4WSFA

Falafel evh1 domain bound to cenp-c fim
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
111
structure length
111
Chain Sequence
DTRRRVKLYALNAERQWDDRGTGHVSSTYVERLKGISLLVRAESDGSLLLESKIQPDTAYQKQQDTLIVWSEGDNFDLALSFQEKAGCDEIWEKICQVQGKDPSVEITQDI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Serine/threonine-protein phosphatase 4 regulatory subunit 3
publication title Centromeric binding and activity of Protein Phosphatase 4.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Signaling protein
total genus 30
structure length 111
sequence length 111
ec nomenclature
pdb deposition date 2014-10-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 4wsfA00
4BBKA 1FOEA 1KZ7A 2LYDA 1V89A 3SO6A 3U7DA 2VRWB 2Q13A 2L1CA 4DX90 1MK9B 3PEGA 2RVBB 2OQBA 3AJ4A 4MT7A 1LW3A 5KQ4A 3UZTA 1J19A 2LKOA 2FJLA 2COCA 2LULA 1XCGA 2P8VA 2YS3A 4ZRIA 3ODXA 1U5EA 4H8SA 1RJ2A 2YRYA 4DBBA 2D9ZA 4ZRKA 3TFMA 2DHIA 2J0KA 1DROA 5HE1A 4KAXB 5KQ1A 1ZM0A 4K2OA 2KGXB 1P6SA 1SGHA 4HAXB 2ADZA 3PSCA 1K5DB 3SNHA 1PFJA 3LJUX 1FHXA 1Y19B 3A8QA 3DXCA 2DHJA 1IRSA 2N0YA 5C6RA 2DX1A 3O96A 5D3YA 2J59M 2Z0QA 3D8EA 2J0MA 1WGUA 1BWNA 2P0FA 3GYOA 2D2QA 3KY9A 1M7RA 1GG3A 4A6FB 2COFA 2RNRB 1PMSA 5CLQB 2Y8GA 4P7IA 5HE0A 1PLSA 3FM8C 2E2XA 2ZPYA 3A8PA 1XODA 4HB3B 1MIXA 1EVHA 3D8FA 1LB1A 5C5BB 4F7UP 1WJ1A 4K2PA 1U29A 2VKIA 3TCAA 2I5CA 2Y7BA 3P6AA 3RCPA 1OMWA 3QIJA 5DHAB 1XD4A 1V5UA 4GXBA 2D10A 2CODA 2DN6A 1AWEA 5JLJB 2OTXA 1UPQA 2P0HA 2YS1A 3ULBA 3WYFB 4KHAA 4K17A 5JP4A 1NI2A 1Y5OA 4HB4B 4CHJA 1GC6A 1TJ6A 1DBHA 2COAA 1B55A 3GYPA 1AQCA 1W1GA 3HK0A 1Z87A 4KHBB 5DIFB 3KRXA 1I7AA 2DA0A 4HB0B 2K2JA 3DXDA 2MDXA 1V88A 5L81A 3X23A 1W1DA 4WVFB 2H7DA 5LOPB 2IFSA 4MK0A 3ODOA 2ELBA 1U27A 4KVGB 4TKNA 4HDQA 1BAKA 4A5KA 2LOZA 2XQNM 3HW2B 1TXDA 2H7EA 3V5WA 4Y94A 1MAIA 1X1FA 5KCVA 3SV1A 3TO1A 3ML4A 4GMVA 2EMSA 3KSYA 5DHFB 3FEHA 4HAYB 2Z0PA 2MKRA 3D8DA 1P3RA 4GZUA 1X86A 2GCJA 4GN1A 1KZGA 3ULCA 4HAVB 1OY2A 4YL8A 1FGZA 4EKUA 1MKEA 4HAUB 4HATB 2QKLA 3NSUA 1OQNA 5EFXA 2YF0A 5FI0A 2J0JA 2NMBA 4WSFA 4KHOA 1ZC3B 2DKPA 2D9WA 4GPTB 5HE2A 3KRWA 1H4RA 2EMTA 3ODWA 1DDWA 2AEHA 2UZSA 5D27A 3M1IB 3ZDTA 3VOQA 4IOYX 1EGXA 4C0AA 2M14A 1QC6A 1U5FA 2D11A 3U8ZA 2UZRA 1W1HA 1V61A 1SHCA 1ISNA 5D3VA 2RUKB 1UNRA 2W2XD 1E5WA 2GCLA 4TYZA 3CXBB 3DXEA 1WGQA 1U5GA 1K5GB 1TQZA 4DXAB 4A6KA 1DDMA 2D9VA 1MK7B 2CRFA 5J3YA 4L6EA 3TW1A 3WA0A 3AU4A 5HE3A 2YS5A 4HAZB 4Z2MB 1I2HA 3PVUA 4F7GA 4A6HA 1U2BA 1U5DA 1UPRA 2KCJA 3IVFA 1V5PA 2G35A 3QWMA 2MFQA 2I1KA 2D9XA 3AU5A 3QBVB 4EMOA 4HHVA 1V5MA 2R0DA 2HE7A 2JP2A 1P5TA 1DYNA 2D9YA 3PP2A 3MPXA 1FHWA 4D0NB 3VIAA 4IAPA 1XX0A 2K2UA 2GJYA 4HDOA 1ZSQA 1EAZA 5JHHA 1FHOA 2YT0A 2CAYA 5J3QA 2K00A 2N23A 1EF1A 2I5FA 3BINA 1NTVA 5D3XA 3ZVRA 1X11A 3OANA 1Q67A 1BTKA 5J3TA 2D4QA 1WJMA 2X18A 2QKMA 5C16A 2EC1A 5DI9B 5DH9B 4PQ0A 1NTYA 2VSZA 3MDBC 4MY6A 5LONB 3P7ZA 2YSZA 2HTHB 3A98B 3FSSA 4XWXA 2ROVA 1N3HA 2AL6A 5C79A 1UNPA 2RSGA 