1WGQA

Solution structure of the pleckstrin homology domain of mouse ethanol decreased 4 protein
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
109
structure length
109
Chain Sequence
GSSGSSGSTMSGYLYRSKGSKKPWKHLWFVIKNKVLYTYAASEDVAALESQPLLGFTVTLVKDENSESKVFQLLHKGMVFYVFKADDAHSTQRWIDAFQEGTVSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FYVE, RhoGEF and PH domain containing 6; ethanol decreased 4
publication title Solution Structure of the Pleckstrin Homology Domain of Mouse Ethanol Decreased 4 Protein
rcsb
source organism Mus musculus
molecule tags Sugar binding protein
total genus 14
structure length 109
sequence length 109
ec nomenclature
pdb deposition date 2004-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00169 PH PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1wgqA00
1QQGA 2RLOA 2NMBA 2OTXA 2DYNA 5FI0A 2IFSA 1NU2A 1OMWA 2UVMA 3TFMA 4DX90 4CYEA 2YS5A 4HATB 5C79A 2XQNM 3ML4A 1LB1A 3ODXA 5DHAB 3ULBA 4A6HA 2LKOA 3VOQA 3V5WA 4EMOA 3WA0A 1XX0A 1DYNA 3PSCA 1DROA 1OQNA 2R09A 3QBVB 3FSSA 2D4QA 2DN6A 1DDMA 3KRXA 1IRSA 1NTYA 2MFQA 1UNRA 4A5KA 2CY5A 4GN1A 1M7EA 1WVHA 2K2UA 1ISNA 3P7ZA 4ZRJA 1E5WA 4Z2MB 3TO1A 5D3VA 3HW2B 4HB2B 2Y7BA 3CXBB 1ZVRA 2HE7A 2DYQA 3O96A 2UZRA 1V89A 2D9VA 5J3TA 1WGQA 3IVFA 3A8PA 2I1KA 2LOZA 1WJMA 3PVLA 1FHOA 1PMSA 2Z0QA 1MK9B 1UEFA 1I2HA 4Y94A 4BBKA 3MPXA 2BCJA 2RVBB 4GPTB 2D10A 2DKQA 3PEGA 4H8SA 1U29A 4TKNA 2EMTA 1V61A 2OQBA 2COCA 2DA0A 1V5MA 3KRWA 1Y19B 5DI9B 5C6RA 2EMSA 3TW1A 2EJ8A 1V88A 1V5UA 5C16A 1TJ6A 2GJYA 1J0WA 2ZPYA 2D11A 5DIFB 1KZ7A 5HE2A 4HAUB 5LONB 4A6KA 4HB4B 2FJLA 1GC6A 2COFA 2P8VA 3QWMA 4HB3B 1Z87A 5D3YA 2Z0OA 1ZC4B 3ODOA 4A6FA 3T06A 4HAVB 3OANA 2AEHA 3QIJA 3GYOA 2RSGA 4GMXB 1XD4A 3CIKA 3G9WA 3GYPA 4CHMA 3D8FA 4HHVA 4F7HA 2DHKA 4K17A 4IFSA 3SNHA 2ROZB 1EF1A 3PVWA 1X05A 5JHGA 1U5FA 5C5BA 1P3RA 3TCAA 3AU4A 1GG3A 4XWXA 1K5DB 5DH9B 2GCJA 3U8ZA 1W1GA 2H7DA 2Q13A 4HDQA 2KGXB 3SV1A 2L1CA 1BTKA 2RNRB 1FHWA 2DHJA 1U5GA 1J19A 2KUPA 3AJ4A 1P6SA 5JP4A 2KCJA 2ADZA 4MT7A 3ZDTA 5D3XA 1GC7A 2YT1A 2W2XC 1Q67A 1ZM0A 4ZRIA 1WG7A 4HAXB 1EGXA 3HQCA 3ODWA 3ZVRA 1W1HA 4C0AA 1XODA 5KCVA 1SHCA 2Y8FA 3TVVA 1XCGA 2DTCA 5HE0A 2MWNB 4KHAA 2D9WA 3DXDA 5D27A 1MPHA 1X1FA 2J0KA 4GZUA 2YT0A 5EFXA 2CODA 1V5PA 2NZ8B 1UPQA 3SO6A 3D8EA 2COAA 1RRPB 3M1IB 4NY0A 2LULA 4KHBB 4PNKA 2YS1A 1UNQA 4Z2NA 2QKMA 2ROVA 3AU5A 1RJ2A 5J3YA 2D2QA 3LJUX 4KVGB 3HK0A 2CRFA 2I1JA 1MK7B 1XR0B 3NSUA 1I7AA 2X18A 5KQ1A 3KZ1A 5KQ4A 5J3QA 4F7GA 1NI2A 1MAIA 4P7IA 3DXEA 2J0JA 1N3HA 1OY2A 2YVCA 1H10A 1LW3A 2J59M 2L2IA 1BTNA 1K5GB 4HAZB 1H4RA 2I5CA 2JP2A 4A6FB 1FGYA 4HAWB 5D3WA 4WJ7A 1QC6A 1U27A 2G35A 2MDXA 2ELAA 2R0DA 1XKEA 4HDOA 2DKPA 3KY9A 4EJNA 4TYZA 1X1GA 2RGNB 4IAPA 2VRWB 5C5BB 1MIXA 2YF0A 1FB8A 4ZRKA 1PLSA 3FEHA 4HB0B 3U7DA 4IOYX 4YONA 4K2PA 4K2OA 4KHOA 2LOXA 4K81A 5CLLB 4NSWA 4HAYB 3F0WA 3D8DA 2Z0PA 2K00A 4DXAB 1TXDA 2VKIA 2YRYA 1FOEA 1UNPA 4EKUA 3DXCA 1MIZB 1Y5OA 2D9ZA 