1PMSA

Pleckstrin homology domain of son of sevenless 1 (sos1) with glycine-serine added to the n-terminus, nmr, 20 structures
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
135
structure length
135
Chain Sequence
SKQLAIKKMNEIQKNIDGWEGKDIGQCCNEFIMEGTLTRVGAKHERHIFLFDGLMICCKSNHGQPRLPGASSAEYRLKEKFFMRKVQINDKDDTSEYKHAFEIILKDGNSVIFSAKSAEEKNNWMAALISLQYRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The solution structure of the pleckstrin homology domain of mouse Son-of-sevenless 1 (mSos1).
pubmed doi rcsb
source organism Mus musculus
molecule tags Signal transduction
molecule keywords SOS 1
total genus 14
structure length 135
sequence length 135
ec nomenclature
pdb deposition date 1997-02-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00169 PH PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1pmsA00
4MK0A 2RNRB 4HAZB 2Z0OA 2DN6A 2IFSA 2UVMA 3KY9A 1V88A 1J0WA 1TXDA 5DH9B 3UZTA 5CLLB 3T06A 3KRWA 1UEFA 4IFSA 2Z0QA 5DHAB 4HATB 3TFMA 2RVBB 4PQ0A 1P5TA 2DHJA 2DHIA 1Y19B 1U27A 4GMVA 2M14A 2P0DA 2K2JA 4ZRIA 4C0AA 2L1CA 1FHXA 1V61A 5JLJB 4WJ7A 1M7RA 5KCVA 5KQ4A 4F7HA 3OANA 2LG1A 1J19A 1OMWA 2M38A 1UNRA 1WVHA 2P0FA 4KVGB 2LOXA 3WYFB 2DYNA 4A6FB 4HAXB 3GYPA 2D9XA 2L2IA 2CODA 3KSYA 1MIZB 5GOWB 4KHBB 1PLSA 1PMSA 5D3XA 3NSUA 2YF0A 2EMTA 5JHHA 1V89A 1DDVA 4CYEA 5FI1A 1U5EA 2PZ1A 3PVWA 4NSWA 3TVVA 1X86A 3DXEA 1OY2A 3D8DA 1K5DB 1WJ1A 4EKUA 5DI9B 4K17A 1I2HA 2ROVA 2AL6A 2Q13A 4YL8A 1FHOA 4Z2NA 1TJ6A 2ELAA 2X18A 3D8FA 2DX5A 1K5GB 2E2XA 2YS5A 4B6HA 2JP2A 5HE2A 4WVFB 3P6AA 4HAUB 1GG3A 4Y94A 2CRFA 3AU4A 1MPHA 3ML4A 1U2BA 5LONB 3U7DA 3DXCA 5HE0A 5J3TA 2R0DA 5C79A 1M7EA 3TCAA 1BAKA 2VRWB 3FSSA 1P6SA 2DX1A 2I5CA 4HHVA 2P0HA 4MY6A 3VIAA 1QC6A 1X11A 2GCJA 4HDQA 1XCGA 4XWXA 2W2WA 4ZRJA 3ULBA 1UPQA 1ZM0A 4DXAB 1XD4A 3M1IB 2J59M 5L81A 2DKPA 2BCJA 1Y5OA 2H7EA 3BINA 2ZPYA 1DDWA 1V5MA 4CHMA 5FI0A 4HB0B 2P8VA 3IVFA 3SV1A 3HQCA 2D11A 3ODWA 4HDOA 1V5UA 3V5WA 5C5BA 5C6RA 3MPXA 4TKNA 1PFJA 3FEHA 5D3VA 1WGUA 2ADZA 1ISNA 5HE3A 2ROZB 4K2PA 2OQBA 1BWNA 1KZGA 4TYZA 2COAA 2RGNB 1EGXA 1FGZA 1EVHA 2YS3A 2YVCA 4K81A 3A98B 5JHGA 3SUZA 1MIXA 2YS1A 2GS0A 1SHCA 3MDBC 3QWMA 5D27A 5JP4A 2W2XC 2I1JA 2DLWA 2ELBA 5HE1A 2R09A 3U8ZA 4IOYX 2OTXA 2UZRA 4KHOA 2MKRA 2YSZA 3D8EA 2MWNB 1AWEA 4IAPA 1WJMA 5D3YA 2KGXB 4HB3B 1U5GA 1EAZA 2DHKA 3AJ4A 3LJUX 1ZC4B 4DX8A 2VKIA 2VSZA 5J3QA 3DXDA 1BTNA 2K2UA 2GCLA 1RJ2A 1MK9B 1ZSQA 3G9WA 3ODXA 1GC6A 4P7IA 2GJYA 1H4RA 2D4QA 2DTCA 3GYOA 3RCPA 1QQGA 3WA0A 4MT7A 1ZVRA 2LYDA 4H8SA 1DYNA 3HK0A 2V76A 3SNHA 2D10A 2Y8GA 1B55A 2D9YA 4DX90 2NZ8B 4HAVB 2AEHA 4F7GA 4A5KA 1U5FA 1DDMA 1LW3A 1NTYA 2W2XD 2LKOA 3TO1A 4PNKA 2CAYA 3KZ1A 3N7CA 4BBKA 2EJ8A 2RUKB 3KRXA 4A6KA 2I1KA 3QBVB 1MKEA 1X05A 1SGHA 1FHWA 2FJLA 3ZDTA 4DBBA 2G35A 3P7ZA 2D9VA 2Y7BA 3TW1A 5DHFB 1FAOA 1NI2A 4D0NB 1UPRA 3BJIA 1NU2A 2COCA 3F0WA 4KAXB 1XX0A 3ULCA 4GXBA 1FB8A 4GPTB 3PVUA 2HE7A 1V5PA 1FOEA 1UNQA 1Z87A 1WI1A 1TQZA 3QIJA 