1PMSA

Pleckstrin homology domain of son of sevenless 1 (sos1) with glycine-serine added to the n-terminus, nmr, 20 structures
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
135
structure length
135
Chain Sequence
SKQLAIKKMNEIQKNIDGWEGKDIGQCCNEFIMEGTLTRVGAKHERHIFLFDGLMICCKSNHGQPRLPGASSAEYRLKEKFFMRKVQINDKDDTSEYKHAFEIILKDGNSVIFSAKSAEEKNNWMAALISLQYRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Signal transduction
molecule keywords SOS 1
publication title The solution structure of the pleckstrin homology domain of mouse Son-of-sevenless 1 (mSos1).
pubmed doi rcsb
source organism Mus musculus
total genus 14
structure length 135
sequence length 135
ec nomenclature
pdb deposition date 1997-02-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00169 PH PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1pmsA00
3SUZA 2UZRA 1M7EA 4NSWA 5DH9B 2MWNB 5FI1A 1MKEA 3CIKA 3PSCA 1SHCA 5C5BA 2YS5A 1FOEA 3VOQA 2D4QA 2Y8GA 3ULCA 3ODXA 3DXDA 1UNRA 3ZVRA 1Y19B 4A5KA 1FGYA 3LJUX 3U7DA 1TJ6A 1H10A 2Y7BA 2ROZB 2NMBA 5LOPB 4WJ7A 4K2PA 3AU4A 3A8PA 1X1GA 2W2XD 3D8EA 3KSYA 1I2HA 1K5GB 3ODOA 5JP4A 1MIZB 1GC6A 2EJ8A 4F7UP 4H8SA 1UPRA 2PZ1A 4PQ0A 5D3WA 2RVBB 1ZC3B 1WJMA 2RGNB 2P0DA 5D3YA 2QKMA 3AJ4A 1RJ2A 1DROA 4GXBA 3TO1A 4DXAB 1WG7A 2OQBA 2KUPA 5J3TA 1RRPB 2J59M 3MPXA 2Q13A 2COAA 2L1CA 3WYFB 4KHOA 1X05A 2DHJA 4YONA 2YS3A 3T06A 2J0JA 1M7RA 4GZUA 4DX8A 4K17A 2GCLA 4WVFB 1FHWA 2NZ8B 4HAWB 1X1FA 4HB3B 3SO6A 2YF0A 2Z0QA 5CLQB 1EAZA 1DDMA 4A6FB 2P0FA 5HE3A 2J0KA 2LULA 2FJLA 2VSZA 5D3XA 4HAVB 2IYBA 1Q67A 2LOXA 4Z2MB 3FM8C 3TFMA 1WGQA 4HB4B 1EGXA 4KHBB 4NY0A 4TKNA 2DFKA 4IFSA 4F7GA 1U5DA 4EJNA 1QC6A 2DTCA 1E5WA 3BINA 3OANA 3U8ZA 1OMWA 2LYDA 2OTXA 5FI0A 4GPTB 4C0AA 3AU5A 1FAOA 3O96A 2BCJA 3X23A 2EC1A 3HQCA 4ZRKA 2D11A 2D2QA 2CY5A 2DHIA 2D9VA 3SNHA 1FHOA 4HB2B 2DA0A 1LW3A 1J19A 2G35A 1P6SA 4WSFA 1XCGA 5LONB 3HK0A 1X86A 3QIJA 1V88A 1UPQA 1U2BA 2DKPA 3VIAA 4D0NB 2ELAA 5EFXA 1XX0A 2AL6A 2MFQA 1MK7B 3IVFA 2MKRA 3F0WA 1NI2A 2GS0A 5GOWB 5HE1A 4K2OA 2YS1A 2DYQA 2CRFA 3PG7A 2I1KA 5C79A 2DLWA 2X18A 1ZC4B 1K5DB 2DHKA 2K00A 4ZRIA 3UZTA 1W1HA 1X11A 4B6HA 1V5UA 2CY4A 3HW2B 1ZM0A 1XODA 5JLJB 3M1IB 2RUKB 1IRSA 1V61A 4HAXB 1BTKA 4HB0B 3KY9A 4EMOA 3PEGA 5J3YA 2MDXA 1KI1B 4L6EA 3QWMA 4F7HA 1GC7A 2UZSA 5JHGA 1Y5OA 1U29A 3V5WA 2I5FA 2QKLA 1AWEA 1N3HA 1OY2A 2ROVA 2RLOA 1WVHA 2DYNA 2LKOA 4HAZB 1DBHA 3A8QA 2YT0A 4TYZA 2D9YA 1TQZA 4KVGB 1XD4A 3TVVA 3CXBB 2CAYA 4CYEA 2D9XA 1KZ7A 4KHAA 3WA0A 1GG3A 3FSSA 1B55A 1XR0B 2D9WA 2DN6A 3KRXA 2KCJA 2RSGA 1PFJA 4DBBA 3ZDTA 1Z87A 1V5MA 2DX5A 3G9WA 3ML4A 1SGHA 5C16A 2K2JA 5CLLB 2D9ZA 4EKUA 2YVCA 1UNPA 2E2XA 4MK0A 3PVLA 4CHMA 2VRWB 4MT7A 4XWXA 1MK9B 4IAPA 1J0WA 3PVUA 4HATB 3RCPA 1V5PA 2W2XC 2YRYA 3P6AA 2HTHB 1U5EA 3DXCA 1NTYA 3SYXA 4A6HA 3NSUA 4KAXB 2COFA 2ELBA 2I1JA 3P7ZA 1P5TA 1PMSA 3GYOA 3MDBC 4A6FA 5DI9B 3TW1A 4PNKA 5L81A 2R0DA 1BTNA 4P7IA 3QBVB 4HDOA 2ADZA 1V89A 1FHXA 2M38A 