1PMSA

Pleckstrin homology domain of son of sevenless 1 (sos1) with glycine-serine added to the n-terminus, nmr, 20 structures
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
135
structure length
135
Chain Sequence
b'SKQLAIKKMNEIQKNIDGWEGKDIGQCCNEFIMEGTLTRVGAKHERHIFLFDGLMICCKSNHGQPRLPGASSAEYRLKEKFFMRKVQINDKDDTSEYKHAFEIILKDGNSVIFSAKSAEEKNNWMAALISLQYRS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords SOS 1
publication title The solution structure of the pleckstrin homology domain of mouse Son-of-sevenless 1 (mSos1).
pubmed doi rcsb
source organism Mus musculus
molecule tags Signal transduction
total genus 14
structure length 135
sequence length 135
ec nomenclature
pdb deposition date 1997-02-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00169 PH PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1pmsA00
2AEHA 2VKIA 3DXDA 2GJYA 3WYFB 2CY5A 2Y8GA 1KZGA 3KRXA 1U27A 1FHOA 3V5WA 1X11A 2RSGA 2DKPA 2H7DA 1AWEA 4CHJA 4TYZA 1H10A 2KGXB 4HAWB 2GCLA 1U5DA 1GC6A 4NY0A 2UZSA 1RJ2A 1UPQA 3BINA 2PZ1A 3CXBB 2MFQA 1X05A 5D3XA 2P8VA 1BTKA 2D4QA 2DYQA 2ROZB 3DXEA 2L1CA 2Q13A 2D9ZA 2EMTA 2ZPYA 1WJ1A 1P6SA 1KI1B 2LYDA 2YT1A 4CYEA 3VIAA 2P0FA 1AQCA 2EC1A 2LOZA 3KZ1A 4K17A 5DHFB 3ZVRA 5J3YA 4EJNA 2W2XD 4P7IA 1U5EA 4C0AA 1DROA 2GS0A 3IVFA 2D11A 3QBVB 4EMOA 2H7EA 2JP2A 1XR0B 2KUPA 2I1JA 2MDXA 3FM8C 5DI9B 1XKEA 2NZ8B 1FAOA 2K00A 3G9WA 1Q67A 2CY4A 2DLWA 2CAYA 2P0DA 2DTCA 5KQ4A 3ODXA 1MK7B 3O96A 2D2QA 3AJ4A 2DHIA 1TQZA 1WVHA 1X1FA 2DHKA 4K2PA 2DKQA 5CLLB 1J0WA 3KRWA 4KAXB 4HB0B 2DX1A 2YF0A 2CRFA 1J19A 1DDVA 3ML4A 4IOYX 2Y7BA 5HE0A 1BTNA 1K5GB 3A98B 3PG7A 2K2UA 5JHHA 5DH9B 2GCJA 1BWNA 1PMSA 3GYPA 1FHXA 2YVCA 1NTYA 1ZVRA 4ZRJA 1P3RA 1V5PA 1OQNA 2OTXA 5EFXA 4H8SA 4HAZB 2YSZA 1WI1A 1DDWA 3M1IB 4L6EA 4MK0A 2K2JA 1UNRA 2IYBA 3GYOA 2M14A 1N3HA 4A6KA 2Y8FA 1DYNA 1GG3A 4HAUB 2YS5A 4K2OA 2J0MA 3QIJA 1ZC4B 2NMBA 1NI2A 1OY2A 1DBHA 1UNPA 5KQ1A 4F7UP 4D0NB 4ZRKA 4IAPA 3ODWA 1W1DA 2V76A 1EF1A 5FI0A 1Y5OA 1WG7A 2Z0QA 1H4RA 2ELAA 3HK0A 3P7ZA 1M7EA 1U5GA 2HE7A 2COFA 3T06A 4HB3B 5D27A 1LB1A 2D9WA 2R09A 3ULBA 1V61A 1ISNA 4Y94A 4DX90 2QKLA 2EMSA 1SHCA 2DA0A 3PVWA 1XX0A 1UNQA 1V88A 4NSWA 2RVBB 4HAYB 1XCGA 2R0DA 1UEFA 4Z2MB 2LOXA 3ODOA 2D9XA 2M38A 2I1KA 4HB2B 3SNHA 2VRWB 2J0JA 5D3WA 5LONB 2ELBA 1X1GA 4KHBB 4MY6A 3N7CA 3TW1A 4IFSA 4A6HA 1ZSQA 2I5CA 1XODA 1MKEA 1E5WA 5JLJB 3A8QA 1MAIA 3SO6A 1MIZB 4GMVA 2G35A 2BCJA 3HQCA 3F5RA 4PQ0A 2KCJA 3PVUA 5JP4A 2J0KA 2X18A 1MIXA 4DX8A 3SV1A 2XQNM 2LKOA 2ADZA 1SGHA 3D8DA 5HE2A 3LJUX 3PEGA 2YT0A 3RCPA 2P0HA 3P6AA 1I7AA 4KVGB 1EVHA 3KY9A 2YRYA 3PZDA 3NSUA 4WSFA 1FB8A 3ZDTA 2RLOA 2MWNB 5CLQB 5DIFB 1MPHA 1UPRA 2Z0OA 4HB4B 2DN6A 3F0WA 3U7DA 1B55A 1WGQA 1QQGA 4Z2NA 1V89A 4KHAA 2E2XA 4KHOA 3FEHA 3SUZA 5KCVA 2CODA 1ZM0A 3VOQA 3BJIA 1IRSA 1LW3A 1MK9B 4EKUA 4XWXA 3AU4A 1EAZA 5D3YA 3OANA 2IFSA 3QWMA 2LG1A 1NU2A 3U8ZA 4F7GA 2COAA 3MDBC 4A6FB 4GMXB 3WA0A 1PLSA 4DBBA 2FJLA 3D8EA 