1PMSA

Pleckstrin homology domain of son of sevenless 1 (sos1) with glycine-serine added to the n-terminus, nmr, 20 structures
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
135
structure length
135
Chain Sequence
SKQLAIKKMNEIQKNIDGWEGKDIGQCCNEFIMEGTLTRVGAKHERHIFLFDGLMICCKSNHGQPRLPGASSAEYRLKEKFFMRKVQINDKDDTSEYKHAFEIILKDGNSVIFSAKSAEEKNNWMAALISLQYRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords SOS 1
publication title The solution structure of the pleckstrin homology domain of mouse Son-of-sevenless 1 (mSos1).
pubmed doi rcsb
source organism Mus musculus
molecule tags Signal transduction
total genus 14
structure length 135
sequence length 135
ec nomenclature
pdb deposition date 1997-02-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00169 PH PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1pmsA00
2GS0A 4HAZB 2J0KA 5DH9B 5GOWB 2VSZA 1X86A 1MK7B 4F7GA 3A8PA 5FI0A 4NY0A 3OANA 3ZDTA 2DYQA 1NU2A 1B55A 4HAVB 3MPXA 1U2BA 4KHOA 1KZ7A 2D9ZA 2P0HA 4WJ7A 5JLJB 1Z87A 2DHJA 4KHBB 5D3WA 3VOQA 1EVHA 1V5MA 2KGXB 3MDBC 2R0DA 2VKIA 3LJUX 2M38A 2YRYA 4HAXB 4D0NB 4GMXB 3PSCA 3D8EA 2H7EA 1XD4A 5HE0A 3D8FA 3G9WA 1H4RA 2CAYA 3GYOA 1PMSA 3DXEA 5DI9B 4ZRKA 3TCAA 3RCPA 3QBVB 1TJ6A 3A8QA 3PVWA 2GCLA 4HHVA 4K81A 2H7DA 2P0DA 2NMBA 2YS1A 4HAYB 5D3YA 2EJ8A 1IRSA 2YVCA 3ODWA 4PQ0A 3F5RA 1QQGA 2DX1A 1GG3A 4L6EA 3T06A 2DFKA 2GJYA 4P7IA 2CODA 5LONB 2MFQA 1WGUA 3BINA 2DTCA 3TFMA 3PP2A 4Y94A 5KCVA 2DN6A 2P0FA 2I5FA 4MT7A 1NTVA 2AL6A 2LYDA 2OTXA 1DDWA 1OMWA 4GMVA 3PVUA 2UVMA 1W1GA 5J3QA 1WG7A 1M7EA 2Z0OA 3TW1A 3U7DA 2RNRB 1AWEA 2J59M 3ODXA 2KCJA 4DBBA 1X05A 1P3RA 4GN1A 1UPRA 2I1JA 1BWNA 1DYNA 1UNRA 1QC6A 1I2HA 2E2XA 1TXDA 4DX90 3N7CA 2HTHB 1MPHA 2ROZB 2LKOA 3AU5A 2ELBA 1UNQA 3WYFB 1J19A 1U5GA 2IFSA 1MIXA 3PZDA 4IAPA 4CYEA 2W2WA 2YT0A 4F7HA 5JP4A 5D3VA 3KY9A 1P6SA 4PNKA 2N0YA 2Y8GA 4HB2B 1SGHA 3F0WA 3TVVA 4C0AA 4HDQA 1J0WA 2K2UA 2BCJA 5DIFB 1FAOA 1FB8A 5HE2A 3UZTA 5D3XA 1LB1A 3GYPA 3P7ZA 1ISNA 2L1CA 2RLOA 1TQZA 5JHGA 3KRXA 5HE3A 4HB0B 4F7UP 4CHMA 1XR0B 3FM8C 4GPTB 3SO6A 2MDXA 2RVBB 4DX8A 1ZVRA 3SYXA 4B6HA 2LULA 1FGZA 4GXBA 3AJ4A 1I7AA 2W2XC 1XCGA 2Y8FA 4XWXA 4A6HA 2L2IA 2I1KA 3NSUA 2COAA 4MK0A 3QIJA 4HB3B 3SV1A 5C5BA 1N3HA 3DXCA 2D9WA 2YS5A 3PVLA 2YT1A 2YF0A 2D11A 2CRFA 1X1FA 2RSGA 4EKUA 1U5FA 1KI1B 3FEHA 2J0MA 1EF1A 2M14A 3HQCA 2ZPYA 3O96A 4K2OA 1RRPB 2LG1A 3AU4A 3V5WA 2EMSA 1NI2A 2DKPA 2COCA 4EMOA 4NSWA 2NZ8B 2QKLA 1FGYA 5KQ1A 4HATB 1DDVA 4IOYX 2KUPA 1FOEA 1LW3A 2ELAA 2UZRA 4HDOA 5DHFB 1V5PA 3TO1A 3WA0A 2RGNB 2GCJA 3BJIA 3X23A 1XX0A 4Z2NA 1Q67A 1UNPA 2UZSA 2D9VA 4A6FA 1FHWA 3PEGA 2R09A 4CHJA 3CXBB 3IVFA 2MWNB 2ADZA 4Z2MB 1GC6A 1MIZB 1DDMA 4A5KA 2DHKA 1ZC3B 2D9XA 5C16A 2N23A 4WVFB 1NTYA 1Y5OA 4GZUA 1MAIA 5J3TA 1EAZA 4HB4B 1AQCA 2EMTA 1FHOA 4KAXB 1K5GB 3DXDA 3PG7A 1W1HA 1Y19B 1KZGA 5C6RA 1X11A 2VRWB 4BBKA 2QKMA 2P8VA 3P6AA 4YONA 2YS3A 2FJLA 5KQ4A 4HAWB 1RJ2A 1UPQA 1V89A 2COFA 1K5DB 