2DFKA 4Z2NA 2Z0OA 2W2XC 2R09A 1GC7A 4CHMA 2ELAA 2M38A 1QQGA 2ROZB 3PZDA 4YONA 2DLWA 2EJ8A 1UEFA 4WJ7A 4GMXB 1WI1A 1MPHA 4NY0A 3HQCA 3PVLA 2I1JA 5JHGA 3G9WA 4CYEA 1X1GA 1BTNA 2V76A 4PNKA 3T06A 1DDVA 1J0WA 3KZ1A 4NSWA 1WVHA 2Y8FA 1RRPB 1FB8A 1FGYA 2L2IA 2LG1A 4IFSA 1X05A 5D3WA 4A6FA 4HB2B 2DHKA 3SUZA 1FAOA 1WG7A 2YT1A 2DTCA 4HAWB 1M7EA 3F0WA 4ZRJA 1ZC4B 2YVCA 2KUPA 2GS0A 5C5BA 1UNQA 2W2WA 3TVVA 2MWNB 2P0DA 2RLOA 2DX5A 4B6HA 1XR0B 2DYQA 1KI1B 3PVWA 5GOWB 2CY4A 3N7CA 1H10A 3PG7A 3F5RA 5FI1A 4F7HA 1ZVRA 3SYXA 2LOXA 3BJIA 1NU2A 2BCJA 2CY5A 4K81A 3CIKA 4DX8A 4EJNA 2RGNB 5CLLB 1MIZB 2DKQA 2PZ1A 2UVMA 2NZ8B 2DYNA 1XKEA 2IYBA
chains in the Genus database with same CATH superfamily
4BBKA 1FOEA 1KZ7A 2LYDA 1V89A 3SO6A 3U7DA 2VRWB 2Q13A 2L1CA 4DX90 1MK9B 3PEGA 2RVBB 1T77A 2OQBA 3AJ4A 4MT7A 1LW3A 5KQ4A 3UZTA 1J19A 2LKOA 2FJLA 2COCA 2K8EA 1XCGA 2LULA 2P8VA 2YS3A 4ZRIA 3ODXA 1U5EA 4H8SA 1RJ2A 2YRYA 2FJUB 4DBBA 2D9ZA 4ZRKA 3TFMA 2DHIA 2J0KA 1DROA 5HE1A 4KAXB 5KQ1A 1ZM0A 4K2OA 2KGXB 1P6SA 1SGHA 4HAXB 2ADZA 3PSCA 1K5DB 3SNHA 1PFJA 3LJUX 1FHXA 1Y19B 3A8QA 3DXCA 2DHJA 1IRSA 2N0YA 5C6RA 2DX1A 3O96A 5D3YA 2J59M 2Z0QA 3D8EA 2J0MA 1WGUA 1BWNA 3GYOA 2P0FA 3NWFA 2KIGA 2D2QA 3KY9A 1M7RA 1GG3A 4A6FB 2COFA 2RNRB 1PMSA 5CLQB 2Y8GA 3A58A 4P7IA 5HE0A 1PLSA 3FM8C 2E2XA 2ZPYA 3A8PA 1XODA 4HB3B 1MIXA 1EVHA 3D8FA 1LB1A 5C5BB 4F7UP 1WJ1A 4K2PA 1U29A 2VKIA 3TCAA 2I5CA 2Y7BA 3P6AA 3RCPA 1OMWA 3QIJA 5DHAB 1XD4A 1V5UA 4GXBA 2D10A 2CODA 2DN6A 1AWEA 5JLJB 2OTXA 1UPQA 2P0HA 2YS1A 3ULBA 3WYFB 4KHAA 2Z13A 4K17A 5JP4A 1NI2A 1Y5OA 4HB4B 4CHJA 1GC6A 1TJ6A 1DBHA 2COAA 1B55A 3GYPA 1AQCA 1W1GA 3OHMB 3HK0A 1Z87A 4KHBB 5DIFB 3KRXA 1I7AA 2DA0A 4HB0B 2K2JA 3DXDA 2MDXA 1V88A 5L81A 5IRSA 3X23A 1W1DA 3DCXA 4WVFB 1ZYIA 2H7DA 5LOPB 2IFSA 4MK0A 3ODOA 2ELBA 1U27A 4KVGB 4TKNA 4HDQA 1BAKA 4D6WA 4A5KA 2LOZA 2XQNM 3HW2B 1TXDA 2H7EA 3NW8A 3V5WA 4Y94A 1MAIA 1MI1A 1X1FA 5KCVA 3U12A 3SV1A 3TO1A 3ML4A 4GMVA 2EMSA 3KSYA 5DHFB 3FEHA 4HAYB 2Z0PA 2MKRA 3D8DA 1P3RA 4GZUA 1X86A 2GCJA 4GN1A 1KZGA 3ULCA 4HAVB 1OY2A 4YL8A 1FGZA 4EKUA 1MKEA 4HAUB 4HATB 2QKLA 3NSUA 1OQNA 5EFXA 5M4YB 2YF0A 5FI0A 2J0JA 2NMBA 3NWDA 4WSFA 4KHOA 1ZC3B 2DKPA 2D9WA 4GPTB 5HE2A 3KRWA 1H4RA 4OSNA 2KIEA 2Z14A 2EMTA 3ODWA 1DDWA 2AEHA 2UZSA 5D27A 3M1IB 3ZDTA 3VOQA 4IOYX 2KUQA 1EGXA 3B77A 4C0AA 2M14A 1QC6A 1U5FA 2D11A 3U8ZA 2UZRA 1W1HA 1V61A 1SHCA 1ISNA 4GNKB 2NBVA 5D3VA 2RUKB 1UNRA 4L1RA 2W2XD 1E5WA 2GCLA 4TYZA 3CXBB 3DXEA 1WGQA 1U5GA 1K5GB 1TQZA 4DXAB 4A6KA 4QJ4B 1DDMA 2RRFA 2D9VA 1MK7B 2CRFA 5J3YA 4L6EA 3TW1A 3WA0A 3AU4A 5HE3A 2YS5A 4HAZB 4Z2MB 1I2HA 3PVUA 4F7GA 4A6HA 1U2BA 4GOUA 1U5DA 1UPRA 2KCJA 3IVFA 1V5PA 2G35A 3QWMA 2MFQA 2I1KA 2D9XA 3AU5A 3QBVB 4EMOA 4HHVA 1V5MA 2R0DA 2HE7A 2JP2A 1P5TA 1DYNA 2D9YA 3PP2A 3MPXA 1FHWA 4D0NB 3VIAA 4IAPA 1XX0A 2K2UA 2GJYA 4HDOA 1ZSQA 1EAZA 5JHHA 1FHOA 2YT0A 2CAYA 2Z4DA 5LG4B 5J3QA 2K00A 2N23A 1EF1A 2I5FA 3BINA 1NTVA 5D3XA 