1PFJA 2CAYA 4WSFA 1EAZA 4MY6A 3BINA 2YS3A 1BAKA 3PG7A 1FHXA 3FM8C 3A8QA 3F5RA 5FI1A 1AQCA 2RUKB 2K2JA 2VSZA 3KSYA 3VIAA 4PQ0A 3PZDA 1X11A 4CHJA 2CY4A 5CLQB 5HE3A 2MKRA 1U5DA 2LYDA 3UZTA 1BWNA 2PZ1A 2P0FA 3SYXA 2V76A 1UPRA 2DX1A 3WYFB 4YL8A 4DBBA 1SGHA 5HE1A 2Y8GA 1B55A 2GS0A 2QKLA 2I5FA 2W2XD 4KAXB 2DHIA 3MDBC 1NTVA 4GXBA 2YSZA 1AWEA 2P0HA 1KZGA 3P6AA 3SUZA 5DHFB 5LOPB 1P5TA 2DX5A 2IYBA 2M14A 4D0NB 4L6EA 4WVFB 3PVUA 1TQZA 2M38A 2DLWA 3N7CA 3BJIA 1EVHA 2UZSA 4F7UP 4B6HA 4DX8A 1WI1A 2HTHB 5L81A 2N0YA 1ZSQA 1FAOA 1WGUA 1M7RA 1KI1B 1ZC3B 1DDVA 2N23A 4GMVA 5GOWB 2EC1A 1WJ1A 1MKEA 3A98B 4MK0A 2D9XA 2H7EA 2J0MA 2W2WA 2P0DA 1DBHA 1FGZA 3PP2A 2AL6A 2LG1A 1U5EA 1DDWA 1W1DA 2ELBA 2DFKA 3X23A 1X86A 3RCPA 2GCLA 3ULCA 2E2XA 1U2BA 5JHHA 2D9YA 5JLJB
chains in the Genus database with same CATH superfamily
1QQGA 2RLOA 2NMBA 2OTXA 2DYNA 5FI0A 2IFSA 1NU2A 1OMWA 2UVMA 4QJ3B 3TFMA 4DX90 2KIGA 4CYEA 2YS5A 4HATB 5C79A 2XQNM 3ML4A 1LB1A 3ODXA 5DHAB 3ULBA 3U12A 3DCXA 2LKOA 4A6HA 3VOQA 3V5WA 4EMOA 3A58A 3WA0A 4CSQA 1XX0A 1DYNA 3PSCA 1DROA 1OQNA 2R09A 3QBVB 3FSSA 2D4QA 2DN6A 1DDMA 3KRXA 1IRSA 1NTYA 2MFQA 1UNRA 1T77A 4A5KA 2CY5A 4GN1A 1M7EA 1WVHA 2Z59A 2K2UA 1ISNA 3P7ZA 4ZRJA 1E5WA 4Z2MB 3TO1A 5D3VA 3HW2B 4D6WA 4HB2B 2Y7BA 3CXBB 1ZVRA 2HE7A 4OSNA 2DYQA 3O96A 2R2YA 2UZRA 1V89A 2D9VA 5J3TA 1WGQA 3IVFA 3A8PA 2I1KA 2LOZA 1WJMA 3PVLA 1FHOA 1PMSA 2Z0QA 1MK9B 1UEFA 1I2HA 4Y94A 4BBKA 3MPXA 2BCJA 2RVBB 4KHBA 4GPTB 2D10A 2DKQA 3PEGA 4H8SA 1U29A 4TKNA 2EMTA 1V61A 2OQBA 2KUQA 2COCA 2DA0A 5I2SA 1V5MA 3KRWA 1Y19B 4GOUA 5DI9B 5C6RA 2EMSA 3TW1A 2EJ8A 1V88A 2Z13A 1V5UA 5C16A 1TJ6A 2GJYA 1J0WA 2ZPYA 2D11A 5DIFB 1KZ7A 5HE2A 4HAUB 5LONB 1ZYIA 4A6KA 4HB4B 5IRSA 2FJLA 1GC6A 2COFA 2P8VA 3QWMA 4HB3B 1Z87A 5D3YA 2Z0OA 1ZC4B 3ODOA 4A6FA 3T06A 4HAVB 3OANA 2AEHA 3QIJA 4L1RA 3GYOA 2RSGA 4GMXB 1XD4A 3CIKA 3G9WA 3GYPA 4CHMA 3D8FA 4HHVA 4F7HA 2DHKA 4K17A 4IFSA 2ZKMX 3SNHA 2ROZB 1EF1A 3PVWA 1X05A 2GUMA 5JHGA 1U5FA 3NW8A 5C5BA 1P3RA 3TCAA 3AU4A 1GG3A 4XWXA 1K5DB 5DH9B 2GCJA 3U8ZA 1W1GA 4DIXA 2H7DA 2Q13A 4HDQA 2KGXB 3HIEA 3SV1A 2L1CA 1BTKA 2RNRB 1FHWA 2DHJA 1U5GA 1J19A 2KUPA 3AJ4A 1P6SA 5JP4A 2KCJA 2ADZA 4MT7A 3ZDTA 5D3XA 5I2MA 1GC7A 2YT1A 2W2XC 1Q67A 1ZM0A 4ZRIA 1WG7A 4HAXB 1EGXA 3HQCA 3ODWA 3ZVRA 1W1HA 4C0AA 1XODA 5KCVA 1SHCA 2Y8FA 3TVVA 1XCGA 2DTCA 5HE0A 2MWNB 4KHAA 2D9WA 3DXDA 5D27A 1MPHA 1X1FA 2J0KA 4GZUA 2YT0A 5EFXA 2CODA 1V5PA 2NZ8B 1UPQA 3SO6A 3D8EA 2COAA 1RRPB 3M1IB 4NY0A 2YT2A 2LULA 4KHBB 4GNKB 5M4YB 4PNKA 2YS1A 1UNQA 3OHMB 4Z2NA 2QKMA 2ROVA 3AU5A 1RJ2A 5J3YA 2D2QA 3LJUX 4KVGB 3HK0A 2CRFA 2I1JA 1MK7B 1XR0B 3NSUA 1I7AA 2X18A 5KQ1A 3KZ1A 5KQ4A 5J3QA 4F7GA 1NI2A 1MAIA 4P7IA 3DXEA 2J0JA 1N3HA 1OY2A 2YVCA 1H10A 1LW3A 2J59M 2L2IA 3NWDA 1BTNA 1K5GB 4HAZB 1H4RA 2I5CA 2JP2A 4A6FB 1FGYA 4HAWB 5D3WA 4HSIA 4WJ7A 1QC6A 1U27A 2G35A 2MDXA 2ELAA 2R0DA 1XKEA 4HDOA 3NWFA 2DKPA 3KY9A 4EJNA 4TYZA 1X1GA 2RGNB 4IAPA 2VRWB 5C5BB 1MIXA 2YF0A 1FB8A 