4WSFA

Falafel evh1 domain bound to cenp-c fim
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
111
structure length
111
Chain Sequence
DTRRRVKLYALNAERQWDDRGTGHVSSTYVERLKGISLLVRAESDGSLLLESKIQPDTAYQKQQDTLIVWSEGDNFDLALSFQEKAGCDEIWEKICQVQGKDPSVEITQDI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords Serine/threonine-protein phosphatase 4 regulatory subunit 3
publication title Centromeric binding and activity of Protein Phosphatase 4.
pubmed doi rcsb
source organism Drosophila melanogaster
total genus 30
structure length 111
sequence length 111
ec nomenclature
pdb deposition date 2014-10-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 4wsfA00
2YS3A 3T06A 4DX90 4K2PA 2D9YA 2EMSA 4A6FB 1LW3A 1NTVA 4GPTB 2LG1A 4HAYB 2EC1A 2ROVA 1V5MA 5DH9B 3ODWA 4MY6A 2GCJA 4KHOA 3M1IB 1GG3A 5EFXA 5HE2A 2Q13A 5L81A 3PP2A 2YF0A 3ZDTA 1E5WA 1WI1A 1U5DA 2CODA 1TQZA 2KUPA 2DYQA 3O96A 4HB2B 1WGUA 3PVLA 3PVWA 2IFSA 4B6HA 2ADZA 4HB4B 5DIFB 1DROA 4IFSA 2YS1A 2DKQA 4HB3B 1WJ1A 3LJUX 1ZC4B 2VSZA 4YONA 1V5PA 1LB1A 3ODOA 5C6RA 1KZ7A 4DX8A 1DDVA 4CHMA 3NSUA 3DXCA 2M38A 2NZ8B 1XR0B 2X18A 1UNRA 3ODXA 4C0AA 2NMBA 1DDWA 2L1CA 4PQ0A 4MK0A 2BCJA 5FI0A 4D0NB 3RCPA 2RLOA 5CLQB 1MKEA 1UNQA 3SV1A 2I5CA 1P5TA 2D9ZA 2D9WA 4K17A 4F7GA 4GMVA 5D3XA 1W1DA 1FHOA 2G35A 2EMTA 1UPQA 2ELAA 4EJNA 3N7CA 2P0FA 2W2WA 2YS5A 1V88A 4P7IA 1Z87A 1WVHA 3SO6A 5HE1A 2RGNB 1X1GA 4GMXB 5D3WA 2R0DA 5GOWB 2COAA 1FAOA 4YL8A 4HHVA 5HE3A 3CXBB 2MWNB 1PMSA 2H7EA 4Z2NA 2K2JA 2V76A 1N3HA 1FB8A 1GC7A 2LULA 3QBVB 1FGYA 1AQCA 1U2BA 3UZTA 1P3RA 2DTCA 3P7ZA 2J0MA 3U8ZA 2P8VA 5DHAB 1OY2A 2RSGA 2AL6A 2LYDA 2LOXA 4HDOA 5C5BB 3V5WA 1FGZA 5D3YA 1V5UA 3ULBA 3A8PA 3VIAA 5J3YA 3AJ4A 4IAPA 2QKLA 1NTYA 5J3QA 2D2QA 3SYXA 2KCJA 2DHJA 4A6KA 3PSCA 2Z0QA 1PFJA 1X11A 3CIKA 3KRWA 2K2UA 1IRSA 1U5GA 1U5FA 2Y8FA 2CAYA 3QIJA 4KVGB 2R09A 1ZSQA 2GS0A 5JHHA 2DN6A 1WJMA 4KHAA 1V61A 2P0HA 3KY9A 2D9VA 2Y7BA 3KSYA 4A5KA 2KGXB 1ZC3B 4KAXB 4ZRIA 2OTXA 5KQ4A 1GC6A 4HATB 1QC6A 1NI2A 1U29A 5D27A 1XD4A 1BTNA 2UZSA 3VOQA 4F7UP 3DXEA 1EVHA 1MK7B 2Y8GA 3D8EA 1U27A 1I2HA 2YT1A 4HB0B 4HAZB 1H4RA 3FEHA 1W1HA 2DX1A 2YRYA 3OANA 4A6FA 1ZM0A 2I5FA 4BBKA 1Q67A 1M7EA 2N23A 2IYBA 4K81A 1BWNA 2DYNA 1RJ2A 3F0WA 1H10A 1BAKA 3PZDA 2MDXA 2VRWB 4HAUB 4XWXA 4ZRKA 2RUKB 4HDQA 2J0JA 3TCAA 2HE7A 1UPRA 5C79A 5J3TA 2YVCA 3TFMA 1MK9B 2DHIA 2GJYA 4HAXB 1DDMA 4F7HA 1K5GB 2DKPA 4H8SA 1AWEA 1EGXA 1OMWA 3U7DA 1RRPB 1EF1A 4K2OA 5C16A 1UEFA 1MIZB 1B55A 2I1JA 1KI1B 1J19A 2CRFA 5JP4A 3A8QA 5D3VA 5KQ1A 1SHCA 1K5DB 2EJ8A 3FSSA 3SNHA 3HQCA 1KZGA 1XCGA 1P6SA 1XKEA 2Z0PA 1MIXA 4PNKA 2YT0A 4A6HA 2J59M 3MPXA 4DBBA 1ZVRA 1Y19B 5DHFB 3ULCA 2DA0A 1DBHA 2J0KA 3F5RA 4KHBB 2VKIA 4EKUA 3X23A 4HAVB 1XODA 2MFQA 2W2XC 2PZ1A 3HW2B 4GXBA 1X05A 3P6AA 4GN1A 4HAWB 3BJIA 1SGHA 1X86A 5JLJB 1M7RA 1W1GA 5CLLB 2P0DA 3PEGA 3HK0A 2RNRB 4TKNA 1UNPA 1OQNA 3ZVRA 4CHJA 2DFKA 2FJLA 2LKOA 4L6EA 1FOEA 2DLWA 2GCLA 1DYNA 