1XODA 1ZSQA 4YL8A 4HAUB 2K2JA 2IYBA 3A98B 5DHAB 2DKQA 2Q13A 1SHCA 3ULCA 2OQBA 2CY5A 2DX5A 1PLSA 2JP2A 3M1IB 4EJNA 1E5WA 1WVHA 2Z0PA 5C5BB 1WGQA 4K17A 2Z0QA 1UEFA 2X18A 3FSSA 1M7RA 1DROA 4ZRIA 5CLLB 2DLWA 3ZVRA 2AEHA 2D9YA 3VIAA 2PZ1A 1U5EA 4ZRJA 4WSFA 5FI1A 4A6KA 4MY6A 2V76A 4IFSA 1U5DA 2W2XD 2LOXA 1BTNA 2DYNA 5C79A 1X1GA 1FHXA 2YSZA 1XKEA 3U8ZA 1MK9B 2MKRA 4H8SA 1W1DA 1WJMA 3KSYA 3HW2B 2ROVA 1GC7A 5L81A 3SUZA 1ZC4B 1H10A 3KZ1A 4A6FB 1V5UA 1DBHA 1P5TA 4TKNA 1U27A 1U29A 2D4QA 2D2QA 1EGXA 4K2PA 1WJ1A 5EFXA 2CY4A 5LOPB 5CLQB 2DA0A 1V61A 1MKEA 2LOZA 1OY2A 1ZM0A 1BTKA 2I5CA 2XQNM 4KHAA 3CIKA 3ULBA 5JHHA 1BAKA 2RUKB 5J3YA 2G35A 4TYZA 1OQNA 2Y7BA 3SNHA 3ODOA 1PFJA 4KVGB 2J0JA 3D8DA 2EC1A 2HE7A 3QWMA 5D27A 5HE1A 2K00A 3ML4A 2D10A 1WI1A 3KRWA 2DHIA 1V88A 4DXAB 3HK0A
chains in the Genus database with same CATH superfamily
2GS0A 4HAZB 2J0KA 5DH9B 5GOWB 2VSZA 1X86A 1MK7B 4F7GA 3A8PA 5FI0A 4NY0A 3OANA 3ZDTA 2DYQA 1NU2A 1B55A 4HAVB 3MPXA 1U2BA 4QXAB 4KHOA 1KZ7A 2D9ZA 2P0HA 4WJ7A 5JLJB 1Z87A 2DHJA 4KHBB 5D3WA 3VOQA 1EVHA 1V5MA 2KGXB 3DCXA 3MDBC 2R0DA 2VKIA 3LJUX 2M38A 2KIGA 2YRYA 4HAXB 2FJUB 4D0NB 4GMXB 3PSCA 3D8EA 2H7EA 1XD4A 5HE0A 3D8FA 3G9WA 1H4RA 3NWAA 2CAYA 3GYOA 1PMSA 3DXEA 5DI9B 4ZRKA 3TCAA 3RCPA 3QBVB 1TJ6A 4OT1A 3A8QA 3PVWA 2GCLA 4HHVA 4K81A 2H7DA 2P0DA 2NMBA 2YS1A 4HAYB 5D3YA 2EJ8A 1IRSA 2YVCA 3ODWA 3U12A 4PQ0A 3F5RA 1QQGA 3NWFA 2DX1A 1GG3A 4L6EA 5I2SA 3T06A 2DFKA 2GJYA 2Z13A 4P7IA 2CODA 2GUMA 5LONB 2MFQA 1WGUA 3BINA 2DTCA 3TFMA 3PP2A 4Y94A 5KCVA 2DN6A 2P0FA 2I5FA 4MT7A 1NTVA 2AL6A 2LYDA 2K8EA 2OTXA 1DDWA 1OMWA 4GMVA 3PVUA 2UVMA 1T77A 1W1GA 5J3QA 1WG7A 1M7EA 2Z0OA 3TW1A 3U7DA 2RNRB 1AWEA 2J59M 3ODXA 2KCJA 4DBBA 1X05A 1P3RA 4GN1A 1UPRA 2I1JA 1BWNA 1DYNA 1UNRA 1QC6A 1I2HA 2E2XA 1TXDA 4DX90 3N7CA 2HTHB 1MPHA 2ROZB 2LKOA 3AU5A 2ELBA 1UNQA 3WYFB 1J19A 1MI1A 1U5GA 2IFSA 1MIXA 3PZDA 4IAPA 4CYEA 2W2WA 4QJ4B 2YT0A 4F7HA 5JP4A 5D3VA 3KY9A 1P6SA 4PNKA 2N0YA 2Y8GA 4HB2B 1SGHA 4QJ5B 3F0WA 3TVVA 4C0AA 4HDQA 1J0WA 3NWDA 2K2UA 2BCJA 5DIFB 1FAOA 1FB8A 5HE2A 3UZTA 5D3XA 1LB1A 3GYPA 3P7ZA 1ISNA 2L1CA 2RLOA 1TQZA 5JHGA 3KRXA 5HE3A 4HB0B 4F7UP 4CHMA 1XR0B 3FM8C 4GPTB 3SO6A 2YT2A 2MDXA 2RVBB 4DX8A 1ZVRA 3SYXA 4B6HA 2LULA 1FGZA 4GXBA 3AJ4A 1I7AA 2W2XC 1XCGA 2Y8FA 4XWXA 4A6HA 2L2IA 2I1KA 3OHMB 3NSUA 2COAA 4MK0A 3QIJA 4HB3B 3SV1A 3HSAA 5C5BA 1N3HA 3DXCA 2D9WA 2YS5A 3PVLA 2YT1A 2Z14A 2YF0A 2D11A 2CRFA 1X1FA 2ZKMX 2Z59A 2RSGA 4EKUA 2Z4DA 2KIEA 1U5FA 1KI1B 5LG4B 3FEHA 2J0MA 1EF1A 2M14A 3HQCA 2ZPYA 3O96A 4K2OA 1RRPB 2LG1A 3AU4A 3V5WA 2EMSA 1NI2A 2DKPA 2COCA 4EMOA 4NSWA 2NZ8B 2QKLA 1FGYA 5KQ1A 4HATB 1DDVA 4IOYX 4HSIA 2KUPA 1FOEA 1LW3A 2ELAA 2UZRA 4HDOA 5DHFB 1V5PA 3TO1A 3WA0A 2RGNB 2KUQA 2GCJA 3BJIA 3X23A 1XX0A 4Z2NA 1Q67A 1UNPA 2UZSA 2D9VA 4A6FA 1FHWA 3B77A 3PEGA 2R09A 4CHJA 3CXBB 3IVFA 2MWNB 2ADZA 4Z2MB 1GC6A 1MIZB 2KR0A 1DDMA 4A5KA 2DHKA 1ZC3B 2D9XA 3A58A 2NBVA 5C16A 4CSQA 2N23A 4WVFB 1NTYA 1Y5OA 4GZUA 