4ZRKA 1PLSA 3FEHA 4HB0B 3U7DA 4IOYX 4YONA 4K2PA 4K2OA 4KHOA 2LOXA 4K81A 5CLLB 4NSWA 4HAYB 3F0WA 3D8DA 2Z0PA 2K00A 4DXAB 1TXDA 2K49A 2VKIA 2NBVA 2YRYA 1FOEA 1UNPA 4EKUA 3DXCA 1MIZB 1Y5OA 2D9ZA 1PFJA 2CAYA 4WSFA 1EAZA 2FJUB 4MY6A 3BINA 2YS3A 1BAKA 3PG7A 1FHXA 3FM8C 2KIEA 3A8QA 3F5RA 5FI1A 3HSAA 1AQCA 2RUKB 2K2JA 2VSZA 1MI1A 3KSYA 2KR0A 3VIAA 4PQ0A 3PZDA 1X11A 4CHJA 2CY4A 5CLQB 5HE3A 4QJ4B 2MKRA 1U5DA 2K8EA 2LYDA 3UZTA 1BWNA 2PZ1A 2P0FA 4QJ5B 3SYXA 2V76A 1UPRA 2DX1A 3WYFB 4YL8A 4DBBA 1SGHA 2Z14A 5LG4B 5HE1A 2Y8GA 1B55A 4QXAB 2GS0A 2QKLA 2I5FA 2W2XD 4KAXB 2DHIA 3MDBC 1NTVA 4GXBA 2YSZA 1AWEA 2P0HA 1KZGA 4OT1A 3P6AA 3SUZA 5DHFB 5LOPB 1P5TA 2DX5A 2IYBA 2M14A 4D0NB 4L6EA 4WVFB 3PVUA 1TQZA 2M38A 2DLWA 3N7CA 3BJIA 1EVHA 2UZSA 4F7UP 4B6HA 4DX8A 2Z4DA 1WI1A 2HTHB 5L81A 2N0YA 1ZSQA 1FAOA 1WGUA 1M7RA 1KI1B 1ZC3B 1DDVA 2N23A 3NWAA 4GMVA 5GOWB 2EC1A 1WJ1A 3B77A 1MKEA 3A98B 4MK0A 2D9XA 2H7EA 2J0MA 2W2WA 2P0DA 1DBHA 1FGZA 3FVCA 3PP2A 2AL6A 2LG1A 1U5EA 1DDWA 1W1DA 2ELBA 2DFKA 3X23A 1X86A 3RCPA 2GCLA 3ULCA 2E2XA 1U2BA 5JHHA 2D9YA 2RRFA 5JLJB
chains in the Genus database with same CATH topology
1QQGA 2RLOA 2NMBA 2OTXA 2DYNA 5FI0A 2IFSA 1NU2A 1OMWA 2UVMA 3TFMA 4DX90 4CYEA 2YS5A 4HATB 5C79A 2XQNM 3ML4A 1LB1A 3ODXA 5DHAB 3ULBA 4A6HA 2LKOA 3VOQA 3V5WA 4EMOA 3WA0A 1XX0A 1DYNA 3PSCA 1DROA 1OQNA 2R09A 3QBVB 3FSSA 2D4QA 2DN6A 1DDMA 3KRXA 1IRSA 1NTYA 2MFQA 1UNRA 4A5KA 2CY5A 4GN1A 1M7EA 1WVHA 2K2UA 1ISNA 3P7ZA 4ZRJA 1E5WA 4Z2MB 3TO1A 5D3VA 3HW2B 4HB2B 2Y7BA 3CXBB 1ZVRA 2HE7A 2DYQA 3O96A 2UZRA 1V89A 2D9VA 5J3TA 1WGQA 3IVFA 3A8PA 2I1KA 2LOZA 1WJMA 3PVLA 1FHOA 1PMSA 2Z0QA 1MK9B 1UEFA 1I2HA 4Y94A 4BBKA 3MPXA 2BCJA 2RVBB 4GPTB 2D10A 2DKQA 3PEGA 4H8SA 1U29A 4TKNA 2EMTA 1V61A 2OQBA 2COCA 2DA0A 1V5MA 3KRWA 1Y19B 5DI9B 5C6RA 2EMSA 3TW1A 2EJ8A 1V88A 1V5UA 5C16A 1TJ6A 2GJYA 1J0WA 2ZPYA 2D11A 5DIFB 1KZ7A 5HE2A 4HAUB 5LONB 4A6KA 4HB4B 2FJLA 1GC6A 2COFA 2P8VA 3QWMA 4HB3B 1Z87A 5D3YA 2Z0OA 1ZC4B 3ODOA 4A6FA 3T06A 4HAVB 3OANA 2AEHA 3QIJA 3GYOA 2RSGA 4GMXB 1XD4A 3CIKA 3G9WA 3GYPA 4CHMA 3D8FA 4HHVA 4F7HA 2DHKA 4K17A 4IFSA 3SNHA 2ROZB 1EF1A 3PVWA 1X05A 5JHGA 1U5FA 5C5BA 1P3RA 3TCAA 3AU4A 1GG3A 4XWXA 1K5DB 5DH9B 2GCJA 3U8ZA 1W1GA 2H7DA 2Q13A 4HDQA 2KGXB 3SV1A 2L1CA 1BTKA 2RNRB 1FHWA 2DHJA 1U5GA 1J19A 2KUPA 3AJ4A 1P6SA 5JP4A 2KCJA 2ADZA 4MT7A 3ZDTA 5D3XA 1GC7A 2YT1A 2W2XC 1Q67A 1ZM0A 4ZRIA 1WG7A 4HAXB 1EGXA 3HQCA 3ODWA 3ZVRA 1W1HA 4C0AA 1XODA 5KCVA 1SHCA 2Y8FA 3TVVA 1XCGA 2DTCA 5HE0A 2MWNB 4KHAA 2D9WA 3DXDA 5D27A 1MPHA 1X1FA 2J0KA 4GZUA 2YT0A 5EFXA 2CODA 1V5PA 2NZ8B 1UPQA 3SO6A 3D8EA 2COAA 1RRPB 3M1IB 4NY0A 2LULA 4KHBB 4PNKA 2YS1A 1UNQA 4Z2NA 2QKMA 2ROVA 3AU5A 1RJ2A 5J3YA 2D2QA 3LJUX 4KVGB 3HK0A 2CRFA 2I1JA 1MK7B 1XR0B 3NSUA 1I7AA 2X18A 5KQ1A 3KZ1A 5KQ4A 5J3QA 4F7GA 1NI2A 1MAIA 4P7IA 3DXEA 2J0JA 1N3HA 1OY2A 2YVCA 1H10A 1LW3A 2J59M 2L2IA 1BTNA 1K5GB 4HAZB 1H4RA 2I5CA 2JP2A 4A6FB 1FGYA 4HAWB 5D3WA 4WJ7A 1QC6A 1U27A 2G35A 