1WGQA

Solution structure of the pleckstrin homology domain of mouse ethanol decreased 4 protein
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
109
structure length
109
Chain Sequence
b'GSSGSSGSTMSGYLYRSKGSKKPWKHLWFVIKNKVLYTYAASEDVAALESQPLLGFTVTLVKDENSESKVFQLLHKGMVFYVFKADDAHSTQRWIDAFQEGTVSGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FYVE, RhoGEF and PH domain containing 6; ethanol decreased 4
molecule tags Sugar binding protein
source organism Mus musculus
publication title Solution Structure of the Pleckstrin Homology Domain of Mouse Ethanol Decreased 4 Protein
rcsb
total genus 14
structure length 109
sequence length 109
ec nomenclature
pdb deposition date 2004-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00169 PH PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1wgqA00
4EKUA 4IFSA 2LOXA 1Y5OA 2HTHB 1KZGA 5D27A 3GYOA 1ZSQA 3QIJA 4Y94A 3U7DA 5D3WA 1MIZB 2ELBA 2RVBB 2IFSA 4GMXB 5C6RA 2YRYA 1DDMA 1FB8A 1MK9B 5D3XA 5HE1A 4HDQA 1V89A 3A8QA 1J19A 2R0DA 1RJ2A 2I1JA 4KVGB 3TVVA 3BJIA 3TFMA 3MPXA 2GS0A 2MWNB 3PG7A 5DH9B 2RLOA 4CHMA 5EFXA 4K2PA 5KCVA 4F7GA 4HB3B 2OQBA 2Y8GA 1U5GA 2YSZA 4PQ0A 2VRWB 4XWXA 4WJ7A 4GPTB 1EAZA 3PZDA 2VKIA 2V76A 2VSZA 1V61A 2XQNM 2YT0A 1GC7A 5JLJB 1BAKA 2G35A 4MT7A 5KQ4A 2DX1A 3UZTA 4KHOA 2HE7A 2COCA 3PVLA 2K2JA 5GOWB 3DXEA 2KGXB 3ODXA 3ULBA 2YS3A 3HK0A 3U8ZA 3AU5A 4D0NB 3D8FA 1FHWA 3SUZA 4DXAB 3T06A 3O96A 1WG7A 1PLSA 2I5CA 1I7AA 2NZ8B 1W1GA 1DDVA 4A5KA 4K81A 3ZDTA 5DIFB 2DKPA 1XODA 2W2XD 2EC1A 4NY0A 1WI1A 1EF1A 2LKOA 2YS5A 3HQCA 3F0WA 1DYNA 2PZ1A 2EMTA 2LULA 2DLWA 1BWNA 3SV1A 3D8EA 5KQ1A 1UNRA 1V5PA 1OY2A 1P6SA 2JP2A 4HDOA 2DYNA 4H8SA 1DBHA 5J3QA 2I5FA 1FOEA 2CAYA 1BTNA 5C79A 1X11A 4IOYX 1H10A 3PP2A 2BCJA 1XR0B 5DHFB 2GCJA 4HAYB 3V5WA 5J3TA 4HAXB 1U2BA 1FAOA 4GZUA 1GC6A 2UZRA 1B55A 1GG3A 3WA0A 2N23A 2LG1A 1NU2A 2R09A 2W2WA 2UVMA 2CY5A 2DKQA 5J3YA 1U5EA 2ELAA 3ZVRA 4F7HA 4HAUB 2D9ZA 2Y8FA 3F5RA 2ADZA 1N3HA 2H7EA 3TO1A 2QKLA 1IRSA 2DYQA 2D9YA 2M14A 1UPQA 1OMWA 2DN6A 2X18A 2GJYA 1EVHA 4YL8A 4BBKA 2QKMA 2J0JA 2AEHA 2RNRB 4F7UP 2H7DA 1Q67A 1V5MA 3FSSA 2Z0PA 2I1KA 5FI1A 1AWEA 1UPRA 4CYEA 5C16A 1WJMA 2J0MA 1UNQA 1WGUA 1J0WA 2D4QA 5DHAB 4HB0B 2KCJA 1M7EA 3FEHA 4DX8A 1X1GA 1NTYA 1K5GB 1MAIA 3KSYA 1XKEA 3A98B 3KY9A 3NSUA 2D2QA 1WJ1A 4ZRJA 2K2UA 1TXDA 1K5DB 1MKEA 4HATB 2DA0A 3SYXA 2MKRA 3KZ1A 5JP4A 4WVFB 4GMVA 4GN1A 2RSGA 1X1FA 2P0FA 3MDBC 4TKNA 3X23A 4A6HA 5HE2A 3PEGA 1DDWA 4Z2MB 2P0DA 1FGYA 1ZC3B 4HAWB 1KI1B 3P6AA 4KHAA 1XCGA 1MIXA 4GXBA 2ZPYA 1TJ6A 3GYPA 4CHJA 5LOPB 4NSWA 5D3YA 3LJUX 3ODOA 4ZRKA 4HAZB 1FGZA 3SO6A 5D3VA 2Q13A 1Y19B 1FHOA 3P7ZA 1WVHA 