4WSFA

Falafel evh1 domain bound to cenp-c fim
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
111
structure length
111
Chain Sequence
DTRRRVKLYALNAERQWDDRGTGHVSSTYVERLKGISLLVRAESDGSLLLESKIQPDTAYQKQQDTLIVWSEGDNFDLALSFQEKAGCDEIWEKICQVQGKDPSVEITQDI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Centromeric binding and activity of Protein Phosphatase 4.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Signaling protein
molecule keywords Serine/threonine-protein phosphatase 4 regulatory subunit 3
total genus 30
structure length 111
sequence length 111
ec nomenclature
pdb deposition date 2014-10-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 4wsfA00
4CHMA 3AU4A 1FOEA 2D9WA 1Z87A 2YT0A 3MDBC 2D10A 5HE2A 4MT7A 2DN6A 4KHOA 4F7UP 1EF1A 4ZRKA 3ZVRA 3A98B 2COAA 2R09A 3DXCA 2NZ8B 4IFSA 3AJ4A 1V88A 2Y8GA 4MK0A 2GS0A 1MPHA 2D2QA 4Y94A 1W1GA 3PEGA 2JP2A 4HAXB 2RSGA 1RRPB 4GN1A 2CY4A 2DTCA 2Z0OA 2DYNA 2I1JA 5HE1A 5C16A 1TXDA 3TVVA 3TFMA 4HB3B 4KHBB 1X05A 1XODA 4KVGB 2D9XA 3GYOA 2N0YA 4GXBA 3P7ZA 2RVBB 5JLJB 1X1GA 3PP2A 4GZUA 3SV1A 1XCGA 2D4QA 2CAYA 3G9WA 2W2XC 1LW3A 1U27A 2DX1A 1FGZA 2DFKA 2V76A 2J59M 1U29A 4L6EA 2LYDA 3PVLA 1ISNA 3ZDTA 1UEFA 1WJ1A 2GCLA 2PZ1A 2UZSA 2X18A 2YF0A 5DHAB 1QQGA 2EMTA 1NTVA 4Z2MB 5J3TA 1GC7A 1AQCA 3NSUA 1U5GA 2DX5A 1WGQA 3GYPA 1K5GB 4Z2NA 2ELAA 4TKNA 5JP4A 2LKOA 2CY5A 2IFSA 4H8SA 2J0JA 1U2BA 4PQ0A 4NSWA 4A6FB 4A5KA 2GJYA 2COFA 1GG3A 2QKLA 4HDOA 1P5TA 1U5DA 4D0NB 2DKQA 2Z0QA 1DYNA 1NU2A 2EJ8A 2DLWA 2H7DA 2ROVA 3KY9A 3QBVB 3N7CA 4A6KA 5D3WA 4HB4B 3CXBB 1DDMA 2K2UA 4K17A 2ZPYA 3LJUX 1U5FA 2M14A 1ZC3B 5C79A 2OTXA 4ZRJA 4A6HA 2L2IA 1TJ6A 4A6FA 2D9YA 3SUZA 2ELBA 1W1HA 2OQBA 4TYZA 3DXEA 5D3YA 1ZVRA 1XKEA 3CIKA 4B6HA 4HAZB 1UNRA 2L1CA 3T06A 4P7IA 4KHAA 3HQCA 1EGXA 1B55A 3TW1A 4GMXB 3QIJA 2VSZA 1WG7A 1KZGA 3A8PA 5C6RA 5C5BB 4C0AA 4K81A 1H4RA 2KGXB 5FI1A 2YRYA 1DDWA 4DX8A 1UNPA 1V5MA 4IOYX 4WVFB 1P6SA 5LONB 3D8EA 1MIXA 4HAVB 3HK0A 3M1IB 1MK9B 1ZM0A 3AU5A 1XR0B 3D8FA 1FHXA 1K5DB 2MDXA 2Q13A 3BINA 4KAXB 2IYBA 4K2PA 1RJ2A 2DYQA 1V5UA 2YSZA 2M38A 1KI1B 3WA0A 3FM8C 2QKMA 4NY0A 1DROA 4HDQA 2DKPA 1Y5OA 2G35A 5EFXA 2RGNB 1P3RA 2YS5A 5GOWB 1X11A 3V5WA 4HAYB 1BWNA 2UVMA 2DHJA 1X1FA 3UZTA 1BTKA 2LOZA 1MIZB 1AWEA 5C5BA 2MKRA 1MK7B 2D9VA 3U8ZA 3O96A 4DBBA 2W2WA 1SHCA 2VKIA 3MPXA 3SYXA 2EMSA 1WI1A 4K2OA 3KZ1A 1Q67A 4F7GA 1U5EA 4DXAB 3U7DA 2ADZA 1FGYA 1OY2A 4EMOA 5DHFB 2LULA 3QWMA 2CODA 3ULCA 1TQZA 1N3HA 5DI9B 4XWXA 2DA0A 3RCPA 2R0DA 3KSYA 5KCVA 2P8VA 2D11A 2I5FA 3PVUA 2LOXA 3SNHA 3HW2B 2AL6A 2W2XD 3A8QA 2VRWB 1SGHA 1UNQA 1X86A 2P0FA 3PZDA 4MY6A 3SO6A 2Y7BA 1XX0A 1ZSQA 1Y19B 2Y8FA 2P0DA 3D8DA 1WVHA 1LB1A 1V89A 1J19A 4EJNA 2H7EA 3OANA 1GC6A 1DBHA 1OMWA 3P6AA 5HE3A 4CHJA 4DX90 5JHHA 4HATB 2RUKB 3X23A 2NMBA 5LOPB 2KCJA 1DDVA 3ODOA 2CRFA 3VIAA 3TO1A 2YVCA 2MFQA 2N23A 1KZ7A 1WJMA 2MWNB 3PG7A 1H10A 1PLSA 1FAOA 2J0KA 4WSFA 1ZC4B 1WGUA 4EKUA 1J0WA 1I7AA 