4EMOA 2LOZA 2XQNM 4WJ7A 5LONB 2HTHB 1MPHA 4Z2MB 2RVBB 3A98B 5LOPB 3KRXA 4IOYX 3AU4A 3GYPA 2ZPYA 4DXAB 1FHXA 4Y94A 2L2IA 4TYZA 2Z0OA 2H7DA 2DX5A 5JHGA 2D11A 2ELBA 3PVUA 2CY4A 5C5BA 5KCVA 4NY0A 4ZRJA 1J0WA 2OQBA 3WA0A 3FM8C 4CYEA 5HE0A 1WG7A 2CY5A 3QWMA 1MAIA 2ROZB 3WYFB 2YSZA 4GZUA 3TVVA 1NU2A 4MT7A 3BINA 2K00A 5DI9B 3D8FA 2D10A 2D9XA 3KZ1A 4NSWA 1TXDA 1WGQA 1ISNA 1X1FA 2QKMA 3PG7A 3GYOA 1PLSA 1U5EA 2JP2A 2UVMA 1I7AA 2E2XA 3AU5A 1FHWA 2MKRA 3MDBC 2AEHA 2DHKA 3IVFA 1BTKA 2N0YA 2D4QA 2UZRA 2COFA 2W2XD 1XX0A 1QQGA 1Y5OA 3G9WA 3TW1A 3TO1A 1EAZA 3DXDA 1TJ6A 2I1KA 3D8DA 3SUZA 5FI1A 4WSFA 2M14A 1V89A 3ML4A 2COCA 4WVFB
chains in the Genus database with same CATH superfamily
2YS3A 3T06A 4DX90 4K2PA 2D9YA 2EMSA 4A6FB 3NWDA 1LW3A 1NTVA 4GPTB 2LG1A 4HAYB 2EC1A 2ROVA 1V5MA 5DH9B 3ODWA 4MY6A 2GCJA 4KHOA 3M1IB 1GG3A 5EFXA 5HE2A 2Q13A 5L81A 4OSNA 3FVCA 3PP2A 2YF0A 3ZDTA 1E5WA 1WI1A 3HSAA 3NWFA 1U5DA 2CODA 1TQZA 2KUPA 2DYQA 3O96A 4HB2B 1WGUA 3PVLA 3PVWA 2IFSA 4B6HA 2ADZA 4HB4B 5DIFB 1DROA 4IFSA 2YS1A 2Z14A 2DKQA 4HB3B 1WJ1A 3LJUX 1ZC4B 2VSZA 4YONA 1V5PA 1LB1A 3ODOA 5C6RA 1KZ7A 4DX8A 1DDVA 4CHMA 3NSUA 3DXCA 2M38A 2NBVA 2NZ8B 1XR0B 2X18A 1T77A 1UNRA 2Z13A 3ODXA 4C0AA 2NMBA 1DDWA 2L1CA 4PQ0A 4MK0A 2BCJA 5FI0A 4D0NB 3RCPA 2RLOA 5CLQB 1MKEA 1UNQA 3SV1A 2I5CA 1P5TA 2D9ZA 2D9WA 4K17A 4F7GA 4KHBA 4GMVA 5D3XA 1W1DA 1MI1A 1FHOA 2G35A 2EMTA 1UPQA 2KR0A 2ELAA 4EJNA 3N7CA 2P0FA 2W2WA 2YS5A 1V88A 4P7IA 1Z87A 1WVHA 3SO6A 5HE1A 2RGNB 1X1GA 4GMXB 5D3WA 2R0DA 5GOWB 2COAA 1ZYIA 1FAOA 4YL8A 4HHVA 5HE3A 3CXBB 2MWNB 1PMSA 2H7EA 4Z2NA 2K2JA 2V76A 2R2YA 1N3HA 1FB8A 1GC7A 2LULA 3QBVB 1FGYA 1AQCA 1U2BA 3UZTA 1P3RA 2DTCA 3P7ZA 2J0MA 4QJ3B 3U8ZA 2P8VA 5DHAB 1OY2A 2RSGA 2AL6A 2LYDA 2LOXA 4HDOA 5IRSA 5C5BB 3V5WA 1FGZA 2KUQA 1V5UA 5D3YA 3ULBA 3A8PA 3HIEA 3NWAA 3VIAA 5J3YA 3AJ4A 4IAPA 2QKLA 1NTYA 5J3QA 2D2QA 3SYXA 2KCJA 2DHJA 4A6KA 3PSCA 2Z0QA 1PFJA 1X11A 3CIKA 2K2UA 1IRSA 1U5GA 3KRWA 1U5FA 2Y8FA 2CAYA 3QIJA 4KVGB 2R09A 1ZSQA 2GS0A 5JHHA 2DN6A 1WJMA 4KHAA 1V61A 2P0HA 3KY9A 2D9VA 2Y7BA 3KSYA 4A5KA 2KGXB 1ZC3B 4KAXB 4ZRIA 2OTXA 5KQ4A 1GC6A 4HATB 1QC6A 1NI2A 1U29A 5D27A 1XD4A 1BTNA 2UZSA 3A58A 3VOQA 4F7UP 3DXEA 1EVHA 1MK7B 2Y8GA 3D8EA 1U27A 1I2HA 2YT1A 4HB0B 4HAZB 1H4RA 3FEHA 3U12A 1W1HA 4GNKB 2DX1A 2YRYA 2K49A 3OANA 4A6FA 1ZM0A 2I5FA 3NW8A 4BBKA 4D6WA 1Q67A 1M7EA 2N23A 2IYBA 4K81A 1BWNA 2DYNA 1RJ2A 3F0WA 1H10A 1BAKA 2K8EA 3PZDA 4OT1A 2MDXA 2VRWB 4HAUB 4XWXA 4ZRKA 2RUKB 4HDQA 2J0JA 3TCAA 2HE7A 1UPRA 5C79A 5J3TA 2YVCA 3TFMA 1MK9B 2DHIA 2GJYA 4HAXB 1DDMA 4F7HA 1K5GB 2DKPA 4H8SA 1AWEA 1EGXA 1OMWA 2YT2A 3U7DA 1RRPB 1EF1A 4K2OA 5C16A 1UEFA 1MIZB 2Z4DA 1B55A 2I1JA 1KI1B 1J19A 2CRFA 5JP4A 3A8QA 5D3VA 5LG4B 5KQ1A 3DCXA 1SHCA 1K5DB 2EJ8A 3FSSA 3SNHA 3HQCA 1KZGA 1XCGA 1P6SA 1XKEA 2Z0PA 1MIXA 4PNKA 2YT0A 2ZKMX 4A6HA 2J59M 3MPXA 4DBBA 4L1RA 1ZVRA 2KIGA 1Y19B 5DHFB 3ULCA 2DA0A 1DBHA 2J0KA 4HSIA 2FJUB 3F5RA 4KHBB 