2MDXA 2ELAA 2R0DA 1XKEA 4HDOA 2DKPA 3KY9A 4EJNA 4TYZA 1X1GA 2RGNB 4IAPA 2VRWB 5C5BB 1MIXA 2YF0A 1FB8A 4ZRKA 1PLSA 3FEHA 4HB0B 3U7DA 4IOYX 4YONA 4K2PA 4K2OA 4KHOA 2LOXA 4K81A 5CLLB 4NSWA 4HAYB 3F0WA 3D8DA 2Z0PA 2K00A 4DXAB 1TXDA 2VKIA 2YRYA 1FOEA 1UNPA 4EKUA 3DXCA 1MIZB 1Y5OA 2D9ZA 1PFJA 2CAYA 4WSFA 1EAZA 4MY6A 3BINA 2YS3A 1BAKA 3PG7A 1FHXA 3FM8C 3A8QA 3F5RA 5FI1A 1AQCA 2RUKB 2K2JA 2VSZA 3KSYA 3VIAA 4PQ0A 3PZDA 1X11A 4CHJA 2CY4A 5CLQB 5HE3A 2MKRA 1U5DA 2LYDA 3UZTA 1BWNA 2PZ1A 2P0FA 3SYXA 2V76A 1UPRA 2DX1A 3WYFB 4YL8A 4DBBA 1SGHA 5HE1A 2Y8GA 1B55A 2GS0A 2QKLA 2I5FA 2W2XD 4KAXB 2DHIA 3MDBC 1NTVA 4GXBA 2YSZA 1AWEA 2P0HA 1KZGA 3P6AA 3SUZA 5DHFB 5LOPB 1P5TA 2DX5A 2IYBA 2M14A 4D0NB 4L6EA 4WVFB 3PVUA 1TQZA 2M38A 2DLWA 3N7CA 3BJIA 1EVHA 2UZSA 4F7UP 4B6HA 4DX8A 1WI1A 2HTHB 5L81A 2N0YA 1ZSQA 1FAOA 1WGUA 1M7RA 1KI1B 1ZC3B 1DDVA 2N23A 4GMVA 5GOWB 2EC1A 1WJ1A 1MKEA 3A98B 4MK0A 2D9XA 2H7EA 2J0MA 2W2WA 2P0DA 1DBHA 1FGZA 3PP2A 2AL6A 2LG1A 1U5EA 1DDWA 1W1DA 2ELBA 2DFKA 3X23A 1X86A 3RCPA 2GCLA 3ULCA 2E2XA 1U2BA 5JHHA 2D9YA 5JLJB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QQG A;  2RLO A;  2NMB A;  2OTX A;  2DYN A;  5FI0 A;  2IFS A;  1NU2 A;  1OMW A;  2UVM A;  3TFM A;  4DX9 0;  4CYE A;  2YS5 A;  4HAT B;  5C79 A;  2XQN M;  3ML4 A;  1LB1 A;  3ODX A;  5DHA B;  3ULB A;  4A6H A;  2LKO A;  3VOQ A;  3V5W A;  4EMO A;  3WA0 A;  1XX0 A;  1DYN A;  3PSC A;  1DRO A;  1OQN A;  2R09 A;  3QBV B;  3FSS A;  2D4Q A;  2DN6 A;  1DDM A;  3KRX A;  1IRS A;  1NTY A;  2MFQ A;  1UNR A;  4A5K A;  2CY5 A;  4GN1 A;  1M7E A;  1WVH A;  2K2U A;  1ISN A;  3P7Z A;  4ZRJ A;  1E5W A;  4Z2M B;  3TO1 A;  5D3V A;  3HW2 B;  4HB2 B;  2Y7B A;  3CXB B;  1ZVR A;  2HE7 A;  2DYQ A;  3O96 A;  2UZR A;  1V89 A;  2D9V A;  5J3T A;  1WGQ A;  3IVF A;  3A8P A;  2I1K A;  2LOZ A;  1WJM A;  3PVL A;  1FHO A;  1PMS A;  2Z0Q A;  1MK9 B;  1UEF A;  1I2H A;  4Y94 A;  4BBK A;  3MPX A;  2BCJ A;  2RVB B;  4GPT B;  2D10 A;  2DKQ A;  3PEG A;  4H8S A;  1U29 A;  4TKN A;  2EMT A;  1V61 A;  2OQB A;  2COC A;  2DA0 A;  1V5M A;  3KRW A;  1Y19 B;  5DI9 B;  5C6R A;  2EMS A;  3TW1 A;  2EJ8 A;  1V88 A;  1V5U A;  5C16 A;  1TJ6 A;  2GJY A;  1J0W A;  2ZPY A;  2D11 A;  5DIF B;  1KZ7 A;  5HE2 A;  4HAU B;  5LON B;  4A6K A;  4HB4 B;  2FJL A;  1GC6 A;  2COF A;  2P8V A;  3QWM A;  4HB3 B;  1Z87 A;  5D3Y A;  2Z0O A;  1ZC4 B;  3ODO A;  4A6F A;  3T06 A;  4HAV B;  3OAN A;  2AEH A;  3QIJ A;  3GYO A;  2RSG A;  4GMX B;  1XD4 A;  3CIK A;  3G9W A;  3GYP A;  4CHM A;  3D8F A;  4HHV A;  4F7H A;  2DHK A;  4K17 A;  4IFS A;  3SNH A;  2ROZ B;  1EF1 A;  3PVW A;  1X05 A;  5JHG A;  1U5F A;  5C5B A;  1P3R A;  3TCA A;  3AU4 A;  1GG3 A;  4XWX A;  1K5D B;  5DH9 B;  2GCJ A;  3U8Z A;  1W1G A;  2H7D A;  2Q13 A;  4HDQ A;  2KGX B;  3SV1 A;  2L1C A;  1BTK A;  2RNR B;  1FHW A;  2DHJ A;  1U5G A;  1J19 A;  2KUP A;  3AJ4 A;  1P6S A;  5JP4 A;  2KCJ A;  2ADZ A;  4MT7 A;  3ZDT A;  5D3X A;  1GC7 A;  