4F7UP 2J0KA 2DKQA 1E5WA 1X1GA 3AU5A 2MFQA 1BTKA 3CXBB 2QKLA 1FGYA 3O96A 1UNPA 4HB2B 4YONA 2EC1A 2RLOA 5C16A 2LULA 1MAIA 1MK7B 4GMXB 4GN1A 1IRSA 3SYXA 2IYBA 3PEGA 3PG7A 1N3HA 4KHAA 5LOPB 1Q67A 2DFKA 2KCJA 3A8PA 2CY4A 1RRPB 4L6EA 3F5RA 2MDXA 1GC7A 3X23A 5DIFB 4A6FA 4A6HA 1AQCA 1XODA 1ZC3B 4Z2MB 3PP2A 5CLQB 1XKEA 2UZSA 1DBHA 1KI1B 3ODOA 3SO6A 4K2OA 4EMOA 2CY5A 2K00A 2N23A 1KZ7A 1EF1A 5C5BB 1OQNA 3PVLA 4WSFA 1W1GA 3ZVRA 3PSCA 2D2QA 2H7DA 5D3WA 3PZDA 2XQNM 2Y8FA 1LB1A 4HAYB 3A8QA 2COFA 1WGQA 2NMBA 2D9WA 2LOZA 2DA0A 2RSGA 1U29A 2I5FA 1H10A 3HW2B 1NTVA 4GZUA 5J3YA 2YRYA 1DROA 4CHJA 1X1FA 2DYQA 1WG7A 2Z0PA 1W1HA 2EMSA 4EJNA 2J0MA 1XR0B 4ZRKA 1W1DA 1U5DA 4HB4B 2N0YA 4NY0A 4HAWB 2HTHB 3CIKA 2YT1A 2D9ZA 1I7AA 2QKMA 1P3RA 2YT0A 3FM8C 2KUPA 5KQ1A 3VOQA 2J0JA 5EFXA
chains in the Genus database with same CATH superfamily
4MK0A 2RNRB 4HAZB 2Z0OA 2DN6A 2IFSA 2UVMA 3KY9A 1V88A 1J0WA 1TXDA 5DH9B 3UZTA 5CLLB 3T06A 3KRWA 1UEFA 4IFSA 2Z0QA 2FJUB 5DHAB 4HATB 4HSIA 3TFMA 2RRFA 2RVBB 4PQ0A 1P5TA 2DHJA 2DHIA 1Y19B 1U27A 4GMVA 2M14A 2P0DA 2K2JA 4ZRIA 4C0AA 2L1CA 1FHXA 1V61A 5JLJB 4WJ7A 1M7RA 5KCVA 5KQ4A 4F7HA 3OANA 2LG1A 1J19A 1OMWA 2M38A 1UNRA 1WVHA 2P0FA 4KVGB 2LOXA 2Z4DA 3WYFB 2DYNA 4A6FB 4HAXB 3GYPA 2D9XA 2L2IA 2CODA 3KSYA 1MIZB 5GOWB 4KHBB 1PLSA 1PMSA 5D3XA 3NSUA 2YF0A 2EMTA 5JHHA 1V89A 1DDVA 4CYEA 5FI1A 1U5EA 2PZ1A 3PVWA 4NSWA 3TVVA 1X86A 3DXEA 1OY2A 3D8DA 1K5DB 1WJ1A 4EKUA 5DI9B 4K17A 1I2HA 2ROVA 2AL6A 2Q13A 4YL8A 1FHOA 4Z2NA 4D6WA 1TJ6A 2ELAA 2X18A 3D8FA 4DIXA 2DX5A 1K5GB 2E2XA 2YS5A 4B6HA 2JP2A 5HE2A 4WVFB 3P6AA 1GG3A 4HAUB 4Y94A 2CRFA 3AU4A 3U12A 1MPHA 3ML4A 1U2BA 5LONB 3U7DA 3DXCA 5HE0A 5J3TA 2GUMA 2R0DA 2YT2A 4OSNA 5C79A 1M7EA 3TCAA 1BAKA 2VRWB 3FSSA 1P6SA 2DX1A 2I5CA 4HHVA 2P0HA 4MY6A 3VIAA 1QC6A 1X11A 2GCJA 4HDQA 1XCGA 4XWXA 2W2WA 4ZRJA 3ULBA 1UPQA 3HIEA 1ZM0A 4DXAB 5IRSA 4GNKB 1XD4A 3M1IB 2J59M 5M4YB 5L81A 2DKPA 2BCJA 1Y5OA 2H7EA 3BINA 2ZPYA 1DDWA 1V5MA 4CHMA 5FI0A 4HB0B 2P8VA 3IVFA 3SV1A 3HQCA 2D11A 3ODWA 4HDOA 1V5UA 3V5WA 2K8EA 5C5BA 5C6RA 3MPXA 4TKNA 1PFJA 3FEHA 5D3VA 1WGUA 2ADZA 4KHBA 1ISNA 5HE3A 2ROZB 4K2PA 2OQBA 1BWNA 3A58A 1KZGA 4TYZA 2COAA 2RGNB 4QJ5B 1EGXA 1FGZA 1EVHA 2YS3A 2KUQA 1MI1A 2YVCA 4K81A 3A98B 5JHGA 3SUZA 1MIXA 2YS1A 2GS0A 2Z14A 1SHCA 3MDBC 3QWMA 5D27A 5JP4A 2W2XC 2I1JA 2DLWA 2ELBA 5HE1A 2R09A 3U8ZA 5LG4B 1ZYIA 4IOYX 2OTXA 2K49A 2UZRA 3NWDA 4KHOA 2MKRA 2YSZA 3D8EA 2MWNB 1AWEA 4IAPA 1WJMA 5D3YA 2KGXB 4HB3B 2Z59A 1U5GA 1EAZA 2DHKA 3AJ4A 3LJUX 1ZC4B 4DX8A 2VKIA 4OT1A 2VSZA 5J3QA 2ZKMX 3DXDA 1BTNA 2K2UA 2GCLA 1RJ2A 1MK9B 1ZSQA 3G9WA 4QJ4B 3ODXA 1GC6A 3NW8A 4P7IA 2GJYA 1H4RA 2D4QA 2DTCA 3GYOA 3RCPA 1QQGA 3WA0A 4MT7A 1ZVRA 2LYDA 4H8SA 1DYNA 3HK0A 2V76A 3SNHA 2D10A 4QJ3B 2Y8GA 1B55A 2D9YA 4DX90 2NZ8B 2KIEA 4HAVB 2AEHA 4F7GA 4A5KA 1U5FA 1DDMA 1LW3A 1NTYA 2R2YA 2W2XD 2LKOA 3TO1A 4PNKA 2CAYA 3KZ1A 3N7CA 2KIGA 4BBKA 2EJ8A 2RUKB 3KRXA 3HSAA 4A6KA 2I1KA 3QBVB 1MKEA 1X05A 1SGHA 