2VKIA 4EKUA 3X23A 4HAVB 1XODA 2MFQA 2W2XC 2PZ1A 3HW2B 4GXBA 4QJ5B 1X05A 3P6AA 2Z59A 4GN1A 2GUMA 4HAWB 3BJIA 1SGHA 2KIEA 1X86A 5JLJB 1M7RA 1W1GA 5CLLB 2P0DA 3PEGA 3HK0A 2RNRB 4TKNA 1UNPA 5I2SA 1OQNA 3ZVRA 4CHJA 2DFKA 2FJLA 2LKOA 4L6EA 4QXAB 1FOEA 2DLWA 2GCLA 1DYNA 4EMOA 2LOZA 2XQNM 4CSQA 4WJ7A 5LONB 2HTHB 1MPHA 4Z2MB 2RVBB 3A98B 5LOPB 3KRXA 4IOYX 3AU4A 3GYPA 2ZPYA 4DXAB 1FHXA 4Y94A 2L2IA 4TYZA 2Z0OA 2H7DA 2DX5A 5JHGA 2D11A 2ELBA 3PVUA 2CY4A 5C5BA 5KCVA 4NY0A 4ZRJA 1J0WA 2OQBA 3WA0A 3FM8C 4CYEA 5HE0A 1WG7A 2CY5A 3QWMA 1MAIA 2ROZB 3WYFB 2YSZA 4GZUA 3TVVA 1NU2A 4MT7A 3BINA 3OHMB 2K00A 3B77A 5DI9B 3D8FA 2D10A 2D9XA 3KZ1A 4NSWA 1TXDA 1WGQA 1ISNA 1X1FA 2QKMA 2RRFA 5M4YB 3PG7A 3GYOA 1PLSA 1U5EA 2JP2A 2UVMA 1I7AA 2E2XA 3AU5A 1FHWA 2MKRA 3MDBC 2AEHA 2DHKA 3IVFA 1BTKA 2N0YA 2D4QA 2UZRA 2COFA 2W2XD 1XX0A 1QQGA 1Y5OA 3G9WA 3TW1A 3TO1A 1EAZA 3DXDA 1TJ6A 4GOUA 4DIXA 2I1KA 3D8DA 3SUZA 5FI1A 4WSFA 2M14A 5I2MA 4QJ4B 1V89A 3ML4A 2COCA 4WVFB
chains in the Genus database with same CATH topology
2YS3A 3T06A 4DX90 4K2PA 2D9YA 2EMSA 4A6FB 1LW3A 1NTVA 4GPTB 2LG1A 4HAYB 2EC1A 2ROVA 1V5MA 5DH9B 3ODWA 4MY6A 2GCJA 4KHOA 3M1IB 1GG3A 5EFXA 5HE2A 2Q13A 5L81A 3PP2A 2YF0A 3ZDTA 1E5WA 1WI1A 1U5DA 2CODA 1TQZA 2KUPA 2DYQA 3O96A 4HB2B 1WGUA 3PVLA 3PVWA 2IFSA 4B6HA 2ADZA 4HB4B 5DIFB 1DROA 4IFSA 2YS1A 2DKQA 4HB3B 1WJ1A 3LJUX 1ZC4B 2VSZA 4YONA 1V5PA 1LB1A 3ODOA 5C6RA 1KZ7A 4DX8A 1DDVA 4CHMA 3NSUA 3DXCA 2M38A 2NZ8B 1XR0B 2X18A 1UNRA 3ODXA 4C0AA 2NMBA 1DDWA 2L1CA 4PQ0A 4MK0A 2BCJA 5FI0A 4D0NB 3RCPA 2RLOA 5CLQB 1MKEA 1UNQA 3SV1A 2I5CA 1P5TA 2D9ZA 2D9WA 4K17A 4F7GA 4GMVA 5D3XA 1W1DA 1FHOA 2G35A 2EMTA 1UPQA 2ELAA 4EJNA 3N7CA 2P0FA 2W2WA 2YS5A 1V88A 4P7IA 1Z87A 1WVHA 3SO6A 5HE1A 2RGNB 1X1GA 4GMXB 5D3WA 2R0DA 5GOWB 2COAA 1FAOA 4YL8A 4HHVA 5HE3A 3CXBB 2MWNB 1PMSA 2H7EA 4Z2NA 2K2JA 2V76A 1N3HA 1FB8A 1GC7A 2LULA 3QBVB 1FGYA 1AQCA 1U2BA 3UZTA 1P3RA 2DTCA 3P7ZA 2J0MA 3U8ZA 2P8VA 5DHAB 1OY2A 2RSGA 2AL6A 2LYDA 2LOXA 4HDOA 5C5BB 3V5WA 1FGZA 5D3YA 1V5UA 3ULBA 3A8PA 3VIAA 5J3YA 3AJ4A 4IAPA 2QKLA 1NTYA 5J3QA 2D2QA 3SYXA 2KCJA 2DHJA 4A6KA 3PSCA 2Z0QA 1PFJA 1X11A 3CIKA 3KRWA 2K2UA 1IRSA 1U5GA 1U5FA 2Y8FA 2CAYA 3QIJA 4KVGB 2R09A 1ZSQA 2GS0A 5JHHA 2DN6A 1WJMA 4KHAA 1V61A 2P0HA 3KY9A 2D9VA 2Y7BA 3KSYA 4A5KA 2KGXB 1ZC3B 4KAXB 4ZRIA 2OTXA 5KQ4A 1GC6A 4HATB 1QC6A 1NI2A 1U29A 5D27A 1XD4A 1BTNA 2UZSA 3VOQA 4F7UP 3DXEA 1EVHA 1MK7B 2Y8GA 3D8EA 1U27A 1I2HA 2YT1A 4HB0B 4HAZB 1H4RA 3FEHA 1W1HA 2DX1A 2YRYA 3OANA 4A6FA 1ZM0A 2I5FA 4BBKA 1Q67A 1M7EA 2N23A 2IYBA 4K81A 1BWNA 2DYNA 1RJ2A 3F0WA 1H10A 1BAKA 3PZDA 2MDXA 2VRWB 4HAUB 4XWXA 4ZRKA 2RUKB 4HDQA 2J0JA 3TCAA 2HE7A 1UPRA 5C79A 5J3TA 2YVCA 3TFMA 1MK9B 2DHIA 2GJYA 4HAXB 1DDMA 4F7HA 1K5GB 2DKPA 4H8SA 1AWEA 1EGXA 1OMWA 3U7DA 1RRPB 1EF1A 4K2OA 5C16A 1UEFA 1MIZB 1B55A 2I1JA 1KI1B 1J19A 2CRFA 5JP4A 3A8QA 5D3VA 5KQ1A 1SHCA 1K5DB 2EJ8A 3FSSA 3SNHA 3HQCA 1KZGA 1XCGA 1P6SA 1XKEA 2Z0PA 