2W2WA 1EF1A 4GMVA 2YT1A 2EMSA 3BJIA 4Z2NA 2DKQA 3KRWA 4HHVA 5DIFB 2V76A 4DX90 2N0YA 3D8DA 5DHAB 4YL8A 1U5FA 5KQ4A 1DDVA 2VKIA 2LOZA 1MIXA 1I7AA 4ZRJA 2IFSA 2UVMA 5KQ1A 5HE2A 2D10A 2P0HA 5HE0A 2YSZA 3PVWA 1ZVRA 2P8VA 4GN1A 1OQNA 3TCAA 3DXEA 4K81A 1ISNA 2K2UA 2AEHA 2H7DA 1MAIA 5D27A 1P3RA 1ZSQA 4A6KA 3SV1A 5J3QA 1QQGA 1TXDA 4HAUB 1MPHA 1FGZA 2ZPYA 2HE7A 3N7CA 1W1GA 1AQCA 4Y94A 5D3VA 5C5BB 3GYPA 4IOYX 5KCVA 5C6RA 2Z0OA 4HAYB 1EVHA 1LB1A 3KZ1A 1UEFA 1BAKA 1XKEA 2GJYA 3D8FA 4MY6A 1UNQA 2L2IA 2COCA 5JHHA 1FB8A 5DHFB 2J0MA 3FEHA 1U5GA 2N23A 1WGUA 2I5CA 4HDQA 3F5RA 2KGXB 2JP2A 1BWNA 2LG1A 2DX1A 3ODWA 1DDWA 3ULBA 1NTVA 1WJ1A 1KZGA 1PLSA 2XQNM 1DYNA 4BBKA 2RNRB 2Z0PA 1H4RA 1U27A 1WI1A 2EMTA 2H7EA 4GMXB 4CHJA 1W1DA 2R09A 2M14A 2GCJA 2Y8FA 3A98B 3PP2A 1NU2A 2CODA 3PZDA
chains in the Genus database with same CATH superfamily
3SUZA 2UZRA 1M7EA 4NSWA 5DH9B 2MWNB 5FI1A 1MKEA 3CIKA 3PSCA 1SHCA 5C5BA 2YS5A 1FOEA 3VOQA 5LG4B 2D4QA 4GNKB 2Y8GA 3ULCA 3ODXA 2KIEA 3DXDA 1UNRA 3ZVRA 1Y19B 1T77A 4A5KA 1FGYA 3LJUX 3U7DA 1TJ6A 1H10A 2Y7BA 3HSAA 2ROZB 2NMBA 5LOPB 4WJ7A 4K2PA 3AU4A 3A8PA 1X1GA 2W2XD 3D8EA 3KSYA 3A58A 1I2HA 1K5GB 3ODOA 5JP4A 1MIZB 4HSIA 1GC6A 2EJ8A 4F7UP 4H8SA 1UPRA 2PZ1A 4PQ0A 5D3WA 2RVBB 1ZC3B 1WJMA 2RGNB 4QJ3B 2P0DA 5D3YA 2QKMA 3AJ4A 1RJ2A 1DROA 2NBVA 4GXBA 3TO1A 4DXAB 1WG7A 2OQBA 2KUPA 5J3TA 1RRPB 2J59M 1MI1A 3MPXA 2Q13A 2COAA 2L1CA 3WYFB 4KHOA 3NWFA 1X05A 2DHJA 4YONA 2YS3A 3T06A 2J0JA 1M7RA 4GZUA 4DX8A 4K17A 2GCLA 4WVFB 1FHWA 2NZ8B 4HAWB 1X1FA 4HB3B 3SO6A 2YF0A 2Z0QA 5CLQB 1EAZA 1DDMA 4A6FB 2P0FA 5HE3A 2J0KA 2LULA 2FJLA 2VSZA 5D3XA 4HAVB 2IYBA 1Q67A 2LOXA 4Z2MB 2KUQA 3FM8C 3TFMA 1WGQA 4HB4B 1EGXA 4KHBB 4NY0A 4TKNA 2DFKA 3DCXA 4IFSA 4F7GA 1U5DA 4EJNA 1QC6A 2DTCA 2Z4DA 1E5WA 3BINA 3OANA 3U8ZA 1OMWA 2LYDA 2OTXA 5FI0A 4GPTB 4C0AA 3AU5A 1FAOA 3O96A 2BCJA 3X23A 2EC1A 3HQCA 4ZRKA 2D11A 2D2QA 2CY5A 2DHIA 2D9VA 3B77A 3SNHA 1FHOA 4HB2B 2DA0A 1LW3A 1J19A 2G35A 1P6SA 4WSFA 1XCGA 5LONB 3HK0A 1X86A 3QIJA 1V88A 1UPQA 1U2BA 2DKPA 3NWAA 3VIAA 4D0NB 2ELAA 5EFXA 5I2SA 1XX0A 2AL6A 3HIEA 2MFQA 1MK7B 3IVFA 2MKRA 3F0WA 1NI2A 2GS0A 5GOWB 5HE1A 4K2OA 2YS1A 4QXAB 2DYQA 2CRFA 3PG7A 2I1KA 4QJ4B 5C79A 2DLWA 2X18A 1ZC4B 1K5DB 2DHKA 2K00A 4ZRIA 3UZTA 1W1HA 1X11A 4B6HA 1V5UA 2CY4A 2RRFA 3HW2B 4GOUA 1ZM0A 1XODA 5JLJB 3M1IB 2RUKB 1IRSA 1V61A 4HAXB 1BTKA 4HB0B 3KY9A 4EMOA 3PEGA 2KIGA 5J3YA 2MDXA 1KI1B 4L6EA 5IRSA 3QWMA 4F7HA 1GC7A 2UZSA 5JHGA 5M4YB 1Y5OA 1U29A 2K49A 3V5WA 2I5FA 2QKLA 1AWEA 1N3HA 1OY2A 2ROVA 2RLOA 1WVHA 2DYNA 2LKOA 4HAZB 1DBHA 3A8QA 2YT0A 4TYZA 2D9YA 3U12A 4DIXA 1TQZA 4KVGB 1XD4A 4D6WA 3TVVA 3CXBB 2CAYA 4CYEA 2D9XA 1KZ7A 2Z14A 4KHAA 3WA0A 1GG3A 3FSSA 1B55A 1XR0B 2D9WA 2DN6A 3KRXA 2KCJA 2RSGA 1PFJA 4DBBA 3ZDTA 1Z87A 1V5MA 2DX5A 3G9WA 3ML4A 1SGHA 5C16A 2K2JA 5CLLB 2D9ZA 4EKUA 2YVCA 1UNPA 2E2XA 4MK0A 2GUMA 2K8EA 3PVLA 4CHMA 2VRWB 4MT7A 4XWXA 4L1RA 1MK9B 4IAPA 1J0WA 3PVUA 4HATB 3RCPA 1V5PA 2W2XC 2YRYA 