  5D3W A;  3PZD A;  4NSW A;  5C5B A;  1KI1 B;  2EMS A;  2P0H A;  1V88 A;  1ZSQ A;  3X23 A;  5L81 A;  1SHC A;  2Y8F A;  4IOY X;  3HQC A;  2DA0 A;  3F0W A;  2DHJ A;  2DHI A;  2LUL A;  2YVC A;  3OAN A;  1KZ7 A;  4MY6 A;  3PP2 A;  4A6K A;  2RGN B;  1EVH A;  4KHA A;  4B6H A;  4HHV A;  3AU5 A;  1NTY A;  2YS5 A;  3FEH A;  4C0A A;  1P3R A;  2LOZ A;  1Y5O A;  2W2W A;  2GCJ A;  2L1C A;  1V5U A;  1FHO A;  2FJL A;  3PVU A;  1MPH A;  2CAY A;  1TQZ A;  4HDO A;  3ULB A;  1MK7 B;  1I2H A;  2LKO A;  4A6F A;  2DKP A;  1UPQ A;  1MKE A;  1NTV A;  1V5M A;  4EJN A;  3TW1 A;  1FHX A;  2JP2 A;  2AL6 A;  2DLW A;  4DX9 0;  4EKU A;  2IFS A;  1AQC A;  4HAW B;  4TYZ A;  4MK0 A;  2YF0 A;  2H7E A;  2R0D A;  1U2B A;  3AJ4 A;  4A5K A;  3A98 B;  3PG7 A;  3DXE A;  2OQB A;  3WYF B;  1WI1 A;  4HB4 B;  4YL8 A;  1OQN A;  1H4R A;  2YSZ A;  2VKI A;  5DIF B;  3ML4 A;  1K5D B;  5J3T A;  2D2Q A;  3F5R A;  5C6R A;  1RRP B;  3D8D A;  4HAT B;  2LOX A;  4HAV B;  1WJM A;  5C16 A;  4Z2N A;  1XD4 A;  2GJY A;  5FI0 A;  5C5B B;  2DX5 A;  2RSG A;  3QIJ A;  1PLS A;  5JLJ B;  1ZVR A;  2UVM A;  1XCG A;  5D3X A;  5D3V A;  4TKN A;  4HB0 B;  3SNH A;  4MT7 A;  1UPR A;  4HAY B;  1X1F A;  4GPT B;  4PNK A;  4WSF A;  1H10 A;  2VSZ A;  1XR0 B;  3A8P A;  3QBV B;  2RLO A;  1V61 A;  1X1G A;  4YON A;  5DH9 B;  2K2U A;  1BWN A;  1MIX A;  5GOW B;  3GYP A;  3KRW A;  1ZM0 A;  1IRS A;  3FM8 C;  1GC6 A;  1W1G A;  2Q13 A;  2AEH A;  4XWX A;  4A6F B;  3SYX A;  3T06 A;  1GG3 A;  2P0D A;  3PSC A;  4HAZ B;  2J0J A;  2N0Y A;  3ZDT A;  1NI2 A;  2EJ8 A;  4DXA B;  4L6E A;  4ZRJ A;  2BCJ A;  4PQ0 A;  5HE3 A;  3MDB C;  1Y19 B;  2NZ8 B;  2OTX A;  2ZPY A;  1U27 A;  1J0W A;  3A8Q A;  1AWE A;  2YS3 A;  3CIK A;  2RVB B;  2YT0 A;  2I1J A;  1GC7 A;  2D9V A;  4ZRK A;  4BBK A;  3WA0 A;  3D8E A;  5C79 A;  5LON B;  5J3Q A;  1DRO A;  3HK0 A;  2GS0 A;  2PZ1 A;  3P7Z A;  1FHW A;  1M7R A;  4DBB A;  1U5F A;  3IVF A;  1XOD A;  2MKR A;  4GZU A;  5HE2 A;  2I1K A;  4EMO A;  4GMX B;  4NY0 A;  4H8S A;  1WGU A;  3G9W A;  3SO6 A;  4CYE A;  3ZVR A;  2Z0Q A;  3SV1 A;  