2LULA 3SYXA 1FGZA 2OQBA 3HW2B 1K5DB 2W2XC 1U2BA 4ZRIA 5HE3A 1WJMA 4GN1A 2W2WA 3AU5A 3TVVA 1I2HA 4GZUA 3ULCA 4HAXB 2D9YA 1U5FA 3KSYA 1ZC3B 1W1HA 3TCAA 1BAKA 1Y19B 2Z0PA 1RRPB 4GXBA 5GOWB 5LOPB 4K81A 3A8PA 4HAVB 2QKMA 2AL6A 4YONA 5C5BB 2DHJA 2D10A 3TO1A 1M7RA 2DFKA 3UZTA 5C16A 1FOEA 2N23A 1KZ7A 5FI1A 2EJ8A 1OMWA 1XD4A 5D3VA 4HDOA 3PP2A 1X86A 2ROVA 4A6FA 3D8FA 1FHWA 1P5TA 1W1GA 1TXDA 4CHMA 2N0YA 2DX5A 1V5MA 3MPXA 1NTVA 4HDQA 1TJ6A 1GC7A 5DHAB 2YS3A 2RNRB 4F7HA 4PNKA 5JHGA 4DXAB 4YL8A 2D9VA 2YS1A 1V5UA 1Z87A 5J3QA 4A5KA 3TFMA 5C79A 1DDMA 2MKRA 4BBKA 5L81A 2RGNB 4WJ7A 3DXCA 3PSCA 4MT7A 4WVFB 1PFJA 1U29A 2UVMA 5C5BA 5C6RA 4B6HA 2RUKB 5HE1A 4GPTB 2DYNA 3PVLA 3CIKA 4HATB 3FSSA 3X23A 1QC6A 4HHVA 2L2IA 2J59M 1WGUA 2UZRA 5J3TA 2COCA 2HTHB 2VSZA 2I5FA 1FGYA 1EGXA 4TKNA
chains in the Genus database with same CATH superfamily
2AEHA 2VKIA 3DXDA 2GJYA 3WYFB 2CY5A 2Y8GA 1KZGA 3KRXA 1U27A 1FHOA 3V5WA 1X11A 2RSGA 2DKPA 2H7DA 1AWEA 4CHJA 4TYZA 1H10A 2KGXB 4HAWB 2GCLA 1U5DA 2KIEA 1GC6A 4NY0A 2UZSA 1RJ2A 1UPQA 3BINA 2PZ1A 3CXBB 2MFQA 4L1RA 3FVCA 1X05A 5D3XA 2P8VA 1BTKA 2D4QA 2DYQA 2ROZB 3DXEA 2R2YA 2L1CA 2Q13A 2D9ZA 2EMTA 2ZPYA 1WJ1A 1P6SA 1KI1B 2LYDA 2YT1A 4CYEA 2K8EA 3VIAA 2P0FA 1AQCA 4HSIA 2KIGA 2EC1A 2LOZA 3KZ1A 4K17A 5DHFB 3ZVRA 3NW8A 5J3YA 4EJNA 2W2XD 4P7IA 1U5EA 3B77A 4C0AA 1DROA 2GS0A 3IVFA 2D11A 3QBVB 4EMOA 2H7EA 3U12A 2JP2A 1XR0B 2KUPA 2I1JA 2MDXA 3FM8C 5DI9B 1XKEA 2NZ8B 5I2MA 1FAOA 2K00A 3G9WA 4OSNA 1Q67A 2CY4A 2DLWA 2CAYA 2P0DA 2DTCA 5M4YB 5KQ4A 3ODXA 2YT2A 1MK7B 3O96A 2D2QA 3AJ4A 2DHIA 1TQZA 1WVHA 1X1FA 2K49A 2DHKA 4K2PA 2DKQA 5CLLB 1J0WA 3KRWA 4KAXB 4GNKB 4HB0B 2DX1A 2YF0A 2CRFA 1J19A 3A58A 1DDVA 3ML4A 4IOYX 2KR0A 2Y7BA 5HE0A 1BTNA 1K5GB 3A98B 3PG7A 2K2UA 5JHHA 5DH9B 2GCJA 1BWNA 1PMSA 3GYPA 1FHXA 2YVCA 1NTYA 1ZVRA 1ZYIA 5LG4B 4ZRJA 1P3RA 1V5PA 1OQNA 2OTXA 5EFXA 4H8SA 4KHBA 5IRSA 4HAZB 2YSZA 1WI1A 1DDWA 3M1IB 4L6EA 2RRFA 4MK0A 2K2JA 1UNRA 2IYBA 3GYOA 2M14A 1N3HA 4A6KA 2Y8FA 1DYNA 1GG3A 4HAUB 1T77A 2YS5A 4K2OA 2J0MA 3QIJA 1ZC4B 2NMBA 1NI2A 1OY2A 1DBHA 1UNPA 5KQ1A 4F7UP 4D0NB 4ZRKA 4IAPA 3ODWA 1W1DA 2V76A 1EF1A 5FI0A 1Y5OA 1WG7A 2Z0QA 1H4RA 2ELAA 4QJ4B 2Z13A 3HK0A 3P7ZA 1M7EA 1U5GA 2HE7A 2COFA 3T06A 4DIXA 4D6WA 4HB3B 5D27A 1LB1A 2D9WA 2R09A 3ULBA 1V61A 1ISNA 4Y94A 4DX90 2QKLA 2EMSA 1SHCA 2DA0A 3PVWA 1XX0A 1UNQA 1V88A 4NSWA 2RVBB 4HAYB 1XCGA 2R0DA 2Z4DA 1UEFA 4Z2MB 2LOXA 3ODOA 2D9XA 2M38A 2I1KA 4HB2B 3SNHA 2VRWB 2J0JA 3HSAA 5D3WA 5LONB 2ELBA 1X1GA 4KHBB 4QJ3B 4MY6A 3N7CA 3TW1A 4IFSA 4A6HA 1ZSQA 2I5CA 1MI1A 3OHMB 1XODA 3DCXA 1MKEA 1E5WA 5JLJB 3A8QA 1MAIA 3SO6A 1MIZB 4GMVA 2G35A 2BCJA 3HQCA 3F5RA 4QJ5B 2NBVA 4PQ0A 2KCJA 3PVUA 5JP4A 2J0KA 2X18A 1MIXA 4DX8A 3SV1A 2XQNM 2LKOA 2ADZA 1SGHA 3NWFA 3D8DA 5HE2A 3LJUX 3PEGA 2YT0A 3RCPA 2P0HA 3P6AA 1I7AA 4KVGB 1EVHA 3KY9A 2YRYA 3PZDA 3NSUA 4WSFA 1FB8A 3ZDTA 2RLOA 2MWNB 5CLQB 5DIFB 1MPHA 1UPRA 2Z0OA 4HB4B 2DN6A 3F0WA 3U7DA 1B55A 1WGQA 1QQGA 4Z2NA 