3P6AA 2HTHB 1ZYIA 1U5EA 2YT2A 3DXCA 1NTYA 3SYXA 4A6HA 2FJUB 3NSUA 4KAXB 2COFA 2ELBA 2I1JA 3P7ZA 1P5TA 1PMSA 3GYOA 3MDBC 4A6FA 5DI9B 3TW1A 4PNKA 5L81A 2R0DA 1BTNA 4P7IA 3QBVB 4HDOA 2ADZA 1V89A 1FHXA 2M38A 2Z13A 2W2WA 4OSNA 1EF1A 4GMVA 2YT1A 2EMSA 3BJIA 4Z2NA 2DKQA 3KRWA 4HHVA 5DIFB 2V76A 4DX90 2N0YA 3D8DA 5DHAB 4YL8A 4KHBA 1U5FA 5KQ4A 1DDVA 2VKIA 2LOZA 1MIXA 3NW8A 1I7AA 4ZRJA 2IFSA 2UVMA 5KQ1A 5HE2A 2D10A 2P0HA 5HE0A 2YSZA 3PVWA 1ZVRA 2P8VA 4GN1A 1OQNA 3TCAA 3DXEA 4K81A 1ISNA 2K2UA 2AEHA 5I2MA 2H7DA 1MAIA 5D27A 4OT1A 3NWDA 1P3RA 1ZSQA 4A6KA 3SV1A 5J3QA 1QQGA 1TXDA 4HAUB 1MPHA 1FGZA 2ZPYA 2HE7A 3N7CA 1W1GA 1AQCA 4Y94A 5D3VA 5C5BB 3GYPA 2Z59A 4IOYX 5KCVA 5C6RA 2Z0OA 4HAYB 1EVHA 1LB1A 3KZ1A 1UEFA 1BAKA 1XKEA 2GJYA 3D8FA 4MY6A 2KR0A 1UNQA 2L2IA 4QJ5B 2COCA 5JHHA 1FB8A 5DHFB 2J0MA 3FEHA 3FVCA 2ZKMX 1U5GA 2N23A 1WGUA 2I5CA 4HDQA 3F5RA 2KGXB 2JP2A 2R2YA 1BWNA 2LG1A 2DX1A 3ODWA 1DDWA 3ULBA 1NTVA 1WJ1A 1KZGA 1PLSA 2XQNM 1DYNA 4BBKA 2RNRB 2H7EA 2Z0PA 1H4RA 1U27A 1WI1A 2EMTA 4GMXB 4CHJA 1W1DA 2R09A 2M14A 2GCJA 2Y8FA 4CSQA 3A98B 3PP2A 1NU2A 3OHMB 2CODA 3PZDA
chains in the Genus database with same CATH topology
3SUZA 2UZRA 1M7EA 4NSWA 5DH9B 2MWNB 5FI1A 1MKEA 3CIKA 3PSCA 1SHCA 5C5BA 2YS5A 1FOEA 3VOQA 2D4QA 2Y8GA 3ULCA 3ODXA 3DXDA 1UNRA 3ZVRA 1Y19B 4A5KA 1FGYA 3LJUX 3U7DA 1TJ6A 1H10A 2Y7BA 2ROZB 2NMBA 5LOPB 4WJ7A 4K2PA 3AU4A 3A8PA 1X1GA 2W2XD 3D8EA 3KSYA 1I2HA 1K5GB 3ODOA 5JP4A 1MIZB 1GC6A 2EJ8A 4F7UP 4H8SA 1UPRA 2PZ1A 4PQ0A 5D3WA 2RVBB 1ZC3B 1WJMA 2RGNB 2P0DA 5D3YA 2QKMA 3AJ4A 1RJ2A 1DROA 4GXBA 3TO1A 4DXAB 1WG7A 2OQBA 2KUPA 5J3TA 1RRPB 2J59M 3MPXA 2Q13A 2COAA 2L1CA 3WYFB 4KHOA 1X05A 2DHJA 4YONA 2YS3A 3T06A 2J0JA 1M7RA 4GZUA 4DX8A 4K17A 2GCLA 4WVFB 1FHWA 2NZ8B 4HAWB 1X1FA 4HB3B 3SO6A 2YF0A 2Z0QA 5CLQB 1EAZA 1DDMA 4A6FB 2P0FA 5HE3A 2J0KA 2LULA 2FJLA 2VSZA 5D3XA 4HAVB 2IYBA 1Q67A 2LOXA 4Z2MB 3FM8C 3TFMA 1WGQA 4HB4B 1EGXA 4KHBB 4NY0A 4TKNA 2DFKA 4IFSA 4F7GA 1U5DA 4EJNA 1QC6A 2DTCA 1E5WA 3BINA 3OANA 3U8ZA 1OMWA 2LYDA 2OTXA 5FI0A 4GPTB 4C0AA 3AU5A 1FAOA 3O96A 2BCJA 3X23A 2EC1A 3HQCA 4ZRKA 2D11A 2D2QA 2CY5A 2DHIA 2D9VA 3SNHA 1FHOA 4HB2B 2DA0A 1LW3A 1J19A 2G35A 1P6SA 4WSFA 1XCGA 5LONB 3HK0A 1X86A 3QIJA 1V88A 1UPQA 1U2BA 2DKPA 3VIAA 4D0NB 2ELAA 5EFXA 1XX0A 2AL6A 2MFQA 1MK7B 3IVFA 2MKRA 3F0WA 1NI2A 2GS0A 5GOWB 5HE1A 4K2OA 2YS1A 2DYQA 2CRFA 3PG7A 2I1KA 5C79A 2DLWA 2X18A 1ZC4B 1K5DB 2DHKA 2K00A 4ZRIA 3UZTA 1W1HA 1X11A 4B6HA 1V5UA 2CY4A 3HW2B 1ZM0A 1XODA 5JLJB 3M1IB 2RUKB 1IRSA 1V61A 4HAXB 1BTKA 4HB0B 3KY9A 4EMOA 3PEGA 5J3YA 2MDXA 1KI1B 4L6EA 3QWMA 4F7HA 1GC7A 2UZSA 5JHGA 1Y5OA 1U29A 3V5WA 2I5FA 2QKLA 1AWEA 1N3HA 1OY2A 2ROVA 2RLOA 1WVHA 2DYNA 2LKOA 4HAZB 1DBHA 3A8QA 2YT0A 4TYZA 2D9YA 1TQZA 4KVGB 1XD4A 3TVVA 3CXBB 2CAYA 4CYEA 2D9XA 1KZ7A 4KHAA 3WA0A 1GG3A 3FSSA 1B55A 1XR0B 2D9WA 2DN6A 3KRXA 2KCJA 2RSGA 1PFJA 4DBBA 3ZDTA 1Z87A 1V5MA 2DX5A 3G9WA 3ML4A 1SGHA 5C16A 2K2JA 5CLLB 2D9ZA 4EKUA 2YVCA 1UNPA 2E2XA 