2P0HA 1MKEA 1UPRA 3F5RA 1PMSA 4IAPA 3ODXA 2KUPA 1M7RA 2ROZB 4WJ7A 2D9ZA 5KQ4A 2J0MA 5DH9B 4YONA 3ULBA 3FSSA 4F7HA 1FHWA 4HAWB 3DXDA 2BCJA 3ML4A 5J3YA 1NI2A 3TCAA 2E2XA 2HE7A 5KQ1A 4HHVA 3KRWA 3PSCA 4GPTB 1W1DA 5HE0A 1IRSA 2DHKA 4BBKA 1FHOA 2COCA 3PVWA 5FI0A 5JHGA 2K00A 1QC6A 4CYEA 4PNKA 5D27A 1PFJA 5CLQB 1M7EA 3BJIA 3WYFB 1V61A 1XD4A 1E5WA 2LG1A 5D3XA 2I5CA 2YT1A 2RNRB 2UZRA 2GCJA 4HB2B 2EC1A 1UPQA 2RLOA 2FJLA 3IVFA 2DHIA 3KRXA 1V5PA 5D3VA 1I2HA 4HAUB 1BTNA 3FEHA 1EVHA 5L81A 1BAKA 5CLLB 1EAZA 2I1KA 2YS3A 4ZRIA 3F0WA 1MAIA 1OQNA 1NTYA 2XQNM 3ODWA 2Z0PA 2K2JA 4HB0B 3VOQA 2AEHA 2HTHB 1FB8A 2YS1A 5J3QA 5DIFB 4YL8A 4GMVA
chains in the Genus database with same CATH superfamily
4CHMA 3AU4A 1FOEA 2D9WA 1Z87A 2YT0A 3MDBC 2D10A 5HE2A 4MT7A 2DN6A 4KHOA 4F7UP 2KIGA 1EF1A 4ZRKA 3ZVRA 3A98B 2COAA 3U12A 2R09A 3DXCA 2NZ8B 4IFSA 3AJ4A 1V88A 2Y8GA 4MK0A 2GS0A 1MPHA 3FVCA 2D2QA 4Y94A 1W1GA 3PEGA 2JP2A 4HAXB 2RSGA 2RRFA 1RRPB 4GN1A 2CY4A 2DTCA 2Z0OA 2DYNA 2I1JA 3OHMB 5HE1A 5C16A 1TXDA 3TVVA 3TFMA 4HB3B 4KHBB 1X05A 1XODA 4KVGB 2D9XA 3GYOA 2N0YA 4GXBA 3P7ZA 2RVBB 5JLJB 1X1GA 3PP2A 4GZUA 3SV1A 1XCGA 2D4QA 2CAYA 3G9WA 2W2XC 3DCXA 1LW3A 1U27A 2DX1A 4CSQA 1FGZA 2Z59A 2DFKA 3NW8A 2V76A 2J59M 1U29A 4L6EA 2LYDA 3PVLA 1ISNA 3ZDTA 1UEFA 1WJ1A 2GCLA 2PZ1A 2UZSA 2K8EA 2X18A 2YF0A 5DHAB 1QQGA 2EMTA 3HIEA 1NTVA 4Z2MB 5J3TA 1GC7A 1AQCA 3NSUA 1U5GA 2DX5A 1WGQA 3GYPA 1K5GB 4Z2NA 2ELAA 4TKNA 5JP4A 2LKOA 2CY5A 2IFSA 4H8SA 2J0JA 1U2BA 4PQ0A 4NSWA 4A6FB 4A5KA 2GJYA 2COFA 1GG3A 2QKLA 3B77A 1P5TA 4HDOA 1U5DA 4D0NB 2DKQA 2Z0QA 1DYNA 1NU2A 2EJ8A 2DLWA 2H7DA 2KIEA 2ROVA 5LG4B 3KY9A 3QBVB 3N7CA 4A6KA 1ZYIA 5D3WA 4HB4B 3NWAA 3CXBB 1DDMA 2K2UA 4K17A 2ZPYA 3LJUX 1U5FA 2NBVA 2M14A 1ZC3B 5C79A 5I2MA 2OTXA 4ZRJA 4A6HA 2L2IA 1MI1A 1TJ6A 2K49A 4A6FA 2D9YA 3SUZA 2ELBA 1W1HA 2OQBA 4TYZA 3DXEA 4KHBA 5D3YA 1ZVRA 1XKEA 3CIKA 4B6HA 4HAZB 1UNRA 2L1CA 3T06A 4P7IA 4KHAA 3HQCA 4OSNA 1EGXA 1B55A 3TW1A 4GMXB 3QIJA 2VSZA 1WG7A 1KZGA 3A8PA 5C6RA 5C5BB 4C0AA 4K81A 1H4RA 2KGXB 2Z14A 5FI1A 2YRYA 4QJ3B 1DDWA 2YT2A 4DX8A 1UNPA 1V5MA 4IOYX 4WVFB 1P6SA 5LONB 3D8EA 1MIXA 4HAVB 4GOUA 4QXAB 3HK0A 3M1IB 1MK9B 1ZM0A 3AU5A 1XR0B 3D8FA 1FHXA 1K5DB 2MDXA 2Q13A 3BINA 4KAXB 2IYBA 4K2PA 4QJ4B 1RJ2A 2DYQA 1V5UA 2YSZA 2M38A 1KI1B 3WA0A 3FM8C 2QKMA 4NY0A 1DROA 4HDQA 2DKPA 1Y5OA 2G35A 5EFXA 2RGNB 1P3RA 2YS5A 5GOWB 1X11A 3V5WA 4HAYB 1BWNA 2UVMA 2DHJA 1X1FA 3UZTA 1BTKA 2LOZA 1MIZB 1AWEA 5C5BA 2MKRA 1MK7B 2D9VA 3U8ZA 3O96A 4DBBA 2W2WA 1SHCA 2VKIA 3MPXA 3SYXA 2EMSA 1WI1A 4K2OA 3KZ1A 1T77A 1Q67A 4F7GA 1U5EA 4DXAB 3U7DA 2ADZA 1FGYA 1OY2A 4EMOA 5DHFB 2LULA 3QWMA 2CODA 3ULCA 1TQZA 1N3HA 5DI9B 4XWXA 2DA0A 3RCPA 2R0DA 3KSYA 5KCVA 2P8VA 2D11A 2I5FA 3PVUA 2LOXA 3SNHA 3HW2B 2AL6A 4D6WA 2W2XD 3A8QA 5IRSA 2VRWB 4OT1A 1SGHA 1UNQA 5M4YB 1X86A 2P0FA 3PZDA 4MY6A 3SO6A 2Y7BA 1XX0A 1ZSQA 1Y19B 2Y8FA 2P0DA 3D8DA 1WVHA 1LB1A 1V89A 1J19A 4EJNA 2H7EA 3OANA 1GC6A 