1V89A 4KHAA 2E2XA 4KHOA 3FEHA 3SUZA 5KCVA 2CODA 4CSQA 1ZM0A 3VOQA 3BJIA 1IRSA 1LW3A 1MK9B 4EKUA 4XWXA 3AU4A 1EAZA 5D3YA 3OANA 2IFSA 3QWMA 2LG1A 1NU2A 3U8ZA 4F7GA 2COAA 3MDBC 4A6FB 4GMXB 3WA0A 1PLSA 4DBBA 2FJLA 3D8EA 2LULA 3SYXA 1FGZA 2OQBA 3HW2B 1K5DB 2W2XC 1U2BA 4ZRIA 4GOUA 5HE3A 1WJMA 4GN1A 2W2WA 3AU5A 3TVVA 1I2HA 4GZUA 3ULCA 4HAXB 2D9YA 1U5FA 3KSYA 1ZC3B 1W1HA 3TCAA 1BAKA 1Y19B 2Z0PA 1RRPB 2GUMA 4GXBA 5GOWB 5LOPB 2FJUB 4K81A 3A8PA 4HAVB 2QKMA 2AL6A 4YONA 5C5BB 2DHJA 2KUQA 2D10A 3TO1A 1M7RA 2DFKA 3UZTA 3NWDA 5C16A 2Z59A 1FOEA 4OT1A 2N23A 1KZ7A 5FI1A 2EJ8A 1OMWA 1XD4A 5D3VA 4HDOA 3PP2A 1X86A 2ROVA 4A6FA 3D8FA 1FHWA 1P5TA 1W1GA 1TXDA 4CHMA 2N0YA 2DX5A 1V5MA 3MPXA 1NTVA 4HDQA 1TJ6A 2Z14A 1GC7A 5DHAB 2YS3A 2RNRB 2ZKMX 4F7HA 4PNKA 3HIEA 5JHGA 4DXAB 4YL8A 2D9VA 2YS1A 1V5UA 1Z87A 5J3QA 4A5KA 3TFMA 5C79A 1DDMA 2MKRA 4BBKA 5L81A 2RGNB 4WJ7A 3NWAA 3DXCA 3PSCA 4MT7A 4WVFB 1PFJA 1U29A 2UVMA 5C5BA 5C6RA 4B6HA 2RUKB 5HE1A 4GPTB 2DYNA 3PVLA 3CIKA 4HATB 3FSSA 3X23A 4QXAB 1QC6A 4HHVA 2L2IA 2J59M 5I2SA 1WGUA 2UZRA 5J3TA 2COCA 2HTHB 2VSZA 2I5FA 1FGYA 1EGXA 4TKNA
chains in the Genus database with same CATH topology
2AEHA 2VKIA 3DXDA 2GJYA 3WYFB 2CY5A 2Y8GA 1KZGA 3KRXA 1U27A 1FHOA 3V5WA 1X11A 2RSGA 2DKPA 2H7DA 1AWEA 4CHJA 4TYZA 1H10A 2KGXB 4HAWB 2GCLA 1U5DA 1GC6A 4NY0A 2UZSA 1RJ2A 1UPQA 3BINA 2PZ1A 3CXBB 2MFQA 1X05A 5D3XA 2P8VA 1BTKA 2D4QA 2DYQA 2ROZB 3DXEA 2L1CA 2Q13A 2D9ZA 2EMTA 2ZPYA 1WJ1A 1P6SA 1KI1B 2LYDA 2YT1A 4CYEA 3VIAA 2P0FA 1AQCA 2EC1A 2LOZA 3KZ1A 4K17A 5DHFB 3ZVRA 5J3YA 4EJNA 2W2XD 4P7IA 1U5EA 4C0AA 1DROA 2GS0A 3IVFA 2D11A 3QBVB 4EMOA 2H7EA 2JP2A 1XR0B 2KUPA 2I1JA 2MDXA 3FM8C 5DI9B 1XKEA 2NZ8B 1FAOA 2K00A 3G9WA 1Q67A 2CY4A 2DLWA 2CAYA 2P0DA 2DTCA 5KQ4A 3ODXA 1MK7B 3O96A 2D2QA 3AJ4A 2DHIA 1TQZA 1WVHA 1X1FA 2DHKA 4K2PA 2DKQA 5CLLB 1J0WA 3KRWA 4KAXB 4HB0B 2DX1A 2YF0A 2CRFA 1J19A 1DDVA 3ML4A 4IOYX 2Y7BA 5HE0A 1BTNA 1K5GB 3A98B 3PG7A 2K2UA 5JHHA 5DH9B 2GCJA 1BWNA 1PMSA 3GYPA 1FHXA 2YVCA 1NTYA 1ZVRA 4ZRJA 1P3RA 1V5PA 1OQNA 2OTXA 5EFXA 4H8SA 4HAZB 2YSZA 1WI1A 1DDWA 3M1IB 4L6EA 4MK0A 2K2JA 1UNRA 2IYBA 3GYOA 2M14A 1N3HA 4A6KA 2Y8FA 1DYNA 1GG3A 4HAUB 2YS5A 4K2OA 2J0MA 3QIJA 1ZC4B 2NMBA 1NI2A 1OY2A 1DBHA 1UNPA 5KQ1A 4F7UP 4D0NB 4ZRKA 4IAPA 3ODWA 1W1DA 2V76A 1EF1A 5FI0A 1Y5OA 1WG7A 2Z0QA 1H4RA 2ELAA 3HK0A 3P7ZA 1M7EA 1U5GA 2HE7A 2COFA 3T06A 4HB3B 5D27A 1LB1A 2D9WA 2R09A 3ULBA 1V61A 1ISNA 4Y94A 4DX90 2QKLA 2EMSA 1SHCA 2DA0A 3PVWA 1XX0A 1UNQA 1V88A 4NSWA 2RVBB 4HAYB 1XCGA 2R0DA 1UEFA 4Z2MB 2LOXA 3ODOA 2D9XA 2M38A 2I1KA 4HB2B 3SNHA 2VRWB 2J0JA 5D3WA 5LONB 2ELBA 1X1GA 4KHBB 4MY6A 3N7CA 3TW1A 4IFSA 4A6HA 1ZSQA 2I5CA 1XODA 1MKEA 1E5WA 5JLJB 3A8QA 1MAIA 3SO6A 1MIZB 4GMVA 2G35A 2BCJA 3HQCA 3F5RA 4PQ0A 2KCJA 3PVUA 5JP4A 2J0KA 2X18A 1MIXA 4DX8A 3SV1A 2XQNM 2LKOA 2ADZA 1SGHA 3D8DA 5HE2A 3LJUX 3PEGA 2YT0A 3RCPA 2P0HA 3P6AA 1I7AA 4KVGB 1EVHA 3KY9A 2YRYA 3PZDA 3NSUA 4WSFA 1FB8A 3ZDTA 2RLOA 2MWNB 5CLQB 