4MK0A 3PVLA 4CHMA 2VRWB 4MT7A 4XWXA 1MK9B 4IAPA 1J0WA 3PVUA 4HATB 3RCPA 1V5PA 2W2XC 2YRYA 3P6AA 2HTHB 1U5EA 3DXCA 1NTYA 3SYXA 4A6HA 3NSUA 4KAXB 2COFA 2ELBA 2I1JA 3P7ZA 1P5TA 1PMSA 3GYOA 3MDBC 4A6FA 5DI9B 3TW1A 4PNKA 5L81A 2R0DA 1BTNA 4P7IA 3QBVB 4HDOA 2ADZA 1V89A 1FHXA 2M38A 2W2WA 1EF1A 4GMVA 2YT1A 2EMSA 3BJIA 4Z2NA 2DKQA 3KRWA 4HHVA 5DIFB 2V76A 4DX90 2N0YA 3D8DA 5DHAB 4YL8A 1U5FA 5KQ4A 1DDVA 2VKIA 2LOZA 1MIXA 1I7AA 4ZRJA 2IFSA 2UVMA 5KQ1A 5HE2A 2D10A 2P0HA 5HE0A 2YSZA 3PVWA 1ZVRA 2P8VA 4GN1A 1OQNA 3TCAA 3DXEA 4K81A 1ISNA 2K2UA 2AEHA 2H7DA 1MAIA 5D27A 1P3RA 1ZSQA 4A6KA 3SV1A 5J3QA 1QQGA 1TXDA 4HAUB 1MPHA 1FGZA 2ZPYA 2HE7A 3N7CA 1W1GA 1AQCA 4Y94A 5D3VA 5C5BB 3GYPA 4IOYX 5KCVA 5C6RA 2Z0OA 4HAYB 1EVHA 1LB1A 3KZ1A 1UEFA 1BAKA 1XKEA 2GJYA 3D8FA 4MY6A 1UNQA 2L2IA 2COCA 5JHHA 1FB8A 5DHFB 2J0MA 3FEHA 1U5GA 2N23A 1WGUA 2I5CA 4HDQA 3F5RA 2KGXB 2JP2A 1BWNA 2LG1A 2DX1A 3ODWA 1DDWA 3ULBA 1NTVA 1WJ1A 1KZGA 1PLSA 2XQNM 1DYNA 4BBKA 2RNRB 2Z0PA 1H4RA 1U27A 1WI1A 2EMTA 2H7EA 4GMXB 4CHJA 1W1DA 2R09A 2M14A 2GCJA 2Y8FA 3A98B 3PP2A 1NU2A 2CODA 3PZDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SUZ A;  2UZR A;  1M7E A;  4NSW A;  5DH9 B;  2MWN B;  5FI1 A;  1MKE A;  3CIK A;  3PSC A;  1SHC A;  5C5B A;  2YS5 A;  1FOE A;  3VOQ A;  2D4Q A;  2Y8G A;  3ULC A;  3ODX A;  3DXD A;  1UNR A;  3ZVR A;  1Y19 B;  4A5K A;  1FGY A;  3LJU X;  3U7D A;  1TJ6 A;  1H10 A;  2Y7B A;  2ROZ B;  2NMB A;  5LOP B;  4WJ7 A;  4K2P A;  3AU4 A;  3A8P A;  1X1G A;  2W2X D;  3D8E A;  3KSY A;  1I2H A;  1K5G B;  3ODO A;  5JP4 A;  1MIZ B;  1GC6 A;  2EJ8 A;  4F7U P;  4H8S A;  1UPR A;  2PZ1 A;  4PQ0 A;  5D3W A;  2RVB B;  1ZC3 B;  1WJM A;  2RGN B;  2P0D A;  5D3Y A;  2QKM A;  3AJ4 A;  1RJ2 A;  1DRO A;  4GXB A;  3TO1 A;  4DXA B;  1WG7 A;  2OQB A;  2KUP A;  5J3T A;  1RRP B;  2J59 M;  3MPX A;  2Q13 A;  2COA A;  2L1C A;  3WYF B;  4KHO A;  1X05 A;  2DHJ A;  4YON A;  2YS3 A;  3T06 A;  2J0J A;  1M7R A;  4GZU A;  4DX8 A;  4K17 A;  2GCL A;  4WVF B;  1FHW A;  2NZ8 B;  4HAW B;  1X1F A;  4HB3 B;  3SO6 A;  2YF0 A;  2Z0Q A;  5CLQ B;  1EAZ A;  1DDM A;  4A6F B;  2P0F A;  5HE3 A;  2J0K A;  2LUL A;  2FJL A;  2VSZ A;  5D3X A;  4HAV B;  2IYB A;  1Q67 A;  2LOX A;  4Z2M B;  3FM8 C;  3TFM A;  1WGQ A;  4HB4 B;  1EGX A;  4KHB B;  4NY0 A;  4TKN A;  2DFK A;  4IFS A;  4F7G A;  1U5D A;  4EJN A;  1QC6 A;  2DTC A;  1E5W A;  3BIN A;  3OAN A;  3U8Z A;  1OMW A;  2LYD A;  2OTX A;  5FI0 A;  4GPT B;  4C0A A;  3AU5 A;  1FAO A;  3O96 A;  2BCJ A;  3X23 A;  2EC1 A;  3HQC A;  4ZRK A;  2D11 A;  2D2Q A;  2CY5 A;  2DHI A;  2D9V A;  3SNH A;  1FHO A;  4HB2 B;  2DA0 A;  1LW3 A;  1J19 A;  2G35 A;  1P6S A;  4WSF A;  1XCG A;  5LON B;  3HK0 A;  1X86 A;  3QIJ A;  1V88 A;  1UPQ A;  1U2B A;  2DKP A;  3VIA A;  4D0N B;  2ELA A;  5EFX A;  1XX0 A;  2AL6 A;  2MFQ A;  1MK7 B;  3IVF A;  2MKR A;  3F0W A;  1NI2 A;  2GS0 A;  5GOW B;  5HE1 A;  4K2O A;  2YS1 A;  2DYQ A;  2CRF A;  3PG7 A;  2I1K A;  