1DBHA 1OMWA 3P6AA 5HE3A 4CHJA 4DX90 5JHHA 4HATB 2RUKB 3X23A 2NMBA 2Z4DA 5LOPB 2KCJA 1DDVA 3ODOA 2CRFA 3VIAA 3TO1A 2YVCA 2MFQA 2N23A 1KZ7A 1WJMA 2MWNB 3PG7A 1H10A 1PLSA 1FAOA 2J0KA 4WSFA 1ZC4B 1WGUA 4EKUA 1J0WA 1I7AA 2P0HA 1MKEA 1UPRA 3F5RA 1PMSA 4IAPA 3ODXA 2KUPA 1M7RA 2ROZB 4WJ7A 2D9ZA 5KQ4A 2FJUB 2J0MA 5DH9B 4L1RA 4YONA 3ULBA 3FSSA 4F7HA 1FHWA 2ZKMX 3HSAA 4HAWB 3DXDA 2BCJA 3ML4A 5J3YA 1NI2A 3TCAA 2E2XA 2HE7A 5KQ1A 2KUQA 4HHVA 4QJ5B 3KRWA 3PSCA 4GPTB 1W1DA 5HE0A 1IRSA 2DHKA 4BBKA 1FHOA 2COCA 3PVWA 5I2SA 5FI0A 4GNKB 5JHGA 4DIXA 2K00A 1QC6A 4CYEA 4PNKA 5D27A 1PFJA 5CLQB 1M7EA 3BJIA 3WYFB 1V61A 1XD4A 1E5WA 2LG1A 5D3XA 2I5CA 2KR0A 2YT1A 2RNRB 2UZRA 2GCJA 4HB2B 2EC1A 1UPQA 2RLOA 2FJLA 3IVFA 2DHIA 3KRXA 1V5PA 5D3VA 1I2HA 4HAUB 2R2YA 1BTNA 2Z13A 3FEHA 1EVHA 5L81A 1BAKA 4HSIA 5CLLB 1EAZA 2I1KA 2YS3A 4ZRIA 3F0WA 1MAIA 1OQNA 2GUMA 1NTYA 2XQNM 3ODWA 2Z0PA 2K2JA 4HB0B 3VOQA 3A58A 2AEHA 2HTHB 3NWDA 1FB8A 2YS1A 5J3QA 5DIFB 4YL8A 4GMVA 3NWFA
chains in the Genus database with same CATH topology
4CHMA 3AU4A 1FOEA 2D9WA 1Z87A 2YT0A 3MDBC 2D10A 5HE2A 4MT7A 2DN6A 4KHOA 4F7UP 1EF1A 4ZRKA 3ZVRA 3A98B 2COAA 2R09A 3DXCA 2NZ8B 4IFSA 3AJ4A 1V88A 2Y8GA 4MK0A 2GS0A 1MPHA 2D2QA 4Y94A 1W1GA 3PEGA 2JP2A 4HAXB 2RSGA 1RRPB 4GN1A 2CY4A 2DTCA 2Z0OA 2DYNA 2I1JA 5HE1A 5C16A 1TXDA 3TVVA 3TFMA 4HB3B 4KHBB 1X05A 1XODA 4KVGB 2D9XA 3GYOA 2N0YA 4GXBA 3P7ZA 2RVBB 5JLJB 1X1GA 3PP2A 4GZUA 3SV1A 1XCGA 2D4QA 2CAYA 3G9WA 2W2XC 1LW3A 1U27A 2DX1A 1FGZA 2DFKA 2V76A 2J59M 1U29A 4L6EA 2LYDA 3PVLA 1ISNA 3ZDTA 1UEFA 1WJ1A 2GCLA 2PZ1A 2UZSA 2X18A 2YF0A 5DHAB 1QQGA 2EMTA 1NTVA 4Z2MB 5J3TA 1GC7A 1AQCA 3NSUA 1U5GA 2DX5A 1WGQA 3GYPA 1K5GB 4Z2NA 2ELAA 4TKNA 5JP4A 2LKOA 2CY5A 2IFSA 4H8SA 2J0JA 1U2BA 4PQ0A 4NSWA 4A6FB 4A5KA 2GJYA 2COFA 1GG3A 2QKLA 4HDOA 1P5TA 1U5DA 4D0NB 2DKQA 2Z0QA 1DYNA 1NU2A 2EJ8A 2DLWA 2H7DA 2ROVA 3KY9A 3QBVB 3N7CA 4A6KA 5D3WA 4HB4B 3CXBB 1DDMA 2K2UA 4K17A 2ZPYA 3LJUX 1U5FA 2M14A 1ZC3B 5C79A 2OTXA 4ZRJA 4A6HA 2L2IA 1TJ6A 4A6FA 2D9YA 3SUZA 2ELBA 1W1HA 2OQBA 4TYZA 3DXEA 5D3YA 1ZVRA 1XKEA 3CIKA 4B6HA 4HAZB 1UNRA 2L1CA 3T06A 4P7IA 4KHAA 3HQCA 1EGXA 1B55A 3TW1A 4GMXB 3QIJA 2VSZA 1WG7A 1KZGA 3A8PA 5C6RA 5C5BB 4C0AA 4K81A 1H4RA 2KGXB 5FI1A 2YRYA 1DDWA 4DX8A 1UNPA 1V5MA 4IOYX 4WVFB 1P6SA 5LONB 3D8EA 1MIXA 4HAVB 3HK0A 3M1IB 1MK9B 1ZM0A 3AU5A 1XR0B 3D8FA 1FHXA 1K5DB 2MDXA 2Q13A 3BINA 4KAXB 2IYBA 4K2PA 1RJ2A 2DYQA 1V5UA 2YSZA 2M38A 1KI1B 3WA0A 3FM8C 2QKMA 4NY0A 1DROA 4HDQA 2DKPA 1Y5OA 2G35A 5EFXA 2RGNB 1P3RA 2YS5A 5GOWB 1X11A 3V5WA 4HAYB 1BWNA 2UVMA 2DHJA 1X1FA 3UZTA 1BTKA 2LOZA 1MIZB 1AWEA 5C5BA 2MKRA 1MK7B 2D9VA 3U8ZA 3O96A 4DBBA 2W2WA 1SHCA 2VKIA 3MPXA 3SYXA 2EMSA 1WI1A 4K2OA 3KZ1A 1Q67A 4F7GA 1U5EA 4DXAB 3U7DA 2ADZA 1FGYA 1OY2A 4EMOA 5DHFB 2LULA 3QWMA 2CODA 3ULCA 1TQZA 1N3HA 5DI9B 4XWXA 2DA0A 3RCPA 2R0DA 3KSYA 5KCVA 2P8VA 2D11A 2I5FA 3PVUA 2LOXA 3SNHA 3HW2B 2AL6A 2W2XD 3A8QA 2VRWB 1SGHA 1UNQA 1X86A 