1MAIA 5J3TA 1EAZA 4HB4B 1AQCA 2EMTA 1FHOA 4KAXB 1K5GB 3DXDA 3PG7A 1W1HA 1Y19B 1KZGA 3NW8A 5C6RA 1X11A 2VRWB 4BBKA 2QKMA 1ZYIA 2P8VA 3P6AA 4YONA 2YS3A 2FJLA 5KQ4A 4HAWB 1RJ2A 1UPQA 3HIEA 1V89A 2COFA 1K5DB 1XODA 2RRFA 1ZSQA 4YL8A 4HAUB 2K2JA 2IYBA 3A98B 5DHAB 4L1RA 2DKQA 2Q13A 1SHCA 3ULCA 2OQBA 4GOUA 2CY5A 2DX5A 1PLSA 2JP2A 3M1IB 4EJNA 1E5WA 1WVHA 2Z0PA 5C5BB 1WGQA 2K49A 4K17A 2Z0QA 1UEFA 2X18A 3FSSA 1M7RA 1DROA 4ZRIA 5CLLB 2DLWA 3ZVRA 2AEHA 5M4YB 4KHBA 2D9YA 3VIAA 2PZ1A 1U5EA 4ZRJA 4WSFA 5FI1A 4D6WA 4A6KA 4MY6A 2V76A 4IFSA 1U5DA 2W2XD 2LOXA 1BTNA 2DYNA 5C79A 1X1GA 1FHXA 2YSZA 1XKEA 3U8ZA 1MK9B 2MKRA 4H8SA 1W1DA 1WJMA 3KSYA 3HW2B 2ROVA 1GC7A 5L81A 3SUZA 1ZC4B 1H10A 3KZ1A 4A6FB 1V5UA 3FVCA 1DBHA 1P5TA 4TKNA 1U27A 1U29A 4GNKB 2D4QA 2D2QA 1EGXA 4K2PA 1WJ1A 5EFXA 4OSNA 2CY4A 5LOPB 5CLQB 2DA0A 1V61A 1MKEA 2LOZA 5I2MA 1OY2A 1ZM0A 1BTKA 2I5CA 2XQNM 4KHAA 3CIKA 3ULBA 5JHHA 1BAKA 2RUKB 2R2YA 5J3YA 2G35A 4TYZA 1OQNA 2Y7BA 3SNHA 3ODOA 4DIXA 1PFJA 4KVGB 2J0JA 3D8DA 2EC1A 2HE7A 3QWMA 5D27A 5HE1A 2K00A 5IRSA 2D10A 3ML4A 1WI1A 3KRWA 4QJ3B 2DHIA 1V88A 4DXAB 3HK0A
chains in the Genus database with same CATH topology
2GS0A 4HAZB 2J0KA 5DH9B 5GOWB 2VSZA 1X86A 1MK7B 4F7GA 3A8PA 5FI0A 4NY0A 3OANA 3ZDTA 2DYQA 1NU2A 1B55A 4HAVB 3MPXA 1U2BA 4KHOA 1KZ7A 2D9ZA 2P0HA 4WJ7A 5JLJB 1Z87A 2DHJA 4KHBB 5D3WA 3VOQA 1EVHA 1V5MA 2KGXB 3MDBC 2R0DA 2VKIA 3LJUX 2M38A 2YRYA 4HAXB 4D0NB 4GMXB 3PSCA 3D8EA 2H7EA 1XD4A 5HE0A 3D8FA 3G9WA 1H4RA 2CAYA 3GYOA 1PMSA 3DXEA 5DI9B 4ZRKA 3TCAA 3RCPA 3QBVB 1TJ6A 3A8QA 3PVWA 2GCLA 4HHVA 4K81A 2H7DA 2P0DA 2NMBA 2YS1A 4HAYB 5D3YA 2EJ8A 1IRSA 2YVCA 3ODWA 4PQ0A 3F5RA 1QQGA 2DX1A 1GG3A 4L6EA 3T06A 2DFKA 2GJYA 4P7IA 2CODA 5LONB 2MFQA 1WGUA 3BINA 2DTCA 3TFMA 3PP2A 4Y94A 5KCVA 2DN6A 2P0FA 2I5FA 4MT7A 1NTVA 2AL6A 2LYDA 2OTXA 1DDWA 1OMWA 4GMVA 3PVUA 2UVMA 1W1GA 5J3QA 1WG7A 1M7EA 2Z0OA 3TW1A 3U7DA 2RNRB 1AWEA 2J59M 3ODXA 2KCJA 4DBBA 1X05A 1P3RA 4GN1A 1UPRA 2I1JA 1BWNA 1DYNA 1UNRA 1QC6A 1I2HA 2E2XA 1TXDA 4DX90 3N7CA 2HTHB 1MPHA 2ROZB 2LKOA 3AU5A 2ELBA 1UNQA 3WYFB 1J19A 1U5GA 2IFSA 1MIXA 3PZDA 4IAPA 4CYEA 2W2WA 2YT0A 4F7HA 5JP4A 5D3VA 3KY9A 1P6SA 4PNKA 2N0YA 2Y8GA 4HB2B 1SGHA 3F0WA 3TVVA 4C0AA 4HDQA 1J0WA 2K2UA 2BCJA 5DIFB 1FAOA 1FB8A 5HE2A 3UZTA 5D3XA 1LB1A 3GYPA 3P7ZA 1ISNA 2L1CA 2RLOA 1TQZA 5JHGA 3KRXA 5HE3A 4HB0B 4F7UP 4CHMA 1XR0B 3FM8C 4GPTB 3SO6A 2MDXA 2RVBB 4DX8A 1ZVRA 3SYXA 4B6HA 2LULA 1FGZA 4GXBA 3AJ4A 1I7AA 2W2XC 1XCGA 2Y8FA 4XWXA 4A6HA 2L2IA 2I1KA 3NSUA 2COAA 4MK0A 3QIJA 4HB3B 3SV1A 5C5BA 1N3HA 3DXCA 2D9WA 2YS5A 3PVLA 2YT1A 2YF0A 2D11A 2CRFA 1X1FA 2RSGA 4EKUA 1U5FA 1KI1B 3FEHA 2J0MA 1EF1A 2M14A 3HQCA 2ZPYA 3O96A 4K2OA 1RRPB 2LG1A 3AU4A 3V5WA 2EMSA 1NI2A 2DKPA 2COCA 4EMOA 4NSWA 2NZ8B 2QKLA 1FGYA 5KQ1A 4HATB 1DDVA 4IOYX 2KUPA 1FOEA 1LW3A 2ELAA 2UZRA 4HDOA 5DHFB 1V5PA 3TO1A 3WA0A 2RGNB 2GCJA 3BJIA 3X23A 1XX0A 4Z2NA 1Q67A 1UNPA 2UZSA 2D9VA 4A6FA 1FHWA 3PEGA 2R09A 4CHJA 3CXBB 3IVFA 2MWNB 