1FHWA 2FJLA 3ZDTA 4DBBA 2G35A 3P7ZA 2D9VA 2NBVA 2Y7BA 3TW1A 5DHFB 1FAOA 1NI2A 4D0NB 1UPRA 3BJIA 1NU2A 2COCA 3F0WA 4KAXB 1XX0A 3ULCA 4GXBA 1FB8A 4GOUA 4GPTB 5I2SA 3PVUA 2HE7A 1V5PA 1FOEA 1UNQA 1Z87A 1WI1A 1TQZA 3QIJA 4F7UP 2J0KA 2DKQA 1E5WA 1X1GA 3AU5A 2MFQA 4CSQA 3B77A 1BTKA 3CXBB 2QKLA 1FGYA 3O96A 1UNPA 4HB2B 4YONA 2EC1A 2RLOA 5C16A 2LULA 1MAIA 1MK7B 4GMXB 4GN1A 1IRSA 3SYXA 2IYBA 3PEGA 3PG7A 1N3HA 4KHAA 5LOPB 1Q67A 2DFKA 2Z13A 2KCJA 3A8PA 2CY4A 1RRPB 4L6EA 3F5RA 2MDXA 1GC7A 3X23A 5DIFB 4A6FA 4A6HA 1AQCA 1XODA 1ZC3B 3NWFA 4QXAB 4Z2MB 3PP2A 5CLQB 1XKEA 2UZSA 1DBHA 1KI1B 3ODOA 3SO6A 3DCXA 4K2OA 4EMOA 2CY5A 2K00A 2N23A 3NWAA 1KZ7A 1EF1A 5C5BB 1OQNA 3PVLA 4WSFA 1W1GA 3ZVRA 3PSCA 2D2QA 2H7DA 5D3WA 3PZDA 2XQNM 2Y8FA 1LB1A 4HAYB 3A8QA 2COFA 1WGQA 2NMBA 2D9WA 2LOZA 4L1RA 2DA0A 1T77A 2RSGA 1U29A 2I5FA 1H10A 3HW2B 1NTVA 4GZUA 5J3YA 2YRYA 1DROA 4CHJA 1X1FA 2DYQA 1WG7A 2Z0PA 1W1HA 2EMSA 4EJNA 2J0MA 1XR0B 4ZRKA 1W1DA 1U5DA 2KR0A 4HB4B 5I2MA 2N0YA 4NY0A 4HAWB 2HTHB 3CIKA 2YT1A 2D9ZA 1I7AA 2QKMA 1P3RA 2YT0A 3FM8C 2KUPA 3OHMB 5KQ1A 3VOQA 2J0JA 3FVCA 5EFXA
chains in the Genus database with same CATH topology
4MK0A 2RNRB 4HAZB 2Z0OA 2DN6A 2IFSA 2UVMA 3KY9A 1V88A 1J0WA 1TXDA 5DH9B 3UZTA 5CLLB 3T06A 3KRWA 1UEFA 4IFSA 2Z0QA 5DHAB 4HATB 3TFMA 2RVBB 4PQ0A 1P5TA 2DHJA 2DHIA 1Y19B 1U27A 4GMVA 2M14A 2P0DA 2K2JA 4ZRIA 4C0AA 2L1CA 1FHXA 1V61A 5JLJB 4WJ7A 1M7RA 5KCVA 5KQ4A 4F7HA 3OANA 2LG1A 1J19A 1OMWA 2M38A 1UNRA 1WVHA 2P0FA 4KVGB 2LOXA 3WYFB 2DYNA 4A6FB 4HAXB 3GYPA 2D9XA 2L2IA 2CODA 3KSYA 1MIZB 5GOWB 4KHBB 1PLSA 1PMSA 5D3XA 3NSUA 2YF0A 2EMTA 5JHHA 1V89A 1DDVA 4CYEA 5FI1A 1U5EA 2PZ1A 3PVWA 4NSWA 3TVVA 1X86A 3DXEA 1OY2A 3D8DA 1K5DB 1WJ1A 4EKUA 5DI9B 4K17A 1I2HA 2ROVA 2AL6A 2Q13A 4YL8A 1FHOA 4Z2NA 1TJ6A 2ELAA 2X18A 3D8FA 2DX5A 1K5GB 2E2XA 2YS5A 4B6HA 2JP2A 5HE2A 4WVFB 3P6AA 4HAUB 1GG3A 4Y94A 2CRFA 3AU4A 1MPHA 3ML4A 1U2BA 5LONB 3U7DA 3DXCA 5HE0A 5J3TA 2R0DA 5C79A 1M7EA 3TCAA 1BAKA 2VRWB 3FSSA 1P6SA 2DX1A 2I5CA 4HHVA 2P0HA 4MY6A 3VIAA 1QC6A 1X11A 2GCJA 4HDQA 1XCGA 4XWXA 2W2WA 4ZRJA 3ULBA 1UPQA 1ZM0A 4DXAB 1XD4A 3M1IB 2J59M 5L81A 2DKPA 2BCJA 1Y5OA 2H7EA 3BINA 2ZPYA 1DDWA 1V5MA 4CHMA 5FI0A 4HB0B 2P8VA 3IVFA 3SV1A 3HQCA 2D11A 3ODWA 4HDOA 1V5UA 3V5WA 5C5BA 5C6RA 3MPXA 4TKNA 1PFJA 3FEHA 5D3VA 1WGUA 2ADZA 1ISNA 5HE3A 2ROZB 4K2PA 2OQBA 1BWNA 1KZGA 4TYZA 2COAA 2RGNB 1EGXA 1FGZA 1EVHA 2YS3A 2YVCA 4K81A 3A98B 5JHGA 3SUZA 1MIXA 2YS1A 2GS0A 1SHCA 3MDBC 3QWMA 5D27A 5JP4A 2W2XC 2I1JA 2DLWA 2ELBA 5HE1A 2R09A 3U8ZA 4IOYX 2OTXA 2UZRA 4KHOA 2MKRA 2YSZA 3D8EA 2MWNB 1AWEA 4IAPA 1WJMA 5D3YA 2KGXB 4HB3B 1U5GA 1EAZA 2DHKA 3AJ4A 3LJUX 1ZC4B 4DX8A 2VKIA 2VSZA 5J3QA 3DXDA 1BTNA 2K2UA 2GCLA 1RJ2A 1MK9B 1ZSQA 3G9WA 3ODXA 1GC6A 4P7IA 2GJYA 1H4RA 2D4QA 2DTCA 3GYOA 3RCPA 1QQGA 3WA0A 4MT7A 1ZVRA 2LYDA 4H8SA 1DYNA 3HK0A 2V76A 3SNHA 2D10A 2Y8GA 1B55A 2D9YA 4DX90 2NZ8B 4HAVB 2AEHA 4F7GA 4A5KA 1U5FA 1DDMA 1LW3A 1NTYA 2W2XD 2LKOA 3TO1A 