1ZC4B 4L6EA 1E5WA 2COAA 4P7IA 3TW1A 1I2HA 3A8PA 1ISNA 4HHVA 5DI9B 1NI2A 2YT1A 2J0KA 3DXDA 2DFKA 1QC6A 2CODA 1UEFA 3WYFB 4DBBA 2DHJA 2P8VA 2CRFA 1UNPA 2ROZB 1PMSA 2EJ8A 3ULCA 2NMBA 2D10A 2MFQA 1U5DA 3SNHA 1PFJA 3M1IB 1OQNA 2DX5A 4A6FB 2IYBA 2D11A 2YF0A 1W1DA 2RUKB 3VIAA 1EGXA 4K17A 5CLLB 3QBVB 2KUPA 3KRWA 2ROVA 3ML4A 4TYZA 3QWMA 2N0YA 1LB1A 4K2OA 2UZSA 3CIKA 1W1HA 2DHKA 3ODWA 2W2XC 4KHBB 2COFA 3G9WA 1XD4A 3N7CA 2OTXA 1U5FA 3TCAA 4C0AA 3AJ4A 3PVUA 1X86A 2L2IA 1M7RA 4ZRIA 2Y7BA 3CXBB 4B6HA 1MPHA 2EMSA 1LW3A 1SHCA 4PNKA 2DHIA 3D8DA 4HAVB 3RCPA 5JHGA 2DTCA 5HE3A 3BINA 4HB2B 1H4RA 4EJNA 2K00A 3IVFA 3VOQA 2L1CA 1WGQA 2CY4A 1MK7B 2D9XA 2RGNB 3DXCA 2LYDA 1Z87A 1P5TA 4A6KA 4MY6A 3AU4A 2E2XA 1RRPB 4HB4B 5L81A 1QQGA 1ZM0A 5JHHA 1AQCA 3OANA 1KZ7A 4DX90 5C5BA 1FHXA 2YVCA 3KRXA 1SGHA 5C5BB 4EMOA 2Z0OA 1DROA 1XX0A 1ZVRA 1BTKA 1U27A 5HE0A 4KAXB 2YS1A 3PSCA 1TQZA 4WSFA 5LONB 2P0HA 1V5UA 4IAPA 4MK0A 2AL6A 1V88A 2M38A 2D9VA 1X05A 3PVWA 5CLQB 1NTVA 2MDXA 3HW2B 3FM8C 2D9WA 2FJLA 2J59M 2GCLA 2Z0QA 5FI0A 4A6FA 4Z2NA 2LOZA 4YONA 1P3RA 1U29A
chains in the Genus database with same CATH superfamily
4EKUA 4IFSA 2LOXA 1Y5OA 2HTHB 1KZGA 5D27A 3GYOA 1ZSQA 3QIJA 4QJ5B 4Y94A 3U7DA 5D3WA 1MIZB 2ELBA 2RVBB 2IFSA 4GMXB 4OSNA 2FJUB 5C6RA 2YRYA 1DDMA 1FB8A 1MK9B 5D3XA 5LG4B 5HE1A 2Z14A 4HDQA 2K49A 1V89A 3A8QA 1J19A 2R0DA 1RJ2A 2I1JA 4KVGB 3TVVA 3BJIA 3TFMA 3MPXA 2KUQA 2GS0A 2MWNB 3PG7A 5DH9B 2RLOA 4CHMA 5EFXA 3NWAA 4K2PA 2ZKMX 5KCVA 4F7GA 4HB3B 2OQBA 2Y8GA 1U5GA 2YSZA 4PQ0A 2VRWB 4XWXA 4WJ7A 4GPTB 1EAZA 3PZDA 2VKIA 2V76A 3NWDA 2VSZA 1V61A 2XQNM 2YT0A 1GC7A 5JLJB 1BAKA 2Z13A 2G35A 4MT7A 5KQ4A 2DX1A 3UZTA 4KHOA 2HE7A 2COCA 3PVLA 2K2JA 5GOWB 3DXEA 2KGXB 3ODXA 3DCXA 3ULBA 2YS3A 3HK0A 3U8ZA 3AU5A 4D0NB 3D8FA 1FHWA 3SUZA 4DXAB 3T06A 3O96A 1WG7A 1PLSA 2I5CA 1I7AA 2NZ8B 1W1GA 1DDVA 4A5KA 4K81A 3ZDTA 5DIFB 2DKPA 1XODA 2W2XD 2EC1A 4NY0A 1WI1A 1EF1A 2LKOA 3U12A 2YS5A 3HQCA 3F0WA 1DYNA 2PZ1A 2GUMA 2EMTA 2LULA 2DLWA 1BWNA 3SV1A 3D8EA 5KQ1A 1UNRA 1V5PA 1OY2A 1P6SA 4QJ3B 2JP2A 4HDOA 2DYNA 4H8SA 1DBHA 5J3QA 2I5FA 1FOEA 2CAYA 1BTNA 5C79A 1X11A 3A58A 4IOYX 1H10A 3FVCA 3PP2A 2BCJA 1XR0B 5DHFB 2GCJA 4HAYB 3V5WA 5J3TA 4HAXB 1U2BA 1FAOA 4GZUA 1GC6A 2UZRA 1B55A 1GG3A 3WA0A 2N23A 2LG1A 1NU2A 2R09A 2W2WA 2UVMA 2CY5A 2DKQA 5J3YA 1U5EA 2ELAA 3ZVRA 2NBVA 4F7HA 2Y8FA 2D9ZA 3F5RA 4HAUB 2ADZA 1N3HA 2H7EA 3NWFA 3TO1A 2QKLA 1IRSA 2DYQA 2D9YA 2M14A 1UPQA 1OMWA 2DN6A 1T77A 2X18A 2GJYA 1EVHA 4YL8A 4BBKA 2QKMA 2J0JA 2AEHA 2RNRB 4F7UP 2H7DA 1Q67A 1V5MA 3FSSA 2Z0PA 2I1KA 5FI1A 1AWEA 1UPRA 4CYEA 5C16A 1WJMA 2J0MA 1UNQA 1WGUA 1J0WA 2D4QA 5IRSA 5DHAB 4HB0B 2KCJA 1M7EA 