2P0FA 3PZDA 4MY6A 3SO6A 2Y7BA 1XX0A 1ZSQA 1Y19B 2Y8FA 2P0DA 3D8DA 1WVHA 1LB1A 1V89A 1J19A 4EJNA 2H7EA 3OANA 1GC6A 1DBHA 1OMWA 3P6AA 5HE3A 4CHJA 4DX90 5JHHA 4HATB 2RUKB 3X23A 2NMBA 5LOPB 2KCJA 1DDVA 3ODOA 2CRFA 3VIAA 3TO1A 2YVCA 2MFQA 2N23A 1KZ7A 1WJMA 2MWNB 3PG7A 1H10A 1PLSA 1FAOA 2J0KA 4WSFA 1ZC4B 1WGUA 4EKUA 1J0WA 1I7AA 2P0HA 1MKEA 1UPRA 3F5RA 1PMSA 4IAPA 3ODXA 2KUPA 1M7RA 2ROZB 4WJ7A 2D9ZA 5KQ4A 2J0MA 5DH9B 4YONA 3ULBA 3FSSA 4F7HA 1FHWA 4HAWB 3DXDA 2BCJA 3ML4A 5J3YA 1NI2A 3TCAA 2E2XA 2HE7A 5KQ1A 4HHVA 3KRWA 3PSCA 4GPTB 1W1DA 5HE0A 1IRSA 2DHKA 4BBKA 1FHOA 2COCA 3PVWA 5FI0A 5JHGA 2K00A 1QC6A 4CYEA 4PNKA 5D27A 1PFJA 5CLQB 1M7EA 3BJIA 3WYFB 1V61A 1XD4A 1E5WA 2LG1A 5D3XA 2I5CA 2YT1A 2RNRB 2UZRA 2GCJA 4HB2B 2EC1A 1UPQA 2RLOA 2FJLA 3IVFA 2DHIA 3KRXA 1V5PA 5D3VA 1I2HA 4HAUB 1BTNA 3FEHA 1EVHA 5L81A 1BAKA 5CLLB 1EAZA 2I1KA 2YS3A 4ZRIA 3F0WA 1MAIA 1OQNA 1NTYA 2XQNM 3ODWA 2Z0PA 2K2JA 4HB0B 3VOQA 2AEHA 2HTHB 1FB8A 2YS1A 5J3QA 5DIFB 4YL8A 4GMVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CHM A;  3AU4 A;  1FOE A;  2D9W A;  1Z87 A;  2YT0 A;  3MDB C;  2D10 A;  5HE2 A;  4MT7 A;  2DN6 A;  4KHO A;  4F7U P;  1EF1 A;  4ZRK A;  3ZVR A;  3A98 B;  2COA A;  2R09 A;  3DXC A;  2NZ8 B;  4IFS A;  3AJ4 A;  1V88 A;  2Y8G A;  4MK0 A;  2GS0 A;  1MPH A;  2D2Q A;  4Y94 A;  1W1G A;  3PEG A;  2JP2 A;  4HAX B;  2RSG A;  1RRP B;  4GN1 A;  2CY4 A;  2DTC A;  2Z0O A;  2DYN A;  2I1J A;  5HE1 A;  5C16 A;  1TXD A;  3TVV A;  3TFM A;  4HB3 B;  4KHB B;  1X05 A;  1XOD A;  4KVG B;  2D9X A;  3GYO A;  2N0Y A;  4GXB A;  3P7Z A;  2RVB B;  5JLJ B;  1X1G A;  3PP2 A;  4GZU A;  3SV1 A;  1XCG A;  2D4Q A;  2CAY A;  3G9W A;  2W2X C;  1LW3 A;  1U27 A;  2DX1 A;  1FGZ A;  2DFK A;  2V76 A;  2J59 M;  1U29 A;  4L6E A;  2LYD A;  3PVL A;  1ISN A;  3ZDT A;  1UEF A;  1WJ1 A;  2GCL A;  2PZ1 A;  2UZS A;  2X18 A;  2YF0 A;  5DHA B;  1QQG A;  2EMT A;  1NTV A;  4Z2M B;  5J3T A;  1GC7 A;  1AQC A;  3NSU A;  1U5G A;  2DX5 A;  1WGQ A;  3GYP A;  1K5G B;  4Z2N A;  2ELA A;  4TKN A;  5JP4 A;  2LKO A;  2CY5 A;  2IFS A;  4H8S A;  2J0J A;  1U2B A;  4PQ0 A;  4NSW A;  4A6F B;  4A5K A;  2GJY A;  2COF A;  1GG3 A;  2QKL A;  4HDO A;  1P5T A;  1U5D A;  4D0N B;  2DKQ A;  2Z0Q A;  1DYN A;  1NU2 A;  2EJ8 A;  2DLW A;  2H7D A;  2ROV A;  3KY9 A;  3QBV B;  3N7C A;  4A6K A;  5D3W A;  4HB4 B;  3CXB B;  1DDM A;  2K2U A;  4K17 A;  2ZPY A;  3LJU X;  1U5F A;  2M14 A;  1ZC3 B;  5C79 A;  2OTX A;  4ZRJ A;  4A6H A;  2L2I A;  1TJ6 A;  4A6F A;  2D9Y A;  3SUZ A;  2ELB A;  1W1H A;  2OQB A;  4TYZ A;  3DXE A;  5D3Y A;  1ZVR A;  1XKE A;  3CIK A;  4B6H A;  4HAZ B;  1UNR A;  2L1C A;  3T06 A;  4P7I A;  4KHA A;  3HQC A;  1EGX A;  1B55 A;  3TW1 A;  4GMX B;  3QIJ A;  2VSZ A;  1WG7 A;  1KZG A;  3A8P A;  5C6R A;  5C5B B;  4C0A A;  4K81 A;  1H4R A;  2KGX B;  5FI1 A;  2YRY A;  1DDW A;  4DX8 A;  1UNP A;  1V5M A;  4IOY X;  4WVF B;  1P6S A;  5LON B;  3D8E A;  1MIX A;  4HAV