4PNKA 2CAYA 3KZ1A 3N7CA 4BBKA 2EJ8A 2RUKB 3KRXA 4A6KA 2I1KA 3QBVB 1MKEA 1X05A 1SGHA 1FHWA 2FJLA 3ZDTA 4DBBA 2G35A 3P7ZA 2D9VA 2Y7BA 3TW1A 5DHFB 1FAOA 1NI2A 4D0NB 1UPRA 3BJIA 1NU2A 2COCA 3F0WA 4KAXB 1XX0A 3ULCA 4GXBA 1FB8A 4GPTB 3PVUA 2HE7A 1V5PA 1FOEA 1UNQA 1Z87A 1WI1A 1TQZA 3QIJA 4F7UP 2J0KA 2DKQA 1E5WA 1X1GA 3AU5A 2MFQA 1BTKA 3CXBB 2QKLA 1FGYA 3O96A 1UNPA 4HB2B 4YONA 2EC1A 2RLOA 5C16A 2LULA 1MAIA 1MK7B 4GMXB 4GN1A 1IRSA 3SYXA 2IYBA 3PEGA 3PG7A 1N3HA 4KHAA 5LOPB 1Q67A 2DFKA 2KCJA 3A8PA 2CY4A 1RRPB 4L6EA 3F5RA 2MDXA 1GC7A 3X23A 5DIFB 4A6FA 4A6HA 1AQCA 1XODA 1ZC3B 4Z2MB 3PP2A 5CLQB 1XKEA 2UZSA 1DBHA 1KI1B 3ODOA 3SO6A 4K2OA 4EMOA 2CY5A 2K00A 2N23A 1KZ7A 1EF1A 5C5BB 1OQNA 3PVLA 4WSFA 1W1GA 3ZVRA 3PSCA 2D2QA 2H7DA 5D3WA 3PZDA 2XQNM 2Y8FA 1LB1A 4HAYB 3A8QA 2COFA 1WGQA 2NMBA 2D9WA 2LOZA 2DA0A 2RSGA 1U29A 2I5FA 1H10A 3HW2B 1NTVA 4GZUA 5J3YA 2YRYA 1DROA 4CHJA 1X1FA 2DYQA 1WG7A 2Z0PA 1W1HA 2EMSA 4EJNA 2J0MA 1XR0B 4ZRKA 1W1DA 1U5DA 4HB4B 2N0YA 4NY0A 4HAWB 2HTHB 3CIKA 2YT1A 2D9ZA 1I7AA 2QKMA 1P3RA 2YT0A 3FM8C 2KUPA 5KQ1A 3VOQA 2J0JA 5EFXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MK0 A;  2RNR B;  4HAZ B;  2Z0O A;  2DN6 A;  2IFS A;  2UVM A;  3KY9 A;  1V88 A;  1J0W A;  1TXD A;  5DH9 B;  3UZT A;  5CLL B;  3T06 A;  3KRW A;  1UEF A;  4IFS A;  2Z0Q A;  5DHA B;  4HAT B;  3TFM A;  2RVB B;  4PQ0 A;  1P5T A;  2DHJ A;  2DHI A;  1Y19 B;  1U27 A;  4GMV A;  2M14 A;  2P0D A;  2K2J A;  4ZRI A;  4C0A A;  2L1C A;  1FHX A;  1V61 A;  5JLJ B;  4WJ7 A;  1M7R A;  5KCV A;  5KQ4 A;  4F7H A;  3OAN A;  2LG1 A;  1J19 A;  1OMW A;  2M38 A;  1UNR A;  1WVH A;  2P0F A;  4KVG B;  2LOX A;  3WYF B;  2DYN A;  4A6F B;  4HAX B;  3GYP A;  2D9X A;  2L2I A;  2COD A;  3KSY A;  1MIZ B;  5GOW B;  4KHB B;  1PLS A;  1PMS A;  5D3X A;  3NSU A;  2YF0 A;  2EMT A;  5JHH A;  1V89 A;  1DDV A;  4CYE A;  5FI1 A;  1U5E A;  2PZ1 A;  3PVW A;  4NSW A;  3TVV A;  1X86 A;  3DXE A;  1OY2 A;  3D8D A;  1K5D B;  1WJ1 A;  4EKU A;  5DI9 B;  4K17 A;  1I2H A;  2ROV A;  2AL6 A;  2Q13 A;  4YL8 A;  1FHO A;  4Z2N A;  1TJ6 A;  2ELA A;  2X18 A;  3D8F A;  2DX5 A;  1K5G B;  2E2X A;  2YS5 A;  4B6H A;  2JP2 A;  5HE2 A;  4WVF B;  3P6A A;  4HAU B;  1GG3 A;  4Y94 A;  2CRF A;  3AU4 A;  1MPH A;  3ML4 A;  1U2B A;  5LON B;  3U7D A;  3DXC A;  5HE0 A;  5J3T A;  2R0D A;  5C79 A;  1M7E A;  3TCA A;  1BAK A;  2VRW B;  3FSS A;  1P6S A;  2DX1 A;  2I5C A;  4HHV A;  2P0H A;  4MY6 A;  3VIA A;  1QC6 A;  1X11 A;  2GCJ A;  4HDQ A;  1XCG A;  4XWX A;  2W2W A;  4ZRJ A;  3ULB A;  1UPQ A;  1ZM0 A;  4DXA B;  1XD4 A;  3M1I B;  2J59 M;  5L81 A;  2DKP A;  2BCJ A;  1Y5O A;  2H7E A;  3BIN A;  2ZPY A;  1DDW A;  1V5M A;  4CHM A;  5FI0 A;  4HB0 B;  2P8V A;  3IVF A;  3SV1 A;  3HQC A;  2D11 A;  3ODW A;  4HDO A;  1V5U A;  3V5W A;  5C5B A;  5C6R A;  3MPX A;  4TKN A;  1PFJ A;  3FEH A;  5D3V A;  1WGU A;  2ADZ A;  1ISN A;  5HE3 A;  2ROZ B;  4K2P A;  2OQB A;  1BWN A;  1KZG A;  4TYZ A;  2COA A;  