5DIFB 1MPHA 1UPRA 2Z0OA 4HB4B 2DN6A 3F0WA 3U7DA 1B55A 1WGQA 1QQGA 4Z2NA 1V89A 4KHAA 2E2XA 4KHOA 3FEHA 3SUZA 5KCVA 2CODA 1ZM0A 3VOQA 3BJIA 1IRSA 1LW3A 1MK9B 4EKUA 4XWXA 3AU4A 1EAZA 5D3YA 3OANA 2IFSA 3QWMA 2LG1A 1NU2A 3U8ZA 4F7GA 2COAA 3MDBC 4A6FB 4GMXB 3WA0A 1PLSA 4DBBA 2FJLA 3D8EA 2LULA 3SYXA 1FGZA 2OQBA 3HW2B 1K5DB 2W2XC 1U2BA 4ZRIA 5HE3A 1WJMA 4GN1A 2W2WA 3AU5A 3TVVA 1I2HA 4GZUA 3ULCA 4HAXB 2D9YA 1U5FA 3KSYA 1ZC3B 1W1HA 3TCAA 1BAKA 1Y19B 2Z0PA 1RRPB 4GXBA 5GOWB 5LOPB 4K81A 3A8PA 4HAVB 2QKMA 2AL6A 4YONA 5C5BB 2DHJA 2D10A 3TO1A 1M7RA 2DFKA 3UZTA 5C16A 1FOEA 2N23A 1KZ7A 5FI1A 2EJ8A 1OMWA 1XD4A 5D3VA 4HDOA 3PP2A 1X86A 2ROVA 4A6FA 3D8FA 1FHWA 1P5TA 1W1GA 1TXDA 4CHMA 2N0YA 2DX5A 1V5MA 3MPXA 1NTVA 4HDQA 1TJ6A 1GC7A 5DHAB 2YS3A 2RNRB 4F7HA 4PNKA 5JHGA 4DXAB 4YL8A 2D9VA 2YS1A 1V5UA 1Z87A 5J3QA 4A5KA 3TFMA 5C79A 1DDMA 2MKRA 4BBKA 5L81A 2RGNB 4WJ7A 3DXCA 3PSCA 4MT7A 4WVFB 1PFJA 1U29A 2UVMA 5C5BA 5C6RA 4B6HA 2RUKB 5HE1A 4GPTB 2DYNA 3PVLA 3CIKA 4HATB 3FSSA 3X23A 1QC6A 4HHVA 2L2IA 2J59M 1WGUA 2UZRA 5J3TA 2COCA 2HTHB 2VSZA 2I5FA 1FGYA 1EGXA 4TKNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AEH A;  2VKI A;  3DXD A;  2GJY A;  3WYF B;  2CY5 A;  2Y8G A;  1KZG A;  3KRX A;  1U27 A;  1FHO A;  3V5W A;  1X11 A;  2RSG A;  2DKP A;  2H7D A;  1AWE A;  4CHJ A;  4TYZ A;  1H10 A;  2KGX B;  4HAW B;  2GCL A;  1U5D A;  1GC6 A;  4NY0 A;  2UZS A;  1RJ2 A;  1UPQ A;  3BIN A;  2PZ1 A;  3CXB B;  2MFQ A;  1X05 A;  5D3X A;  2P8V A;  1BTK A;  2D4Q A;  2DYQ A;  2ROZ B;  3DXE A;  2L1C A;  2Q13 A;  2D9Z A;  2EMT A;  2ZPY A;  1WJ1 A;  1P6S A;  1KI1 B;  2LYD A;  2YT1 A;  4CYE A;  3VIA A;  2P0F A;  1AQC A;  2EC1 A;  2LOZ A;  3KZ1 A;  4K17 A;  5DHF B;  3ZVR A;  5J3Y A;  4EJN A;  2W2X D;  4P7I A;  1U5E A;  4C0A A;  1DRO A;  2GS0 A;  3IVF A;  2D11 A;  3QBV B;  4EMO A;  2H7E A;  2JP2 A;  1XR0 B;  2KUP A;  2I1J A;  2MDX A;  3FM8 C;  5DI9 B;  1XKE A;  2NZ8 B;  1FAO A;  2K00 A;  3G9W A;  1Q67 A;  2CY4 A;  2DLW A;  2CAY A;  2P0D A;  2DTC A;  5KQ4 A;  3ODX A;  1MK7 B;  3O96 A;  2D2Q A;  3AJ4 A;  2DHI A;  1TQZ A;  1WVH A;  1X1F A;  2DHK A;  4K2P A;  2DKQ A;  5CLL B;  1J0W A;  3KRW A;  4KAX B;  4HB0 B;  2DX1 A;  2YF0 A;  2CRF A;  1J19 A;  1DDV A;  3ML4 A;  4IOY X;  2Y7B A;  5HE0 A;  1BTN A;  1K5G B;  3A98 B;  3PG7 A;  2K2U A;  5JHH A;  5DH9 B;  2GCJ A;  1BWN A;  1PMS A;  3GYP A;  1FHX A;  2YVC A;  1NTY A;  1ZVR A;  4ZRJ A;  1P3R A;  1V5P A;  1OQN A;  2OTX A;  5EFX A;  4H8S A;  4HAZ B;  2YSZ A;  1WI1 A;  1DDW A;  3M1I B;  4L6E A;  4MK0 A;  2K2J A;  1UNR A;  2IYB A;  3GYO A;  2M14 A;  1N3H A;  4A6K A;  2Y8F A;  1DYN A;  1GG3 A;  4HAU B;  2YS5 A;  4K2O A;  2J0M A;  3QIJ A;  1ZC4 B;  2NMB A;  1NI2 A;  1OY2 A;  1DBH A;  1UNP A;  5KQ1 A;  4F7U P;  4D0N B;  4ZRK A;  4IAP A;  3ODW A;  1W1D A;  2V76 A;  1EF1 A;  5FI0 A;  1Y5O A;  1WG7 A;  2Z0Q A;  1H4R A;  2ELA A;  3HK0 A;  3P7Z A;  1M7E A;  1U5G A;  2HE7 A;  2COF A;  3T06 A;  4HB3 