2YT1 A;  2W2X C;  1Q67 A;  1ZM0 A;  4ZRI A;  1WG7 A;  4HAX B;  1EGX A;  3HQC A;  3ODW A;  3ZVR A;  1W1H A;  4C0A A;  1XOD A;  5KCV A;  1SHC A;  2Y8F A;  3TVV A;  1XCG A;  2DTC A;  5HE0 A;  2MWN B;  4KHA A;  2D9W A;  3DXD A;  5D27 A;  1MPH A;  1X1F A;  2J0K A;  4GZU A;  2YT0 A;  5EFX A;  2COD A;  1V5P A;  2NZ8 B;  1UPQ A;  3SO6 A;  3D8E A;  2COA A;  1RRP B;  3M1I B;  4NY0 A;  2LUL A;  4KHB B;  4PNK A;  2YS1 A;  1UNQ A;  4Z2N A;  2QKM A;  2ROV A;  3AU5 A;  1RJ2 A;  5J3Y A;  2D2Q A;  3LJU X;  4KVG B;  3HK0 A;  2CRF A;  2I1J A;  1MK7 B;  1XR0 B;  3NSU A;  1I7A A;  2X18 A;  5KQ1 A;  3KZ1 A;  5KQ4 A;  5J3Q A;  4F7G A;  1NI2 A;  1MAI A;  4P7I A;  3DXE A;  2J0J A;  1N3H A;  1OY2 A;  2YVC A;  1H10 A;  1LW3 A;  2J59 M;  2L2I A;  1BTN A;  1K5G B;  4HAZ B;  1H4R A;  2I5C A;  2JP2 A;  4A6F B;  1FGY A;  4HAW B;  5D3W A;  4WJ7 A;  1QC6 A;  1U27 A;  2G35 A;  2MDX A;  2ELA A;  2R0D A;  1XKE A;  4HDO A;  2DKP A;  3KY9 A;  4EJN A;  4TYZ A;  1X1G A;  2RGN B;  4IAP A;  2VRW B;  5C5B B;  1MIX A;  2YF0 A;  1FB8 A;  4ZRK A;  1PLS A;  3FEH A;  4HB0 B;  3U7D A;  4IOY X;  4YON A;  4K2P A;  4K2O A;  4KHO A;  2LOX A;  4K81 A;  5CLL B;  4NSW A;  4HAY B;  3F0W A;  3D8D A;  2Z0P A;  2K00 A;  4DXA B;  1TXD A;  2VKI A;  2YRY A;  1FOE A;  1UNP A;  4EKU A;  3DXC A;  1MIZ B;  1Y5O A;  2D9Z A;  1PFJ A;  2CAY A;  4WSF A;  1EAZ A;  4MY6 A;  3BIN A;  2YS3 A;  1BAK A;  3PG7 A;  1FHX A;  3FM8 C;  3A8Q A;  3F5R A;  5FI1 A;  1AQC A;  2RUK B;  2K2J A;  2VSZ A;  3KSY A;  3VIA A;  4PQ0 A;  3PZD A;  1X11 A;  4CHJ A;  2CY4 A;  5CLQ B;  5HE3 A;  2MKR A;  1U5D A;  2LYD A;  3UZT A;  1BWN A;  2PZ1 A;  2P0F A;  3SYX A;  2V76 A;  1UPR A;  2DX1 A;  3WYF B;  4YL8 A;  4DBB A;  1SGH A;  5HE1 A;  2Y8G A;  1B55 A;  2GS0 A;  2QKL A;  2I5F A;  2W2X D;  4KAX B;  2DHI A;  3MDB C;  1NTV A;  4GXB A;  2YSZ A;  1AWE A;  2P0H A;  1KZG A;  3P6A A;  3SUZ A;  5DHF B;  5LOP B;  1P5T A;  2DX5 A;  2IYB A;  2M14 A;  4D0N B;  4L6E A;  4WVF B;  3PVU A;  1TQZ A;  2M38 A;  2DLW A;  3N7C A;  3BJI A;  1EVH A;  2UZS A;  4F7U P;  4B6H A;  4DX8 A;  1WI1 A;  2HTH B;  5L81 A;  2N0Y A;  1ZSQ A;  1FAO A;  1WGU A;  1M7R A;  1KI1 B;  1ZC3 B;  1DDV A;  2N23 A;  4GMV A;  5GOW B;  2EC1 A;  1WJ1 A;  1MKE A;  3A98 B;  4MK0 A;  2D9X A;  2H7E A;  2J0M A;  2W2W A;  2P0D A;  1DBH A;  1FGZ A;  3PP2 A;  2AL6 A;  2LG1 A;  1U5E A;  1DDW A;  1W1D A;  2ELB A;  2DFK A;  3X23 A;  1X86 A;  3RCP A;  2GCL A;  3ULC A;  2E2X A;  1U2B A;  5JHH A;  2D9Y A;  5JLJ B; 
#chains in the Genus database with same CATH topology