4KHBA 3FEHA 4DX8A 5I2MA 1X1GA 1NTYA 1K5GB 1MAIA 3KSYA 1XKEA 3A98B 3KY9A 3NSUA 2D2QA 3HSAA 1WJ1A 4ZRJA 2K2UA 1TXDA 1K5DB 1ZYIA 4QXAB 3OHMB 1MKEA 4HATB 2DA0A 3SYXA 2MKRA 3KZ1A 5JP4A 4WVFB 4GMVA 4GN1A 2RSGA 2Z59A 1X1FA 2P0FA 3MDBC 4TKNA 3X23A 4A6HA 5HE2A 3PEGA 1DDWA 4Z2MB 2P0DA 1FGYA 1ZC3B 4HAWB 1KI1B 4QJ4B 3P6AA 4KHAA 1XCGA 1MIXA 4GXBA 2ZPYA 1TJ6A 3GYPA 4CHJA 5LOPB 4NSWA 5D3YA 3LJUX 3ODOA 2R2YA 4ZRKA 4HAZB 1FGZA 3SO6A 5D3VA 2Q13A 1Y19B 1FHOA 3P7ZA 1WVHA 2KR0A 1ZC4B 4L6EA 4GOUA 2K8EA 1E5WA 2COAA 4P7IA 3TW1A 1I2HA 3A8PA 1ISNA 2RRFA 4HHVA 5DI9B 1NI2A 2YT1A 2J0KA 3DXDA 2Z4DA 2DFKA 1QC6A 2CODA 1UEFA 3WYFB 4DBBA 2DHJA 2P8VA 2KIGA 2CRFA 1UNPA 4L1RA 2ROZB 1PMSA 2EJ8A 3ULCA 2NMBA 2D10A 2MFQA 1U5DA 3SNHA 1PFJA 3M1IB 1OQNA 2DX5A 4A6FB 2IYBA 2D11A 2YF0A 1W1DA 4GNKB 2RUKB 3VIAA 1EGXA 4K17A 5CLLB 3QBVB 4OT1A 2KUPA 3KRWA 2ROVA 3ML4A 4TYZA 3QWMA 2N0YA 1LB1A 4CSQA 4K2OA 2UZSA 3CIKA 1W1HA 2DHKA 3ODWA 2W2XC 4KHBB 2COFA 3G9WA 1XD4A 3N7CA 2OTXA 1U5FA 3TCAA 4C0AA 3AJ4A 3PVUA 1X86A 2L2IA 1M7RA 4ZRIA 2Y7BA 2KIEA 3CXBB 4B6HA 1MPHA 2EMSA 1LW3A 1SHCA 4PNKA 1MI1A 2DHIA 3D8DA 4HAVB 3RCPA 4D6WA 5JHGA 2DTCA 5HE3A 3NW8A 3BINA 4HB2B 1H4RA 4EJNA 2K00A 3IVFA 3VOQA 2L1CA 1WGQA 2CY4A 1MK7B 2D9XA 2RGNB 3DXCA 2LYDA 1Z87A 1P5TA 4A6KA 4MY6A 3AU4A 2E2XA 1RRPB 4HB4B 5L81A 1QQGA 1ZM0A 4HSIA 5JHHA 1AQCA 3OANA 1KZ7A 4DX90 5C5BA 1FHXA 2YVCA 3KRXA 1SGHA 5C5BB 4EMOA 2Z0OA 2YT2A 3HIEA 1DROA 1XX0A 1ZVRA 1BTKA 1U27A 5HE0A 4KAXB 2YS1A 3PSCA 1TQZA 4WSFA 5LONB 2P0HA 1V5UA 5I2SA 4IAPA 4MK0A 2AL6A 1V88A 4DIXA 2M38A 2D9VA 1X05A 3PVWA 5CLQB 5M4YB 1NTVA 2MDXA 3HW2B 3FM8C 2D9WA 2FJLA 2J59M 2GCLA 2Z0QA 5FI0A 4A6FA 4Z2NA 2LOZA 4YONA 1P3RA 3B77A 1U29A
chains in the Genus database with same CATH topology
4EKUA 4IFSA 2LOXA 1Y5OA 2HTHB 1KZGA 5D27A 3GYOA 1ZSQA 3QIJA 4Y94A 3U7DA 5D3WA 1MIZB 2ELBA 2RVBB 2IFSA 4GMXB 5C6RA 2YRYA 1DDMA 1FB8A 1MK9B 5D3XA 5HE1A 4HDQA 1V89A 3A8QA 1J19A 2R0DA 1RJ2A 2I1JA 4KVGB 3TVVA 3BJIA 3TFMA 3MPXA 2GS0A 2MWNB 3PG7A 5DH9B 2RLOA 4CHMA 5EFXA 4K2PA 5KCVA 4F7GA 4HB3B 2OQBA 2Y8GA 1U5GA 2YSZA 4PQ0A 2VRWB 4XWXA 4WJ7A 4GPTB 1EAZA 3PZDA 2VKIA 2V76A 2VSZA 1V61A 2XQNM 2YT0A 1GC7A 5JLJB 1BAKA 2G35A 4MT7A 5KQ4A 2DX1A 3UZTA 4KHOA 2HE7A 2COCA 3PVLA 2K2JA 5GOWB 3DXEA 2KGXB 3ODXA 3ULBA 2YS3A 3HK0A 3U8ZA 3AU5A 4D0NB 3D8FA 1FHWA 3SUZA 4DXAB 3T06A 3O96A 1WG7A 1PLSA 2I5CA 1I7AA 2NZ8B 1W1GA 1DDVA 4A5KA 4K81A 3ZDTA 5DIFB 2DKPA 1XODA 2W2XD 2EC1A 4NY0A 1WI1A 1EF1A 2LKOA 2YS5A 3HQCA 3F0WA 1DYNA 2PZ1A 2EMTA 2LULA 2DLWA 1BWNA 3SV1A 3D8EA 5KQ1A 1UNRA 1V5PA 1OY2A 1P6SA 2JP2A 4HDOA 2DYNA 4H8SA 1DBHA 5J3QA 2I5FA 1FOEA 2CAYA 1BTNA 5C79A 1X11A 4IOYX 1H10A 3PP2A 