5C79 A;  2DLW A;  2X18 A;  1ZC4 B;  1K5D B;  2DHK A;  2K00 A;  4ZRI A;  3UZT A;  1W1H A;  1X11 A;  4B6H A;  1V5U A;  2CY4 A;  3HW2 B;  1ZM0 A;  1XOD A;  5JLJ B;  3M1I B;  2RUK B;  1IRS A;  1V61 A;  4HAX B;  1BTK A;  4HB0 B;  3KY9 A;  4EMO A;  3PEG A;  5J3Y A;  2MDX A;  1KI1 B;  4L6E A;  3QWM A;  4F7H A;  1GC7 A;  2UZS A;  5JHG A;  1Y5O A;  1U29 A;  3V5W A;  2I5F A;  2QKL A;  1AWE A;  1N3H A;  1OY2 A;  2ROV A;  2RLO A;  1WVH A;  2DYN A;  2LKO A;  4HAZ B;  1DBH A;  3A8Q A;  2YT0 A;  4TYZ A;  2D9Y A;  1TQZ A;  4KVG B;  1XD4 A;  3TVV A;  3CXB B;  2CAY A;  4CYE A;  2D9X A;  1KZ7 A;  4KHA A;  3WA0 A;  1GG3 A;  3FSS A;  1B55 A;  1XR0 B;  2D9W A;  2DN6 A;  3KRX A;  2KCJ A;  2RSG A;  1PFJ A;  4DBB A;  3ZDT A;  1Z87 A;  1V5M A;  2DX5 A;  3G9W A;  3ML4 A;  1SGH A;  5C16 A;  2K2J A;  5CLL B;  2D9Z A;  4EKU A;  2YVC A;  1UNP A;  2E2X A;  4MK0 A;  3PVL A;  4CHM A;  2VRW B;  4MT7 A;  4XWX A;  1MK9 B;  4IAP A;  1J0W A;  3PVU A;  4HAT B;  3RCP A;  1V5P A;  2W2X C;  2YRY A;  3P6A A;  2HTH B;  1U5E A;  3DXC A;  1NTY A;  3SYX A;  4A6H A;  3NSU A;  4KAX B;  2COF A;  2ELB A;  2I1J A;  3P7Z A;  1P5T A;  1PMS A;  3GYO A;  3MDB C;  4A6F A;  5DI9 B;  3TW1 A;  4PNK A;  5L81 A;  2R0D A;  1BTN A;  4P7I A;  3QBV B;  4HDO A;  2ADZ A;  1V89 A;  1FHX A;  2M38 A;  2W2W A;  1EF1 A;  4GMV A;  2YT1 A;  2EMS A;  3BJI A;  4Z2N A;  2DKQ A;  3KRW A;  4HHV A;  5DIF B;  2V76 A;  4DX9 0;  2N0Y A;  3D8D A;  5DHA B;  4YL8 A;  1U5F A;  5KQ4 A;  1DDV A;  2VKI A;  2LOZ A;  1MIX A;  1I7A A;  4ZRJ A;  2IFS A;  2UVM A;  5KQ1 A;  5HE2 A;  2D10 A;  2P0H A;  5HE0 A;  2YSZ A;  3PVW A;  1ZVR A;  2P8V A;  4GN1 A;  1OQN A;  3TCA A;  3DXE A;  4K81 A;  1ISN A;  2K2U A;  2AEH A;  2H7D A;  1MAI A;  5D27 A;  1P3R A;  1ZSQ A;  4A6K A;  3SV1 A;  5J3Q A;  1QQG A;  1TXD A;  4HAU B;  1MPH A;  1FGZ A;  2ZPY A;  2HE7 A;  3N7C A;  1W1G A;  1AQC A;  4Y94 A;  5D3V A;  5C5B B;  3GYP A;  4IOY X;  5KCV A;  5C6R A;  2Z0O A;  4HAY B;  1EVH A;  1LB1 A;  3KZ1 A;  1UEF A;  1BAK A;  1XKE A;  2GJY A;  3D8F A;  4MY6 A;  1UNQ A;  2L2I A;  2COC A;  5JHH A;  1FB8 A;  5DHF B;  2J0M A;  3FEH A;  1U5G A;  2N23 A;  1WGU A;  2I5C A;  4HDQ A;  3F5R A;  2KGX B;  2JP2 A;  1BWN A;  2LG1 A;  2DX1 A;  3ODW A;  1DDW A;  3ULB A;  1NTV A;  1WJ1 A;  1KZG A;  1PLS A;  2XQN M;  1DYN A;  4BBK A;  2RNR B;  2Z0P A;  1H4R A;  1U27 A;  1WI1 A;  2EMT A;  2H7E A;  4GMX B;  4CHJ A;  1W1D A;  2R09 A;  2M14 A;  2GCJ A;  2Y8F A;  3A98 B;  3PP2 A;  1NU2 A;  2COD A;  3PZD A; 
#chains in the Genus database with same CATH topology