5DHF B;  3O96 A;  4A6H A;  1TXD A;  1NU2 A;  2D9Y A;  2J0K A;  1UNR A;  2ELA A;  2W2X C;  2DHK A;  2D4Q A;  3N7C A;  5DHA B;  1MIZ B;  5JP4 A;  4IAP A;  4HAU B;  3BIN A;  3ULC A;  1FOE A;  4CHJ A;  1PFJ A;  1X86 A;  2Z0P A;  1ZC4 B;  1B55 A;  2ROV A;  2LYD A;  2COF A;  1SGH A;  4K2P A;  1PMS A;  2Y7B A;  2YT1 A;  3KZ1 A;  2CY4 A;  2D9W A;  2DFK A;  1U5D A;  3KSY A;  1KZG A;  2MDX A;  3U7D A;  1P5T A;  1E5W A;  2UZS A;  3BJI A;  2HE7 A;  4K2O A;  1LB1 A;  3DXC A;  3DXD A;  3TCA A;  1UEF A;  3D8F A;  2RUK B;  4KVG B;  3RCP A;  3VIA A;  2DYN A;  2CRF A;  2DX1 A;  4K81 A;  3ODO A;  1FAO A;  1TJ6 A;  4DX8 A;  1QQG A;  3ODW A;  2J59 M;  1M7E A;  2EC1 A;  1XKE A;  5D27 A;  4WVF B;  1FGY A;  1FGZ A;  1V89 A;  5KQ1 A;  1DDV A;  1WG7 A;  4Z2M B;  2D10 A;  1N3H A;  2KUP A;  2HTH B;  3GYO A;  1DDM A;  1Q67 A;  2X18 A;  2MWN B;  1P6S A;  2D9Z A;  3V5W A;  2Y8G A;  3AU4 A;  1X11 A;  1BTK A;  3ODX A;  2H7D A;  2D9X A;  1ISN A;  2XQN M;  2YRY A;  1WVH A;  4GMV A;  3KRX A;  3UZT A;  2M38 A;  4ZRI A;  1U5E A;  5JHG A;  1XX0 A;  2I5F A;  4CHM A;  1X05 A;  2VRW B;  4KAX B; 
#chains in the Genus database with same CATH topology
 1BAK A;  1ZC3 B;  2EMT A;  3VOQ A;  4F7G A;  1EGX A;  1ZYI A;  2KGX B;  2COC A;  2D11 A;  3QWM A;  3TVV A;  5M4Y B;  1FB8 A;  2UZR A;  2DKQ A;  1DDW A;  2J0M A;  2MFQ A;  3TFM A;  2L2I A;  2COA A;  1OMW A;  2V76 A;  1V5P A;  1WJ1 A;  2DYQ A;  4D0N B;  2LG1 A;  2ROZ B;  1W1D A;  2I5C A;  2G35 A;  1UNP A;  4HAX B;  4K17 A;  2Z13 A;  4KHB B;  5D3Y A;  1EF1 A;  2W2X D;  4IFS A;  5CLL B;  3FVC A;  4F7H A;  1J19 A;  2YT2 A;  2COD A;  2K00 A;  3LJU X;  2P0F A;  3P6A A;  3M1I B;  5KCV A;  2Z59 A;  1BTN A;  2DTC A;  4GN1 A;  4GXB A;  2RNR B;  2KCJ A;  3KY9 A;  2ADZ A;  4F7U P;  4P7I A;  1LW3 A;  1QC6 A;  2M14 A;  4Y94 A;  4QJ5 B;  2E2X A;  1DBH A;  1MK9 B;  1U29 A;  2ELB A;  2GCL A;  2DN6 A;  5DI9 B;  5FI1 A;  2NMB A;  4QXA B;  3PVW A;  4HB2 B;  2KIG A;  4HDQ A;  1RJ2 A;  4QJ4 B;  3TO1 A;  5JHH A;  4WJ7 A;  2R09 A;  2Z0O A;  3A58 A;  1OY2 A;  3PVL A;  5I2M A;  