B;  5D27 A;  1LB1 A;  2D9W A;  2R09 A;  3ULB A;  1V61 A;  1ISN A;  4Y94 A;  4DX9 0;  2QKL A;  2EMS A;  1SHC A;  2DA0 A;  3PVW A;  1XX0 A;  1UNQ A;  1V88 A;  4NSW A;  2RVB B;  4HAY B;  1XCG A;  2R0D A;  1UEF A;  4Z2M B;  2LOX A;  3ODO A;  2D9X A;  2M38 A;  2I1K A;  4HB2 B;  3SNH A;  2VRW B;  2J0J A;  5D3W A;  5LON B;  2ELB A;  1X1G A;  4KHB B;  4MY6 A;  3N7C A;  3TW1 A;  4IFS A;  4A6H A;  1ZSQ A;  2I5C A;  1XOD A;  1MKE A;  1E5W A;  5JLJ B;  3A8Q A;  1MAI A;  3SO6 A;  1MIZ B;  4GMV A;  2G35 A;  2BCJ A;  3HQC A;  3F5R A;  4PQ0 A;  2KCJ A;  3PVU A;  5JP4 A;  2J0K A;  2X18 A;  1MIX A;  4DX8 A;  3SV1 A;  2XQN M;  2LKO A;  2ADZ A;  1SGH A;  3D8D A;  5HE2 A;  3LJU X;  3PEG A;  2YT0 A;  3RCP A;  2P0H A;  3P6A A;  1I7A A;  4KVG B;  1EVH A;  3KY9 A;  2YRY A;  3PZD A;  3NSU A;  4WSF A;  1FB8 A;  3ZDT A;  2RLO A;  2MWN B;  5CLQ B;  5DIF B;  1MPH A;  1UPR A;  2Z0O A;  4HB4 B;  2DN6 A;  3F0W A;  3U7D A;  1B55 A;  1WGQ A;  1QQG A;  4Z2N A;  1V89 A;  4KHA A;  2E2X A;  4KHO A;  3FEH A;  3SUZ A;  5KCV A;  2COD A;  1ZM0 A;  3VOQ A;  3BJI A;  1IRS A;  1LW3 A;  1MK9 B;  4EKU A;  4XWX A;  3AU4 A;  1EAZ A;  5D3Y A;  3OAN A;  2IFS A;  3QWM A;  2LG1 A;  1NU2 A;  3U8Z A;  4F7G A;  2COA A;  3MDB C;  4A6F B;  4GMX B;  3WA0 A;  1PLS A;  4DBB A;  2FJL A;  3D8E A;  2LUL A;  3SYX A;  1FGZ A;  2OQB A;  3HW2 B;  1K5D B;  2W2X C;  1U2B A;  4ZRI A;  5HE3 A;  1WJM A;  4GN1 A;  2W2W A;  3AU5 A;  3TVV A;  1I2H A;  4GZU A;  3ULC A;  4HAX B;  2D9Y A;  1U5F A;  3KSY A;  1ZC3 B;  1W1H A;  3TCA A;  1BAK A;  1Y19 B;  2Z0P A;  1RRP B;  4GXB A;  5GOW B;  5LOP B;  4K81 A;  3A8P A;  4HAV B;  2QKM A;  2AL6 A;  4YON A;  5C5B B;  2DHJ A;  2D10 A;  3TO1 A;  1M7R A;  2DFK A;  3UZT A;  5C16 A;  1FOE A;  2N23 A;  1KZ7 A;  5FI1 A;  2EJ8 A;  1OMW A;  1XD4 A;  5D3V A;  4HDO A;  3PP2 A;  1X86 A;  2ROV A;  4A6F A;  3D8F A;  1FHW A;  1P5T A;  1W1G A;  1TXD A;  4CHM A;  2N0Y A;  2DX5 A;  1V5M A;  3MPX A;  1NTV A;  4HDQ A;  1TJ6 A;  1GC7 A;  5DHA B;  2YS3 A;  2RNR B;  4F7H A;  4PNK A;  5JHG A;  4DXA B;  4YL8 A;  2D9V A;  2YS1 A;  1V5U A;  1Z87 A;  5J3Q A;  4A5K A;  3TFM A;  5C79 A;  1DDM A;  2MKR A;  4BBK A;  5L81 A;  2RGN B;  4WJ7 A;  3DXC A;  3PSC A;  4MT7 A;  4WVF B;  1PFJ A;  1U29 A;  2UVM A;  5C5B A;  5C6R A;  4B6H A;  2RUK B;  5HE1 A;  4GPT B;  2DYN A;  3PVL A;  3CIK A;  4HAT B;  3FSS A;  3X23 A;  1QC6 A;  4HHV A;  2L2I A;  2J59 M;  1WGU A;  2UZR A;  5J3T A;  2COC A;  2HTH B;  2VSZ A;  2I5F A;  1FGY A;  1EGX A;  4TKN A; 
#chains in the Genus database with same CATH topology