3HIEA 3ZVRA 1X11A 3OANA 1Q67A 1BTKA 5J3TA 2D4QA 1WJMA 2X18A 4KHBA 2QKMA 5C16A 2EC1A 2KR0A 5DI9B 5DH9B 4PQ0A 4QXAB 1NTYA 2VSZA 3MDBC 4MY6A 5LONB 3P7ZA 2YSZA 2HTHB 3A98B 3FSSA 4XWXA 2ROVA 1N3HA 2AL6A 5C79A 1UNPA 2RSGA 2DFKA 4Z2NA 2Z0OA 2W2XC 2R09A 3FVCA 1GC7A 4CHMA 5I2SA 2ELAA 3NWAA 2M38A 1QQGA 2ROZB 3PZDA 3HSAA 4YONA 2DLWA 2EJ8A 1UEFA 4WJ7A 4GMXB 1WI1A 2YT2A 1MPHA 4NY0A 3HQCA 3PVLA 2I1JA 5JHGA 4QJ3B 3G9WA 4CYEA 1X1GA 1BTNA 2V76A 4PNKA 3T06A 1DDVA 1J0WA 3KZ1A 4NSWA 1WVHA 2Y8FA 1RRPB 1FB8A 1FGYA 2L2IA 2LG1A 4IFSA 1X05A 5D3WA 4A6FA 4HB2B 2DHKA 3SUZA 2ZKMX 1FAOA 1WG7A 2YT1A 2DTCA 4HAWB 1M7EA 3F0WA 4ZRJA 1ZC4B 2YVCA 2K49A 2KUPA 2GS0A 5C5BA 1UNQA 2W2WA 3TVVA 2MWNB 2P0DA 2RLOA 2DX5A 4B6HA 1XR0B 2DYQA 1KI1B 3PVWA 5GOWB 4QJ5B 2CY4A 3N7CA 4HSIA 4OT1A 1H10A 3PG7A 3F5RA 5FI1A 2GUMA 4F7HA 1ZVRA 3SYXA 2LOXA 3BJIA 4DIXA 2R2YA 1NU2A 2BCJA 2CY5A 4K81A 3CIKA 4DX8A 4EJNA 5I2MA 2RGNB 5CLLB 1MIZB 2Z59A 2DKQA 2PZ1A 2UVMA 2NZ8B 2DYNA 1XKEA 2IYBA 4CSQA
chains in the Genus database with same CATH topology
4BBKA 1FOEA 1KZ7A 2LYDA 1V89A 3SO6A 3U7DA 2VRWB 2Q13A 2L1CA 4DX90 1MK9B 3PEGA 2RVBB 2OQBA 3AJ4A 4MT7A 1LW3A 5KQ4A 3UZTA 1J19A 2LKOA 2FJLA 2COCA 2LULA 1XCGA 2P8VA 2YS3A 4ZRIA 3ODXA 1U5EA 4H8SA 1RJ2A 2YRYA 4DBBA 2D9ZA 4ZRKA 3TFMA 2DHIA 2J0KA 1DROA 5HE1A 4KAXB 5KQ1A 1ZM0A 4K2OA 2KGXB 1P6SA 1SGHA 4HAXB 2ADZA 3PSCA 1K5DB 3SNHA 1PFJA 3LJUX 1FHXA 1Y19B 3A8QA 3DXCA 2DHJA 1IRSA 2N0YA 5C6RA 2DX1A 3O96A 5D3YA 2J59M 2Z0QA 3D8EA 2J0MA 1WGUA 1BWNA 2P0FA 3GYOA 2D2QA 3KY9A 1M7RA 1GG3A 4A6FB 2COFA 2RNRB 1PMSA 5CLQB 2Y8GA 4P7IA 5HE0A 1PLSA 3FM8C 2E2XA 2ZPYA 3A8PA 1XODA 4HB3B 1MIXA 1EVHA 3D8FA 1LB1A 5C5BB 4F7UP 1WJ1A 4K2PA 1U29A 2VKIA 3TCAA 2I5CA 2Y7BA 3P6AA 3RCPA 1OMWA 3QIJA 5DHAB 1XD4A 1V5UA 4GXBA 2D10A 2CODA 2DN6A 1AWEA 5JLJB 2OTXA 1UPQA 2P0HA 2YS1A 3ULBA 3WYFB 4KHAA 4K17A 5JP4A 1NI2A 1Y5OA 4HB4B 4CHJA 1GC6A 1TJ6A 1DBHA 2COAA 1B55A 3GYPA 1AQCA 1W1GA 3HK0A 1Z87A 4KHBB 5DIFB 3KRXA 1I7AA 2DA0A 4HB0B 2K2JA 3DXDA 2MDXA 1V88A 5L81A 3X23A 1W1DA 4WVFB 2H7DA 5LOPB 2IFSA 4MK0A 3ODOA 2ELBA 1U27A 4KVGB 4TKNA 4HDQA 1BAKA 4A5KA 2LOZA 2XQNM 3HW2B 1TXDA 2H7EA 3V5WA 4Y94A 1MAIA 1X1FA 5KCVA 3SV1A 3TO1A 3ML4A 4GMVA 2EMSA 3KSYA 5DHFB 3FEHA 4HAYB 2Z0PA 2MKRA 3D8DA 1P3RA 4GZUA 1X86A 2GCJA 4GN1A 1KZGA 3ULCA 4HAVB 1OY2A 4YL8A 1FGZA 4EKUA 1MKEA 4HAUB 4HATB 2QKLA 3NSUA 1OQNA 5EFXA 2YF0A 5FI0A 2J0JA 2NMBA 4WSFA 4KHOA 1ZC3B 2DKPA 2D9WA 4GPTB 5HE2A 3KRWA 1H4RA 2EMTA 3ODWA 1DDWA 2AEHA 2UZSA 5D27A 3M1IB 3ZDTA 3VOQA 4IOYX 1EGXA 4C0AA 2M14A 1QC6A 1U5FA 2D11A 3U8ZA 2UZRA 1W1HA 1V61A 1SHCA 1ISNA 5D3VA 2RUKB 1UNRA 2W2XD 1E5WA 2GCLA 4TYZA 3CXBB 3DXEA 1WGQA 1U5GA 1K5GB 1TQZA 4DXAB 4A6KA 1DDMA 2D9VA 1MK7B 2CRFA 5J3YA 4L6EA 3TW1A 3WA0A 3AU4A 5HE3A 2YS5A 4HAZB 4Z2MB 1I2HA 3PVUA 4F7GA 4A6HA 1U2BA 1U5DA 1UPRA 2KCJA 3IVFA 1V5PA 2G35A 3QWMA 2MFQA 2I1KA 2D9XA 3AU5A 3QBVB 4EMOA 4HHVA 1V5MA 2R0DA 2HE7A 2JP2A 1P5TA 1DYNA 2D9YA 3PP2A 3MPXA 