1I7A A;  3CXB B;  2ZKM X;  3NSU A;  2QKM A;  3U8Z A;  3MPX A;  1DYN A;  1EAZ A;  3SUZ A;  1W1H A;  5HE0 A;  5LOP B;  2QKL A;  1K5G B;  2P8V A;  2K8E A;  5CLQ B;  3PEG A;  5HE1 A;  2IYB A;  1Z87 A;  2CY5 A;  4HB3 B;  1WGQ A;  3FSS A;  4KHO A;  2RRF A;  3HW2 B;  2YS1 A;  4HSI A;  2N23 A;  3NWA A;  1U5G A;  2K2J A;  2Z4D A;  1MAI A;  5KQ4 A;  5EFX A;  5J3Y A;  1UNQ A;  5D3W A;  3PZD A;  4NSW A;  5C5B A;  1KI1 B;  2EMS A;  2P0H A;  1V88 A;  1ZSQ A;  3X23 A;  5L81 A;  1SHC A;  2Y8F A;  4IOY X;  3HQC A;  2DA0 A;  3F0W A;  2DHJ A;  3U12 A;  2DHI A;  2LUL A;  2R2Y A;  2YVC A;  3OHM B;  2K49 A;  3OAN A;  1KZ7 A;  4MY6 A;  3PP2 A;  4A6K A;  2RGN B;  1EVH A;  3HIE A;  4KHA A;  4B6H A;  4HHV A;  3AU5 A;  1NTY A;  2YS5 A;  3FEH A;  4C0A A;  1P3R A;  2LOZ A;  1Y5O A;  2W2W A;  2GCJ A;  4QJ3 B;  2L1C A;  1V5U A;  1FHO A;  2FJL A;  3PVU A;  1MPH A;  2CAY A;  1TQZ A;  4HDO A;  3ULB A;  1MK7 B;  1I2H A;  2LKO A;  4A6F A;  2DKP A;  1UPQ A;  1MKE A;  1NTV A;  1T77 A;  1V5M A;  4EJN A;  3TW1 A;  2KR0 A;  1FHX A;  2JP2 A;  2AL6 A;  2DLW A;  4DX9 0;  4EKU A;  2IFS A;  1AQC A;  4HAW B;  4TYZ A;  4MK0 A;  2YF0 A;  2H7E A;  2R0D A;  1U2B A;  3AJ4 A;  2KIE A;  4A5K A;  3A98 B;  3PG7 A;  3DXE A;  2OQB A;  3WYF B;  1WI1 A;  4HB4 B;  4YL8 A;  1OQN A;  1H4R A;  2YSZ A;  2VKI A;  5DIF B;  3ML4 A;  1K5D B;  5J3T A;  2D2Q A;  3F5R A;  5C6R A;  1RRP B;  3D8D A;  4HAT B;  2LOX A;  4HAV B;  1WJM A;  5C16 A;  4Z2N A;  1XD4 A;  2GJY A;  5FI0 A;  5C5B B;  2DX5 A;  2RSG A;  3QIJ A;  1PLS A;  5JLJ B;  1ZVR A;  2UVM A;  1XCG A;  2KUQ A;  5D3X A;  5D3V A;  4TKN A;  4HB0 B;  3SNH A;  3HSA A;  4MT7 A;  4CSQ A;  1UPR A;  4HAY B;  1X1F A;  4GPT B;  4PNK A;  4WSF A;  1H10 A;  2VSZ A;  1XR0 B;  3A8P A;  3QBV B;  2RLO A;  1V61 A;  1X1G A;  4YON A;  5DH9 B;  2K2U A;  1BWN A;  3NW8 A;  1MIX A;  5GOW B;  3GYP A;  3KRW A;  1ZM0 A;  1IRS A;  3FM8 C;  1GC6 A;  1W1G A;  2Q13 A;  2AEH A;  4XWX A;  4A6F B;  3SYX A;  3T06 A;  1GG3 A;  2P0D A;  3PSC A;  4HAZ B;  2J0J A;  3NWD A;  2N0Y A;  3DCX A;  3ZDT A;  1NI2 A;  2EJ8 