2BCJA 1XR0B 5DHFB 2GCJA 4HAYB 3V5WA 5J3TA 4HAXB 1U2BA 1FAOA 4GZUA 1GC6A 2UZRA 1B55A 1GG3A 3WA0A 2N23A 2LG1A 1NU2A 2R09A 2W2WA 2UVMA 2CY5A 2DKQA 5J3YA 1U5EA 2ELAA 3ZVRA 4F7HA 4HAUB 2D9ZA 2Y8FA 3F5RA 2ADZA 1N3HA 2H7EA 3TO1A 2QKLA 1IRSA 2DYQA 2D9YA 2M14A 1UPQA 1OMWA 2DN6A 2X18A 2GJYA 1EVHA 4YL8A 4BBKA 2QKMA 2J0JA 2AEHA 2RNRB 4F7UP 2H7DA 1Q67A 1V5MA 3FSSA 2Z0PA 2I1KA 5FI1A 1AWEA 1UPRA 4CYEA 5C16A 1WJMA 2J0MA 1UNQA 1WGUA 1J0WA 2D4QA 5DHAB 4HB0B 2KCJA 1M7EA 3FEHA 4DX8A 1X1GA 1NTYA 1K5GB 1MAIA 3KSYA 1XKEA 3A98B 3KY9A 3NSUA 2D2QA 1WJ1A 4ZRJA 2K2UA 1TXDA 1K5DB 1MKEA 4HATB 2DA0A 3SYXA 2MKRA 3KZ1A 5JP4A 4WVFB 4GMVA 4GN1A 2RSGA 1X1FA 2P0FA 3MDBC 4TKNA 3X23A 4A6HA 5HE2A 3PEGA 1DDWA 4Z2MB 2P0DA 1FGYA 1ZC3B 4HAWB 1KI1B 3P6AA 4KHAA 1XCGA 1MIXA 4GXBA 2ZPYA 1TJ6A 3GYPA 4CHJA 5LOPB 4NSWA 5D3YA 3LJUX 3ODOA 4ZRKA 4HAZB 1FGZA 3SO6A 5D3VA 2Q13A 1Y19B 1FHOA 3P7ZA 1WVHA 1ZC4B 4L6EA 1E5WA 2COAA 4P7IA 3TW1A 1I2HA 3A8PA 1ISNA 4HHVA 5DI9B 1NI2A 2YT1A 2J0KA 3DXDA 2DFKA 1QC6A 2CODA 1UEFA 3WYFB 4DBBA 2DHJA 2P8VA 2CRFA 1UNPA 2ROZB 1PMSA 2EJ8A 3ULCA 2NMBA 2D10A 2MFQA 1U5DA 3SNHA 1PFJA 3M1IB 1OQNA 2DX5A 4A6FB 2IYBA 2D11A 2YF0A 1W1DA 2RUKB 3VIAA 1EGXA 4K17A 5CLLB 3QBVB 2KUPA 3KRWA 2ROVA 3ML4A 4TYZA 3QWMA 2N0YA 1LB1A 4K2OA 2UZSA 3CIKA 1W1HA 2DHKA 3ODWA 2W2XC 4KHBB 2COFA 3G9WA 1XD4A 3N7CA 2OTXA 1U5FA 3TCAA 4C0AA 3AJ4A 3PVUA 1X86A 2L2IA 1M7RA 4ZRIA 2Y7BA 3CXBB 4B6HA 1MPHA 2EMSA 1LW3A 1SHCA 4PNKA 2DHIA 3D8DA 4HAVB 3RCPA 5JHGA 2DTCA 5HE3A 3BINA 4HB2B 1H4RA 4EJNA 2K00A 3IVFA 3VOQA 2L1CA 1WGQA 2CY4A 1MK7B 2D9XA 2RGNB 3DXCA 2LYDA 1Z87A 1P5TA 4A6KA 4MY6A 3AU4A 2E2XA 1RRPB 4HB4B 5L81A 1QQGA 1ZM0A 5JHHA 1AQCA 3OANA 1KZ7A 4DX90 5C5BA 1FHXA 2YVCA 3KRXA 1SGHA 5C5BB 4EMOA 2Z0OA 1DROA 1XX0A 1ZVRA 1BTKA 1U27A 5HE0A 4KAXB 2YS1A 3PSCA 1TQZA 4WSFA 5LONB 2P0HA 1V5UA 4IAPA 4MK0A 2AL6A 1V88A 2M38A 2D9VA 1X05A 3PVWA 5CLQB 1NTVA 2MDXA 3HW2B 3FM8C 2D9WA 2FJLA 2J59M 2GCLA 2Z0QA 5FI0A 4A6FA 4Z2NA 2LOZA 4YONA 1P3RA 1U29A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4EKU A;  4IFS A;  2LOX A;  1Y5O A;  2HTH B;  1KZG A;  5D27 A;  3GYO A;  1ZSQ A;  3QIJ A;  4Y94 A;  3U7D A;  5D3W A;  1MIZ B;  2ELB A;  2RVB B;  2IFS A;  4GMX B;  5C6R A;  2YRY A;  1DDM A;  1FB8 A;  1MK9 B;  5D3X A;  5HE1 A;  4HDQ A;  1V89 A;  3A8Q A;  1J19 A;  2R0D A;  1RJ2 A;  2I1J A;  4KVG B;  3TVV A;  3BJI A;  3TFM A;  3MPX A;  2GS0 A;  2MWN B;  3PG7 A;  5DH9 B;  2RLO A;  4CHM A;  5EFX A;  4K2P A;  5KCV A;  4F7G A;  4HB3 B;  2OQB A;  2Y8G A;  1U5G A;  2YSZ A;  4PQ0 A;  2VRW B;  4XWX A;  4WJ7 A;  4GPT B;  1EAZ A;  3PZD A;  2VKI A;  2V76 A;  2VSZ A;  1V61 A;  2XQN M;  2YT0 A;  1GC7 