 3SUZ A;  2UZR A;  1M7E A;  4NSW A;  5DH9 B;  2MWN B;  5FI1 A;  1MKE A;  3CIK A;  3PSC A;  1SHC A;  5C5B A;  2YS5 A;  1FOE A;  3VOQ A;  5LG4 B;  2D4Q A;  4GNK B;  2Y8G A;  3ULC A;  3ODX A;  2KIE A;  3DXD A;  1UNR A;  3ZVR A;  1Y19 B;  1T77 A;  4A5K A;  1FGY A;  3LJU X;  3U7D A;  1TJ6 A;  1H10 A;  2Y7B A;  3HSA A;  2ROZ B;  2NMB A;  5LOP B;  4WJ7 A;  4K2P A;  3AU4 A;  3A8P A;  1X1G A;  2W2X D;  3D8E A;  3KSY A;  3A58 A;  1I2H A;  1K5G B;  3ODO A;  5JP4 A;  1MIZ B;  4HSI A;  1GC6 A;  2EJ8 A;  4F7U P;  4H8S A;  1UPR A;  2PZ1 A;  4PQ0 A;  5D3W A;  2RVB B;  1ZC3 B;  1WJM A;  2RGN B;  4QJ3 B;  2P0D A;  5D3Y A;  2QKM A;  3AJ4 A;  1RJ2 A;  1DRO A;  2NBV A;  4GXB A;  3TO1 A;  4DXA B;  1WG7 A;  2OQB A;  2KUP A;  5J3T A;  1RRP B;  2J59 M;  1MI1 A;  3MPX A;  2Q13 A;  2COA A;  2L1C A;  3WYF B;  4KHO A;  3NWF A;  1X05 A;  2DHJ A;  4YON A;  2YS3 A;  3T06 A;  2J0J A;  1M7R A;  4GZU A;  4DX8 A;  4K17 A;  2GCL A;  4WVF B;  1FHW A;  2NZ8 B;  4HAW B;  1X1F A;  4HB3 B;  3SO6 A;  2YF0 A;  2Z0Q A;  5CLQ B;  1EAZ A;  1DDM A;  4A6F B;  2P0F A;  5HE3 A;  2J0K A;  2LUL A;  2FJL A;  2VSZ A;  5D3X A;  4HAV B;  2IYB A;  1Q67 A;  2LOX A;  4Z2M B;  2KUQ A;  3FM8 C;  3TFM A;  1WGQ A;  4HB4 B;  1EGX A;  4KHB B;  4NY0 A;  4TKN A;  2DFK A;  3DCX A;  4IFS A;  4F7G A;  1U5D A;  4EJN A;  1QC6 A;  2DTC A;  2Z4D A;  1E5W A;  3BIN A;  3OAN A;  3U8Z A;  1OMW A;  2LYD A;  2OTX A;  5FI0 A;  4GPT B;  4C0A A;  3AU5 A;  1FAO A;  3O96 A;  2BCJ A;  3X23 A;  2EC1 A;  3HQC A;  4ZRK A;  2D11 A;  2D2Q A;  2CY5 A;  2DHI A;  2D9V A;  3B77 A;  3SNH A;  1FHO A;  4HB2 B;  2DA0 A;  1LW3 A;  1J19 A;  2G35 A;  1P6S A;  4WSF A;  1XCG A;  5LON B;  3HK0 A;  1X86 A;  3QIJ A;  1V88 A;  1UPQ A;  1U2B A;  2DKP A;  3NWA A;  3VIA A;  4D0N B;  2ELA A;  5EFX A;  5I2S A;  1XX0 A;  2AL6 A;  3HIE A;  2MFQ A;  1MK7 B;  3IVF A;  2MKR A;  3F0W A;  1NI2 A;  2GS0 A;  5GOW B;  5HE1 A;  4K2O A;  2YS1 A;  4QXA B;  2DYQ A;  2CRF A;  3PG7 A;  2I1K A;  4QJ4 B;  5C79 A;  2DLW A;  2X18 A;  1ZC4 B;  1K5D B;  2DHK A;  2K00 A;  4ZRI A;  3UZT A;  1W1H A;  1X11 A;  4B6H A;  1V5U A;  2CY4 A;  2RRF A;  3HW2 B;  4GOU A;  1ZM0 A;  1XOD A;  5JLJ B;  3M1I B;  2RUK B;  1IRS A;  1V61 A;  4HAX B;  1BTK A;  4HB0 B;  3KY9 A;  4EMO A;  3PEG A;  2KIG A;  5J3Y A;  2MDX A;  1KI1 B;  4L6E A;  5IRS A;  3QWM A;  4F7H A;  1GC7 A;  2UZS A;  5JHG A;  5M4Y B;  1Y5O A;  1U29 A;  2K49 A;  3V5W A;  2I5F A;  2QKL A;  1AWE A;  1N3H A;  1OY2 A;  2ROV A;  2RLO A;  1WVH A;  2DYN A;  2LKO A;  4HAZ B;  1DBH A;  3A8Q A;  2YT0 A;  4TYZ A;  2D9Y A;  3U12 A;  4DIX A;  1TQZ A;  4KVG B;  1XD4 A;  4D6W A;  3TVV A;  3CXB B;  2CAY A;  4CYE A;  2D9X A;  1KZ7 A;  2Z14 A;  4KHA A;  3WA0 A;  1GG3 A;  3FSS A;  1B55 A;  1XR0 B;  2D9W A;  2DN6 A;  3KRX A;  2KCJ A;  2RSG A;  1PFJ A;  4DBB A;  3ZDT A;  1Z87 A;  1V5M A;  2DX5 A;  3G9W A;  3ML4 A;  1SGH A;  5C16 A;  2K2J A;  5CLL B;  2D9Z A;  4EKU A;  2YVC A;  1UNP A;  2E2X A;  4MK0 A;  2GUM A;  2K8E A;  3PVL A;  4CHM A;  2VRW B;  4MT7 A;  4XWX A;  4L1R A;  1MK9 B;  4IAP A;  1J0W A;  3PVU A;  4HAT B;  3RCP A;  1V5P A;  2W2X C;  2YRY A;  3P6A A;  2HTH B;  1ZYI A;  1U5E A;  2YT2 A;  3DXC A;  1NTY A;  3SYX A;  4A6H A;  2FJU B;  3NSU A;  4KAX B;  2COF A;  2ELB A;  2I1J A;  3P7Z A;  1P5T A;  1PMS A;  3GYO A;  3MDB C;  4A6F