A;  4DXA B;  4L6E A;  4ZRJ A;  2BCJ A;  4PQ0 A;  5HE3 A;  3MDB C;  1Y19 B;  2NZ8 B;  2OTX A;  2ZPY A;  1U27 A;  1J0W A;  3A8Q A;  1AWE A;  2YS3 A;  3CIK A;  4OT1 A;  2RVB B;  2Z14 A;  2YT0 A;  2I1J A;  4OSN A;  1GC7 A;  2D9V A;  4ZRK A;  4BBK A;  3WA0 A;  3D8E A;  5C79 A;  5LON B;  5J3Q A;  4DIX A;  1DRO A;  3HK0 A;  2GS0 A;  2PZ1 A;  3P7Z A;  1FHW A;  1M7R A;  4DBB A;  1U5F A;  3IVF A;  1XOD A;  2MKR A;  4GZU A;  5HE2 A;  2I1K A;  4EMO A;  4GMX B;  4NY0 A;  4H8S A;  1WGU A;  3G9W A;  3SO6 A;  4CYE A;  4D6W A;  3ZVR A;  2Z0Q A;  2GUM A;  3SV1 A;  5DHF B;  3O96 A;  4A6H A;  1TXD A;  1NU2 A;  2D9Y A;  2J0K A;  1UNR A;  2ELA A;  2W2X C;  4GOU A;  2DHK A;  2D4Q A;  3N7C A;  3B77 A;  5DHA B;  1MIZ B;  5JP4 A;  4IAP A;  4HAU B;  5IRS A;  3BIN A;  3ULC A;  1FOE A;  4CHJ A;  5I2S A;  1PFJ A;  1X86 A;  3NWF A;  2Z0P A;  1ZC4 B;  5LG4 B;  1B55 A;  2ROV A;  4GNK B;  2LYD A;  4KHB A;  2COF A;  1SGH A;  4K2P A;  1PMS A;  2Y7B A;  2YT1 A;  3KZ1 A;  2CY4 A;  2D9W A;  2DFK A;  1U5D A;  3KSY A;  1KZG A;  2MDX A;  3U7D A;  2NBV A;  1P5T A;  1E5W A;  2UZS A;  3BJI A;  1MI1 A;  2HE7 A;  4K2O A;  1LB1 A;  3DXC A;  3DXD A;  3TCA A;  1UEF A;  3D8F A;  2RUK B;  4KVG B;  3RCP A;  3VIA A;  2DYN A;  2CRF A;  2DX1 A;  4K81 A;  3ODO A;  1FAO A;  1TJ6 A;  4DX8 A;  1QQG A;  3ODW A;  2J59 M;  1M7E A;  2EC1 A;  1XKE A;  5D27 A;  4WVF B;  1FGY A;  1FGZ A;  1V89 A;  5KQ1 A;  1DDV A;  1WG7 A;  4Z2M B;  2D10 A;  1N3H A;  2KUP A;  2HTH B;  3GYO A;  1DDM A;  1Q67 A;  2X18 A;  2MWN B;  1P6S A;  2D9Z A;  3V5W A;  2Y8G A;  3AU4 A;  1X11 A;  1BTK A;  2H7D A;  3ODX A;  2D9X A;  1ISN A;  2XQN M;  2YRY A;  1WVH A;  4GMV A;  3KRX A;  3UZT A;  2FJU B;  2M38 A;  4ZRI A;  1U5E A;  5JHG A;  4L1R A;  1XX0 A;  2I5F A;  4CHM A;  1X05 A;  2VRW B;  4KAX B; 
#chains in the Genus database with same CATH homology