2RGN B;  1EGX A;  1FGZ A;  1EVH A;  2YS3 A;  2YVC A;  4K81 A;  3A98 B;  5JHG A;  3SUZ A;  1MIX A;  2YS1 A;  2GS0 A;  1SHC A;  3MDB C;  3QWM A;  5D27 A;  5JP4 A;  2W2X C;  2I1J A;  2DLW A;  2ELB A;  5HE1 A;  2R09 A;  3U8Z A;  4IOY X;  2OTX A;  2UZR A;  4KHO A;  2MKR A;  2YSZ A;  3D8E A;  2MWN B;  1AWE A;  4IAP A;  1WJM A;  5D3Y A;  2KGX B;  4HB3 B;  1U5G A;  1EAZ A;  2DHK A;  3AJ4 A;  3LJU X;  1ZC4 B;  4DX8 A;  2VKI A;  2VSZ A;  5J3Q A;  3DXD A;  1BTN A;  2K2U A;  2GCL A;  1RJ2 A;  1MK9 B;  1ZSQ A;  3G9W A;  3ODX A;  1GC6 A;  4P7I A;  2GJY A;  1H4R A;  2D4Q A;  2DTC A;  3GYO A;  3RCP A;  1QQG A;  3WA0 A;  4MT7 A;  1ZVR A;  2LYD A;  4H8S A;  1DYN A;  3HK0 A;  2V76 A;  3SNH A;  2D10 A;  2Y8G A;  1B55 A;  2D9Y A;  4DX9 0;  2NZ8 B;  4HAV B;  2AEH A;  4F7G A;  4A5K A;  1U5F A;  1DDM A;  1LW3 A;  1NTY A;  2W2X D;  2LKO A;  3TO1 A;  4PNK A;  2CAY A;  3KZ1 A;  3N7C A;  4BBK A;  2EJ8 A;  2RUK B;  3KRX A;  4A6K A;  2I1K A;  3QBV B;  1MKE A;  1X05 A;  1SGH A;  1FHW A;  2FJL A;  3ZDT A;  4DBB A;  2G35 A;  3P7Z A;  2D9V A;  2Y7B A;  3TW1 A;  5DHF B;  1FAO A;  1NI2 A;  4D0N B;  1UPR A;  3BJI A;  1NU2 A;  2COC A;  3F0W A;  4KAX B;  1XX0 A;  3ULC A;  4GXB A;  1FB8 A;  4GPT B;  3PVU A;  2HE7 A;  1V5P A;  1FOE A;  1UNQ A;  1Z87 A;  1WI1 A;  1TQZ A;  3QIJ A;  4F7U P;  2J0K A;  2DKQ A;  1E5W A;  1X1G A;  3AU5 A;  2MFQ A;  1BTK A;  3CXB B;  2QKL A;  1FGY A;  3O96 A;  1UNP A;  4HB2 B;  4YON A;  2EC1 A;  2RLO A;  5C16 A;  2LUL A;  1MAI A;  1MK7 B;  4GMX B;  4GN1 A;  1IRS A;  3SYX A;  2IYB A;  3PEG A;  3PG7 A;  1N3H A;  4KHA A;  5LOP B;  1Q67 A;  2DFK A;  2KCJ A;  3A8P A;  2CY4 A;  1RRP B;  4L6E A;  3F5R A;  2MDX A;  1GC7 A;  3X23 A;  5DIF B;  4A6F A;  4A6H A;  1AQC A;  1XOD A;  1ZC3 B;  4Z2M B;  3PP2 A;  5CLQ B;  1XKE A;  2UZS A;  1DBH A;  1KI1 B;  3ODO A;  3SO6 A;  4K2O A;  4EMO A;  2CY5 A;  2K00 A;  2N23 A;  1KZ7 A;  1EF1 A;  5C5B B;  1OQN A;  3PVL A;  4WSF A;  1W1G A;  3ZVR A;  3PSC A;  2D2Q A;  2H7D A;  5D3W A;  3PZD A;  2XQN M;  2Y8F A;  1LB1 A;  4HAY B;  3A8Q A;  2COF A;  1WGQ A;  2NMB A;  2D9W A;  2LOZ A;  2DA0 A;  2RSG A;  1U29 A;  2I5F A;  1H10 A;  3HW2 B;  1NTV A;  4GZU A;  5J3Y A;  2YRY A;  1DRO A;  4CHJ A;  1X1F A;  2DYQ A;  1WG7 A;  2Z0P A;  1W1H A;  2EMS A;  4EJN A;  2J0M A;  1XR0 B;  4ZRK A;  1W1D A;  1U5D A;  4HB4 B;  2N0Y A;  4NY0 A;  4HAW B;  2HTH B;  3CIK A;  2YT1 A;  2D9Z A;  1I7A A;  2QKM A;  1P3R A;  2YT0 A;  3FM8 C;  2KUP A;  5KQ1 A;  3VOQ A;  2J0J A;  5EFX A; 
#chains in the Genus database with same CATH topology