B;  3HK0 A;  3M1I B;  1MK9 B;  1ZM0 A;  3AU5 A;  1XR0 B;  3D8F A;  1FHX A;  1K5D B;  2MDX A;  2Q13 A;  3BIN A;  4KAX B;  2IYB A;  4K2P A;  1RJ2 A;  2DYQ A;  1V5U A;  2YSZ A;  2M38 A;  1KI1 B;  3WA0 A;  3FM8 C;  2QKM A;  4NY0 A;  1DRO A;  4HDQ A;  2DKP A;  1Y5O A;  2G35 A;  5EFX A;  2RGN B;  1P3R A;  2YS5 A;  5GOW B;  1X11 A;  3V5W A;  4HAY B;  1BWN A;  2UVM A;  2DHJ A;  1X1F A;  3UZT A;  1BTK A;  2LOZ A;  1MIZ B;  1AWE A;  5C5B A;  2MKR A;  1MK7 B;  2D9V A;  3U8Z A;  3O96 A;  4DBB A;  2W2W A;  1SHC A;  2VKI A;  3MPX A;  3SYX A;  2EMS A;  1WI1 A;  4K2O A;  3KZ1 A;  1Q67 A;  4F7G A;  1U5E A;  4DXA B;  3U7D A;  2ADZ A;  1FGY A;  1OY2 A;  4EMO A;  5DHF B;  2LUL A;  3QWM A;  2COD A;  3ULC A;  1TQZ A;  1N3H A;  5DI9 B;  4XWX A;  2DA0 A;  3RCP A;  2R0D A;  3KSY A;  5KCV A;  2P8V A;  2D11 A;  2I5F A;  3PVU A;  2LOX A;  3SNH A;  3HW2 B;  2AL6 A;  2W2X D;  3A8Q A;  2VRW B;  1SGH A;  1UNQ A;  1X86 A;  2P0F A;  3PZD A;  4MY6 A;  3SO6 A;  2Y7B A;  1XX0 A;  1ZSQ A;  1Y19 B;  2Y8F A;  2P0D A;  3D8D A;  1WVH A;  1LB1 A;  1V89 A;  1J19 A;  4EJN A;  2H7E A;  3OAN A;  1GC6 A;  1DBH A;  1OMW A;  3P6A A;  5HE3 A;  4CHJ A;  4DX9 0;  5JHH A;  4HAT B;  2RUK B;  3X23 A;  2NMB A;  5LOP B;  2KCJ A;  1DDV A;  3ODO A;  2CRF A;  3VIA A;  3TO1 A;  2YVC A;  2MFQ A;  2N23 A;  1KZ7 A;  1WJM A;  2MWN B;  3PG7 A;  1H10 A;  1PLS A;  1FAO A;  2J0K A;  4WSF A;  1ZC4 B;  1WGU A;  4EKU A;  1J0W A;  1I7A A;  2P0H A;  1MKE A;  1UPR A;  3F5R A;  1PMS A;  4IAP A;  3ODX A;  2KUP A;  1M7R A;  2ROZ B;  4WJ7 A;  2D9Z A;  5KQ4 A;  2J0M A;  5DH9 B;  4YON A;  3ULB A;  3FSS A;  4F7H A;  1FHW A;  4HAW B;  3DXD A;  2BCJ A;  3ML4 A;  5J3Y A;  1NI2 A;  3TCA A;  2E2X A;  2HE7 A;  5KQ1 A;  4HHV A;  3KRW A;  3PSC A;  4GPT B;  1W1D A;  5HE0 A;  1IRS A;  2DHK A;  4BBK A;  1FHO A;  2COC A;  3PVW A;  5FI0 A;  5JHG A;  2K00 A;  1QC6 A;  4CYE A;  4PNK A;  5D27 A;  1PFJ A;  5CLQ B;  1M7E A;  3BJI A;  3WYF B;  1V61 A;  1XD4 A;  1E5W A;  2LG1 A;  5D3X A;  2I5C A;  2YT1 A;  2RNR B;  2UZR A;  2GCJ A;  4HB2 B;  2EC1 A;  1UPQ A;  2RLO A;  2FJL A;  3IVF A;  2DHI A;  3KRX A;  1V5P A;  5D3V A;  1I2H A;  4HAU B;  1BTN A;  3FEH A;  1EVH A;  5L81 A;  1BAK A;  5CLL B;  1EAZ A;  2I1K A;  2YS3 A;  4ZRI A;  3F0W A;  1MAI A;  1OQN A;  1NTY A;  2XQN M;  3ODW A;  2Z0P A;  2K2J A;  4HB0 B;  3VOQ A;  2AEH A;  2HTH B;  1FB8 A;  2YS1 A;  5J3Q A;  5DIF B;  4YL8 A;  4GMV A; 
#chains in the Genus database with same CATH topology
 4CHM A;  3AU4 A;  1FOE A;  2D9W A;  1Z87 A;  2YT0 A;  3MDB C;  2D10 A;  5HE2 A;  4MT7 A;  2DN6 A;  4KHO A;  4F7U P;  2KIG A;  1EF1 A;  4ZRK A;  3ZVR A;  3A98 B;  2COA A;  3U12 A;  2R09 A;  3DXC A;  2NZ8 B;  4IFS A;  3AJ4 A;  1V88 A;  2Y8G A;  4MK0 A;  2GS0 A;  1MPH A;  3FVC A;  2D2Q A;  4Y94 A;  1W1G A;  3PEG A;  2JP2 A;  4HAX B;  2RSG A;  2RRF A;  1RRP B;  4GN1 A;  2CY4 A;  2DTC A;  2Z0O A;  2DYN A;  2I1J A;  3OHM B;  