 1BAK A;  1ZC3 B;  2EMT A;  3VOQ A;  4F7G A;  1EGX A;  2KGX B;  2COC A;  2D11 A;  3QWM A;  3TVV A;  1FB8 A;  2UZR A;  2DKQ A;  1DDW A;  2J0M A;  2MFQ A;  3TFM A;  2L2I A;  2COA A;  1OMW A;  2V76 A;  1V5P A;  1WJ1 A;  2DYQ A;  4D0N B;  2LG1 A;  2ROZ B;  1W1D A;  2I5C A;  2G35 A;  1UNP A;  4HAX B;  4K17 A;  4KHB B;  5D3Y A;  1EF1 A;  2W2X D;  4IFS A;  5CLL B;  4F7H A;  1J19 A;  2COD A;  2K00 A;  3LJU X;  2P0F A;  3P6A A;  3M1I B;  5KCV A;  1BTN A;  2DTC A;  4GN1 A;  4GXB A;  2RNR B;  2KCJ A;  3KY9 A;  2ADZ A;  4F7U P;  4P7I A;  1LW3 A;  1QC6 A;  2M14 A;  4Y94 A;  2E2X A;  1DBH A;  1MK9 B;  1U29 A;  2ELB A;  2GCL A;  2DN6 A;  5DI9 B;  5FI1 A;  2NMB A;  3PVW A;  4HB2 B;  4HDQ A;  1RJ2 A;  5JHH A;  3TO1 A;  4WJ7 A;  2R09 A;  2Z0O A;  1OY2 A;  3PVL A;  1I7A A;  3CXB B;  3NSU A;  2QKM A;  3U8Z A;  3MPX A;  1DYN A;  1EAZ A;  3SUZ A;  1W1H A;  5HE0 A;  5LOP B;  2QKL A;  1K5G B;  2P8V A;  5CLQ B;  3PEG A;  5HE1 A;  2IYB A;  1Z87 A;  2CY5 A;  4HB3 B;  1WGQ A;  3FSS A;  4KHO A;  3HW2 B;  2YS1 A;  2N23 A;  1U5G A;  2K2J A;  1MAI A;  5KQ4 A;  5EFX A;  5J3Y A;  1UNQ A;  5D3W A;  3PZD A;  4NSW A;  5C5B A;  1KI1 B;  2EMS A;  2P0H A;  1V88 A;  1ZSQ A;  3X23 A;  5L81 A;  1SHC A;  2Y8F A;  4IOY X;  3HQC A;  2DA0 A;  3F0W A;  2DHJ A;  2DHI A;  2LUL A;  2YVC A;  3OAN A;  1KZ7 A;  4MY6 A;  3PP2 A;  4A6K A;  2RGN B;  1EVH A;  4KHA A;  4B6H A;  4HHV A;  3AU5 A;  1NTY A;  2YS5 A;  3FEH A;  4C0A A;  1P3R A;  2LOZ A;  1Y5O A;  2W2W A;  2GCJ A;  2L1C A;  1V5U A;  1FHO A;  2FJL A;  3PVU A;  1MPH A;  2CAY A;  1TQZ A;  4HDO A;  3ULB A;  1MK7 B;  1I2H A;  2LKO A;  4A6F A;  2DKP A;  1UPQ A;  1MKE A;  1NTV A;  1V5M A;  4EJN A;  3TW1 A;  1FHX A;  2JP2 A;  2AL6 A;  2DLW A;  4DX9 0;  4EKU A;  2IFS A;  1AQC A;  4HAW B;  4TYZ A;  4MK0 A;  2YF0 A;  2H7E A;  2R0D A;  1U2B A;  3AJ4 A;  4A5K A;  3A98 B;  3PG7 A;  3DXE A;  2OQB A;  3WYF B;  1WI1 A;  4HB4 B;  4YL8 A;  1OQN A;  1H4R A;  2YSZ A;  2VKI A;  5DIF B;  3ML4 A;  1K5D B;  5J3T A;  2D2Q A;  3F5R A;  5C6R A;  1RRP B;  3D8D A;  4HAT B;  2LOX A;  4HAV B;  1WJM A;  5C16 A;  4Z2N A;  1XD4 A;  2GJY A;  5FI0 A;  5C5B B;  2DX5 A;  2RSG A;  3QIJ A;  1PLS A;  5JLJ B;  1ZVR A;  2UVM A;  1XCG A;  5D3X A;  5D3V A;  4TKN A;  4HB0 B;  3SNH A;  4MT7 A;  1UPR