1FHWA 4D0NB 3VIAA 4IAPA 1XX0A 2K2UA 2GJYA 4HDOA 1ZSQA 1EAZA 5JHHA 1FHOA 2YT0A 2CAYA 5J3QA 2K00A 2N23A 1EF1A 2I5FA 3BINA 1NTVA 5D3XA 3ZVRA 1X11A 3OANA 1Q67A 1BTKA 5J3TA 2D4QA 1WJMA 2X18A 2QKMA 5C16A 2EC1A 5DI9B 5DH9B 4PQ0A 1NTYA 2VSZA 3MDBC 4MY6A 5LONB 3P7ZA 2YSZA 2HTHB 3A98B 3FSSA 4XWXA 2ROVA 1N3HA 2AL6A 5C79A 1UNPA 2RSGA 2DFKA 4Z2NA 2Z0OA 2W2XC 2R09A 1GC7A 4CHMA 2ELAA 2M38A 1QQGA 2ROZB 3PZDA 4YONA 2DLWA 2EJ8A 1UEFA 4WJ7A 4GMXB 1WI1A 1MPHA 4NY0A 3HQCA 3PVLA 2I1JA 5JHGA 3G9WA 4CYEA 1X1GA 1BTNA 2V76A 4PNKA 3T06A 1DDVA 1J0WA 3KZ1A 4NSWA 1WVHA 2Y8FA 1RRPB 1FB8A 1FGYA 2L2IA 2LG1A 4IFSA 1X05A 5D3WA 4A6FA 4HB2B 2DHKA 3SUZA 1FAOA 1WG7A 2YT1A 2DTCA 4HAWB 1M7EA 3F0WA 4ZRJA 1ZC4B 2YVCA 2KUPA 2GS0A 5C5BA 1UNQA 2W2WA 3TVVA 2MWNB 2P0DA 2RLOA 2DX5A 4B6HA 1XR0B 2DYQA 1KI1B 3PVWA 5GOWB 2CY4A 3N7CA 1H10A 3PG7A 3F5RA 5FI1A 4F7HA 1ZVRA 3SYXA 2LOXA 3BJIA 1NU2A 2BCJA 2CY5A 4K81A 3CIKA 4DX8A 4EJNA 2RGNB 5CLLB 1MIZB 2DKQA 2PZ1A 2UVMA 2NZ8B 2DYNA 1XKEA 2IYBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BBK A;  1FOE A;  1KZ7 A;  2LYD A;  1V89 A;  3SO6 A;  3U7D A;  2VRW B;  2Q13 A;  2L1C A;  4DX9 0;  1MK9 B;  3PEG A;  2RVB B;  2OQB A;  3AJ4 A;  4MT7 A;  1LW3 A;  5KQ4 A;  3UZT A;  1J19 A;  2LKO A;  2FJL A;  2COC A;  2LUL A;  1XCG A;  2P8V A;  2YS3 A;  4ZRI A;  3ODX A;  1U5E A;  4H8S A;  1RJ2 A;  2YRY A;  4DBB A;  2D9Z A;  4ZRK A;  3TFM A;  2DHI A;  2J0K A;  1DRO A;  5HE1 A;  4KAX B;  5KQ1 A;  1ZM0 A;  4K2O A;  2KGX B;  1P6S A;  1SGH A;  4HAX B;  2ADZ A;  3PSC A;  1K5D B;  3SNH A;  1PFJ A;  3LJU X;  1FHX A;  1Y19 B;  3A8Q A;  3DXC A;  2DHJ A;  1IRS A;  2N0Y A;  5C6R A;  2DX1 A;  3O96 A;  5D3Y A;  2J59 M;  2Z0Q A;  3D8E A;  2J0M A;  1WGU A;  1BWN A;  2P0F A;  3GYO A;  2D2Q A;  3KY9 A;  1M7R A;  1GG3 A;  4A6F B;  2COF A;  2RNR B;  1PMS A;  5CLQ B;  2Y8G A;  4P7I A;  5HE0 A;  1PLS A;  3FM8 C;  2E2X A;  2ZPY A;  3A8P A;  1XOD A;  4HB3 B;  1MIX A;  1EVH A;  3D8F A;  1LB1 A;  5C5B B;  4F7U P;  1WJ1 A;  4K2P A;  1U29 A;  2VKI A;  3TCA A;  2I5C A;  2Y7B A;  3P6A A;  3RCP A;  1OMW A;  3QIJ A;  5DHA B;  1XD4 A;  1V5U A;  4GXB A;  2D10 A;  2COD A;  2DN6 A;  1AWE A;  5JLJ B;  2OTX A;  1UPQ A;  2P0H A;  2YS1 A;  3ULB A;  3WYF B;  4KHA A;  4K17 A;  5JP4 A;  1NI2 A;  1Y5O A;  4HB4 B;  4CHJ A;  1GC6 A;  1TJ6 A;  1DBH A;  2COA A;  1B55 A;  3GYP A;  1AQC A;  1W1G A;  3HK0 A;  1Z87 A;  4KHB B;  5DIF B;  3KRX A;  1I7A A;  2DA0 A;  4HB0 B;  2K2J A;  3DXD A;  2MDX A;  1V88 A;  5L81 A;  3X23 A;  1W1D A;  4WVF B;  2H7D A;  5LOP B;  2IFS A;  4MK0 A;  3ODO A;  2ELB A;  1U27 A;  4KVG B;  4TKN A;  4HDQ A;  1BAK A;  4A5K A;  2LOZ A;  2XQN M;  3HW2 B;  1TXD A;  2H7E A;  3V5W A;  4Y94 A;  1MAI A;  1X1F A;  5KCV A;  3SV1 A;  3TO1 A;  3ML4 A;  4GMV A;  2EMS A;  3KSY A;  5DHF B;  3FEH A;  4HAY B;  2Z0P A;  2MKR A;  3D8D A;  1P3R A;  4GZU A;  1X86 A;  2GCJ A;  4GN1 A;  1KZG A;  3ULC A;  4HAV B;  1OY2 A;  4YL8 