 2AEH A;  2VKI A;  3DXD A;  2GJY A;  3WYF B;  2CY5 A;  2Y8G A;  1KZG A;  3KRX A;  1U27 A;  1FHO A;  3V5W A;  1X11 A;  2RSG A;  2DKP A;  2H7D A;  1AWE A;  4CHJ A;  4TYZ A;  1H10 A;  2KGX B;  4HAW B;  2GCL A;  1U5D A;  2KIE A;  1GC6 A;  4NY0 A;  2UZS A;  1RJ2 A;  1UPQ A;  3BIN A;  2PZ1 A;  3CXB B;  2MFQ A;  4L1R A;  3FVC A;  1X05 A;  5D3X A;  2P8V A;  1BTK A;  2D4Q A;  2DYQ A;  2ROZ B;  3DXE A;  2R2Y A;  2L1C A;  2Q13 A;  2D9Z A;  2EMT A;  2ZPY A;  1WJ1 A;  1P6S A;  1KI1 B;  2LYD A;  2YT1 A;  4CYE A;  2K8E A;  3VIA A;  2P0F A;  1AQC A;  4HSI A;  2KIG A;  2EC1 A;  2LOZ A;  3KZ1 A;  4K17 A;  5DHF B;  3ZVR A;  3NW8 A;  5J3Y A;  4EJN A;  2W2X D;  4P7I A;  1U5E A;  3B77 A;  4C0A A;  1DRO A;  2GS0 A;  3IVF A;  2D11 A;  3QBV B;  4EMO A;  2H7E A;  3U12 A;  2JP2 A;  1XR0 B;  2KUP A;  2I1J A;  2MDX A;  3FM8 C;  5DI9 B;  1XKE A;  2NZ8 B;  5I2M A;  1FAO A;  2K00 A;  3G9W A;  4OSN A;  1Q67 A;  2CY4 A;  2DLW A;  2CAY A;  2P0D A;  2DTC A;  5M4Y B;  5KQ4 A;  3ODX A;  2YT2 A;  1MK7 B;  3O96 A;  2D2Q A;  3AJ4 A;  2DHI A;  1TQZ A;  1WVH A;  1X1F A;  2K49 A;  2DHK A;  4K2P A;  2DKQ A;  5CLL B;  1J0W A;  3KRW A;  4KAX B;  4GNK B;  4HB0 B;  2DX1 A;  2YF0 A;  2CRF A;  1J19 A;  3A58 A;  1DDV A;  3ML4 A;  4IOY X;  2KR0 A;  2Y7B A;  5HE0 A;  1BTN A;  1K5G B;  3A98 B;  3PG7 A;  2K2U A;  5JHH A;  5DH9 B;  2GCJ A;  1BWN A;  1PMS A;  3GYP A;  1FHX A;  2YVC A;  1NTY A;  1ZVR A;  1ZYI A;  5LG4 B;  4ZRJ A;  1P3R A;  1V5P A;  1OQN A;  2OTX A;  5EFX A;  4H8S A;  4KHB A;  5IRS A;  4HAZ B;  2YSZ A;  1WI1 A;  1DDW A;  3M1I B;  4L6E A;  2RRF A;  4MK0 A;  2K2J A;  1UNR A;  2IYB A;  3GYO A;  2M14 A;  1N3H A;  4A6K A;  2Y8F A;  1DYN A;  1GG3 A;  4HAU B;  1T77 A;  2YS5 A;  4K2O A;  2J0M A;  3QIJ A;  1ZC4 B;  2NMB A;  1NI2 A;  1OY2 A;  1DBH A;  1UNP A;  5KQ1 A;  4F7U P;  4D0N B;  4ZRK A;  4IAP A;  3ODW A;  1W1D A;  2V76 A;  1EF1 A;  5FI0 A;  1Y5O A;  1WG7 A;  2Z0Q A;  1H4R A;  2ELA A;  4QJ4 B;  2Z13 A;  3HK0 A;  3P7Z A;  1M7E A;  1U5G A;  2HE7 A;  2COF A;  3T06 A;  4DIX A;  4D6W A;  4HB3 B;  5D27 A;  1LB1 A;  2D9W A;  2R09 A;  3ULB A;  1V61 A;  1ISN A;  4Y94 A;  4DX9 0;  2QKL A;  2EMS A;  1SHC A;  2DA0 A;  3PVW A;  1XX0 A;  1UNQ A;  1V88 A;  4NSW A;  2RVB B;  4HAY B;  1XCG A;  2R0D A;  2Z4D A;  1UEF A;  4Z2M B;  2LOX A;  3ODO A;  2D9X A;  2M38 A;  2I1K A;  4HB2 B;  3SNH A;  2VRW B;  2J0J A;  3HSA A;  5D3W A;  5LON B;  2ELB A;  1X1G A;  4KHB B;  4QJ3 B;  4MY6 A;  3N7C A;  3TW1 A;  4IFS A;  4A6H A;  1ZSQ A;  2I5C A;  1MI1 A;  3OHM B;  1XOD A;  3DCX A;  1MKE A;  1E5W A;  5JLJ B;  3A8Q A;  1MAI A;  3SO6 A;  1MIZ B;  4GMV A;  2G35 A;  2BCJ A;  3HQC A;  3F5R A;  4QJ5 B;  2NBV A;  4PQ0 A;  2KCJ A;  3PVU A;  5JP4 A;  2J0K A;  2X18 A;  1MIX A;  4DX8 A;  3SV1 A;  2XQN M;  2LKO A;  2ADZ A;  1SGH A;  3NWF A;  3D8D A;  5HE2 A;  3LJU X;  3PEG A;  2YT0 A;  3RCP A;  2P0H A;  3P6A A;  1I7A A;  4KVG B;  1EVH A;  3KY9 A;  2YRY A;  3PZD A;  3NSU A;  4WSF A;  1FB8 A;  3ZDT A;  2RLO A;  2MWN B;  5CLQ B;  5DIF B;  1MPH A;  1UPR A;  2Z0O A;  4HB4 B;  2DN6 A;  3F0W A;  3U7D A;  1B55 A;  1WGQ A;  1QQG A;  4Z2N A;  1V89 A;  4KHA A;  2E2X A;  4KHO A;  3FEH A;  3SUZ A;  5KCV A;  2COD A;  4CSQ A;  1ZM0 A;  3VOQ A;  3BJI A;  1IRS A;  1LW3 A;  1MK9 B;  4EKU A;  4XWX A;  3AU4 A;  1EAZ A;  5D3Y A;  3OAN