A;  5DI9 B;  3TW1 A;  4PNK A;  5L81 A;  2R0D A;  1BTN A;  4P7I A;  3QBV B;  4HDO A;  2ADZ A;  1V89 A;  1FHX A;  2M38 A;  2Z13 A;  2W2W A;  4OSN A;  1EF1 A;  4GMV A;  2YT1 A;  2EMS A;  3BJI A;  4Z2N A;  2DKQ A;  3KRW A;  4HHV A;  5DIF B;  2V76 A;  4DX9 0;  2N0Y A;  3D8D A;  5DHA B;  4YL8 A;  4KHB A;  1U5F A;  5KQ4 A;  1DDV A;  2VKI A;  2LOZ A;  1MIX A;  3NW8 A;  1I7A A;  4ZRJ A;  2IFS A;  2UVM A;  5KQ1 A;  5HE2 A;  2D10 A;  2P0H A;  5HE0 A;  2YSZ A;  3PVW A;  1ZVR A;  2P8V A;  4GN1 A;  1OQN A;  3TCA A;  3DXE A;  4K81 A;  1ISN A;  2K2U A;  2AEH A;  5I2M A;  2H7D A;  1MAI A;  5D27 A;  4OT1 A;  3NWD A;  1P3R A;  1ZSQ A;  4A6K A;  3SV1 A;  5J3Q A;  1QQG A;  1TXD A;  4HAU B;  1MPH A;  1FGZ A;  2ZPY A;  2HE7 A;  3N7C A;  1W1G A;  1AQC A;  4Y94 A;  5D3V A;  5C5B B;  3GYP A;  2Z59 A;  4IOY X;  5KCV A;  5C6R A;  2Z0O A;  4HAY B;  1EVH A;  1LB1 A;  3KZ1 A;  1UEF A;  1BAK A;  1XKE A;  2GJY A;  3D8F A;  4MY6 A;  2KR0 A;  1UNQ A;  2L2I A;  4QJ5 B;  2COC A;  5JHH A;  1FB8 A;  5DHF B;  2J0M A;  3FEH A;  3FVC A;  2ZKM X;  1U5G A;  2N23 A;  1WGU A;  2I5C A;  4HDQ A;  3F5R A;  2KGX B;  2JP2 A;  2R2Y A;  1BWN A;  2LG1 A;  2DX1 A;  3ODW A;  1DDW A;  3ULB A;  1NTV A;  1WJ1 A;  1KZG A;  1PLS A;  2XQN M;  1DYN A;  4BBK A;  2RNR B;  2H7E A;  2Z0P A;  1H4R A;  1U27 A;  1WI1 A;  2EMT A;  4GMX B;  4CHJ A;  1W1D A;  2R09 A;  2M14 A;  2GCJ A;  2Y8F A;  4CSQ A;  3A98 B;  3PP2 A;  1NU2 A;  3OHM B;  2COD A;  3PZD A; 
#chains in the Genus database with same CATH homology
 3SUZ A;  2UZR A;  1M7E A;  4NSW A;  5DH9 B;  2MWN B;  5FI1 A;  1MKE A;  3CIK A;  3PSC A;  1SHC A;  5C5B A;  2YS5 A;  1FOE A;  3VOQ A;  2D4Q A;  2Y8G A;  3ULC A;  3ODX A;  3DXD A;  1UNR A;  3ZVR A;  1Y19 B;  4A5K A;  1FGY A;  3LJU X;  3U7D A;  1TJ6 A;  1H10 A;  2Y7B A;  2ROZ B;  2NMB A;  5LOP B;  4WJ7 A;  4K2P A;  3AU4 A;  3A8P A;  1X1G A;  2W2X D;  3D8E A;  3KSY A;  1I2H A;  1K5G B;  3ODO A;  5JP4 A;  1MIZ B;  1GC6 A;  2EJ8 A;  4F7U P;  4H8S A;  1UPR A;  2PZ1 A;  4PQ0 A;  5D3W A;  2RVB B;  1ZC3 B;  1WJM A;  2RGN B;  2P0D A;  5D3Y A;  2QKM A;  3AJ4 A;  1RJ2 A;  1DRO A;  4GXB A;  3TO1 A;  4DXA B;  1WG7 A;  2OQB A;  2KUP A;  5J3T A;  1RRP B;  2J59 M;  3MPX A;  2Q13 A;  2COA A;  2L1C A;  3WYF B;  4KHO A;  1X05 A;  2DHJ A;  4YON A;  2YS3 A;  3T06 A;  2J0J A;  1M7R A;  4GZU A;  4DX8 A;  4K17 A;  2GCL A;  4WVF B;  1FHW A;  2NZ8 B;  4HAW B;  1X1F A;  4HB3 B;  3SO6 A;  2YF0 A;  2Z0Q A;  5CLQ B;  1EAZ A;  1DDM A;  4A6F B;  2P0F A;  5HE3 A;  2J0K A;  2LUL A;  2FJL A;  2VSZ A;  5D3X A;  4HAV B;  2IYB A;  1Q67 A;  2LOX A;  4Z2M B;  3FM8 C;  3TFM A;  1WGQ A;  4HB4 B;  1EGX A;  4KHB B;  4NY0 A;  4TKN A;  2DFK A;  4IFS A;  4F7G A;  1U5D A;  4EJN A;  1QC6 A;  2DTC A;  1E5W A;  3BIN A;  3OAN A;  3U8Z A;  1OMW A;  2LYD A;  2OTX A;  5FI0 A;  4GPT B;  4C0A A;  3AU5 A;  1FAO A;  3O96 A;  2BCJ A;  3X23 A;  2EC1 A;  3HQC A;  4ZRK A;  2D11 A;  2D2Q A;  2CY5 A;  