2ADZA 4Z2MB 1GC6A 1MIZB 1DDMA 4A5KA 2DHKA 1ZC3B 2D9XA 5C16A 2N23A 4WVFB 1NTYA 1Y5OA 4GZUA 1MAIA 5J3TA 1EAZA 4HB4B 1AQCA 2EMTA 1FHOA 4KAXB 1K5GB 3DXDA 3PG7A 1W1HA 1Y19B 1KZGA 5C6RA 1X11A 2VRWB 4BBKA 2QKMA 2P8VA 3P6AA 4YONA 2YS3A 2FJLA 5KQ4A 4HAWB 1RJ2A 1UPQA 1V89A 2COFA 1K5DB 1XODA 1ZSQA 4YL8A 4HAUB 2K2JA 2IYBA 3A98B 5DHAB 2DKQA 2Q13A 1SHCA 3ULCA 2OQBA 2CY5A 2DX5A 1PLSA 2JP2A 3M1IB 4EJNA 1E5WA 1WVHA 2Z0PA 5C5BB 1WGQA 4K17A 2Z0QA 1UEFA 2X18A 3FSSA 1M7RA 1DROA 4ZRIA 5CLLB 2DLWA 3ZVRA 2AEHA 2D9YA 3VIAA 2PZ1A 1U5EA 4ZRJA 4WSFA 5FI1A 4A6KA 4MY6A 2V76A 4IFSA 1U5DA 2W2XD 2LOXA 1BTNA 2DYNA 5C79A 1X1GA 1FHXA 2YSZA 1XKEA 3U8ZA 1MK9B 2MKRA 4H8SA 1W1DA 1WJMA 3KSYA 3HW2B 2ROVA 1GC7A 5L81A 3SUZA 1ZC4B 1H10A 3KZ1A 4A6FB 1V5UA 1DBHA 1P5TA 4TKNA 1U27A 1U29A 2D4QA 2D2QA 1EGXA 4K2PA 1WJ1A 5EFXA 2CY4A 5LOPB 5CLQB 2DA0A 1V61A 1MKEA 2LOZA 1OY2A 1ZM0A 1BTKA 2I5CA 2XQNM 4KHAA 3CIKA 3ULBA 5JHHA 1BAKA 2RUKB 5J3YA 2G35A 4TYZA 1OQNA 2Y7BA 3SNHA 3ODOA 1PFJA 4KVGB 2J0JA 3D8DA 2EC1A 2HE7A 3QWMA 5D27A 5HE1A 2K00A 3ML4A 2D10A 1WI1A 3KRWA 2DHIA 1V88A 4DXAB 3HK0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GS0 A;  4HAZ B;  2J0K A;  5DH9 B;  5GOW B;  2VSZ A;  1X86 A;  1MK7 B;  4F7G A;  3A8P A;  5FI0 A;  4NY0 A;  3OAN A;  3ZDT A;  2DYQ A;  1NU2 A;  1B55 A;  4HAV B;  3MPX A;  1U2B A;  4KHO A;  1KZ7 A;  2D9Z A;  2P0H A;  4WJ7 A;  5JLJ B;  1Z87 A;  2DHJ A;  4KHB B;  5D3W A;  3VOQ A;  1EVH A;  1V5M A;  2KGX B;  3MDB C;  2R0D A;  2VKI A;  3LJU X;  2M38 A;  2YRY A;  4HAX B;  4D0N B;  4GMX B;  3PSC A;  3D8E A;  2H7E A;  1XD4 A;  5HE0 A;  3D8F A;  3G9W A;  1H4R A;  2CAY A;  3GYO A;  1PMS A;  3DXE A;  5DI9 B;  4ZRK A;  3TCA A;  3RCP A;  3QBV B;  1TJ6 A;  3A8Q A;  3PVW A;  2GCL A;  4HHV A;  4K81 A;  2H7D A;  2P0D A;  2NMB A;  2YS1 A;  4HAY B;  5D3Y A;  2EJ8 A;  1IRS A;  2YVC A;  3ODW A;  4PQ0 A;  3F5R A;  1QQG A;  2DX1 A;  1GG3 A;  4L6E A;  3T06 A;  2DFK A;  2GJY A;  4P7I A;  2COD A;  5LON B;  2MFQ A;  1WGU A;  3BIN A;  2DTC A;  3TFM A;  3PP2 A;  4Y94 A;  5KCV A;  2DN6 A;  2P0F A;  2I5F A;  4MT7 A;  1NTV A;  2AL6 A;  2LYD A;  2OTX A;  1DDW A;  1OMW A;  4GMV A;  3PVU A;  2UVM A;  1W1G A;  5J3Q A;  1WG7 A;  1M7E A;  2Z0O A;  3TW1 A;  3U7D A;  2RNR B;  1AWE A;  2J59 M;  3ODX A;  2KCJ A;  4DBB A;  1X05 A;  1P3R A;  4GN1 A;  1UPR A;  2I1J A;  1BWN A;  1DYN A;  1UNR A;  1QC6 A;  1I2H A;  2E2X A;  1TXD A;  4DX9 0;  3N7C A;  2HTH B;  1MPH A;  2ROZ B;  2LKO A;  3AU5 A;  2ELB A;  1UNQ A;  3WYF B;  1J19 A;  1U5G A;  2IFS A;  1MIX A;  3PZD A;  4IAP A;  4CYE A;  2W2W A;  2YT0 A;  4F7H A;  5JP4 A;  5D3V A;  3KY9 A;  1P6S A;  4PNK A;  2N0Y A;  2Y8G A;  4HB2 B;  1SGH A;  3F0W A;  3TVV A;  4C0A A;  4HDQ A;  1J0W A;  2K2U A;  2BCJ A;  5DIF B;  1FAO A;  1FB8 A;  5HE2 A;  3UZT A;  5D3X A;  1LB1 A;  3GYP A;  3P7Z A;  1ISN A;  2L1C A;  2RLO A;  1TQZ A;  5JHG A;  3KRX A;  5HE3 A;  4HB0 B;  4F7U P;  4CHM A;  1XR0 B;  3FM8 C;  4GPT