A;  1FGZ A;  4EKU A;  1MKE A;  4HAU B;  4HAT B;  2QKL A;  3NSU A;  1OQN A;  5EFX A;  2YF0 A;  5FI0 A;  2J0J A;  2NMB A;  4WSF A;  4KHO A;  1ZC3 B;  2DKP A;  2D9W A;  4GPT B;  5HE2 A;  3KRW A;  1H4R A;  2EMT A;  3ODW A;  1DDW A;  2AEH A;  2UZS A;  5D27 A;  3M1I B;  3ZDT A;  3VOQ A;  4IOY X;  1EGX A;  4C0A A;  2M14 A;  1QC6 A;  1U5F A;  2D11 A;  3U8Z A;  2UZR A;  1W1H A;  1V61 A;  1SHC A;  1ISN A;  5D3V A;  2RUK B;  1UNR A;  2W2X D;  1E5W A;  2GCL A;  4TYZ A;  3CXB B;  3DXE A;  1WGQ A;  1U5G A;  1K5G B;  1TQZ A;  4DXA B;  4A6K A;  1DDM A;  2D9V A;  1MK7 B;  2CRF A;  5J3Y A;  4L6E A;  3TW1 A;  3WA0 A;  3AU4 A;  5HE3 A;  2YS5 A;  4HAZ B;  4Z2M B;  1I2H A;  3PVU A;  4F7G A;  4A6H A;  1U2B A;  1U5D A;  1UPR A;  2KCJ A;  3IVF A;  1V5P A;  2G35 A;  3QWM A;  2MFQ A;  2I1K A;  2D9X A;  3AU5 A;  3QBV B;  4EMO A;  4HHV A;  1V5M A;  2R0D A;  2HE7 A;  2JP2 A;  1P5T A;  1DYN A;  2D9Y A;  3PP2 A;  3MPX A;  1FHW A;  4D0N B;  3VIA A;  4IAP A;  1XX0 A;  2K2U A;  2GJY A;  4HDO A;  1ZSQ A;  1EAZ A;  5JHH A;  1FHO A;  2YT0 A;  2CAY A;  5J3Q A;  2K00 A;  2N23 A;  1EF1 A;  2I5F A;  3BIN A;  1NTV A;  5D3X A;  3ZVR A;  1X11 A;  3OAN A;  1Q67 A;  1BTK A;  5J3T A;  2D4Q A;  1WJM A;  2X18 A;  2QKM A;  5C16 A;  2EC1 A;  5DI9 B;  5DH9 B;  4PQ0 A;  1NTY A;  2VSZ A;  3MDB C;  4MY6 A;  5LON B;  3P7Z A;  2YSZ A;  2HTH B;  3A98 B;  3FSS A;  4XWX A;  2ROV A;  1N3H A;  2AL6 A;  5C79 A;  1UNP A;  2RSG A;  2DFK A;  4Z2N A;  2Z0O A;  2W2X C;  2R09 A;  1GC7 A;  4CHM A;  2ELA A;  2M38 A;  1QQG A;  2ROZ B;  3PZD A;  4YON A;  2DLW A;  2EJ8 A;  1UEF A;  4WJ7 A;  4GMX B;  1WI1 A;  1MPH A;  4NY0 A;  3HQC A;  3PVL A;  2I1J A;  5JHG A;  3G9W A;  4CYE A;  1X1G A;  1BTN A;  2V76 A;  4PNK A;  3T06 A;  1DDV A;  1J0W A;  3KZ1 A;  4NSW A;  1WVH A;  2Y8F A;  1RRP B;  1FB8 A;  1FGY A;  2L2I A;  2LG1 A;  4IFS A;  1X05 A;  5D3W A;  4A6F A;  4HB2 B;  2DHK A;  3SUZ A;  1FAO A;  1WG7 A;  2YT1 A;  2DTC A;  4HAW B;  1M7E A;  3F0W A;  4ZRJ A;  1ZC4 B;  2YVC A;  2KUP A;  2GS0 A;  5C5B A;  1UNQ A;  2W2W A;  3TVV A;  2MWN B;  2P0D A;  2RLO A;  2DX5 A;  4B6H A;  1XR0 B;  2DYQ A;  1KI1 B;  3PVW A;  5GOW B;  2CY4 A;  3N7C A;  1H10 A;  3PG7 A;  3F5R A;  5FI1 A;  4F7H A;  1ZVR A;  3SYX A;  2LOX A;  3BJI A;  1NU2 A;  2BCJ A;  2CY5 A;  4K81 A;  3CIK A;  4DX8 A;  4EJN A;  2RGN B;  5CLL B;  1MIZ B;  2DKQ A;  2PZ1 A;  2UVM A;  2NZ8 B;  2DYN A;  1XKE A;  2IYB A; 
#chains in the Genus database with same CATH topology
 4BBK A;  1FOE A;  1KZ7 A;  2LYD A;  1V89 A;  3SO6 A;  3U7D A;  2VRW B;  2Q13 A;  2L1C A;  4DX9 0;  1MK9 B;  3PEG A;  2RVB B;  1T77 A;  2OQB A;  3AJ4 A;  4MT7 A;  1LW3 A;  5KQ4 A;  3UZT A;  1J19 A;  2LKO A;  2FJL A;  2COC A;  2K8E A;  1XCG A;  2LUL A;  2P8V A;  2YS3 A;  4ZRI A;  3ODX A;  1U5E A;  4H8S A;  1RJ2 A;  2YRY A;  2FJU B;  4DBB A;  2D9Z A;  4ZRK A;  3TFM A;  2DHI A;  2J0K A;  1DRO A;  5HE1 A;  4KAX B;  5KQ1 A;  