 4MK0 A;  2RNR B;  4HAZ B;  2Z0O A;  2DN6 A;  2IFS A;  2UVM A;  3KY9 A;  1V88 A;  1J0W A;  1TXD A;  5DH9 B;  3UZT A;  5CLL B;  3T06 A;  3KRW A;  1UEF A;  4IFS A;  2Z0Q A;  2FJU B;  5DHA B;  4HAT B;  4HSI A;  3TFM A;  2RRF A;  2RVB B;  4PQ0 A;  1P5T A;  2DHJ A;  2DHI A;  1Y19 B;  1U27 A;  4GMV A;  2M14 A;  2P0D A;  2K2J A;  4ZRI A;  4C0A A;  2L1C A;  1FHX A;  1V61 A;  5JLJ B;  4WJ7 A;  1M7R A;  5KCV A;  5KQ4 A;  4F7H A;  3OAN A;  2LG1 A;  1J19 A;  1OMW A;  2M38 A;  1UNR A;  1WVH A;  2P0F A;  4KVG B;  2LOX A;  2Z4D A;  3WYF B;  2DYN A;  4A6F B;  4HAX B;  3GYP A;  2D9X A;  2L2I A;  2COD A;  3KSY A;  1MIZ B;  5GOW B;  4KHB B;  1PLS A;  1PMS A;  5D3X A;  3NSU A;  2YF0 A;  2EMT A;  5JHH A;  1V89 A;  1DDV A;  4CYE A;  5FI1 A;  1U5E A;  2PZ1 A;  3PVW A;  4NSW A;  3TVV A;  1X86 A;  3DXE A;  1OY2 A;  3D8D A;  1K5D B;  1WJ1 A;  4EKU A;  5DI9 B;  4K17 A;  1I2H A;  2ROV A;  2AL6 A;  2Q13 A;  4YL8 A;  1FHO A;  4Z2N A;  4D6W A;  1TJ6 A;  2ELA A;  2X18 A;  3D8F A;  4DIX A;  2DX5 A;  1K5G B;  2E2X A;  2YS5 A;  4B6H A;  2JP2 A;  5HE2 A;  4WVF B;  3P6A A;  1GG3 A;  4HAU B;  4Y94 A;  2CRF A;  3AU4 A;  3U12 A;  1MPH A;  3ML4 A;  1U2B A;  5LON B;  3U7D A;  3DXC A;  5HE0 A;  5J3T A;  2GUM A;  2R0D A;  2YT2 A;  4OSN A;  5C79 A;  1M7E A;  3TCA A;  1BAK A;  2VRW B;  3FSS A;  1P6S A;  2DX1 A;  2I5C A;  4HHV A;  2P0H A;  4MY6 A;  3VIA A;  1QC6 A;  1X11 A;  2GCJ A;  4HDQ A;  1XCG A;  4XWX A;  2W2W A;  4ZRJ A;  3ULB A;  1UPQ A;  3HIE A;  1ZM0 A;  4DXA B;  5IRS A;  4GNK B;  1XD4 A;  3M1I B;  2J59 M;  5M4Y B;  5L81 A;  2DKP A;  2BCJ A;  1Y5O A;  2H7E A;  3BIN A;  2ZPY A;  1DDW A;  1V5M A;  4CHM A;  5FI0 A;  4HB0 B;  2P8V A;  3IVF A;  3SV1 A;  3HQC A;  2D11 A;  3ODW A;  4HDO A;  1V5U A;  3V5W A;  2K8E A;  5C5B A;  5C6R A;  3MPX A;  4TKN A;  1PFJ A;  3FEH A;  5D3V A;  1WGU A;  2ADZ A;  4KHB A;  1ISN A;  5HE3 A;  2ROZ B;  4K2P A;  2OQB A;  1BWN A;  3A58 A;  1KZG A;  4TYZ A;  2COA A;  2RGN B;  4QJ5 B;  1EGX A;  1FGZ A;  1EVH A;  2YS3 A;  2KUQ A;  1MI1 A;  2YVC A;  4K81 A;  3A98 B;  5JHG A;  3SUZ A;  1MIX A;  2YS1 A;  2GS0 A;  2Z14 A;  1SHC A;  3MDB C;  3QWM A;  5D27 A;  5JP4 A;  2W2X C;  2I1J A;  2DLW A;  2ELB A;  5HE1 A;  2R09 A;  3U8Z A;  5LG4 B;  1ZYI A;  4IOY X;  2OTX A;  2K49 A;  2UZR A;  3NWD A;  4KHO A;  2MKR A;  2YSZ A;  3D8E A;  2MWN B;  1AWE A;  4IAP A;  1WJM A;  5D3Y A;  2KGX B;  4HB3 B;  2Z59 A;  1U5G A;  1EAZ A;  2DHK A;  3AJ4 A;  3LJU X;  1ZC4 B;  4DX8 A;  2VKI A;  4OT1 A;  2VSZ A;  5J3Q A;  2ZKM X;  3DXD A;  1BTN A;  2K2U A;  2GCL A;  1RJ2 A;  1MK9 B;  1ZSQ A;  3G9W A;  4QJ4 B;  3ODX A;  1GC6 A;  3NW8 A;  4P7I A;  2GJY A;  1H4R A;  2D4Q A;  2DTC A;  3GYO A;  3RCP A;  1QQG A;  3WA0 A;  4MT7 A;  1ZVR A;  2LYD A;  4H8S A;  1DYN A;  3HK0 A;  2V76 A;  3SNH A;  2D10 A;  4QJ3 B;  2Y8G A;  1B55 A;  2D9Y A;  4DX9 0;  2NZ8 B;  2KIE A;  4HAV B;  2AEH A;  4F7G A;  4A5K A;  1U5F A;  1DDM A;  1LW3 A;  1NTY A;  2R2Y A;  2W2X D;  2LKO A;  3TO1 A;  4PNK A;  2CAY A;  3KZ1 A;  3N7C A;  2KIG A;  4BBK A;  2EJ8 A;  2RUK B;  3KRX A;  3HSA A;  4A6K A;  2I1K A;  3QBV B;  1MKE A;  1X05 A;  1SGH A;  1FHW A;  2FJL A;  3ZDT A;  4DBB A;  2G35 A;  3P7Z A;  2D9V A;  2NBV A;  2Y7B A;  3TW1 A;  5DHF B;  1FAO A;  1NI2 A;  4D0N B;  1UPR A;  3BJI A;  1NU2 A;  2COC A;  3F0W A;  4KAX B;  