B;  3SO6 A;  2MDX A;  2RVB B;  4DX8 A;  1ZVR A;  3SYX A;  4B6H A;  2LUL A;  1FGZ A;  4GXB A;  3AJ4 A;  1I7A A;  2W2X C;  1XCG A;  2Y8F A;  4XWX A;  4A6H A;  2L2I A;  2I1K A;  3NSU A;  2COA A;  4MK0 A;  3QIJ A;  4HB3 B;  3SV1 A;  5C5B A;  1N3H A;  3DXC A;  2D9W A;  2YS5 A;  3PVL A;  2YT1 A;  2YF0 A;  2D11 A;  2CRF A;  1X1F A;  2RSG A;  4EKU A;  1U5F A;  1KI1 B;  3FEH A;  2J0M A;  1EF1 A;  2M14 A;  3HQC A;  2ZPY A;  3O96 A;  4K2O A;  1RRP B;  2LG1 A;  3AU4 A;  3V5W A;  2EMS A;  1NI2 A;  2DKP A;  2COC A;  4EMO A;  4NSW A;  2NZ8 B;  2QKL A;  1FGY A;  5KQ1 A;  4HAT B;  1DDV A;  4IOY X;  2KUP A;  1FOE A;  1LW3 A;  2ELA A;  2UZR A;  4HDO A;  5DHF B;  1V5P A;  3TO1 A;  3WA0 A;  2RGN B;  2GCJ A;  3BJI A;  3X23 A;  1XX0 A;  4Z2N A;  1Q67 A;  1UNP A;  2UZS A;  2D9V A;  4A6F A;  1FHW A;  3PEG A;  2R09 A;  4CHJ A;  3CXB B;  3IVF A;  2MWN B;  2ADZ A;  4Z2M B;  1GC6 A;  1MIZ B;  1DDM A;  4A5K A;  2DHK A;  1ZC3 B;  2D9X A;  5C16 A;  2N23 A;  4WVF B;  1NTY A;  1Y5O A;  4GZU A;  1MAI A;  5J3T A;  1EAZ A;  4HB4 B;  1AQC A;  2EMT A;  1FHO A;  4KAX B;  1K5G B;  3DXD A;  3PG7 A;  1W1H A;  1Y19 B;  1KZG A;  5C6R A;  1X11 A;  2VRW B;  4BBK A;  2QKM A;  2P8V A;  3P6A A;  4YON A;  2YS3 A;  2FJL A;  5KQ4 A;  4HAW B;  1RJ2 A;  1UPQ A;  1V89 A;  2COF A;  1K5D B;  1XOD A;  1ZSQ A;  4YL8 A;  4HAU B;  2K2J A;  2IYB A;  3A98 B;  5DHA B;  2DKQ A;  2Q13 A;  1SHC A;  3ULC A;  2OQB A;  2CY5 A;  2DX5 A;  1PLS A;  2JP2 A;  3M1I B;  4EJN A;  1E5W A;  1WVH A;  2Z0P A;  5C5B B;  1WGQ A;  4K17 A;  2Z0Q A;  1UEF A;  2X18 A;  3FSS A;  1M7R A;  1DRO A;  4ZRI A;  5CLL B;  2DLW A;  3ZVR A;  2AEH A;  2D9Y A;  3VIA A;  2PZ1 A;  1U5E A;  4ZRJ A;  4WSF A;  5FI1 A;  4A6K A;  4MY6 A;  2V76 A;  4IFS A;  1U5D A;  2W2X D;  2LOX A;  1BTN A;  2DYN A;  5C79 A;  1X1G A;  1FHX A;  2YSZ A;  1XKE A;  3U8Z A;  1MK9 B;  2MKR A;  4H8S A;  1W1D A;  1WJM A;  3KSY A;  3HW2 B;  2ROV A;  1GC7 A;  5L81 A;  3SUZ A;  1ZC4 B;  1H10 A;  3KZ1 A;  4A6F B;  1V5U A;  1DBH A;  1P5T A;  4TKN A;  1U27 A;  1U29 A;  2D4Q A;  2D2Q A;  1EGX A;  4K2P A;  1WJ1 A;  5EFX A;  2CY4 A;  5LOP B;  5CLQ B;  2DA0 A;  1V61 A;  1MKE A;  2LOZ A;  1OY2 A;  1ZM0 A;  1BTK A;  2I5C A;  2XQN M;  4KHA A;  3CIK A;  3ULB A;  5JHH A;  1BAK A;  2RUK B;  5J3Y A;  2G35 A;  4TYZ A;  1OQN A;  2Y7B A;  3SNH A;  3ODO A;  1PFJ A;  4KVG B;  2J0J A;  3D8D A;  2EC1 A;  2HE7 A;  3QWM A;  5D27 A;  5HE1 A;  2K00 A;  3ML4 A;  2D10 A;  1WI1 A;  3KRW A;  2DHI A;  1V88 A;  4DXA B;  3HK0 A; 
#chains in the Genus database with same CATH topology