A;  5JLJ B;  1BAK A;  2G35 A;  4MT7 A;  5KQ4 A;  2DX1 A;  3UZT A;  4KHO A;  2HE7 A;  2COC A;  3PVL A;  2K2J A;  5GOW B;  3DXE A;  2KGX B;  3ODX A;  3ULB A;  2YS3 A;  3HK0 A;  3U8Z A;  3AU5 A;  4D0N B;  3D8F A;  1FHW A;  3SUZ A;  4DXA B;  3T06 A;  3O96 A;  1WG7 A;  1PLS A;  2I5C A;  1I7A A;  2NZ8 B;  1W1G A;  1DDV A;  4A5K A;  4K81 A;  3ZDT A;  5DIF B;  2DKP A;  1XOD A;  2W2X D;  2EC1 A;  4NY0 A;  1WI1 A;  1EF1 A;  2LKO A;  2YS5 A;  3HQC A;  3F0W A;  1DYN A;  2PZ1 A;  2EMT A;  2LUL A;  2DLW A;  1BWN A;  3SV1 A;  3D8E A;  5KQ1 A;  1UNR A;  1V5P A;  1OY2 A;  1P6S A;  2JP2 A;  4HDO A;  2DYN A;  4H8S A;  1DBH A;  5J3Q A;  2I5F A;  1FOE A;  2CAY A;  1BTN A;  5C79 A;  1X11 A;  4IOY X;  1H10 A;  3PP2 A;  2BCJ A;  1XR0 B;  5DHF B;  2GCJ A;  4HAY B;  3V5W A;  5J3T A;  4HAX B;  1U2B A;  1FAO A;  4GZU A;  1GC6 A;  2UZR A;  1B55 A;  1GG3 A;  3WA0 A;  2N23 A;  2LG1 A;  1NU2 A;  2R09 A;  2W2W A;  2UVM A;  2CY5 A;  2DKQ A;  5J3Y A;  1U5E A;  2ELA A;  3ZVR A;  4F7H A;  4HAU B;  2D9Z A;  2Y8F A;  3F5R A;  2ADZ A;  1N3H A;  2H7E A;  3TO1 A;  2QKL A;  1IRS A;  2DYQ A;  2D9Y A;  2M14 A;  1UPQ A;  1OMW A;  2DN6 A;  2X18 A;  2GJY A;  1EVH A;  4YL8 A;  4BBK A;  2QKM A;  2J0J A;  2AEH A;  2RNR B;  4F7U P;  2H7D A;  1Q67 A;  1V5M A;  3FSS A;  2Z0P A;  2I1K A;  5FI1 A;  1AWE A;  1UPR A;  4CYE A;  5C16 A;  1WJM A;  2J0M A;  1UNQ A;  1WGU A;  1J0W A;  2D4Q A;  5DHA B;  4HB0 B;  2KCJ A;  1M7E A;  3FEH A;  4DX8 A;  1X1G A;  1NTY A;  1K5G B;  1MAI A;  3KSY A;  1XKE A;  3A98 B;  3KY9 A;  3NSU A;  2D2Q A;  1WJ1 A;  4ZRJ A;  2K2U A;  1TXD A;  1K5D B;  1MKE A;  4HAT B;  2DA0 A;  3SYX A;  2MKR A;  3KZ1 A;  5JP4 A;  4WVF B;  4GMV A;  4GN1 A;  2RSG A;  1X1F A;  2P0F A;  3MDB C;  4TKN A;  3X23 A;  4A6H A;  5HE2 A;  3PEG A;  1DDW A;  4Z2M B;  2P0D A;  1FGY A;  1ZC3 B;  4HAW B;  1KI1 B;  3P6A A;  4KHA A;  1XCG A;  1MIX A;  4GXB A;  2ZPY A;  1TJ6 A;  3GYP A;  4CHJ A;  5LOP B;  4NSW A;  5D3Y A;  3LJU X;  3ODO A;  4ZRK A;  4HAZ B;  1FGZ A;  3SO6 A;  5D3V A;  2Q13 A;  1Y19 B;  1FHO A;  3P7Z A;  1WVH A;  1ZC4 B;  4L6E A;  1E5W A;  2COA A;  4P7I A;  3TW1 A;  1I2H A;  3A8P A;  1ISN A;  4HHV A;  5DI9 B;  1NI2 A;  2YT1 A;  2J0K A;  3DXD A;  2DFK A;  1QC6 A;  2COD A;  1UEF A;  3WYF B;  4DBB A;  2DHJ A;  2P8V A;  2CRF A;  1UNP A;  2ROZ B;  1PMS A;  2EJ8 A;  3ULC A;  2NMB A;  2D10 A;  2MFQ A;  1U5D A;  3SNH A;  1PFJ A;  3M1I B;  1OQN A;  2DX5 A;  4A6F B;  2IYB A;  2D11 A;  2YF0 A;  1W1D A;  2RUK B;  3VIA A;  1EGX A;  4K17 A;  5CLL B;  3QBV B;  2KUP A;  3KRW A;  2ROV A;  3ML4 A;  4TYZ A;  3QWM A;  2N0Y A;  1LB1 A;  4K2O A;  2UZS A;  3CIK A;  