1MIXA 4PNKA 2YT0A 4A6HA 2J59M 3MPXA 4DBBA 1ZVRA 1Y19B 5DHFB 3ULCA 2DA0A 1DBHA 2J0KA 3F5RA 4KHBB 2VKIA 4EKUA 3X23A 4HAVB 1XODA 2MFQA 2W2XC 2PZ1A 3HW2B 4GXBA 1X05A 3P6AA 4GN1A 4HAWB 3BJIA 1SGHA 1X86A 5JLJB 1M7RA 1W1GA 5CLLB 2P0DA 3PEGA 3HK0A 2RNRB 4TKNA 1UNPA 1OQNA 3ZVRA 4CHJA 2DFKA 2FJLA 2LKOA 4L6EA 1FOEA 2DLWA 2GCLA 1DYNA 4EMOA 2LOZA 2XQNM 4WJ7A 5LONB 2HTHB 1MPHA 4Z2MB 2RVBB 3A98B 5LOPB 3KRXA 4IOYX 3AU4A 3GYPA 2ZPYA 4DXAB 1FHXA 4Y94A 2L2IA 4TYZA 2Z0OA 2H7DA 2DX5A 5JHGA 2D11A 2ELBA 3PVUA 2CY4A 5C5BA 5KCVA 4NY0A 4ZRJA 1J0WA 2OQBA 3WA0A 3FM8C 4CYEA 5HE0A 1WG7A 2CY5A 3QWMA 1MAIA 2ROZB 3WYFB 2YSZA 4GZUA 3TVVA 1NU2A 4MT7A 3BINA 2K00A 5DI9B 3D8FA 2D10A 2D9XA 3KZ1A 4NSWA 1TXDA 1WGQA 1ISNA 1X1FA 2QKMA 3PG7A 3GYOA 1PLSA 1U5EA 2JP2A 2UVMA 1I7AA 2E2XA 3AU5A 1FHWA 2MKRA 3MDBC 2AEHA 2DHKA 3IVFA 1BTKA 2N0YA 2D4QA 2UZRA 2COFA 2W2XD 1XX0A 1QQGA 1Y5OA 3G9WA 3TW1A 3TO1A 1EAZA 3DXDA 1TJ6A 2I1KA 3D8DA 3SUZA 5FI1A 4WSFA 2M14A 1V89A 3ML4A 2COCA 4WVFB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YS3 A;  3T06 A;  4DX9 0;  4K2P A;  2D9Y A;  2EMS A;  4A6F B;  1LW3 A;  1NTV A;  4GPT B;  2LG1 A;  4HAY B;  2EC1 A;  2ROV A;  1V5M A;  5DH9 B;  3ODW A;  4MY6 A;  2GCJ A;  4KHO A;  3M1I B;  1GG3 A;  5EFX A;  5HE2 A;  2Q13 A;  5L81 A;  3PP2 A;  2YF0 A;  3ZDT A;  1E5W A;  1WI1 A;  1U5D A;  2COD A;  1TQZ A;  2KUP A;  2DYQ A;  3O96 A;  4HB2 B;  1WGU A;  3PVL A;  3PVW A;  2IFS A;  4B6H A;  2ADZ A;  4HB4 B;  5DIF B;  1DRO A;  4IFS A;  2YS1 A;  2DKQ A;  4HB3 B;  1WJ1 A;  3LJU X;  1ZC4 B;  2VSZ A;  4YON A;  1V5P A;  1LB1 A;  3ODO A;  5C6R A;  1KZ7 A;  4DX8 A;  1DDV A;  4CHM A;  3NSU A;  3DXC A;  2M38 A;  2NZ8 B;  1XR0 B;  2X18 A;  1UNR A;  3ODX A;  4C0A A;  2NMB A;  1DDW A;  2L1C A;  4PQ0 A;  4MK0 A;  2BCJ A;  5FI0 A;  4D0N B;  3RCP A;  2RLO A;  5CLQ B;  1MKE A;  1UNQ A;  3SV1 A;  2I5C A;  1P5T A;  2D9Z A;  2D9W A;  4K17 A;  4F7G A;  4GMV A;  5D3X A;  1W1D A;  1FHO A;  2G35 A;  2EMT A;  1UPQ A;  2ELA A;  4EJN A;  3N7C A;  2P0F A;  2W2W A;  2YS5 A;  1V88 A;  4P7I A;  1Z87 A;  1WVH A;  3SO6 A;  5HE1 A;  2RGN B;  1X1G A;  4GMX B;  5D3W A;  2R0D A;  5GOW B;  2COA A;  1FAO A;  4YL8 A;  4HHV A;  5HE3 A;  3CXB B;  2MWN B;  1PMS A;  2H7E A;  4Z2N A;  2K2J A;  2V76 A;  1N3H A;  1FB8 A;  1GC7 A;  2LUL A;  3QBV B;  1FGY A;  1AQC A;  1U2B A;  3UZT A;  1P3R A;  2DTC A;  3P7Z A;  2J0M A;  3U8Z A;  2P8V A;  5DHA B;  1OY2 A;  2RSG A;  2AL6 A;  2LYD A;  2LOX A;  4HDO A;  5C5B B;  3V5W A;  1FGZ A;  5D3Y A;  1V5U A;  3ULB A;  3A8P A;  3VIA A;  5J3Y A;  3AJ4 A;  4IAP A;  2QKL A;  1NTY A;  5J3Q A;  2D2Q A;  3SYX A;  2KCJ A;  2DHJ A;  4A6K A;  3PSC A;  2Z0Q A;  1PFJ A;  1X11 A;  3CIK A;  3KRW A;  2K2U A;  1IRS A;  1U5G A;  1U5F A;  2Y8F A;  2CAY A;  3QIJ A;  4KVG B;  2R09 A;  1ZSQ A;  2GS0 A;  5JHH A;  2DN6 A;  1WJM A;  4KHA A;  1V61 A;  2P0H A;  3KY9 A;  2D9V A;  2Y7B A;  3KSY A;  4A5K A;  2KGX B;  1ZC3 B;  