 2GS0 A;  4HAZ B;  2J0K A;  5DH9 B;  5GOW B;  2VSZ A;  1X86 A;  1MK7 B;  4F7G A;  3A8P A;  5FI0 A;  4NY0 A;  3OAN A;  3ZDT A;  2DYQ A;  1NU2 A;  1B55 A;  4HAV B;  3MPX A;  1U2B A;  4QXA B;  4KHO A;  1KZ7 A;  2D9Z A;  2P0H A;  4WJ7 A;  5JLJ B;  1Z87 A;  2DHJ A;  4KHB B;  5D3W A;  3VOQ A;  1EVH A;  1V5M A;  2KGX B;  3DCX A;  3MDB C;  2R0D A;  2VKI A;  3LJU X;  2M38 A;  2KIG A;  2YRY A;  4HAX B;  2FJU B;  4D0N B;  4GMX B;  3PSC A;  3D8E A;  2H7E A;  1XD4 A;  5HE0 A;  3D8F A;  3G9W A;  1H4R A;  3NWA A;  2CAY A;  3GYO A;  1PMS A;  3DXE A;  5DI9 B;  4ZRK A;  3TCA A;  3RCP A;  3QBV B;  1TJ6 A;  4OT1 A;  3A8Q A;  3PVW A;  2GCL A;  4HHV A;  4K81 A;  2H7D A;  2P0D A;  2NMB A;  2YS1 A;  4HAY B;  5D3Y A;  2EJ8 A;  1IRS A;  2YVC A;  3ODW A;  3U12 A;  4PQ0 A;  3F5R A;  1QQG A;  3NWF A;  2DX1 A;  1GG3 A;  4L6E A;  5I2S A;  3T06 A;  2DFK A;  2GJY A;  2Z13 A;  4P7I A;  2COD A;  2GUM A;  5LON B;  2MFQ A;  1WGU A;  3BIN A;  2DTC A;  3TFM A;  3PP2 A;  4Y94 A;  5KCV A;  2DN6 A;  2P0F A;  2I5F A;  4MT7 A;  1NTV A;  2AL6 A;  2LYD A;  2K8E A;  2OTX A;  1DDW A;  1OMW A;  4GMV A;  3PVU A;  2UVM A;  1T77 A;  1W1G A;  5J3Q A;  1WG7 A;  1M7E A;  2Z0O A;  3TW1 A;  3U7D A;  2RNR B;  1AWE A;  2J59 M;  3ODX A;  2KCJ A;  4DBB A;  1X05 A;  1P3R A;  4GN1 A;  1UPR A;  2I1J A;  1BWN A;  1DYN A;  1UNR A;  1QC6 A;  1I2H A;  2E2X A;  1TXD A;  4DX9 0;  3N7C A;  2HTH B;  1MPH A;  2ROZ B;  2LKO A;  3AU5 A;  2ELB A;  1UNQ A;  3WYF B;  1J19 A;  1MI1 A;  1U5G A;  2IFS A;  1MIX A;  3PZD A;  4IAP A;  4CYE A;  2W2W A;  4QJ4 B;  2YT0 A;  4F7H A;  5JP4 A;  5D3V A;  3KY9 A;  1P6S A;  4PNK A;  2N0Y A;  2Y8G A;  4HB2 B;  1SGH A;  4QJ5 B;  3F0W A;  3TVV A;  4C0A A;  4HDQ A;  1J0W A;  3NWD A;  2K2U A;  2BCJ A;  5DIF B;  1FAO A;  1FB8 A;  5HE2 A;  3UZT A;  5D3X A;  1LB1 A;  3GYP A;  3P7Z A;  1ISN A;  2L1C A;  2RLO A;  1TQZ A;  5JHG A;  3KRX A;  5HE3 A;  4HB0 B;  4F7U P;  4CHM A;  1XR0 B;  3FM8 C;  4GPT B;  3SO6 A;  2YT2 A;  2MDX A;  2RVB B;  4DX8 A;  1ZVR A;  3SYX A;  4B6H A;  2LUL A;  1FGZ A;  4GXB A;  3AJ4 A;  1I7A A;  2W2X C;  1XCG A;  2Y8F A;  4XWX A;  4A6H A;  2L2I A;  2I1K A;  3OHM B;  3NSU A;  2COA A;  4MK0 A;  3QIJ A;  4HB3 B;  3SV1 A;  3HSA A;  5C5B A;  1N3H A;  3DXC A;  2D9W A;  2YS5 A;  3PVL A;  2YT1 A;  2Z14 A;  2YF0 A;  2D11 A;  2CRF A;  1X1F A;  2ZKM X;  2Z59 A;  2RSG A;  4EKU A;  2Z4D A;  2KIE A;  1U5F A;  1KI1 B;  5LG4 B;  3FEH A;  2J0M A;  1EF1 A;  2M14 A;  3HQC A;  2ZPY A;  3O96 A;  4K2O A;  1RRP B;  2LG1 A;  3AU4 A;  3V5W A;  2EMS A;  1NI2 A;  2DKP A;  2COC A;  4EMO A;  4NSW A;  2NZ8 B;  2QKL A;  1FGY A;  5KQ1 A;  4HAT B;  1DDV A;  4IOY X;  4HSI A;  2KUP A;  1FOE A;  1LW3 A;  2ELA A;  2UZR A;  4HDO A;  5DHF B;  1V5P A;  3TO1 A;  3WA0 A;  2RGN B;  2KUQ A;  2GCJ A;  3BJI A;  3X23 A;  1XX0 A;  4Z2N A;  1Q67 A;  1UNP A;  2UZS A;  2D9V A;  4A6F A;  1FHW A;  3B77 A;  3PEG A;  2R09 A;  4CHJ A;  3CXB B;  3IVF A;  2MWN B;  2ADZ A;  4Z2M B;  1GC6 A;  1MIZ B;  2KR0 A;  1DDM A;  4A5K A;  2DHK A;  1ZC3 B;  2D9X A;  3A58 A;  2NBV A;  5C16 A;  4CSQ A;  2N23 A;  4WVF B;  1NTY A;  1Y5O A;  4GZU A;  1MAI A;  5J3T A;  1EAZ A;  4HB4 B;  1AQC A;  2EMT A;  1FHO A;  4KAX B;  1K5G B;  3DXD A;  3PG7 A;  1W1H A;  1Y19 B;  1KZG A;  3NW8 A;  5C6R A;  1X11 A;  2VRW B;  4BBK A;  2QKM A;  1ZYI