1W1H A;  2DHK A;  3ODW A;  2W2X C;  4KHB B;  2COF A;  3G9W A;  1XD4 A;  3N7C A;  2OTX A;  1U5F A;  3TCA A;  4C0A A;  3AJ4 A;  3PVU A;  1X86 A;  2L2I A;  1M7R A;  4ZRI A;  2Y7B A;  3CXB B;  4B6H A;  1MPH A;  2EMS A;  1LW3 A;  1SHC A;  4PNK A;  2DHI A;  3D8D A;  4HAV B;  3RCP A;  5JHG A;  2DTC A;  5HE3 A;  3BIN A;  4HB2 B;  1H4R A;  4EJN A;  2K00 A;  3IVF A;  3VOQ A;  2L1C A;  1WGQ A;  2CY4 A;  1MK7 B;  2D9X A;  2RGN B;  3DXC A;  2LYD A;  1Z87 A;  1P5T A;  4A6K A;  4MY6 A;  3AU4 A;  2E2X A;  1RRP B;  4HB4 B;  5L81 A;  1QQG A;  1ZM0 A;  5JHH A;  1AQC A;  3OAN A;  1KZ7 A;  4DX9 0;  5C5B A;  1FHX A;  2YVC A;  3KRX A;  1SGH A;  5C5B B;  4EMO A;  2Z0O A;  1DRO A;  1XX0 A;  1ZVR A;  1BTK A;  1U27 A;  5HE0 A;  4KAX B;  2YS1 A;  3PSC A;  1TQZ A;  4WSF A;  5LON B;  2P0H A;  1V5U A;  4IAP A;  4MK0 A;  2AL6 A;  1V88 A;  2M38 A;  2D9V A;  1X05 A;  3PVW A;  5CLQ B;  1NTV A;  2MDX A;  3HW2 B;  3FM8 C;  2D9W A;  2FJL A;  2J59 M;  2GCL A;  2Z0Q A;  5FI0 A;  4A6F A;  4Z2N A;  2LOZ A;  4YON A;  1P3R A;  1U29 A; 
#chains in the Genus database with same CATH topology
 4EKU A;  4IFS A;  2LOX A;  1Y5O A;  2HTH B;  1KZG A;  5D27 A;  3GYO A;  1ZSQ A;  3QIJ A;  4QJ5 B;  4Y94 A;  3U7D A;  5D3W A;  1MIZ B;  2ELB A;  2RVB B;  2IFS A;  4GMX B;  4OSN A;  2FJU B;  5C6R A;  2YRY A;  1DDM A;  1FB8 A;  1MK9 B;  5D3X A;  5LG4 B;  5HE1 A;  2Z14 A;  4HDQ A;  2K49 A;  1V89 A;  3A8Q A;  1J19 A;  2R0D A;  1RJ2 A;  2I1J A;  4KVG B;  3TVV A;  3BJI A;  3TFM A;  3MPX A;  2KUQ A;  2GS0 A;  2MWN B;  3PG7 A;  5DH9 B;  2RLO A;  4CHM A;  5EFX A;  3NWA A;  4K2P A;  2ZKM X;  5KCV A;  4F7G A;  4HB3 B;  2OQB A;  2Y8G A;  1U5G A;  2YSZ A;  4PQ0 A;  2VRW B;  4XWX A;  4WJ7 A;  4GPT B;  1EAZ A;  3PZD A;  2VKI A;  2V76 A;  3NWD A;  2VSZ A;  1V61 A;  2XQN M;  2YT0 A;  1GC7 A;  5JLJ B;  1BAK A;  2Z13 A;  2G35 A;  4MT7 A;  5KQ4 A;  2DX1 A;  3UZT A;  4KHO A;  2HE7 A;  2COC A;  3PVL A;  2K2J A;  5GOW B;  3DXE A;  2KGX B;  3ODX A;  3DCX A;  3ULB A;  2YS3 A;  3HK0 A;  3U8Z A;  3AU5 A;  4D0N B;  3D8F A;  1FHW A;  3SUZ A;  4DXA B;  3T06 A;  3O96 A;  1WG7 A;  1PLS A;  2I5C A;  1I7A A;  2NZ8 B;  1W1G A;  1DDV A;  4A5K A;  4K81 A;  3ZDT A;  5DIF B;  2DKP A;  1XOD A;  2W2X D;  2EC1 A;  4NY0 A;  1WI1 A;  1EF1 A;  2LKO A;  3U12 A;  2YS5 A;  3HQC A;  3F0W A;  1DYN A;  2PZ1 A;  2GUM A;  2EMT A;  2LUL A;  2DLW A;  1BWN A;  3SV1 A;  3D8E A;  5KQ1 A;  1UNR A;  1V5P A;  1OY2 A;  1P6S A;  4QJ3 B;  2JP2 A;  4HDO A;  2DYN A;  4H8S A;  1DBH A;  5J3Q A;  2I5F A;  1FOE A;  2CAY A;  1BTN A;  5C79 A;  1X11 A;  3A58 A;  4IOY X;  1H10 A;  3FVC A;  3PP2 A;  2BCJ A;  1XR0 B;  5DHF