5HE1 A;  5C16 A;  1TXD A;  3TVV A;  3TFM A;  4HB3 B;  4KHB B;  1X05 A;  1XOD A;  4KVG B;  2D9X A;  3GYO A;  2N0Y A;  4GXB A;  3P7Z A;  2RVB B;  5JLJ B;  1X1G A;  3PP2 A;  4GZU A;  3SV1 A;  1XCG A;  2D4Q A;  2CAY A;  3G9W A;  2W2X C;  3DCX A;  1LW3 A;  1U27 A;  2DX1 A;  4CSQ A;  1FGZ A;  2Z59 A;  2DFK A;  3NW8 A;  2V76 A;  2J59 M;  1U29 A;  4L6E A;  2LYD A;  3PVL A;  1ISN A;  3ZDT A;  1UEF A;  1WJ1 A;  2GCL A;  2PZ1 A;  2UZS A;  2K8E A;  2X18 A;  2YF0 A;  5DHA B;  1QQG A;  2EMT A;  3HIE A;  1NTV A;  4Z2M B;  5J3T A;  1GC7 A;  1AQC A;  3NSU A;  1U5G A;  2DX5 A;  1WGQ A;  3GYP A;  1K5G B;  4Z2N A;  2ELA A;  4TKN A;  5JP4 A;  2LKO A;  2CY5 A;  2IFS A;  4H8S A;  2J0J A;  1U2B A;  4PQ0 A;  4NSW A;  4A6F B;  4A5K A;  2GJY A;  2COF A;  1GG3 A;  2QKL A;  3B77 A;  1P5T A;  4HDO A;  1U5D A;  4D0N B;  2DKQ A;  2Z0Q A;  1DYN A;  1NU2 A;  2EJ8 A;  2DLW A;  2H7D A;  2KIE A;  2ROV A;  5LG4 B;  3KY9 A;  3QBV B;  3N7C A;  4A6K A;  1ZYI A;  5D3W A;  4HB4 B;  3NWA A;  3CXB B;  1DDM A;  2K2U A;  4K17 A;  2ZPY A;  3LJU X;  1U5F A;  2NBV A;  2M14 A;  1ZC3 B;  5C79 A;  5I2M A;  2OTX A;  4ZRJ A;  4A6H A;  2L2I A;  1MI1 A;  1TJ6 A;  2K49 A;  4A6F A;  2D9Y A;  3SUZ A;  2ELB A;  1W1H A;  2OQB A;  4TYZ A;  3DXE A;  4KHB A;  5D3Y A;  1ZVR A;  1XKE A;  3CIK A;  4B6H A;  4HAZ B;  1UNR A;  2L1C A;  3T06 A;  4P7I A;  4KHA A;  3HQC A;  4OSN A;  1EGX A;  1B55 A;  3TW1 A;  4GMX B;  3QIJ A;  2VSZ A;  1WG7 A;  1KZG A;  3A8P A;  5C6R A;  5C5B B;  4C0A A;  4K81 A;  1H4R A;  2KGX B;  2Z14 A;  5FI1 A;  2YRY A;  4QJ3 B;  1DDW A;  2YT2 A;  4DX8 A;  1UNP A;  1V5M A;  4IOY X;  4WVF B;  1P6S A;  5LON B;  3D8E A;  1MIX A;  4HAV B;  4GOU A;  4QXA B;  3HK0 A;  3M1I B;  1MK9 B;  1ZM0 A;  3AU5 A;  1XR0 B;  3D8F A;  1FHX A;  1K5D B;  2MDX A;  2Q13 A;  3BIN A;  4KAX B;  2IYB A;  4K2P A;  4QJ4 B;  1RJ2 A;  2DYQ A;  1V5U A;  2YSZ A;  2M38 A;  1KI1 B;  3WA0 A;  3FM8 C;  2QKM A;  4NY0 A;  1DRO A;  4HDQ A;  2DKP A;  1Y5O A;  2G35 A;  5EFX A;  2RGN B;  1P3R A;  2YS5 A;  5GOW B;  1X11 A;  3V5W A;  4HAY B;  1BWN A;  2UVM A;  2DHJ A;  1X1F A;  3UZT A;  1BTK A;  2LOZ A;  1MIZ B;  1AWE A;  5C5B A;  2MKR A;  1MK7 B;  2D9V A;  3U8Z A;  3O96 A;  4DBB A;  2W2W A;  1SHC A;  2VKI A;  3MPX A;  3SYX A;  2EMS A;  1WI1 A;  4K2O A;  3KZ1 A;  1T77 A;  1Q67 A;  4F7G A;  1U5E A;  4DXA B;  3U7D A;  2ADZ A;  1FGY A;  1OY2 A;  4EMO A;  5DHF B;  2LUL A;  3QWM A;  2COD A;  3ULC A;  1TQZ A;  1N3H A;  5DI9 B;  4XWX A;  2DA0 A;  3RCP A;  2R0D A;  3KSY A;  5KCV A;  2P8V A;  2D11 A;  2I5F A;  3PVU A;  2LOX A;  3SNH A;  3HW2 B;  2AL6 A;  4D6W A;  2W2X D;  3A8Q A;  5IRS A;  2VRW B;  4OT1 A;  1SGH A;  1UNQ A;  5M4Y B;  1X86 A;  2P0F A;  3PZD A;  4MY6 A;  3SO6 A;  2Y7B A;  1XX0 A;  1ZSQ A;  1Y19 B;  2Y8F A;  2P0D A;  3D8D A;  1WVH A;  1LB1 A;  1V89 A;  1J19 A;  4EJN A;  2H7E A;  3OAN A;  1GC6 A;  1DBH A;  1OMW A;  3P6A A;  5HE3 A;  4CHJ A;  