1ZM0 A;  4K2O A;  2KGX B;  1P6S A;  1SGH A;  4HAX B;  2ADZ A;  3PSC A;  1K5D B;  3SNH A;  1PFJ A;  3LJU X;  1FHX A;  1Y19 B;  3A8Q A;  3DXC A;  2DHJ A;  1IRS A;  2N0Y A;  5C6R A;  2DX1 A;  3O96 A;  5D3Y A;  2J59 M;  2Z0Q A;  3D8E A;  2J0M A;  1WGU A;  1BWN A;  3GYO A;  2P0F A;  3NWF A;  2KIG A;  2D2Q A;  3KY9 A;  1M7R A;  1GG3 A;  4A6F B;  2COF A;  2RNR B;  1PMS A;  5CLQ B;  2Y8G A;  3A58 A;  4P7I A;  5HE0 A;  1PLS A;  3FM8 C;  2E2X A;  2ZPY A;  3A8P A;  1XOD A;  4HB3 B;  1MIX A;  1EVH A;  3D8F A;  1LB1 A;  5C5B B;  4F7U P;  1WJ1 A;  4K2P A;  1U29 A;  2VKI A;  3TCA A;  2I5C A;  2Y7B A;  3P6A A;  3RCP A;  1OMW A;  3QIJ A;  5DHA B;  1XD4 A;  1V5U A;  4GXB A;  2D10 A;  2COD A;  2DN6 A;  1AWE A;  5JLJ B;  2OTX A;  1UPQ A;  2P0H A;  2YS1 A;  3ULB A;  3WYF B;  4KHA A;  2Z13 A;  4K17 A;  5JP4 A;  1NI2 A;  1Y5O A;  4HB4 B;  4CHJ A;  1GC6 A;  1TJ6 A;  1DBH A;  2COA A;  1B55 A;  3GYP A;  1AQC A;  1W1G A;  3OHM B;  3HK0 A;  1Z87 A;  4KHB B;  5DIF B;  3KRX A;  1I7A A;  2DA0 A;  4HB0 B;  2K2J A;  3DXD A;  2MDX A;  1V88 A;  5L81 A;  5IRS A;  3X23 A;  1W1D A;  3DCX A;  4WVF B;  1ZYI A;  2H7D A;  5LOP B;  2IFS A;  4MK0 A;  3ODO A;  2ELB A;  1U27 A;  4KVG B;  4TKN A;  4HDQ A;  1BAK A;  4D6W A;  4A5K A;  2LOZ A;  2XQN M;  3HW2 B;  1TXD A;  2H7E A;  3NW8 A;  3V5W A;  4Y94 A;  1MAI A;  1MI1 A;  1X1F A;  5KCV A;  3U12 A;  3SV1 A;  3TO1 A;  3ML4 A;  4GMV A;  2EMS A;  3KSY A;  5DHF B;  3FEH A;  4HAY B;  2Z0P A;  2MKR A;  3D8D A;  1P3R A;  4GZU A;  1X86 A;  2GCJ A;  4GN1 A;  1KZG A;  3ULC A;  4HAV B;  1OY2 A;  4YL8 A;  1FGZ A;  4EKU A;  1MKE A;  4HAU B;  4HAT B;  2QKL A;  3NSU A;  1OQN A;  5EFX A;  5M4Y B;  2YF0 A;  5FI0 A;  2J0J A;  2NMB A;  3NWD A;  4WSF A;  4KHO A;  1ZC3 B;  2DKP A;  2D9W A;  4GPT B;  5HE2 A;  3KRW A;  1H4R A;  4OSN A;  2KIE A;  2Z14 A;  2EMT A;  3ODW A;  1DDW A;  2AEH A;  2UZS A;  5D27 A;  3M1I B;  3ZDT A;  3VOQ A;  4IOY X;  2KUQ A;  1EGX A;  3B77 A;  4C0A A;  2M14 A;  1QC6 A;  1U5F A;  2D11 A;  3U8Z A;  2UZR A;  1W1H A;  1V61 A;  1SHC A;  1ISN A;  4GNK B;  2NBV A;  5D3V A;  2RUK B;  1UNR A;  4L1R A;  2W2X D;  1E5W A;  2GCL A;  4TYZ A;  3CXB B;  3DXE A;  1WGQ A;  1U5G A;  1K5G B;  1TQZ A;  4DXA B;  4A6K A;  4QJ4 B;  1DDM A;  2RRF A;  2D9V A;  1MK7 B;  2CRF A;  5J3Y A;  4L6E A;  3TW1 A;  3WA0 A;  3AU4 A;  5HE3 A;  2YS5 A;  4HAZ B;  4Z2M B;  1I2H A;  3PVU A;  4F7G A;  4A6H A;  1U2B A;  4GOU A;  1U5D A;  1UPR A;  2KCJ A;  3IVF A;  1V5P A;  2G35 A;  3QWM A;  2MFQ A;  2I1K A;  2D9X A;  3AU5 A;  3QBV B;  4EMO A;  4HHV A;  1V5M A;  2R0D A;  2HE7 A;  2JP2 A;  1P5T A;  1DYN A;  2D9Y A;  3PP2 A;  3MPX A;  1FHW A;  4D0N B;  3VIA A;  4IAP A;  1XX0 A;  2K2U A;  2GJY A;  4HDO A;  1ZSQ A;  1EAZ A;  5JHH A;  1FHO A;  2YT0 A;  2CAY A;  2Z4D A;  5LG4 B;  5J3Q A;  2K00 A;  2N23 A;  1EF1 A;  2I5F A;  3BIN A;  1NTV A;  5D3X A;  3HIE A;  3ZVR A;  1X11 A;  3OAN A;  1Q67 A;  