A;  2IFS A;  3QWM A;  2LG1 A;  1NU2 A;  3U8Z A;  4F7G A;  2COA A;  3MDB C;  4A6F B;  4GMX B;  3WA0 A;  1PLS A;  4DBB A;  2FJL A;  3D8E A;  2LUL A;  3SYX A;  1FGZ A;  2OQB A;  3HW2 B;  1K5D B;  2W2X C;  1U2B A;  4ZRI A;  4GOU A;  5HE3 A;  1WJM A;  4GN1 A;  2W2W A;  3AU5 A;  3TVV A;  1I2H A;  4GZU A;  3ULC A;  4HAX B;  2D9Y A;  1U5F A;  3KSY A;  1ZC3 B;  1W1H A;  3TCA A;  1BAK A;  1Y19 B;  2Z0P A;  1RRP B;  2GUM A;  4GXB A;  5GOW B;  5LOP B;  2FJU B;  4K81 A;  3A8P A;  4HAV B;  2QKM A;  2AL6 A;  4YON A;  5C5B B;  2DHJ A;  2KUQ A;  2D10 A;  3TO1 A;  1M7R A;  2DFK A;  3UZT A;  3NWD A;  5C16 A;  2Z59 A;  1FOE A;  4OT1 A;  2N23 A;  1KZ7 A;  5FI1 A;  2EJ8 A;  1OMW A;  1XD4 A;  5D3V A;  4HDO A;  3PP2 A;  1X86 A;  2ROV A;  4A6F A;  3D8F A;  1FHW A;  1P5T A;  1W1G A;  1TXD A;  4CHM A;  2N0Y A;  2DX5 A;  1V5M A;  3MPX A;  1NTV A;  4HDQ A;  1TJ6 A;  2Z14 A;  1GC7 A;  5DHA B;  2YS3 A;  2RNR B;  2ZKM X;  4F7H A;  4PNK A;  3HIE A;  5JHG A;  4DXA B;  4YL8 A;  2D9V A;  2YS1 A;  1V5U A;  1Z87 A;  5J3Q A;  4A5K A;  3TFM A;  5C79 A;  1DDM A;  2MKR A;  4BBK A;  5L81 A;  2RGN B;  4WJ7 A;  3NWA A;  3DXC A;  3PSC A;  4MT7 A;  4WVF B;  1PFJ A;  1U29 A;  2UVM A;  5C5B A;  5C6R A;  4B6H A;  2RUK B;  5HE1 A;  4GPT B;  2DYN A;  3PVL A;  3CIK A;  4HAT B;  3FSS A;  3X23 A;  4QXA B;  1QC6 A;  4HHV A;  2L2I A;  2J59 M;  5I2S A;  1WGU A;  2UZR A;  5J3T A;  2COC A;  2HTH B;  2VSZ A;  2I5F A;  1FGY A;  1EGX A;  4TKN A; 
#chains in the Genus database with same CATH homology
 2AEH A;  2VKI A;  3DXD A;  2GJY A;  3WYF B;  2CY5 A;  2Y8G A;  1KZG A;  3KRX A;  1U27 A;  1FHO A;  3V5W A;  1X11 A;  2RSG A;  2DKP A;  2H7D A;  1AWE A;  4CHJ A;  4TYZ A;  1H10 A;  2KGX B;  4HAW B;  2GCL A;  1U5D A;  1GC6 A;  4NY0 A;  2UZS A;  1RJ2 A;  1UPQ A;  3BIN A;  2PZ1 A;  3CXB B;  2MFQ A;  1X05 A;  5D3X A;  2P8V A;  1BTK A;  2D4Q A;  2DYQ A;  2ROZ B;  3DXE A;  2L1C A;  2Q13 A;  2D9Z A;  2EMT A;  2ZPY A;  1WJ1 A;  1P6S A;  1KI1 B;  2LYD A;  2YT1 A;  4CYE A;  3VIA A;  2P0F A;  1AQC A;  2EC1 A;  2LOZ A;  3KZ1 A;  4K17 A;  5DHF B;  3ZVR A;  5J3Y A;  4EJN A;  2W2X D;  4P7I A;  1U5E A;  4C0A A;  1DRO A;  2GS0 A;  3IVF A;  2D11 A;  3QBV B;  4EMO A;  2H7E A;  2JP2 A;  1XR0 B;  2KUP A;  2I1J A;  2MDX A;  3FM8 C;  5DI9 B;  1XKE A;  2NZ8 B;  1FAO A;  2K00 A;  3G9W A;  1Q67 A;  2CY4 A;  2DLW A;  2CAY A;  2P0D A;  2DTC A;  5KQ4 A;  3ODX A;  1MK7 B;  3O96 A;  2D2Q A;  3AJ4 A;  2DHI A;  1TQZ A;  1WVH A;  1X1F A;  2DHK A;  4K2P A;  2DKQ A;  5CLL B;  1J0W A;  3KRW A;  4KAX B;  4HB0 B;  2DX1 A;  2YF0 A;  2CRF A;  1J19 A;  1DDV A;  3ML4 A;  4IOY X;  2Y7B A;  5HE0 A;  1BTN A;  1K5G B;  3A98 B;  3PG7 A;  2K2U A;  5JHH A;  5DH9 B;  2GCJ A;  1BWN A;  1PMS A;  3GYP A;  1FHX A;  2YVC A;  1NTY A;  1ZVR A;  4ZRJ A;  1P3R A;  1V5P A;  1OQN A;  2OTX A;  5EFX A;  4H8S A;  4HAZ B;  2YSZ A;  1WI1 A;  1DDW A;  3M1I B;  4L6E A;  4MK0 A;  2K2J A;  1UNR A;  2IYB A;  