4DX9 0;  5JHH A;  4HAT B;  2RUK B;  3X23 A;  2NMB A;  2Z4D A;  5LOP B;  2KCJ A;  1DDV A;  3ODO A;  2CRF A;  3VIA A;  3TO1 A;  2YVC A;  2MFQ A;  2N23 A;  1KZ7 A;  1WJM A;  2MWN B;  3PG7 A;  1H10 A;  1PLS A;  1FAO A;  2J0K A;  4WSF A;  1ZC4 B;  1WGU A;  4EKU A;  1J0W A;  1I7A A;  2P0H A;  1MKE A;  1UPR A;  3F5R A;  1PMS A;  4IAP A;  3ODX A;  2KUP A;  1M7R A;  2ROZ B;  4WJ7 A;  2D9Z A;  5KQ4 A;  2FJU B;  2J0M A;  5DH9 B;  4L1R A;  4YON A;  3ULB A;  3FSS A;  4F7H A;  1FHW A;  2ZKM X;  3HSA A;  4HAW B;  3DXD A;  2BCJ A;  3ML4 A;  5J3Y A;  1NI2 A;  3TCA A;  2E2X A;  2HE7 A;  5KQ1 A;  2KUQ A;  4HHV A;  4QJ5 B;  3KRW A;  3PSC A;  4GPT B;  1W1D A;  5HE0 A;  1IRS A;  2DHK A;  4BBK A;  1FHO A;  2COC A;  3PVW A;  5I2S A;  5FI0 A;  4GNK B;  5JHG A;  4DIX A;  2K00 A;  1QC6 A;  4CYE A;  4PNK A;  5D27 A;  1PFJ A;  5CLQ B;  1M7E A;  3BJI A;  3WYF B;  1V61 A;  1XD4 A;  1E5W A;  2LG1 A;  5D3X A;  2I5C A;  2KR0 A;  2YT1 A;  2RNR B;  2UZR A;  2GCJ A;  4HB2 B;  2EC1 A;  1UPQ A;  2RLO A;  2FJL A;  3IVF A;  2DHI A;  3KRX A;  1V5P A;  5D3V A;  1I2H A;  4HAU B;  2R2Y A;  1BTN A;  2Z13 A;  3FEH A;  1EVH A;  5L81 A;  1BAK A;  4HSI A;  5CLL B;  1EAZ A;  2I1K A;  2YS3 A;  4ZRI A;  3F0W A;  1MAI A;  1OQN A;  2GUM A;  1NTY A;  2XQN M;  3ODW A;  2Z0P A;  2K2J A;  4HB0 B;  3VOQ A;  3A58 A;  2AEH A;  2HTH B;  3NWD A;  1FB8 A;  2YS1 A;  5J3Q A;  5DIF B;  4YL8 A;  4GMV A;  3NWF A; 
#chains in the Genus database with same CATH homology
 4CHM A;  3AU4 A;  1FOE A;  2D9W A;  1Z87 A;  2YT0 A;  3MDB C;  2D10 A;  5HE2 A;  4MT7 A;  2DN6 A;  4KHO A;  4F7U P;  1EF1 A;  4ZRK A;  3ZVR A;  3A98 B;  2COA A;  2R09 A;  3DXC A;  2NZ8 B;  4IFS A;  3AJ4 A;  1V88 A;  2Y8G A;  4MK0 A;  2GS0 A;  1MPH A;  2D2Q A;  4Y94 A;  1W1G A;  3PEG A;  2JP2 A;  4HAX B;  2RSG A;  1RRP B;  4GN1 A;  2CY4 A;  2DTC A;  2Z0O A;  2DYN A;  2I1J A;  5HE1 A;  5C16 A;  1TXD A;  3TVV A;  3TFM A;  4HB3 B;  4KHB B;  1X05 A;  1XOD A;  4KVG B;  2D9X A;  3GYO A;  2N0Y A;  4GXB A;  3P7Z A;  2RVB B;  5JLJ B;  1X1G A;  3PP2 A;  4GZU A;  3SV1 A;  1XCG A;  2D4Q A;  2CAY A;  3G9W A;  2W2X C;  1LW3 A;  1U27 A;  2DX1 A;  1FGZ A;  2DFK A;  2V76 A;  2J59 M;  1U29 A;  4L6E A;  2LYD A;  3PVL A;  1ISN A;  3ZDT A;  1UEF A;  1WJ1 A;  2GCL A;  2PZ1 A;  2UZS A;  2X18 A;  2YF0 A;  5DHA B;  1QQG A;  2EMT A;  1NTV A;  4Z2M B;  5J3T A;  1GC7 A;  1AQC A;  3NSU A;  1U5G A;  2DX5 A;  1WGQ A;  3GYP A;  1K5G B;  4Z2N A;  2ELA A;  4TKN A;  5JP4 A;  2LKO A;  2CY5 A;  2IFS A;  4H8S A;  2J0J A;  1U2B A;  4PQ0 A;  4NSW A;  4A6F B;  4A5K A;  2GJY A;  2COF A;  1GG3 A;  2QKL A;  4HDO A;  1P5T A;  1U5D A;  4D0N B;  2DKQ A;  2Z0Q A;  1DYN A;  1NU2 A;  2EJ8 A;  2DLW A;  2H7D A;  2ROV A;  3KY9 A;  3QBV B;  3N7C A;  4A6K A;  5D3W A;  4HB4 B;  3CXB B;  1DDM A;  2K2U A;  4K17 A;  2ZPY A;  3LJU X;  1U5F A;  2M14 A;  1ZC3 B;  5C79 A;  2OTX A;  4ZRJ A;  4A6H A;  2L2I A;  1TJ6 A;  4A6F