4KAX B;  4ZRI A;  2OTX A;  5KQ4 A;  1GC6 A;  4HAT B;  1QC6 A;  1NI2 A;  1U29 A;  5D27 A;  1XD4 A;  1BTN A;  2UZS A;  3VOQ A;  4F7U P;  3DXE A;  1EVH A;  1MK7 B;  2Y8G A;  3D8E A;  1U27 A;  1I2H A;  2YT1 A;  4HB0 B;  4HAZ B;  1H4R A;  3FEH A;  1W1H A;  2DX1 A;  2YRY A;  3OAN A;  4A6F A;  1ZM0 A;  2I5F A;  4BBK A;  1Q67 A;  1M7E A;  2N23 A;  2IYB A;  4K81 A;  1BWN A;  2DYN A;  1RJ2 A;  3F0W A;  1H10 A;  1BAK A;  3PZD A;  2MDX A;  2VRW B;  4HAU B;  4XWX A;  4ZRK A;  2RUK B;  4HDQ A;  2J0J A;  3TCA A;  2HE7 A;  1UPR A;  5C79 A;  5J3T A;  2YVC A;  3TFM A;  1MK9 B;  2DHI A;  2GJY A;  4HAX B;  1DDM A;  4F7H A;  1K5G B;  2DKP A;  4H8S A;  1AWE A;  1EGX A;  1OMW A;  3U7D A;  1RRP B;  1EF1 A;  4K2O A;  5C16 A;  1UEF A;  1MIZ B;  1B55 A;  2I1J A;  1KI1 B;  1J19 A;  2CRF A;  5JP4 A;  3A8Q A;  5D3V A;  5KQ1 A;  1SHC A;  1K5D B;  2EJ8 A;  3FSS A;  3SNH A;  3HQC A;  1KZG A;  1XCG A;  1P6S A;  1XKE A;  2Z0P A;  1MIX A;  4PNK A;  2YT0 A;  4A6H A;  2J59 M;  3MPX A;  4DBB A;  1ZVR A;  1Y19 B;  5DHF B;  3ULC A;  2DA0 A;  1DBH A;  2J0K A;  3F5R A;  4KHB B;  2VKI A;  4EKU A;  3X23 A;  4HAV B;  1XOD A;  2MFQ A;  2W2X C;  2PZ1 A;  3HW2 B;  4GXB A;  1X05 A;  3P6A A;  4GN1 A;  4HAW B;  3BJI A;  1SGH A;  1X86 A;  5JLJ B;  1M7R A;  1W1G A;  5CLL B;  2P0D A;  3PEG A;  3HK0 A;  2RNR B;  4TKN A;  1UNP A;  1OQN A;  3ZVR A;  4CHJ A;  2DFK A;  2FJL A;  2LKO A;  4L6E A;  1FOE A;  2DLW A;  2GCL A;  1DYN A;  4EMO A;  2LOZ A;  2XQN M;  4WJ7 A;  5LON B;  2HTH B;  1MPH A;  4Z2M B;  2RVB B;  3A98 B;  5LOP B;  3KRX A;  4IOY X;  3AU4 A;  3GYP A;  2ZPY A;  4DXA B;  1FHX A;  4Y94 A;  2L2I A;  4TYZ A;  2Z0O A;  2H7D A;  2DX5 A;  5JHG A;  2D11 A;  2ELB A;  3PVU A;  2CY4 A;  5C5B A;  5KCV A;  4NY0 A;  4ZRJ A;  1J0W A;  2OQB A;  3WA0 A;  3FM8 C;  4CYE A;  5HE0 A;  1WG7 A;  2CY5 A;  3QWM A;  1MAI A;  2ROZ B;  3WYF B;  2YSZ A;  4GZU A;  3TVV A;  1NU2 A;  4MT7 A;  3BIN A;  2K00 A;  5DI9 B;  3D8F A;  2D10 A;  2D9X A;  3KZ1 A;  4NSW A;  1TXD A;  1WGQ A;  1ISN A;  1X1F A;  2QKM A;  3PG7 A;  3GYO A;  1PLS A;  1U5E A;  2JP2 A;  2UVM A;  1I7A A;  2E2X A;  3AU5 A;  1FHW A;  2MKR A;  3MDB C;  2AEH A;  2DHK A;  3IVF A;  1BTK A;  2N0Y A;  2D4Q A;  2UZR A;  2COF A;  2W2X D;  1XX0 A;  1QQG A;  1Y5O A;  3G9W A;  3TW1 A;  3TO1 A;  1EAZ A;  3DXD A;  1TJ6 A;  2I1K A;  3D8D A;  3SUZ A;  5FI1 A;  4WSF A;  2M14 A;  1V89 A;  3ML4 A;  2COC A;  4WVF B; 
#chains in the Genus database with same CATH topology
 2YS3 A;  3T06 A;  4DX9 0;  4K2P A;  2D9Y A;  2EMS A;  4A6F B;  3NWD A;  1LW3 A;  1NTV A;  4GPT B;  2LG1 A;  4HAY B;  2EC1 A;  2ROV A;  1V5M A;  5DH9 B;  3ODW A;  4MY6 A;  2GCJ A;  4KHO A;  3M1I B;  1GG3 A;  5EFX A;  5HE2 A;  2Q13 A;  5L81 A;  4OSN A;  3FVC A;  3PP2 A;  2YF0 A;  3ZDT A;  1E5W A;  1WI1 A;  3HSA A;  3NWF A;  1U5D A;  2COD A;  1TQZ A;  2KUP A;  2DYQ A;  3O96 A;  4HB2 B;  1WGU A;  3PVL A;  3PVW A;  2IFS A;  4B6H