B;  2GCJ A;  4HAY B;  3V5W A;  5J3T A;  4HAX B;  1U2B A;  1FAO A;  4GZU A;  1GC6 A;  2UZR A;  1B55 A;  1GG3 A;  3WA0 A;  2N23 A;  2LG1 A;  1NU2 A;  2R09 A;  2W2W A;  2UVM A;  2CY5 A;  2DKQ A;  5J3Y A;  1U5E A;  2ELA A;  3ZVR A;  2NBV A;  4F7H A;  2Y8F A;  2D9Z A;  3F5R A;  4HAU B;  2ADZ A;  1N3H A;  2H7E A;  3NWF A;  3TO1 A;  2QKL A;  1IRS A;  2DYQ A;  2D9Y A;  2M14 A;  1UPQ A;  1OMW A;  2DN6 A;  1T77 A;  2X18 A;  2GJY A;  1EVH A;  4YL8 A;  4BBK A;  2QKM A;  2J0J A;  2AEH A;  2RNR B;  4F7U P;  2H7D A;  1Q67 A;  1V5M A;  3FSS A;  2Z0P A;  2I1K A;  5FI1 A;  1AWE A;  1UPR A;  4CYE A;  5C16 A;  1WJM A;  2J0M A;  1UNQ A;  1WGU A;  1J0W A;  2D4Q A;  5IRS A;  5DHA B;  4HB0 B;  2KCJ A;  1M7E A;  4KHB A;  3FEH A;  4DX8 A;  5I2M A;  1X1G A;  1NTY A;  1K5G B;  1MAI A;  3KSY A;  1XKE A;  3A98 B;  3KY9 A;  3NSU A;  2D2Q A;  3HSA A;  1WJ1 A;  4ZRJ A;  2K2U A;  1TXD A;  1K5D B;  1ZYI A;  4QXA B;  3OHM B;  1MKE A;  4HAT B;  2DA0 A;  3SYX A;  2MKR A;  3KZ1 A;  5JP4 A;  4WVF B;  4GMV A;  4GN1 A;  2RSG A;  2Z59 A;  1X1F A;  2P0F A;  3MDB C;  4TKN A;  3X23 A;  4A6H A;  5HE2 A;  3PEG A;  1DDW A;  4Z2M B;  2P0D A;  1FGY A;  1ZC3 B;  4HAW B;  1KI1 B;  4QJ4 B;  3P6A A;  4KHA A;  1XCG A;  1MIX A;  4GXB A;  2ZPY A;  1TJ6 A;  3GYP A;  4CHJ A;  5LOP B;  4NSW A;  5D3Y A;  3LJU X;  3ODO A;  2R2Y A;  4ZRK A;  4HAZ B;  1FGZ A;  3SO6 A;  5D3V A;  2Q13 A;  1Y19 B;  1FHO A;  3P7Z A;  1WVH A;  2KR0 A;  1ZC4 B;  4L6E A;  4GOU A;  2K8E A;  1E5W A;  2COA A;  4P7I A;  3TW1 A;  1I2H A;  3A8P A;  1ISN A;  2RRF A;  4HHV A;  5DI9 B;  1NI2 A;  2YT1 A;  2J0K A;  3DXD A;  2Z4D A;  2DFK A;  1QC6 A;  2COD A;  1UEF A;  3WYF B;  4DBB A;  2DHJ A;  2P8V A;  2KIG A;  2CRF A;  1UNP A;  4L1R A;  2ROZ B;  1PMS A;  2EJ8 A;  3ULC A;  2NMB A;  2D10 A;  2MFQ A;  1U5D A;  3SNH A;  1PFJ A;  3M1I B;  1OQN A;  2DX5 A;  4A6F B;  2IYB A;  2D11 A;  2YF0 A;  1W1D A;  4GNK B;  2RUK B;  3VIA A;  1EGX A;  4K17 A;  5CLL B;  3QBV B;  4OT1 A;  2KUP A;  3KRW A;  2ROV A;  3ML4 A;  4TYZ A;  3QWM A;  2N0Y A;  1LB1 A;  4CSQ A;  4K2O A;  2UZS A;  3CIK A;  1W1H A;  2DHK A;  3ODW A;  2W2X C;  4KHB B;  2COF A;  3G9W A;  1XD4 A;  3N7C A;  2OTX A;  1U5F A;  3TCA A;  4C0A A;  3AJ4 A;  3PVU A;  1X86 A;  2L2I A;  1M7R A;  4ZRI A;  2Y7B A;  2KIE A;  3CXB B;  4B6H A;  1MPH A;  2EMS A;  1LW3 A;  1SHC A;  4PNK A;  1MI1 A;  2DHI A;  3D8D A;  4HAV B;  3RCP A;  4D6W A;  5JHG A;  2DTC A;  5HE3 A;  3NW8 A;  3BIN A;  4HB2 B;  1H4R A;  4EJN A;  2K00 A;  3IVF A;  3VOQ A;  2L1C A;  1WGQ A;  2CY4 A;  1MK7 B;  2D9X A;  2RGN B;  3DXC A;  2LYD A;  1Z87 A;  1P5T A;  4A6K A;  4MY6 A;  3AU4 A;  