1XX0 A;  3ULC A;  4GXB A;  1FB8 A;  4GOU A;  4GPT B;  5I2S A;  3PVU A;  2HE7 A;  1V5P A;  1FOE A;  1UNQ A;  1Z87 A;  1WI1 A;  1TQZ A;  3QIJ A;  4F7U P;  2J0K A;  2DKQ A;  1E5W A;  1X1G A;  3AU5 A;  2MFQ A;  4CSQ A;  3B77 A;  1BTK A;  3CXB B;  2QKL A;  1FGY A;  3O96 A;  1UNP A;  4HB2 B;  4YON A;  2EC1 A;  2RLO A;  5C16 A;  2LUL A;  1MAI A;  1MK7 B;  4GMX B;  4GN1 A;  1IRS A;  3SYX A;  2IYB A;  3PEG A;  3PG7 A;  1N3H A;  4KHA A;  5LOP B;  1Q67 A;  2DFK A;  2Z13 A;  2KCJ A;  3A8P A;  2CY4 A;  1RRP B;  4L6E A;  3F5R A;  2MDX A;  1GC7 A;  3X23 A;  5DIF B;  4A6F A;  4A6H A;  1AQC A;  1XOD A;  1ZC3 B;  3NWF A;  4QXA B;  4Z2M B;  3PP2 A;  5CLQ B;  1XKE A;  2UZS A;  1DBH A;  1KI1 B;  3ODO A;  3SO6 A;  3DCX A;  4K2O A;  4EMO A;  2CY5 A;  2K00 A;  2N23 A;  3NWA A;  1KZ7 A;  1EF1 A;  5C5B B;  1OQN A;  3PVL A;  4WSF A;  1W1G A;  3ZVR A;  3PSC A;  2D2Q A;  2H7D A;  5D3W A;  3PZD A;  2XQN M;  2Y8F A;  1LB1 A;  4HAY B;  3A8Q A;  2COF A;  1WGQ A;  2NMB A;  2D9W A;  2LOZ A;  4L1R A;  2DA0 A;  1T77 A;  2RSG A;  1U29 A;  2I5F A;  1H10 A;  3HW2 B;  1NTV A;  4GZU A;  5J3Y A;  2YRY A;  1DRO A;  4CHJ A;  1X1F A;  2DYQ A;  1WG7 A;  2Z0P A;  1W1H A;  2EMS A;  4EJN A;  2J0M A;  1XR0 B;  4ZRK A;  1W1D A;  1U5D A;  2KR0 A;  4HB4 B;  5I2M A;  2N0Y A;  4NY0 A;  4HAW B;  2HTH B;  3CIK A;  2YT1 A;  2D9Z A;  1I7A A;  2QKM A;  1P3R A;  2YT0 A;  3FM8 C;  2KUP A;  3OHM B;  5KQ1 A;  3VOQ A;  2J0J A;  3FVC A;  5EFX A; 
#chains in the Genus database with same CATH homology
 4MK0 A;  2RNR B;  4HAZ B;  2Z0O A;  2DN6 A;  2IFS A;  2UVM A;  3KY9 A;  1V88 A;  1J0W A;  1TXD A;  5DH9 B;  3UZT A;  5CLL B;  3T06 A;  3KRW A;  1UEF A;  4IFS A;  2Z0Q A;  5DHA B;  4HAT B;  3TFM A;  2RVB B;  4PQ0 A;  1P5T A;  2DHJ A;  2DHI A;  1Y19 B;  1U27 A;  4GMV A;  2M14 A;  2P0D A;  2K2J A;  4ZRI A;  4C0A A;  2L1C A;  1FHX A;  1V61 A;  5JLJ B;  4WJ7 A;  1M7R A;  5KCV A;  5KQ4 A;  4F7H A;  3OAN A;  2LG1 A;  1J19 A;  1OMW A;  2M38 A;  1UNR A;  1WVH A;  2P0F A;  4KVG B;  2LOX A;  3WYF B;  2DYN A;  4A6F B;  4HAX B;  3GYP A;  2D9X A;  2L2I A;  2COD A;  3KSY A;  1MIZ B;  5GOW B;  4KHB B;  1PLS A;  1PMS A;  5D3X A;  3NSU A;  2YF0 A;  2EMT A;  5JHH A;  1V89 A;  1DDV A;  4CYE A;  5FI1 A;  1U5E A;  2PZ1 A;  3PVW A;  4NSW A;  3TVV A;  1X86 A;  3DXE A;  1OY2 A;  3D8D A;  1K5D B;  1WJ1 A;  4EKU A;  5DI9 B;  4K17 A;  1I2H A;  2ROV A;  2AL6 A;  2Q13 A;  4YL8 A;  1FHO A;  4Z2N A;  1TJ6 A;  2ELA A;  2X18 A;  3D8F A;  2DX5 A;  1K5G B;  2E2X A;  2YS5 A;  4B6H A;  2JP2 A;  5HE2 A;  4WVF B;  3P6A A;  4HAU B;  1GG3 A;  4Y94 A;  2CRF A;  3AU4 A;  1MPH A;  3ML4 A;  1U2B A;  5LON B;  3U7D A;  3DXC A;  5HE0 A;  5J3T A;  2R0D A;  5C79 A;  1M7E A;  3TCA A;  1BAK A;  2VRW B;  3FSS A;  1P6S A;  2DX1 A;  2I5C A;  4HHV A;  2P0H A;  4MY6 A;  3VIA A;  1QC6 A;  1X11 A;  2GCJ A;  4HDQ A;  1XCG A;  4XWX A;  2W2W A;  4ZRJ A;  3ULB A;  1UPQ A;  1ZM0 A;  4DXA B;  1XD4 A;  