3GYO A;  2M14 A;  1N3H A;  4A6K A;  2Y8F A;  1DYN A;  1GG3 A;  4HAU B;  2YS5 A;  4K2O A;  2J0M A;  3QIJ A;  1ZC4 B;  2NMB A;  1NI2 A;  1OY2 A;  1DBH A;  1UNP A;  5KQ1 A;  4F7U P;  4D0N B;  4ZRK A;  4IAP A;  3ODW A;  1W1D A;  2V76 A;  1EF1 A;  5FI0 A;  1Y5O A;  1WG7 A;  2Z0Q A;  1H4R A;  2ELA A;  3HK0 A;  3P7Z A;  1M7E A;  1U5G A;  2HE7 A;  2COF A;  3T06 A;  4HB3 B;  5D27 A;  1LB1 A;  2D9W A;  2R09 A;  3ULB A;  1V61 A;  1ISN A;  4Y94 A;  4DX9 0;  2QKL A;  2EMS A;  1SHC A;  2DA0 A;  3PVW A;  1XX0 A;  1UNQ A;  1V88 A;  4NSW A;  2RVB B;  4HAY B;  1XCG A;  2R0D A;  1UEF A;  4Z2M B;  2LOX A;  3ODO A;  2D9X A;  2M38 A;  2I1K A;  4HB2 B;  3SNH A;  2VRW B;  2J0J A;  5D3W A;  5LON B;  2ELB A;  1X1G A;  4KHB B;  4MY6 A;  3N7C A;  3TW1 A;  4IFS A;  4A6H A;  1ZSQ A;  2I5C A;  1XOD A;  1MKE A;  1E5W A;  5JLJ B;  3A8Q A;  1MAI A;  3SO6 A;  1MIZ B;  4GMV A;  2G35 A;  2BCJ A;  3HQC A;  3F5R A;  4PQ0 A;  2KCJ A;  3PVU A;  5JP4 A;  2J0K A;  2X18 A;  1MIX A;  4DX8 A;  3SV1 A;  2XQN M;  2LKO A;  2ADZ A;  1SGH A;  3D8D A;  5HE2 A;  3LJU X;  3PEG A;  2YT0 A;  3RCP A;  2P0H A;  3P6A A;  1I7A A;  4KVG B;  1EVH A;  3KY9 A;  2YRY A;  3PZD A;  3NSU A;  4WSF A;  1FB8 A;  3ZDT A;  2RLO A;  2MWN B;  5CLQ B;  5DIF B;  1MPH A;  1UPR A;  2Z0O A;  4HB4 B;  2DN6 A;  3F0W A;  3U7D A;  1B55 A;  1WGQ A;  1QQG A;  4Z2N A;  1V89 A;  4KHA A;  2E2X A;  4KHO A;  3FEH A;  3SUZ A;  5KCV A;  2COD A;  1ZM0 A;  3VOQ A;  3BJI A;  1IRS A;  1LW3 A;  1MK9 B;  4EKU A;  4XWX A;  3AU4 A;  1EAZ A;  5D3Y A;  3OAN A;  2IFS A;  3QWM A;  2LG1 A;  1NU2 A;  3U8Z A;  4F7G A;  2COA A;  3MDB C;  4A6F B;  4GMX B;  3WA0 A;  1PLS A;  4DBB A;  2FJL A;  3D8E A;  2LUL A;  3SYX A;  1FGZ A;  2OQB A;  3HW2 B;  1K5D B;  2W2X C;  1U2B A;  4ZRI A;  5HE3 A;  1WJM A;  4GN1 A;  2W2W A;  3AU5 A;  3TVV A;  1I2H A;  4GZU A;  3ULC A;  4HAX B;  2D9Y A;  1U5F A;  3KSY A;  1ZC3 B;  1W1H A;  3TCA A;  1BAK A;  1Y19 B;  2Z0P A;  1RRP B;  4GXB A;  5GOW B;  5LOP B;  4K81 A;  3A8P A;  4HAV B;  2QKM A;  2AL6 A;  4YON A;  5C5B B;  2DHJ A;  2D10 A;  3TO1 A;  1M7R A;  2DFK A;  3UZT A;  5C16 A;  1FOE A;  2N23 A;  1KZ7 A;  5FI1 A;  2EJ8 A;  1OMW A;  1XD4 A;  5D3V A;  4HDO A;  3PP2 A;  1X86 A;  2ROV A;  4A6F A;  3D8F A;  1FHW A;  1P5T A;  1W1G A;  1TXD A;  4CHM A;  2N0Y A;  2DX5 A;  1V5M A;  3MPX A;  1NTV A;  4HDQ A;  1TJ6 A;  1GC7 A;  5DHA B;  2YS3 A;  2RNR B;  4F7H A;  4PNK A;  5JHG A;  4DXA B;  4YL8 A;  2D9V A;  2YS1 A;  1V5U A;  1Z87 A;  5J3Q A;  4A5K A;  3TFM A;  5C79 A;  1DDM A;  2MKR A;  4BBK A;  5L81 A;  2RGN B;  4WJ7 A;  3DXC A;  3PSC A;  4MT7 A;  4WVF B;  1PFJ A;  1U29 A;  2UVM A;  5C5B A;  5C6R A;  4B6H A;  2RUK B;  5HE1 A;  4GPT B;  2DYN A;  3PVL A;  3CIK A;  4HAT B;  3FSS A;  3X23 A;  1QC6 A;  4HHV A;  2L2I A;  2J59 M;  1WGU A;  2UZR A;  5J3T A;  2COC A;  2HTH B;  2VSZ A;  2I5F A;  1FGY A;  1EGX A;  4TKN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...