 1QQG A;  2RLO A;  2NMB A;  2OTX A;  2DYN A;  5FI0 A;  2IFS A;  1NU2 A;  1OMW A;  2UVM A;  4QJ3 B;  3TFM A;  4DX9 0;  2KIG A;  4CYE A;  2YS5 A;  4HAT B;  5C79 A;  2XQN M;  3ML4 A;  1LB1 A;  3ODX A;  5DHA B;  3ULB A;  3U12 A;  3DCX A;  2LKO A;  4A6H A;  3VOQ A;  3V5W A;  4EMO A;  3A58 A;  3WA0 A;  4CSQ A;  1XX0 A;  1DYN A;  3PSC A;  1DRO A;  1OQN A;  2R09 A;  3QBV B;  3FSS A;  2D4Q A;  2DN6 A;  1DDM A;  3KRX A;  1IRS A;  1NTY A;  2MFQ A;  1UNR A;  1T77 A;  4A5K A;  2CY5 A;  4GN1 A;  1M7E A;  1WVH A;  2Z59 A;  2K2U A;  1ISN A;  3P7Z A;  4ZRJ A;  1E5W A;  4Z2M B;  3TO1 A;  5D3V A;  3HW2 B;  4D6W A;  4HB2 B;  2Y7B A;  3CXB B;  1ZVR A;  2HE7 A;  4OSN A;  2DYQ A;  3O96 A;  2R2Y A;  2UZR A;  1V89 A;  2D9V A;  5J3T A;  1WGQ A;  3IVF A;  3A8P A;  2I1K A;  2LOZ A;  1WJM A;  3PVL A;  1FHO A;  1PMS A;  2Z0Q A;  1MK9 B;  1UEF A;  1I2H A;  4Y94 A;  4BBK A;  3MPX A;  2BCJ A;  2RVB B;  4KHB A;  4GPT B;  2D10 A;  2DKQ A;  3PEG A;  4H8S A;  1U29 A;  4TKN A;  2EMT A;  1V61 A;  2OQB A;  2KUQ A;  2COC A;  2DA0 A;  5I2S A;  1V5M A;  3KRW A;  1Y19 B;  4GOU A;  5DI9 B;  5C6R A;  2EMS A;  3TW1 A;  2EJ8 A;  1V88 A;  2Z13 A;  1V5U A;  5C16 A;  1TJ6 A;  2GJY A;  1J0W A;  2ZPY A;  2D11 A;  5DIF B;  1KZ7 A;  5HE2 A;  4HAU B;  5LON B;  1ZYI A;  4A6K A;  4HB4 B;  5IRS A;  2FJL A;  1GC6 A;  2COF A;  2P8V A;  3QWM A;  4HB3 B;  1Z87 A;  5D3Y A;  2Z0O A;  1ZC4 B;  3ODO A;  4A6F A;  3T06 A;  4HAV B;  3OAN A;  2AEH A;  3QIJ A;  4L1R A;  3GYO A;  2RSG A;  4GMX B;  1XD4 A;  3CIK A;  3G9W A;  3GYP A;  4CHM A;  3D8F A;  4HHV A;  4F7H A;  2DHK A;  4K17 A;  4IFS A;  2ZKM X;  3SNH A;  2ROZ B;  1EF1 A;  3PVW A;  1X05 A;  2GUM A;  5JHG A;  1U5F A;  3NW8 A;  5C5B A;  1P3R A;  3TCA A;  3AU4 A;  1GG3 A;  4XWX A;  1K5D B;  5DH9 B;  2GCJ A;  3U8Z A;  1W1G A;  4DIX A;  2H7D A;  2Q13 A;  4HDQ A;  2KGX B;  3HIE A;  3SV1 A;  2L1C A;  1BTK A;  2RNR B;  1FHW A;  2DHJ A;  1U5G A;  1J19 A;  2KUP A;  3AJ4 A;  1P6S A;  5JP4 A;  2KCJ A;  2ADZ A;  4MT7 A;  3ZDT A;  5D3X A;  5I2M A;  1GC7 A;  2YT1 A;  2W2X C;  1Q67 A;  1ZM0 A;  4ZRI A;  1WG7 A;  4HAX B;  1EGX A;  3HQC A;  3ODW A;  3ZVR A;  1W1H A;  4C0A A;  1XOD A;  5KCV A;  1SHC A;  2Y8F A;  3TVV A;  1XCG A;  2DTC A;  5HE0 A;  2MWN B;  4KHA A;  2D9W A;  3DXD A;  5D27 A;  1MPH A;  1X1F A;  2J0K A;  4GZU A;  2YT0 A;  5EFX A;  2COD A;  1V5P A;  2NZ8 B;  1UPQ A;  3SO6 A;  3D8E A;  2COA A;  1RRP B;  3M1I B;  4NY0 A;  2YT2 A;  2LUL A;  4KHB B;  4GNK B;  5M4Y B;  4PNK A;  2YS1 A;  1UNQ A;  3OHM B;  4Z2N A;  2QKM A;  2ROV A;  3AU5 A;  1RJ2 A;  5J3Y A;  2D2Q A;  3LJU X;  4KVG B;  3HK0 A;  2CRF A;  2I1J A;  1MK7 B;  1XR0 B;  3NSU A;  1I7A A;  2X18 A;  5KQ1 A;  3KZ1 A;  5KQ4 A;  5J3Q A;  4F7G A;  1NI2 A;  1MAI A;  4P7I A;  3DXE A;  2J0J A;  1N3H A;  1OY2 A;  2YVC A;  1H10 A;  1LW3 A;  2J59 M;  2L2I A;  3NWD A;  1BTN A;  1K5G B;  4HAZ B;  1H4R A;  2I5C A;  2JP2 A;  4A6F B;  1FGY A;  4HAW B;  5D3W A;  4HSI A;  4WJ7 A;  1QC6 A;  1U27 A;  2G35 A;  2MDX A;  2ELA A;  2R0D A;  1XKE A;  4HDO A;  3NWF A;  2DKP A;  3KY9 A;  4EJN A;  4TYZ A;  1X1G A;  2RGN B;  4IAP A;  2VRW B;  5C5B B;  1MIX A;  2YF0 A;  1FB8 A;  4ZRK A;  1PLS A;  3FEH A;  4HB0 B;  3U7D A;  4IOY X;  4YON A;  4K2P A;  4K2O A;  4KHO A;  2LOX A;  4K81 A;  5CLL B;  4NSW A;  4HAY B;  3F0W A;  3D8D A;  2Z0P