A;  4HAY B;  1X1F A;  4GPT B;  4PNK A;  4WSF A;  1H10 A;  2VSZ A;  1XR0 B;  3A8P A;  3QBV B;  2RLO A;  1V61 A;  1X1G A;  4YON A;  5DH9 B;  2K2U A;  1BWN A;  1MIX A;  5GOW B;  3GYP A;  3KRW A;  1ZM0 A;  1IRS A;  3FM8 C;  1GC6 A;  1W1G A;  2Q13 A;  2AEH A;  4XWX A;  4A6F B;  3SYX A;  3T06 A;  1GG3 A;  2P0D A;  3PSC A;  4HAZ B;  2J0J A;  2N0Y A;  3ZDT A;  1NI2 A;  2EJ8 A;  4DXA B;  4L6E A;  4ZRJ A;  2BCJ A;  4PQ0 A;  5HE3 A;  3MDB C;  1Y19 B;  2NZ8 B;  2OTX A;  2ZPY A;  1U27 A;  1J0W A;  3A8Q A;  1AWE A;  2YS3 A;  3CIK A;  2RVB B;  2YT0 A;  2I1J A;  1GC7 A;  2D9V A;  4ZRK A;  4BBK A;  3WA0 A;  3D8E A;  5C79 A;  5LON B;  5J3Q A;  1DRO A;  3HK0 A;  2GS0 A;  2PZ1 A;  3P7Z A;  1FHW A;  1M7R A;  4DBB A;  1U5F A;  3IVF A;  1XOD A;  2MKR A;  4GZU A;  5HE2 A;  2I1K A;  4EMO A;  4GMX B;  4NY0 A;  4H8S A;  1WGU A;  3G9W A;  3SO6 A;  4CYE A;  3ZVR A;  2Z0Q A;  3SV1 A;  5DHF B;  3O96 A;  4A6H A;  1TXD A;  1NU2 A;  2D9Y A;  2J0K A;  1UNR A;  2ELA A;  2W2X C;  2DHK A;  2D4Q A;  3N7C A;  5DHA B;  1MIZ B;  5JP4 A;  4IAP A;  4HAU B;  3BIN A;  3ULC A;  1FOE A;  4CHJ A;  1PFJ A;  1X86 A;  2Z0P A;  1ZC4 B;  1B55 A;  2ROV A;  2LYD A;  2COF A;  1SGH A;  4K2P A;  1PMS A;  2Y7B A;  2YT1 A;  3KZ1 A;  2CY4 A;  2D9W A;  2DFK A;  1U5D A;  3KSY A;  1KZG A;  2MDX A;  3U7D A;  1P5T A;  1E5W A;  2UZS A;  3BJI A;  2HE7 A;  4K2O A;  1LB1 A;  3DXC A;  3DXD A;  3TCA A;  1UEF A;  3D8F A;  2RUK B;  4KVG B;  3RCP A;  3VIA A;  2DYN A;  2CRF A;  2DX1 A;  4K81 A;  3ODO A;  1FAO A;  1TJ6 A;  4DX8 A;  1QQG A;  3ODW A;  2J59 M;  1M7E A;  2EC1 A;  1XKE A;  5D27 A;  4WVF B;  1FGY A;  1FGZ A;  1V89 A;  5KQ1 A;  1DDV A;  1WG7 A;  4Z2M B;  2D10 A;  1N3H A;  2KUP A;  2HTH B;  3GYO A;  1DDM A;  1Q67 A;  2X18 A;  2MWN B;  1P6S A;  2D9Z A;  3V5W A;  2Y8G A;  3AU4 A;  1X11 A;  1BTK A;  3ODX A;  2H7D A;  2D9X A;  1ISN A;  2XQN M;  2YRY A;  1WVH A;  4GMV A;  3KRX A;  3UZT A;  2M38 A;  4ZRI A;  1U5E A;  5JHG A;  1XX0 A;  2I5F A;  4CHM A;  1X05 A;  2VRW B;  4KAX B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...