A;  2P8V A;  3P6A A;  4YON A;  2YS3 A;  2FJL A;  5KQ4 A;  4HAW B;  1RJ2 A;  1UPQ A;  3HIE A;  1V89 A;  2COF A;  1K5D B;  1XOD A;  2RRF A;  1ZSQ A;  4YL8 A;  4HAU B;  2K2J A;  2IYB A;  3A98 B;  5DHA B;  4L1R A;  2DKQ A;  2Q13 A;  1SHC A;  3ULC A;  2OQB A;  4GOU A;  2CY5 A;  2DX5 A;  1PLS A;  2JP2 A;  3M1I B;  4EJN A;  1E5W A;  1WVH A;  2Z0P A;  5C5B B;  1WGQ A;  2K49 A;  4K17 A;  2Z0Q A;  1UEF A;  2X18 A;  3FSS A;  1M7R A;  1DRO A;  4ZRI A;  5CLL B;  2DLW A;  3ZVR A;  2AEH A;  5M4Y B;  4KHB A;  2D9Y A;  3VIA A;  2PZ1 A;  1U5E A;  4ZRJ A;  4WSF A;  5FI1 A;  4D6W A;  4A6K A;  4MY6 A;  2V76 A;  4IFS A;  1U5D A;  2W2X D;  2LOX A;  1BTN A;  2DYN A;  5C79 A;  1X1G A;  1FHX A;  2YSZ A;  1XKE A;  3U8Z A;  1MK9 B;  2MKR A;  4H8S A;  1W1D A;  1WJM A;  3KSY A;  3HW2 B;  2ROV A;  1GC7 A;  5L81 A;  3SUZ A;  1ZC4 B;  1H10 A;  3KZ1 A;  4A6F B;  1V5U A;  3FVC A;  1DBH A;  1P5T A;  4TKN A;  1U27 A;  1U29 A;  4GNK B;  2D4Q A;  2D2Q A;  1EGX A;  4K2P A;  1WJ1 A;  5EFX A;  4OSN A;  2CY4 A;  5LOP B;  5CLQ B;  2DA0 A;  1V61 A;  1MKE A;  2LOZ A;  5I2M A;  1OY2 A;  1ZM0 A;  1BTK A;  2I5C A;  2XQN M;  4KHA A;  3CIK A;  3ULB A;  5JHH A;  1BAK A;  2RUK B;  2R2Y A;  5J3Y A;  2G35 A;  4TYZ A;  1OQN A;  2Y7B A;  3SNH A;  3ODO A;  4DIX A;  1PFJ A;  4KVG B;  2J0J A;  3D8D A;  2EC1 A;  2HE7 A;  3QWM A;  5D27 A;  5HE1 A;  2K00 A;  5IRS A;  2D10 A;  3ML4 A;  1WI1 A;  3KRW A;  4QJ3 B;  2DHI A;  1V88 A;  4DXA B;  3HK0 A; 
#chains in the Genus database with same CATH homology
 2GS0 A;  4HAZ B;  2J0K A;  5DH9 B;  5GOW B;  2VSZ A;  1X86 A;  1MK7 B;  4F7G A;  3A8P A;  5FI0 A;  4NY0 A;  3OAN A;  3ZDT A;  2DYQ A;  1NU2 A;  1B55 A;  4HAV B;  3MPX A;  1U2B A;  4KHO A;  1KZ7 A;  2D9Z A;  2P0H A;  4WJ7 A;  5JLJ B;  1Z87 A;  2DHJ A;  4KHB B;  5D3W A;  3VOQ A;  1EVH A;  1V5M A;  2KGX B;  3MDB C;  2R0D A;  2VKI A;  3LJU X;  2M38 A;  2YRY A;  4HAX B;  4D0N B;  4GMX B;  3PSC A;  3D8E A;  2H7E A;  1XD4 A;  5HE0 A;  3D8F A;  3G9W A;  1H4R A;  2CAY A;  3GYO A;  1PMS A;  3DXE A;  5DI9 B;  4ZRK A;  3TCA A;  3RCP A;  3QBV B;  1TJ6 A;  3A8Q A;  3PVW A;  2GCL A;  4HHV A;  4K81 A;  2H7D A;  2P0D A;  2NMB A;  2YS1 A;  4HAY B;  5D3Y A;  2EJ8 A;  1IRS A;  2YVC A;  3ODW A;  4PQ0 A;  3F5R A;  1QQG A;  2DX1 A;  1GG3 A;  4L6E A;  3T06 A;  2DFK A;  2GJY A;  4P7I A;  2COD A;  5LON B;  2MFQ A;  1WGU A;  3BIN A;  2DTC A;  3TFM A;  3PP2 A;  4Y94 A;  5KCV A;  2DN6 A;  2P0F A;  2I5F A;  4MT7 A;  1NTV A;  2AL6 A;  2LYD A;  2OTX A;  1DDW A;  1OMW A;  4GMV A;  3PVU A;  2UVM A;  1W1G A;  5J3Q A;  1WG7 A;  1M7E A;  2Z0O A;  3TW1 A;  3U7D A;  2RNR B;  1AWE A;  2J59 M;  3ODX A;  2KCJ A;  4DBB A;  1X05 A;  1P3R A;  4GN1 A;  1UPR A;  2I1J A;  1BWN A;  1DYN A;  1UNR A;  1QC6 A;  1I2H A;  2E2X A;  1TXD A;  4DX9 0;  3N7C A;  2HTH B;  1MPH A;  2ROZ B;  2LKO A;  3AU5 A;  2ELB A;  1UNQ A;  3WYF B;  1J19 A;  1U5G A;  2IFS A;  1MIX A;  3PZD A;  4IAP A;  4CYE A;  