A;  2K00 A;  4DXA B;  1TXD A;  2K49 A;  2VKI A;  2NBV A;  2YRY A;  1FOE A;  1UNP A;  4EKU A;  3DXC A;  1MIZ B;  1Y5O A;  2D9Z A;  1PFJ A;  2CAY A;  4WSF A;  1EAZ A;  2FJU B;  4MY6 A;  3BIN A;  2YS3 A;  1BAK A;  3PG7 A;  1FHX A;  3FM8 C;  2KIE A;  3A8Q A;  3F5R A;  5FI1 A;  3HSA A;  1AQC A;  2RUK B;  2K2J A;  2VSZ A;  1MI1 A;  3KSY A;  2KR0 A;  3VIA A;  4PQ0 A;  3PZD A;  1X11 A;  4CHJ A;  2CY4 A;  5CLQ B;  5HE3 A;  4QJ4 B;  2MKR A;  1U5D A;  2K8E A;  2LYD A;  3UZT A;  1BWN A;  2PZ1 A;  2P0F A;  4QJ5 B;  3SYX A;  2V76 A;  1UPR A;  2DX1 A;  3WYF B;  4YL8 A;  4DBB A;  1SGH A;  2Z14 A;  5LG4 B;  5HE1 A;  2Y8G A;  1B55 A;  4QXA B;  2GS0 A;  2QKL A;  2I5F A;  2W2X D;  4KAX B;  2DHI A;  3MDB C;  1NTV A;  4GXB A;  2YSZ A;  1AWE A;  2P0H A;  1KZG A;  4OT1 A;  3P6A A;  3SUZ A;  5DHF B;  5LOP B;  1P5T A;  2DX5 A;  2IYB A;  2M14 A;  4D0N B;  4L6E A;  4WVF B;  3PVU A;  1TQZ A;  2M38 A;  2DLW A;  3N7C A;  3BJI A;  1EVH A;  2UZS A;  4F7U P;  4B6H A;  4DX8 A;  2Z4D A;  1WI1 A;  2HTH B;  5L81 A;  2N0Y A;  1ZSQ A;  1FAO A;  1WGU A;  1M7R A;  1KI1 B;  1ZC3 B;  1DDV A;  2N23 A;  3NWA A;  4GMV A;  5GOW B;  2EC1 A;  1WJ1 A;  3B77 A;  1MKE A;  3A98 B;  4MK0 A;  2D9X A;  2H7E A;  2J0M A;  2W2W A;  2P0D A;  1DBH A;  1FGZ A;  3FVC A;  3PP2 A;  2AL6 A;  2LG1 A;  1U5E A;  1DDW A;  1W1D A;  2ELB A;  2DFK A;  3X23 A;  1X86 A;  3RCP A;  2GCL A;  3ULC A;  2E2X A;  1U2B A;  5JHH A;  2D9Y A;  2RRF A;  5JLJ B; 
#chains in the Genus database with same CATH homology
 1QQG A;  2RLO A;  2NMB A;  2OTX A;  2DYN A;  5FI0 A;  2IFS A;  1NU2 A;  1OMW A;  2UVM A;  3TFM A;  4DX9 0;  4CYE A;  2YS5 A;  4HAT B;  5C79 A;  2XQN M;  3ML4 A;  1LB1 A;  3ODX A;  5DHA B;  3ULB A;  4A6H A;  2LKO A;  3VOQ A;  3V5W A;  4EMO A;  3WA0 A;  1XX0 A;  1DYN A;  3PSC A;  1DRO A;  1OQN A;  2R09 A;  3QBV B;  3FSS A;  2D4Q A;  2DN6 A;  1DDM A;  3KRX A;  1IRS A;  1NTY A;  2MFQ A;  1UNR A;  4A5K A;  2CY5 A;  4GN1 A;  1M7E A;  1WVH A;  2K2U A;  1ISN A;  3P7Z A;  4ZRJ A;  1E5W A;  4Z2M B;  3TO1 A;  5D3V A;  3HW2 B;  4HB2 B;  2Y7B A;  3CXB B;  1ZVR A;  2HE7 A;  2DYQ A;  3O96 A;  2UZR A;  1V89 A;  2D9V A;  5J3T A;  1WGQ A;  3IVF A;  3A8P A;  2I1K A;  2LOZ A;  1WJM A;  3PVL A;  1FHO A;  1PMS A;  2Z0Q A;  1MK9 B;  1UEF A;  1I2H A;  4Y94 A;  4BBK A;  3MPX A;  2BCJ A;  2RVB B;  4GPT B;  2D10 A;  2DKQ A;  3PEG A;  4H8S A;  1U29 A;  4TKN A;  2EMT A;  1V61 A;  2OQB A;  2COC A;  2DA0 A;  1V5M A;  3KRW A;  1Y19 B;  5DI9 B;  5C6R A;  2EMS A;  3TW1 A;  2EJ8 A;  1V88 A;  1V5U A;  5C16 A;  1TJ6 A;  2GJY A;  1J0W A;  2ZPY A;  2D11 A;  5DIF B;  1KZ7 A;  5HE2 A;  4HAU B;  5LON B;  4A6K A;  4HB4 B;  2FJL A;  1GC6 A;  2COF A;  2P8V A;  3QWM A;  4HB3 B;  1Z87 A;  5D3Y A;  2Z0O A;  1ZC4 B;  3ODO A;  4A6F A;  3T06 A;  4HAV B;  3OAN A;  2AEH A;  3QIJ A;  3GYO A;  2RSG A;  4GMX B;  1XD4 A;  3CIK A;  3G9W A;  3GYP A;  4CHM A;  3D8F A;  4HHV A;  4F7H A;  2DHK A;  4K17 