3M1I B;  2J59 M;  5L81 A;  2DKP A;  2BCJ A;  1Y5O A;  2H7E A;  3BIN A;  2ZPY A;  1DDW A;  1V5M A;  4CHM A;  5FI0 A;  4HB0 B;  2P8V A;  3IVF A;  3SV1 A;  3HQC A;  2D11 A;  3ODW A;  4HDO A;  1V5U A;  3V5W A;  5C5B A;  5C6R A;  3MPX A;  4TKN A;  1PFJ A;  3FEH A;  5D3V A;  1WGU A;  2ADZ A;  1ISN A;  5HE3 A;  2ROZ B;  4K2P A;  2OQB A;  1BWN A;  1KZG A;  4TYZ A;  2COA A;  2RGN B;  1EGX A;  1FGZ A;  1EVH A;  2YS3 A;  2YVC A;  4K81 A;  3A98 B;  5JHG A;  3SUZ A;  1MIX A;  2YS1 A;  2GS0 A;  1SHC A;  3MDB C;  3QWM A;  5D27 A;  5JP4 A;  2W2X C;  2I1J A;  2DLW A;  2ELB A;  5HE1 A;  2R09 A;  3U8Z A;  4IOY X;  2OTX A;  2UZR A;  4KHO A;  2MKR A;  2YSZ A;  3D8E A;  2MWN B;  1AWE A;  4IAP A;  1WJM A;  5D3Y A;  2KGX B;  4HB3 B;  1U5G A;  1EAZ A;  2DHK A;  3AJ4 A;  3LJU X;  1ZC4 B;  4DX8 A;  2VKI A;  2VSZ A;  5J3Q A;  3DXD A;  1BTN A;  2K2U A;  2GCL A;  1RJ2 A;  1MK9 B;  1ZSQ A;  3G9W A;  3ODX A;  1GC6 A;  4P7I A;  2GJY A;  1H4R A;  2D4Q A;  2DTC A;  3GYO A;  3RCP A;  1QQG A;  3WA0 A;  4MT7 A;  1ZVR A;  2LYD A;  4H8S A;  1DYN A;  3HK0 A;  2V76 A;  3SNH A;  2D10 A;  2Y8G A;  1B55 A;  2D9Y A;  4DX9 0;  2NZ8 B;  4HAV B;  2AEH A;  4F7G A;  4A5K A;  1U5F A;  1DDM A;  1LW3 A;  1NTY A;  2W2X D;  2LKO A;  3TO1 A;  4PNK A;  2CAY A;  3KZ1 A;  3N7C A;  4BBK A;  2EJ8 A;  2RUK B;  3KRX A;  4A6K A;  2I1K A;  3QBV B;  1MKE A;  1X05 A;  1SGH A;  1FHW A;  2FJL A;  3ZDT A;  4DBB A;  2G35 A;  3P7Z A;  2D9V A;  2Y7B A;  3TW1 A;  5DHF B;  1FAO A;  1NI2 A;  4D0N B;  1UPR A;  3BJI A;  1NU2 A;  2COC A;  3F0W A;  4KAX B;  1XX0 A;  3ULC A;  4GXB A;  1FB8 A;  4GPT B;  3PVU A;  2HE7 A;  1V5P A;  1FOE A;  1UNQ A;  1Z87 A;  1WI1 A;  1TQZ A;  3QIJ A;  4F7U P;  2J0K A;  2DKQ A;  1E5W A;  1X1G A;  3AU5 A;  2MFQ A;  1BTK A;  3CXB B;  2QKL A;  1FGY A;  3O96 A;  1UNP A;  4HB2 B;  4YON A;  2EC1 A;  2RLO A;  5C16 A;  2LUL A;  1MAI A;  1MK7 B;  4GMX B;  4GN1 A;  1IRS A;  3SYX A;  2IYB A;  3PEG A;  3PG7 A;  1N3H A;  4KHA A;  5LOP B;  1Q67 A;  2DFK A;  2KCJ A;  3A8P A;  2CY4 A;  1RRP B;  4L6E A;  3F5R A;  2MDX A;  1GC7 A;  3X23 A;  5DIF B;  4A6F A;  4A6H A;  1AQC A;  1XOD A;  1ZC3 B;  4Z2M B;  3PP2 A;  5CLQ B;  1XKE A;  2UZS A;  1DBH A;  1KI1 B;  3ODO A;  3SO6 A;  4K2O A;  4EMO A;  2CY5 A;  2K00 A;  2N23 A;  1KZ7 A;  1EF1 A;  5C5B B;  1OQN A;  3PVL A;  4WSF A;  1W1G A;  3ZVR A;  3PSC A;  2D2Q A;  2H7D A;  5D3W A;  3PZD A;  2XQN M;  2Y8F A;  1LB1 A;  4HAY B;  3A8Q A;  2COF A;  1WGQ A;  2NMB A;  2D9W A;  2LOZ A;  2DA0 A;  2RSG A;  1U29 A;  2I5F A;  1H10 A;  3HW2 B;  1NTV A;  4GZU A;  5J3Y A;  2YRY A;  1DRO A;  4CHJ A;  1X1F A;  2DYQ A;  1WG7 A;  2Z0P A;  1W1H A;  2EMS A;  4EJN A;  2J0M A;  1XR0 B;  4ZRK A;  1W1D A;  1U5D A;  4HB4 B;  2N0Y A;  4NY0 A;  4HAW B;  2HTH B;  3CIK A;  2YT1 A;  2D9Z A;  1I7A A;  2QKM A;  1P3R A;  2YT0 A;  3FM8 C;  2KUP A;  5KQ1 A;  3VOQ A;  2J0J A;  5EFX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...