1BTK A;  5J3T A;  2D4Q A;  1WJM A;  2X18 A;  4KHB A;  2QKM A;  5C16 A;  2EC1 A;  2KR0 A;  5DI9 B;  5DH9 B;  4PQ0 A;  4QXA B;  1NTY A;  2VSZ A;  3MDB C;  4MY6 A;  5LON B;  3P7Z A;  2YSZ A;  2HTH B;  3A98 B;  3FSS A;  4XWX A;  2ROV A;  1N3H A;  2AL6 A;  5C79 A;  1UNP A;  2RSG A;  2DFK A;  4Z2N A;  2Z0O A;  2W2X C;  2R09 A;  3FVC A;  1GC7 A;  4CHM A;  5I2S A;  2ELA A;  3NWA A;  2M38 A;  1QQG A;  2ROZ B;  3PZD A;  3HSA A;  4YON A;  2DLW A;  2EJ8 A;  1UEF A;  4WJ7 A;  4GMX B;  1WI1 A;  2YT2 A;  1MPH A;  4NY0 A;  3HQC A;  3PVL A;  2I1J A;  5JHG A;  4QJ3 B;  3G9W A;  4CYE A;  1X1G A;  1BTN A;  2V76 A;  4PNK A;  3T06 A;  1DDV A;  1J0W A;  3KZ1 A;  4NSW A;  1WVH A;  2Y8F A;  1RRP B;  1FB8 A;  1FGY A;  2L2I A;  2LG1 A;  4IFS A;  1X05 A;  5D3W A;  4A6F A;  4HB2 B;  2DHK A;  3SUZ A;  2ZKM X;  1FAO A;  1WG7 A;  2YT1 A;  2DTC A;  4HAW B;  1M7E A;  3F0W A;  4ZRJ A;  1ZC4 B;  2YVC A;  2K49 A;  2KUP A;  2GS0 A;  5C5B A;  1UNQ A;  2W2W A;  3TVV A;  2MWN B;  2P0D A;  2RLO A;  2DX5 A;  4B6H A;  1XR0 B;  2DYQ A;  1KI1 B;  3PVW A;  5GOW B;  4QJ5 B;  2CY4 A;  3N7C A;  4HSI A;  4OT1 A;  1H10 A;  3PG7 A;  3F5R A;  5FI1 A;  2GUM A;  4F7H A;  1ZVR A;  3SYX A;  2LOX A;  3BJI A;  4DIX A;  2R2Y A;  1NU2 A;  2BCJ A;  2CY5 A;  4K81 A;  3CIK A;  4DX8 A;  4EJN A;  5I2M A;  2RGN B;  5CLL B;  1MIZ B;  2Z59 A;  2DKQ A;  2PZ1 A;  2UVM A;  2NZ8 B;  2DYN A;  1XKE A;  2IYB A;  4CSQ A; 
#chains in the Genus database with same CATH homology
 4BBK A;  1FOE A;  1KZ7 A;  2LYD A;  1V89 A;  3SO6 A;  3U7D A;  2VRW B;  2Q13 A;  2L1C A;  4DX9 0;  1MK9 B;  3PEG A;  2RVB B;  2OQB A;  3AJ4 A;  4MT7 A;  1LW3 A;  5KQ4 A;  3UZT A;  1J19 A;  2LKO A;  2FJL A;  2COC A;  2LUL A;  1XCG A;  2P8V A;  2YS3 A;  4ZRI A;  3ODX A;  1U5E A;  4H8S A;  1RJ2 A;  2YRY A;  4DBB A;  2D9Z A;  4ZRK A;  3TFM A;  2DHI A;  2J0K A;  1DRO A;  5HE1 A;  4KAX B;  5KQ1 A;  1ZM0 A;  4K2O A;  2KGX B;  1P6S A;  1SGH A;  4HAX B;  2ADZ A;  3PSC A;  1K5D B;  3SNH A;  1PFJ A;  3LJU X;  1FHX A;  1Y19 B;  3A8Q A;  3DXC A;  2DHJ A;  1IRS A;  2N0Y A;  5C6R A;  2DX1 A;  3O96 A;  5D3Y A;  2J59 M;  2Z0Q A;  3D8E A;  2J0M A;  1WGU A;  1BWN A;  2P0F A;  3GYO A;  2D2Q A;  3KY9 A;  1M7R A;  1GG3 A;  4A6F B;  2COF A;  2RNR B;  1PMS A;  5CLQ B;  2Y8G A;  4P7I A;  5HE0 A;  1PLS A;  3FM8 C;  2E2X A;  2ZPY A;  3A8P A;  1XOD A;  4HB3 B;  1MIX A;  1EVH A;  3D8F A;  1LB1 A;  5C5B B;  4F7U P;  1WJ1 A;  4K2P A;  1U29 A;  2VKI A;  3TCA A;  2I5C A;  2Y7B A;  3P6A A;  3RCP A;  1OMW A;  3QIJ A;  5DHA B;  1XD4 A;  1V5U A;  4GXB A;  2D10 A;  2COD A;  2DN6 A;  1AWE A;  5JLJ B;  2OTX A;  1UPQ A;  2P0H A;  2YS1 A;  3ULB A;  3WYF B;  4KHA A;  4K17 A;  5JP4 A;  1NI2 A;  1Y5O A;  4HB4 B;  4CHJ A;  1GC6 A;  1TJ6 A;  1DBH A;  2COA A;  1B55 A;  3GYP A;  1AQC A;  1W1G A;  3HK0 A;  1Z87 A;  4KHB B;  5DIF B;  3KRX A;  1I7A A;  2DA0 A;  4HB0 B;  2K2J A;  3DXD A;  2MDX A;  1V88 A;  5L81 