A;  4IFS A;  3SNH A;  2ROZ B;  1EF1 A;  3PVW A;  1X05 A;  5JHG A;  1U5F A;  5C5B A;  1P3R A;  3TCA A;  3AU4 A;  1GG3 A;  4XWX A;  1K5D B;  5DH9 B;  2GCJ A;  3U8Z A;  1W1G A;  2H7D A;  2Q13 A;  4HDQ A;  2KGX B;  3SV1 A;  2L1C A;  1BTK A;  2RNR B;  1FHW A;  2DHJ A;  1U5G A;  1J19 A;  2KUP A;  3AJ4 A;  1P6S A;  5JP4 A;  2KCJ A;  2ADZ A;  4MT7 A;  3ZDT A;  5D3X A;  1GC7 A;  2YT1 A;  2W2X C;  1Q67 A;  1ZM0 A;  4ZRI A;  1WG7 A;  4HAX B;  1EGX A;  3HQC A;  3ODW A;  3ZVR A;  1W1H A;  4C0A A;  1XOD A;  5KCV A;  1SHC A;  2Y8F A;  3TVV A;  1XCG A;  2DTC A;  5HE0 A;  2MWN B;  4KHA A;  2D9W A;  3DXD A;  5D27 A;  1MPH A;  1X1F A;  2J0K A;  4GZU A;  2YT0 A;  5EFX A;  2COD A;  1V5P A;  2NZ8 B;  1UPQ A;  3SO6 A;  3D8E A;  2COA A;  1RRP B;  3M1I B;  4NY0 A;  2LUL A;  4KHB B;  4PNK A;  2YS1 A;  1UNQ A;  4Z2N A;  2QKM A;  2ROV A;  3AU5 A;  1RJ2 A;  5J3Y A;  2D2Q A;  3LJU X;  4KVG B;  3HK0 A;  2CRF A;  2I1J A;  1MK7 B;  1XR0 B;  3NSU A;  1I7A A;  2X18 A;  5KQ1 A;  3KZ1 A;  5KQ4 A;  5J3Q A;  4F7G A;  1NI2 A;  1MAI A;  4P7I A;  3DXE A;  2J0J A;  1N3H A;  1OY2 A;  2YVC A;  1H10 A;  1LW3 A;  2J59 M;  2L2I A;  1BTN A;  1K5G B;  4HAZ B;  1H4R A;  2I5C A;  2JP2 A;  4A6F B;  1FGY A;  4HAW B;  5D3W A;  4WJ7 A;  1QC6 A;  1U27 A;  2G35 A;  2MDX A;  2ELA A;  2R0D A;  1XKE A;  4HDO A;  2DKP A;  3KY9 A;  4EJN A;  4TYZ A;  1X1G A;  2RGN B;  4IAP A;  2VRW B;  5C5B B;  1MIX A;  2YF0 A;  1FB8 A;  4ZRK A;  1PLS A;  3FEH A;  4HB0 B;  3U7D A;  4IOY X;  4YON A;  4K2P A;  4K2O A;  4KHO A;  2LOX A;  4K81 A;  5CLL B;  4NSW A;  4HAY B;  3F0W A;  3D8D A;  2Z0P A;  2K00 A;  4DXA B;  1TXD A;  2VKI A;  2YRY A;  1FOE A;  1UNP A;  4EKU A;  3DXC A;  1MIZ B;  1Y5O A;  2D9Z A;  1PFJ A;  2CAY A;  4WSF A;  1EAZ A;  4MY6 A;  3BIN A;  2YS3 A;  1BAK A;  3PG7 A;  1FHX A;  3FM8 C;  3A8Q A;  3F5R A;  5FI1 A;  1AQC A;  2RUK B;  2K2J A;  2VSZ A;  3KSY A;  3VIA A;  4PQ0 A;  3PZD A;  1X11 A;  4CHJ A;  2CY4 A;  5CLQ B;  5HE3 A;  2MKR A;  1U5D A;  2LYD A;  3UZT A;  1BWN A;  2PZ1 A;  2P0F A;  3SYX A;  2V76 A;  1UPR A;  2DX1 A;  3WYF B;  4YL8 A;  4DBB A;  1SGH A;  5HE1 A;  2Y8G A;  1B55 A;  2GS0 A;  2QKL A;  2I5F A;  2W2X D;  4KAX B;  2DHI A;  3MDB C;  1NTV A;  4GXB A;  2YSZ A;  1AWE A;  2P0H A;  1KZG A;  3P6A A;  3SUZ A;  5DHF B;  5LOP B;  1P5T A;  2DX5 A;  2IYB A;  2M14 A;  4D0N B;  4L6E A;  4WVF B;  3PVU A;  1TQZ A;  2M38 A;  2DLW A;  3N7C A;  3BJI A;  1EVH A;  2UZS A;  4F7U P;  4B6H A;  4DX8 A;  1WI1 A;  2HTH B;  5L81 A;  2N0Y A;  1ZSQ A;  1FAO A;  1WGU A;  1M7R A;  1KI1 B;  1ZC3 B;  1DDV A;  2N23 A;  4GMV A;  5GOW B;  2EC1 A;  1WJ1 A;  1MKE A;  3A98 B;  4MK0 A;  2D9X A;  2H7E A;  2J0M A;  2W2W A;  2P0D A;  1DBH A;  1FGZ A;  3PP2 A;  2AL6 A;  2LG1 A;  1U5E A;  1DDW A;  1W1D A;  2ELB A;  2DFK A;  3X23 A;  1X86 A;  3RCP A;  2GCL A;  3ULC A;  2E2X A;  1U2B A;  5JHH A;  2D9Y A;  5JLJ B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...