A;  2ADZ A;  4HB4 B;  5DIF B;  1DRO A;  4IFS A;  2YS1 A;  2Z14 A;  2DKQ A;  4HB3 B;  1WJ1 A;  3LJU X;  1ZC4 B;  2VSZ A;  4YON A;  1V5P A;  1LB1 A;  3ODO A;  5C6R A;  1KZ7 A;  4DX8 A;  1DDV A;  4CHM A;  3NSU A;  3DXC A;  2M38 A;  2NBV A;  2NZ8 B;  1XR0 B;  2X18 A;  1T77 A;  1UNR A;  2Z13 A;  3ODX A;  4C0A A;  2NMB A;  1DDW A;  2L1C A;  4PQ0 A;  4MK0 A;  2BCJ A;  5FI0 A;  4D0N B;  3RCP A;  2RLO A;  5CLQ B;  1MKE A;  1UNQ A;  3SV1 A;  2I5C A;  1P5T A;  2D9Z A;  2D9W A;  4K17 A;  4F7G A;  4KHB A;  4GMV A;  5D3X A;  1W1D A;  1MI1 A;  1FHO A;  2G35 A;  2EMT A;  1UPQ A;  2KR0 A;  2ELA A;  4EJN A;  3N7C A;  2P0F A;  2W2W A;  2YS5 A;  1V88 A;  4P7I A;  1Z87 A;  1WVH A;  3SO6 A;  5HE1 A;  2RGN B;  1X1G A;  4GMX B;  5D3W A;  2R0D A;  5GOW B;  2COA A;  1ZYI A;  1FAO A;  4YL8 A;  4HHV A;  5HE3 A;  3CXB B;  2MWN B;  1PMS A;  2H7E A;  4Z2N A;  2K2J A;  2V76 A;  2R2Y A;  1N3H A;  1FB8 A;  1GC7 A;  2LUL A;  3QBV B;  1FGY A;  1AQC A;  1U2B A;  3UZT A;  1P3R A;  2DTC A;  3P7Z A;  2J0M A;  4QJ3 B;  3U8Z A;  2P8V A;  5DHA B;  1OY2 A;  2RSG A;  2AL6 A;  2LYD A;  2LOX A;  4HDO A;  5IRS A;  5C5B B;  3V5W A;  1FGZ A;  2KUQ A;  1V5U A;  5D3Y A;  3ULB A;  3A8P A;  3HIE A;  3NWA A;  3VIA A;  5J3Y A;  3AJ4 A;  4IAP A;  2QKL A;  1NTY A;  5J3Q A;  2D2Q A;  3SYX A;  2KCJ A;  2DHJ A;  4A6K A;  3PSC A;  2Z0Q A;  1PFJ A;  1X11 A;  3CIK A;  2K2U A;  1IRS A;  1U5G A;  3KRW A;  1U5F A;  2Y8F A;  2CAY A;  3QIJ A;  4KVG B;  2R09 A;  1ZSQ A;  2GS0 A;  5JHH A;  2DN6 A;  1WJM A;  4KHA A;  1V61 A;  2P0H A;  3KY9 A;  2D9V A;  2Y7B A;  3KSY A;  4A5K A;  2KGX B;  1ZC3 B;  4KAX B;  4ZRI A;  2OTX A;  5KQ4 A;  1GC6 A;  4HAT B;  1QC6 A;  1NI2 A;  1U29 A;  5D27 A;  1XD4 A;  1BTN A;  2UZS A;  3A58 A;  3VOQ A;  4F7U P;  3DXE A;  1EVH A;  1MK7 B;  2Y8G A;  3D8E A;  1U27 A;  1I2H A;  2YT1 A;  4HB0 B;  4HAZ B;  1H4R A;  3FEH A;  3U12 A;  1W1H A;  4GNK B;  2DX1 A;  2YRY A;  2K49 A;  3OAN A;  4A6F A;  1ZM0 A;  2I5F A;  3NW8 A;  4BBK A;  4D6W A;  1Q67 A;  1M7E A;  2N23 A;  2IYB A;  4K81 A;  1BWN A;  2DYN A;  1RJ2 A;  3F0W A;  1H10 A;  1BAK A;  2K8E A;  3PZD A;  4OT1 A;  2MDX A;  2VRW B;  4HAU B;  4XWX A;  4ZRK A;  2RUK B;  4HDQ A;  2J0J A;  3TCA A;  2HE7 A;  1UPR A;  5C79 A;  5J3T A;  2YVC A;  3TFM A;  1MK9 B;  2DHI A;  2GJY A;  4HAX B;  1DDM A;  4F7H A;  1K5G B;  2DKP A;  4H8S A;  1AWE A;  1EGX A;  1OMW A;  2YT2 A;  3U7D A;  1RRP B;  1EF1 A;  4K2O A;  5C16 A;  1UEF A;  1MIZ B;  2Z4D A;  1B55 A;  2I1J A;  1KI1 B;  1J19 A;  2CRF A;  5JP4 A;  3A8Q A;  5D3V A;  5LG4 B;  5KQ1 A;  3DCX A;  1SHC A;  1K5D B;  2EJ8 A;  3FSS A;  3SNH A;  3HQC A;  1KZG A;  1XCG A;  1P6S A;  1XKE A;  2Z0P A;  1MIX A;  4PNK A;  2YT0 A;  2ZKM X;  4A6H A;  2J59 M;  3MPX A;  4DBB A;  4L1R A;  1ZVR A;  2KIG A;  1Y19 B;  5DHF B;  3ULC A;  2DA0 A;  1DBH A;  2J0K A;  4HSI A;  2FJU B;  3F5R A;  4KHB B;  2VKI A;  4EKU A;  3X23 A;  4HAV B;  1XOD