A;  3X23 A;  1W1D A;  4WVF B;  2H7D A;  5LOP B;  2IFS A;  4MK0 A;  3ODO A;  2ELB A;  1U27 A;  4KVG B;  4TKN A;  4HDQ A;  1BAK A;  4A5K A;  2LOZ A;  2XQN M;  3HW2 B;  1TXD A;  2H7E A;  3V5W A;  4Y94 A;  1MAI A;  1X1F A;  5KCV A;  3SV1 A;  3TO1 A;  3ML4 A;  4GMV A;  2EMS A;  3KSY A;  5DHF B;  3FEH A;  4HAY B;  2Z0P A;  2MKR A;  3D8D A;  1P3R A;  4GZU A;  1X86 A;  2GCJ A;  4GN1 A;  1KZG A;  3ULC A;  4HAV B;  1OY2 A;  4YL8 A;  1FGZ A;  4EKU A;  1MKE A;  4HAU B;  4HAT B;  2QKL A;  3NSU A;  1OQN A;  5EFX A;  2YF0 A;  5FI0 A;  2J0J A;  2NMB A;  4WSF A;  4KHO A;  1ZC3 B;  2DKP A;  2D9W A;  4GPT B;  5HE2 A;  3KRW A;  1H4R A;  2EMT A;  3ODW A;  1DDW A;  2AEH A;  2UZS A;  5D27 A;  3M1I B;  3ZDT A;  3VOQ A;  4IOY X;  1EGX A;  4C0A A;  2M14 A;  1QC6 A;  1U5F A;  2D11 A;  3U8Z A;  2UZR A;  1W1H A;  1V61 A;  1SHC A;  1ISN A;  5D3V A;  2RUK B;  1UNR A;  2W2X D;  1E5W A;  2GCL A;  4TYZ A;  3CXB B;  3DXE A;  1WGQ A;  1U5G A;  1K5G B;  1TQZ A;  4DXA B;  4A6K A;  1DDM A;  2D9V A;  1MK7 B;  2CRF A;  5J3Y A;  4L6E A;  3TW1 A;  3WA0 A;  3AU4 A;  5HE3 A;  2YS5 A;  4HAZ B;  4Z2M B;  1I2H A;  3PVU A;  4F7G A;  4A6H A;  1U2B A;  1U5D A;  1UPR A;  2KCJ A;  3IVF A;  1V5P A;  2G35 A;  3QWM A;  2MFQ A;  2I1K A;  2D9X A;  3AU5 A;  3QBV B;  4EMO A;  4HHV A;  1V5M A;  2R0D A;  2HE7 A;  2JP2 A;  1P5T A;  1DYN A;  2D9Y A;  3PP2 A;  3MPX A;  1FHW A;  4D0N B;  3VIA A;  4IAP A;  1XX0 A;  2K2U A;  2GJY A;  4HDO A;  1ZSQ A;  1EAZ A;  5JHH A;  1FHO A;  2YT0 A;  2CAY A;  5J3Q A;  2K00 A;  2N23 A;  1EF1 A;  2I5F A;  3BIN A;  1NTV A;  5D3X A;  3ZVR A;  1X11 A;  3OAN A;  1Q67 A;  1BTK A;  5J3T A;  2D4Q A;  1WJM A;  2X18 A;  2QKM A;  5C16 A;  2EC1 A;  5DI9 B;  5DH9 B;  4PQ0 A;  1NTY A;  2VSZ A;  3MDB C;  4MY6 A;  5LON B;  3P7Z A;  2YSZ A;  2HTH B;  3A98 B;  3FSS A;  4XWX A;  2ROV A;  1N3H A;  2AL6 A;  5C79 A;  1UNP A;  2RSG A;  2DFK A;  4Z2N A;  2Z0O A;  2W2X C;  2R09 A;  1GC7 A;  4CHM A;  2ELA A;  2M38 A;  1QQG A;  2ROZ B;  3PZD A;  4YON A;  2DLW A;  2EJ8 A;  1UEF A;  4WJ7 A;  4GMX B;  1WI1 A;  1MPH A;  4NY0 A;  3HQC A;  3PVL A;  2I1J A;  5JHG A;  3G9W A;  4CYE A;  1X1G A;  1BTN A;  2V76 A;  4PNK A;  3T06 A;  1DDV A;  1J0W A;  3KZ1 A;  4NSW A;  1WVH A;  2Y8F A;  1RRP B;  1FB8 A;  1FGY A;  2L2I A;  2LG1 A;  4IFS A;  1X05 A;  5D3W A;  4A6F A;  4HB2 B;  2DHK A;  3SUZ A;  1FAO A;  1WG7 A;  2YT1 A;  2DTC A;  4HAW B;  1M7E A;  3F0W A;  4ZRJ A;  1ZC4 B;  2YVC A;  2KUP A;  2GS0 A;  5C5B A;  1UNQ A;  2W2W A;  3TVV A;  2MWN B;  2P0D A;  2RLO A;  2DX5 A;  4B6H A;  1XR0 B;  2DYQ A;  1KI1 B;  3PVW A;  5GOW B;  2CY4 A;  3N7C A;  1H10 A;  3PG7 A;  3F5R A;  5FI1 A;  4F7H A;  1ZVR A;  3SYX A;  2LOX A;  3BJI A;  1NU2 A;  2BCJ A;  2CY5 A;  4K81 A;  3CIK A;  4DX8 A;  4EJN A;  2RGN B;  5CLL B;  1MIZ B;  2DKQ A;  2PZ1 A;  2UVM A;  2NZ8 B;  2DYN A;  1XKE A;  2IYB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...