A;  2D9Y A;  3SUZ A;  2ELB A;  1W1H A;  2OQB A;  4TYZ A;  3DXE A;  5D3Y A;  1ZVR A;  1XKE A;  3CIK A;  4B6H A;  4HAZ B;  1UNR A;  2L1C A;  3T06 A;  4P7I A;  4KHA A;  3HQC A;  1EGX A;  1B55 A;  3TW1 A;  4GMX B;  3QIJ A;  2VSZ A;  1WG7 A;  1KZG A;  3A8P A;  5C6R A;  5C5B B;  4C0A A;  4K81 A;  1H4R A;  2KGX B;  5FI1 A;  2YRY A;  1DDW A;  4DX8 A;  1UNP A;  1V5M A;  4IOY X;  4WVF B;  1P6S A;  5LON B;  3D8E A;  1MIX A;  4HAV B;  3HK0 A;  3M1I B;  1MK9 B;  1ZM0 A;  3AU5 A;  1XR0 B;  3D8F A;  1FHX A;  1K5D B;  2MDX A;  2Q13 A;  3BIN A;  4KAX B;  2IYB A;  4K2P A;  1RJ2 A;  2DYQ A;  1V5U A;  2YSZ A;  2M38 A;  1KI1 B;  3WA0 A;  3FM8 C;  2QKM A;  4NY0 A;  1DRO A;  4HDQ A;  2DKP A;  1Y5O A;  2G35 A;  5EFX A;  2RGN B;  1P3R A;  2YS5 A;  5GOW B;  1X11 A;  3V5W A;  4HAY B;  1BWN A;  2UVM A;  2DHJ A;  1X1F A;  3UZT A;  1BTK A;  2LOZ A;  1MIZ B;  1AWE A;  5C5B A;  2MKR A;  1MK7 B;  2D9V A;  3U8Z A;  3O96 A;  4DBB A;  2W2W A;  1SHC A;  2VKI A;  3MPX A;  3SYX A;  2EMS A;  1WI1 A;  4K2O A;  3KZ1 A;  1Q67 A;  4F7G A;  1U5E A;  4DXA B;  3U7D A;  2ADZ A;  1FGY A;  1OY2 A;  4EMO A;  5DHF B;  2LUL A;  3QWM A;  2COD A;  3ULC A;  1TQZ A;  1N3H A;  5DI9 B;  4XWX A;  2DA0 A;  3RCP A;  2R0D A;  3KSY A;  5KCV A;  2P8V A;  2D11 A;  2I5F A;  3PVU A;  2LOX A;  3SNH A;  3HW2 B;  2AL6 A;  2W2X D;  3A8Q A;  2VRW B;  1SGH A;  1UNQ A;  1X86 A;  2P0F A;  3PZD A;  4MY6 A;  3SO6 A;  2Y7B A;  1XX0 A;  1ZSQ A;  1Y19 B;  2Y8F A;  2P0D A;  3D8D A;  1WVH A;  1LB1 A;  1V89 A;  1J19 A;  4EJN A;  2H7E A;  3OAN A;  1GC6 A;  1DBH A;  1OMW A;  3P6A A;  5HE3 A;  4CHJ A;  4DX9 0;  5JHH A;  4HAT B;  2RUK B;  3X23 A;  2NMB A;  5LOP B;  2KCJ A;  1DDV A;  3ODO A;  2CRF A;  3VIA A;  3TO1 A;  2YVC A;  2MFQ A;  2N23 A;  1KZ7 A;  1WJM A;  2MWN B;  3PG7 A;  1H10 A;  1PLS A;  1FAO A;  2J0K A;  4WSF A;  1ZC4 B;  1WGU A;  4EKU A;  1J0W A;  1I7A A;  2P0H A;  1MKE A;  1UPR A;  3F5R A;  1PMS A;  4IAP A;  3ODX A;  2KUP A;  1M7R A;  2ROZ B;  4WJ7 A;  2D9Z A;  5KQ4 A;  2J0M A;  5DH9 B;  4YON A;  3ULB A;  3FSS A;  4F7H A;  1FHW A;  4HAW B;  3DXD A;  2BCJ A;  3ML4 A;  5J3Y A;  1NI2 A;  3TCA A;  2E2X A;  2HE7 A;  5KQ1 A;  4HHV A;  3KRW A;  3PSC A;  4GPT B;  1W1D A;  5HE0 A;  1IRS A;  2DHK A;  4BBK A;  1FHO A;  2COC A;  3PVW A;  5FI0 A;  5JHG A;  2K00 A;  1QC6 A;  4CYE A;  4PNK A;  5D27 A;  1PFJ A;  5CLQ B;  1M7E A;  3BJI A;  3WYF B;  1V61 A;  1XD4 A;  1E5W A;  2LG1 A;  5D3X A;  2I5C A;  2YT1 A;  2RNR B;  2UZR A;  2GCJ A;  4HB2 B;  2EC1 A;  1UPQ A;  2RLO A;  2FJL A;  3IVF A;  2DHI A;  3KRX A;  1V5P A;  5D3V A;  1I2H A;  4HAU B;  1BTN A;  3FEH A;  1EVH A;  5L81 A;  1BAK A;  5CLL B;  1EAZ A;  2I1K A;  2YS3 A;  4ZRI A;  3F0W A;  1MAI A;  1OQN A;  1NTY A;  2XQN M;  3ODW A;  2Z0P A;  2K2J A;  4HB0 B;  3VOQ A;  2AEH A;  2HTH B;  1FB8 A;  2YS1 A;  5J3Q A;  5DIF B;  4YL8 A;  4GMV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...