2DHI A;  2D9V A;  3SNH A;  1FHO A;  4HB2 B;  2DA0 A;  1LW3 A;  1J19 A;  2G35 A;  1P6S A;  4WSF A;  1XCG A;  5LON B;  3HK0 A;  1X86 A;  3QIJ A;  1V88 A;  1UPQ A;  1U2B A;  2DKP A;  3VIA A;  4D0N B;  2ELA A;  5EFX A;  1XX0 A;  2AL6 A;  2MFQ A;  1MK7 B;  3IVF A;  2MKR A;  3F0W A;  1NI2 A;  2GS0 A;  5GOW B;  5HE1 A;  4K2O A;  2YS1 A;  2DYQ A;  2CRF A;  3PG7 A;  2I1K A;  5C79 A;  2DLW A;  2X18 A;  1ZC4 B;  1K5D B;  2DHK A;  2K00 A;  4ZRI A;  3UZT A;  1W1H A;  1X11 A;  4B6H A;  1V5U A;  2CY4 A;  3HW2 B;  1ZM0 A;  1XOD A;  5JLJ B;  3M1I B;  2RUK B;  1IRS A;  1V61 A;  4HAX B;  1BTK A;  4HB0 B;  3KY9 A;  4EMO A;  3PEG A;  5J3Y A;  2MDX A;  1KI1 B;  4L6E A;  3QWM A;  4F7H A;  1GC7 A;  2UZS A;  5JHG A;  1Y5O A;  1U29 A;  3V5W A;  2I5F A;  2QKL A;  1AWE A;  1N3H A;  1OY2 A;  2ROV A;  2RLO A;  1WVH A;  2DYN A;  2LKO A;  4HAZ B;  1DBH A;  3A8Q A;  2YT0 A;  4TYZ A;  2D9Y A;  1TQZ A;  4KVG B;  1XD4 A;  3TVV A;  3CXB B;  2CAY A;  4CYE A;  2D9X A;  1KZ7 A;  4KHA A;  3WA0 A;  1GG3 A;  3FSS A;  1B55 A;  1XR0 B;  2D9W A;  2DN6 A;  3KRX A;  2KCJ A;  2RSG A;  1PFJ A;  4DBB A;  3ZDT A;  1Z87 A;  1V5M A;  2DX5 A;  3G9W A;  3ML4 A;  1SGH A;  5C16 A;  2K2J A;  5CLL B;  2D9Z A;  4EKU A;  2YVC A;  1UNP A;  2E2X A;  4MK0 A;  3PVL A;  4CHM A;  2VRW B;  4MT7 A;  4XWX A;  1MK9 B;  4IAP A;  1J0W A;  3PVU A;  4HAT B;  3RCP A;  1V5P A;  2W2X C;  2YRY A;  3P6A A;  2HTH B;  1U5E A;  3DXC A;  1NTY A;  3SYX A;  4A6H A;  3NSU A;  4KAX B;  2COF A;  2ELB A;  2I1J A;  3P7Z A;  1P5T A;  1PMS A;  3GYO A;  3MDB C;  4A6F A;  5DI9 B;  3TW1 A;  4PNK A;  5L81 A;  2R0D A;  1BTN A;  4P7I A;  3QBV B;  4HDO A;  2ADZ A;  1V89 A;  1FHX A;  2M38 A;  2W2W A;  1EF1 A;  4GMV A;  2YT1 A;  2EMS A;  3BJI A;  4Z2N A;  2DKQ A;  3KRW A;  4HHV A;  5DIF B;  2V76 A;  4DX9 0;  2N0Y A;  3D8D A;  5DHA B;  4YL8 A;  1U5F A;  5KQ4 A;  1DDV A;  2VKI A;  2LOZ A;  1MIX A;  1I7A A;  4ZRJ A;  2IFS A;  2UVM A;  5KQ1 A;  5HE2 A;  2D10 A;  2P0H A;  5HE0 A;  2YSZ A;  3PVW A;  1ZVR A;  2P8V A;  4GN1 A;  1OQN A;  3TCA A;  3DXE A;  4K81 A;  1ISN A;  2K2U A;  2AEH A;  2H7D A;  1MAI A;  5D27 A;  1P3R A;  1ZSQ A;  4A6K A;  3SV1 A;  5J3Q A;  1QQG A;  1TXD A;  4HAU B;  1MPH A;  1FGZ A;  2ZPY A;  2HE7 A;  3N7C A;  1W1G A;  1AQC A;  4Y94 A;  5D3V A;  5C5B B;  3GYP A;  4IOY X;  5KCV A;  5C6R A;  2Z0O A;  4HAY B;  1EVH A;  1LB1 A;  3KZ1 A;  1UEF A;  1BAK A;  1XKE A;  2GJY A;  3D8F A;  4MY6 A;  1UNQ A;  2L2I A;  2COC A;  5JHH A;  1FB8 A;  5DHF B;  2J0M A;  3FEH A;  1U5G A;  2N23 A;  1WGU A;  2I5C A;  4HDQ A;  3F5R A;  2KGX B;  2JP2 A;  1BWN A;  2LG1 A;  2DX1 A;  3ODW A;  1DDW A;  3ULB A;  1NTV A;  1WJ1 A;  1KZG A;  1PLS A;  2XQN M;  1DYN A;  4BBK A;  2RNR B;  2Z0P A;  1H4R A;  1U27 A;  1WI1 A;  2EMT A;  2H7E A;  4GMX B;  4CHJ A;  1W1D A;  2R09 A;  2M14 A;  2GCJ A;  2Y8F A;  3A98 B;  3PP2 A;  1NU2 A;  2COD A;  3PZD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...