2W2W A;  2YT0 A;  4F7H A;  5JP4 A;  5D3V A;  3KY9 A;  1P6S A;  4PNK A;  2N0Y A;  2Y8G A;  4HB2 B;  1SGH A;  3F0W A;  3TVV A;  4C0A A;  4HDQ A;  1J0W A;  2K2U A;  2BCJ A;  5DIF B;  1FAO A;  1FB8 A;  5HE2 A;  3UZT A;  5D3X A;  1LB1 A;  3GYP A;  3P7Z A;  1ISN A;  2L1C A;  2RLO A;  1TQZ A;  5JHG A;  3KRX A;  5HE3 A;  4HB0 B;  4F7U P;  4CHM A;  1XR0 B;  3FM8 C;  4GPT B;  3SO6 A;  2MDX A;  2RVB B;  4DX8 A;  1ZVR A;  3SYX A;  4B6H A;  2LUL A;  1FGZ A;  4GXB A;  3AJ4 A;  1I7A A;  2W2X C;  1XCG A;  2Y8F A;  4XWX A;  4A6H A;  2L2I A;  2I1K A;  3NSU A;  2COA A;  4MK0 A;  3QIJ A;  4HB3 B;  3SV1 A;  5C5B A;  1N3H A;  3DXC A;  2D9W A;  2YS5 A;  3PVL A;  2YT1 A;  2YF0 A;  2D11 A;  2CRF A;  1X1F A;  2RSG A;  4EKU A;  1U5F A;  1KI1 B;  3FEH A;  2J0M A;  1EF1 A;  2M14 A;  3HQC A;  2ZPY A;  3O96 A;  4K2O A;  1RRP B;  2LG1 A;  3AU4 A;  3V5W A;  2EMS A;  1NI2 A;  2DKP A;  2COC A;  4EMO A;  4NSW A;  2NZ8 B;  2QKL A;  1FGY A;  5KQ1 A;  4HAT B;  1DDV A;  4IOY X;  2KUP A;  1FOE A;  1LW3 A;  2ELA A;  2UZR A;  4HDO A;  5DHF B;  1V5P A;  3TO1 A;  3WA0 A;  2RGN B;  2GCJ A;  3BJI A;  3X23 A;  1XX0 A;  4Z2N A;  1Q67 A;  1UNP A;  2UZS A;  2D9V A;  4A6F A;  1FHW A;  3PEG A;  2R09 A;  4CHJ A;  3CXB B;  3IVF A;  2MWN B;  2ADZ A;  4Z2M B;  1GC6 A;  1MIZ B;  1DDM A;  4A5K A;  2DHK A;  1ZC3 B;  2D9X A;  5C16 A;  2N23 A;  4WVF B;  1NTY A;  1Y5O A;  4GZU A;  1MAI A;  5J3T A;  1EAZ A;  4HB4 B;  1AQC A;  2EMT A;  1FHO A;  4KAX B;  1K5G B;  3DXD A;  3PG7 A;  1W1H A;  1Y19 B;  1KZG A;  5C6R A;  1X11 A;  2VRW B;  4BBK A;  2QKM A;  2P8V A;  3P6A A;  4YON A;  2YS3 A;  2FJL A;  5KQ4 A;  4HAW B;  1RJ2 A;  1UPQ A;  1V89 A;  2COF A;  1K5D B;  1XOD A;  1ZSQ A;  4YL8 A;  4HAU B;  2K2J A;  2IYB A;  3A98 B;  5DHA B;  2DKQ A;  2Q13 A;  1SHC A;  3ULC A;  2OQB A;  2CY5 A;  2DX5 A;  1PLS A;  2JP2 A;  3M1I B;  4EJN A;  1E5W A;  1WVH A;  2Z0P A;  5C5B B;  1WGQ A;  4K17 A;  2Z0Q A;  1UEF A;  2X18 A;  3FSS A;  1M7R A;  1DRO A;  4ZRI A;  5CLL B;  2DLW A;  3ZVR A;  2AEH A;  2D9Y A;  3VIA A;  2PZ1 A;  1U5E A;  4ZRJ A;  4WSF A;  5FI1 A;  4A6K A;  4MY6 A;  2V76 A;  4IFS A;  1U5D A;  2W2X D;  2LOX A;  1BTN A;  2DYN A;  5C79 A;  1X1G A;  1FHX A;  2YSZ A;  1XKE A;  3U8Z A;  1MK9 B;  2MKR A;  4H8S A;  1W1D A;  1WJM A;  3KSY A;  3HW2 B;  2ROV A;  1GC7 A;  5L81 A;  3SUZ A;  1ZC4 B;  1H10 A;  3KZ1 A;  4A6F B;  1V5U A;  1DBH A;  1P5T A;  4TKN A;  1U27 A;  1U29 A;  2D4Q A;  2D2Q A;  1EGX A;  4K2P A;  1WJ1 A;  5EFX A;  2CY4 A;  5LOP B;  5CLQ B;  2DA0 A;  1V61 A;  1MKE A;  2LOZ A;  1OY2 A;  1ZM0 A;  1BTK A;  2I5C A;  2XQN M;  4KHA A;  3CIK A;  3ULB A;  5JHH A;  1BAK A;  2RUK B;  5J3Y A;  2G35 A;  4TYZ A;  1OQN A;  2Y7B A;  3SNH A;  3ODO A;  1PFJ A;  4KVG B;  2J0J A;  3D8D A;  2EC1 A;  2HE7 A;  3QWM A;  5D27 A;  5HE1 A;  2K00 A;  3ML4 A;  2D10 A;  1WI1 A;  3KRW A;  2DHI A;  1V88 A;  4DXA B;  3HK0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...