A;  2MFQ A;  2W2X C;  2PZ1 A;  3HW2 B;  4GXB A;  4QJ5 B;  1X05 A;  3P6A A;  2Z59 A;  4GN1 A;  2GUM A;  4HAW B;  3BJI A;  1SGH A;  2KIE A;  1X86 A;  5JLJ B;  1M7R A;  1W1G A;  5CLL B;  2P0D A;  3PEG A;  3HK0 A;  2RNR B;  4TKN A;  1UNP A;  5I2S A;  1OQN A;  3ZVR A;  4CHJ A;  2DFK A;  2FJL A;  2LKO A;  4L6E A;  4QXA B;  1FOE A;  2DLW A;  2GCL A;  1DYN A;  4EMO A;  2LOZ A;  2XQN M;  4CSQ A;  4WJ7 A;  5LON B;  2HTH B;  1MPH A;  4Z2M B;  2RVB B;  3A98 B;  5LOP B;  3KRX A;  4IOY X;  3AU4 A;  3GYP A;  2ZPY A;  4DXA B;  1FHX A;  4Y94 A;  2L2I A;  4TYZ A;  2Z0O A;  2H7D A;  2DX5 A;  5JHG A;  2D11 A;  2ELB A;  3PVU A;  2CY4 A;  5C5B A;  5KCV A;  4NY0 A;  4ZRJ A;  1J0W A;  2OQB A;  3WA0 A;  3FM8 C;  4CYE A;  5HE0 A;  1WG7 A;  2CY5 A;  3QWM A;  1MAI A;  2ROZ B;  3WYF B;  2YSZ A;  4GZU A;  3TVV A;  1NU2 A;  4MT7 A;  3BIN A;  3OHM B;  2K00 A;  3B77 A;  5DI9 B;  3D8F A;  2D10 A;  2D9X A;  3KZ1 A;  4NSW A;  1TXD A;  1WGQ A;  1ISN A;  1X1F A;  2QKM A;  2RRF A;  5M4Y B;  3PG7 A;  3GYO A;  1PLS A;  1U5E A;  2JP2 A;  2UVM A;  1I7A A;  2E2X A;  3AU5 A;  1FHW A;  2MKR A;  3MDB C;  2AEH A;  2DHK A;  3IVF A;  1BTK A;  2N0Y A;  2D4Q A;  2UZR A;  2COF A;  2W2X D;  1XX0 A;  1QQG A;  1Y5O A;  3G9W A;  3TW1 A;  3TO1 A;  1EAZ A;  3DXD A;  1TJ6 A;  4GOU A;  4DIX A;  2I1K A;  3D8D A;  3SUZ A;  5FI1 A;  4WSF A;  2M14 A;  5I2M A;  4QJ4 B;  1V89 A;  3ML4 A;  2COC A;  4WVF B; 
#chains in the Genus database with same CATH homology
 2YS3 A;  3T06 A;  4DX9 0;  4K2P A;  2D9Y A;  2EMS A;  4A6F B;  1LW3 A;  1NTV A;  4GPT B;  2LG1 A;  4HAY B;  2EC1 A;  2ROV A;  1V5M A;  5DH9 B;  3ODW A;  4MY6 A;  2GCJ A;  4KHO A;  3M1I B;  1GG3 A;  5EFX A;  5HE2 A;  2Q13 A;  5L81 A;  3PP2 A;  2YF0 A;  3ZDT A;  1E5W A;  1WI1 A;  1U5D A;  2COD A;  1TQZ A;  2KUP A;  2DYQ A;  3O96 A;  4HB2 B;  1WGU A;  3PVL A;  3PVW A;  2IFS A;  4B6H A;  2ADZ A;  4HB4 B;  5DIF B;  1DRO A;  4IFS A;  2YS1 A;  2DKQ A;  4HB3 B;  1WJ1 A;  3LJU X;  1ZC4 B;  2VSZ A;  4YON A;  1V5P A;  1LB1 A;  3ODO A;  5C6R A;  1KZ7 A;  4DX8 A;  1DDV A;  4CHM A;  3NSU A;  3DXC A;  2M38 A;  2NZ8 B;  1XR0 B;  2X18 A;  1UNR A;  3ODX A;  4C0A A;  2NMB A;  1DDW A;  2L1C A;  4PQ0 A;  4MK0 A;  2BCJ A;  5FI0 A;  4D0N B;  3RCP A;  2RLO A;  5CLQ B;  1MKE A;  1UNQ A;  3SV1 A;  2I5C A;  1P5T A;  2D9Z A;  2D9W A;  4K17 A;  4F7G A;  4GMV A;  5D3X A;  1W1D A;  1FHO A;  2G35 A;  2EMT A;  1UPQ A;  2ELA A;  4EJN A;  3N7C A;  2P0F A;  2W2W A;  2YS5 A;  1V88 A;  4P7I A;  1Z87 A;  1WVH A;  3SO6 A;  5HE1 A;  2RGN B;  1X1G A;  4GMX B;  5D3W A;  2R0D A;  5GOW B;  2COA A;  1FAO A;  4YL8 A;  4HHV A;  5HE3 A;  3CXB B;  2MWN B;  1PMS A;  2H7E A;  4Z2N A;  2K2J A;  2V76 A;  1N3H A;  1FB8 A;  1GC7 A;  2LUL A;  3QBV B;  1FGY A;  1AQC A;  1U2B A;  3UZT A;  1P3R A;  2DTC A;  3P7Z A;  2J0M A;  3U8Z A;  2P8V A;  5DHA B;  1OY2 A;  2RSG A;  2AL6 A;  2LYD A;  2LOX A;  4HDO A;  5C5B B;  3V5W A;  1FGZ A;  5D3Y A;  1V5U A;  3ULB A;  3A8P A;  3VIA A;  5J3Y A;  3AJ4 A;  4IAP A;  2QKL A;  1NTY A;  5J3Q A;  2D2Q A;  3SYX A;  2KCJ A;  2DHJ A;  4A6K A;  3PSC A;  2Z0Q A;  1PFJ A;  1X11 A;  3CIK A;  3KRW A;  2K2U A;  1IRS A;  1U5G A;  1U5F A;  2Y8F A;  2CAY A;  3QIJ A;  4KVG B;  2R09 A;  1ZSQ A;  2GS0 A;  5JHH A;  2DN6 A;  1WJM A;  4KHA A;  1V61 A;  2P0H A;  3KY9 A;  2D9V A;  2Y7B A;  3KSY A;  4A5K A;  2KGX B;  1ZC3 B;  4KAX B;  4ZRI A;  2OTX A;  5KQ4 A;  1GC6 A;  4HAT B;  1QC6 A;  1NI2 A;  1U29 A;  5D27 A;  1XD4 A;  1BTN A;  2UZS A;  3VOQ A;  4F7U P;  3DXE A;  1EVH A;  1MK7 B;  2Y8G A;  3D8E A;  1U27 A;  1I2H A;  2YT1 A;  4HB0 B;  4HAZ B;  1H4R A;  3FEH A;  1W1H A;  2DX1 A;  2YRY A;  3OAN A;  4A6F A;  1ZM0 A;  2I5F A;  4BBK A;  1Q67 A;  1M7E A;  2N23 A;  2IYB A;  4K81 A;  1BWN A;  2DYN A;  1RJ2 A;  3F0W A;  1H10 A;  1BAK A;  3PZD A;  2MDX A;  2VRW B;  4HAU B;  4XWX A;  4ZRK A;  2RUK B;  4HDQ A;  2J0J A;  3TCA A;  2HE7 A;  1UPR A;  5C79 A;  5J3T A;  2YVC A;  3TFM A;  1MK9 B;  2DHI A;  2GJY A;  4HAX B;  1DDM A;  4F7H A;  1K5G B;  2DKP A;  4H8S A;  1AWE A;  1EGX A;  1OMW A;  3U7D A;  1RRP B;  1EF1 A;  4K2O A;  5C16 A;  1UEF A;  1MIZ B;  1B55 A;  2I1J A;  1KI1 B;  1J19 A;  2CRF A;  5JP4 A;  3A8Q A;  5D3V A;  5KQ1 A;  1SHC A;  1K5D B;  2EJ8 A;  3FSS A;  3SNH A;  3HQC A;  1KZG A;  1XCG A;  1P6S A;  1XKE A;  2Z0P A;  1MIX A;  4PNK A;  2YT0 A;  4A6H A;  2J59 M;  3MPX A;  4DBB A;  1ZVR A;  1Y19 B;  5DHF B;  3ULC A;  2DA0 A;  1DBH A;  2J0K A;  3F5R A;  4KHB B;  2VKI A;  4EKU A;  3X23 A;  4HAV B;  1XOD A;  2MFQ A;  2W2X C;  2PZ1 A;  3HW2 B;  4GXB A;  1X05 A;  3P6A A;  4GN1 A;  4HAW B;  3BJI A;  1SGH A;  1X86 A;  5JLJ B;  1M7R A;  1W1G A;  5CLL B;  2P0D A;  3PEG A;  3HK0 A;  2RNR B;  4TKN A;  1UNP A;  1OQN A;  3ZVR A;  4CHJ A;  2DFK A;  2FJL A;  2LKO A;  4L6E A;  1FOE A;  2DLW A;  2GCL A;  1DYN A;  4EMO A;  2LOZ A;  2XQN M;  4WJ7 A;  5LON B;  2HTH B;  1MPH A;  4Z2M B;  2RVB B;  3A98 B;  5LOP B;  3KRX A;  4IOY X;  3AU4 A;  3GYP A;  2ZPY A;  4DXA B;  1FHX A;  4Y94 A;  2L2I A;  4TYZ A;  2Z0O A;  2H7D A;  2DX5 A;  5JHG A;  2D11 A;  2ELB A;  3PVU A;  2CY4 A;  5C5B A;  5KCV A;  4NY0 A;  4ZRJ A;  1J0W A;  2OQB A;  3WA0 A;  3FM8 C;  4CYE A;  5HE0 A;  1WG7 A;  2CY5 A;  3QWM A;  1MAI A;  2ROZ B;  3WYF B;  2YSZ A;  4GZU A;  3TVV A;  1NU2 A;  4MT7 A;  3BIN A;  2K00 A;  5DI9 B;  3D8F A;  2D10 A;  2D9X A;  3KZ1 A;  4NSW A;  1TXD A;  1WGQ A;  1ISN A;  1X1F A;  2QKM A;  3PG7 A;  3GYO A;  1PLS A;  1U5E A;  2JP2 A;  2UVM A;  1I7A A;  2E2X A;  3AU5 A;  1FHW A;  2MKR A;  3MDB C;  2AEH A;  2DHK A;  3IVF A;  1BTK A;  2N0Y A;  2D4Q A;  2UZR A;  2COF A;  2W2X D;  1XX0 A;  1QQG A;  1Y5O A;  3G9W A;  3TW1 A;  3TO1 A;  1EAZ A;  3DXD A;  1TJ6 A;  2I1K A;  3D8D A;  3SUZ A;  5FI1 A;  4WSF A;  2M14 A;  1V89 A;  3ML4 A;  2COC A;  4WVF B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...