2E2X A;  1RRP B;  4HB4 B;  5L81 A;  1QQG A;  1ZM0 A;  4HSI A;  5JHH A;  1AQC A;  3OAN A;  1KZ7 A;  4DX9 0;  5C5B A;  1FHX A;  2YVC A;  3KRX A;  1SGH A;  5C5B B;  4EMO A;  2Z0O A;  2YT2 A;  3HIE A;  1DRO A;  1XX0 A;  1ZVR A;  1BTK A;  1U27 A;  5HE0 A;  4KAX B;  2YS1 A;  3PSC A;  1TQZ A;  4WSF A;  5LON B;  2P0H A;  1V5U A;  5I2S A;  4IAP A;  4MK0 A;  2AL6 A;  1V88 A;  4DIX A;  2M38 A;  2D9V A;  1X05 A;  3PVW A;  5CLQ B;  5M4Y B;  1NTV A;  2MDX A;  3HW2 B;  3FM8 C;  2D9W A;  2FJL A;  2J59 M;  2GCL A;  2Z0Q A;  5FI0 A;  4A6F A;  4Z2N A;  2LOZ A;  4YON A;  1P3R A;  3B77 A;  1U29 A; 
#chains in the Genus database with same CATH homology
 4EKU A;  4IFS A;  2LOX A;  1Y5O A;  2HTH B;  1KZG A;  5D27 A;  3GYO A;  1ZSQ A;  3QIJ A;  4Y94 A;  3U7D A;  5D3W A;  1MIZ B;  2ELB A;  2RVB B;  2IFS A;  4GMX B;  5C6R A;  2YRY A;  1DDM A;  1FB8 A;  1MK9 B;  5D3X A;  5HE1 A;  4HDQ A;  1V89 A;  3A8Q A;  1J19 A;  2R0D A;  1RJ2 A;  2I1J A;  4KVG B;  3TVV A;  3BJI A;  3TFM A;  3MPX A;  2GS0 A;  2MWN B;  3PG7 A;  5DH9 B;  2RLO A;  4CHM A;  5EFX A;  4K2P A;  5KCV A;  4F7G A;  4HB3 B;  2OQB A;  2Y8G A;  1U5G A;  2YSZ A;  4PQ0 A;  2VRW B;  4XWX A;  4WJ7 A;  4GPT B;  1EAZ A;  3PZD A;  2VKI A;  2V76 A;  2VSZ A;  1V61 A;  2XQN M;  2YT0 A;  1GC7 A;  5JLJ B;  1BAK A;  2G35 A;  4MT7 A;  5KQ4 A;  2DX1 A;  3UZT A;  4KHO A;  2HE7 A;  2COC A;  3PVL A;  2K2J A;  5GOW B;  3DXE A;  2KGX B;  3ODX A;  3ULB A;  2YS3 A;  3HK0 A;  3U8Z A;  3AU5 A;  4D0N B;  3D8F A;  1FHW A;  3SUZ A;  4DXA B;  3T06 A;  3O96 A;  1WG7 A;  1PLS A;  2I5C A;  1I7A A;  2NZ8 B;  1W1G A;  1DDV A;  4A5K A;  4K81 A;  3ZDT A;  5DIF B;  2DKP A;  1XOD A;  2W2X D;  2EC1 A;  4NY0 A;  1WI1 A;  1EF1 A;  2LKO A;  2YS5 A;  3HQC A;  3F0W A;  1DYN A;  2PZ1 A;  2EMT A;  2LUL A;  2DLW A;  1BWN A;  3SV1 A;  3D8E A;  5KQ1 A;  1UNR A;  1V5P A;  1OY2 A;  1P6S A;  2JP2 A;  4HDO A;  2DYN A;  4H8S A;  1DBH A;  5J3Q A;  2I5F A;  1FOE A;  2CAY A;  1BTN A;  5C79 A;  1X11 A;  4IOY X;  1H10 A;  3PP2 A;  2BCJ A;  1XR0 B;  5DHF B;  2GCJ A;  4HAY B;  3V5W A;  5J3T A;  4HAX B;  1U2B A;  1FAO A;  4GZU A;  1GC6 A;  2UZR A;  1B55 A;  1GG3 A;  3WA0 A;  2N23 A;  2LG1 A;  1NU2 A;  2R09 A;  2W2W A;  2UVM A;  2CY5 A;  2DKQ A;  5J3Y A;  1U5E A;  2ELA A;  3ZVR A;  4F7H A;  4HAU B;  2D9Z A;  2Y8F A;  3F5R A;  2ADZ A;  1N3H A;  2H7E A;  3TO1 A;  2QKL A;  1IRS A;  2DYQ A;  2D9Y A;  2M14 A;  1UPQ A;  1OMW A;  2DN6 A;  2X18 A;  2GJY A;  1EVH A;  4YL8 A;  4BBK A;  2QKM A;  2J0J A;  2AEH A;  2RNR B;  4F7U P;  2H7D A;  1Q67 A;  1V5M A;  3FSS A;  2Z0P A;  2I1K A;  5FI1 A;  1AWE A;  1UPR A;  4CYE A;  5C16 A;  1WJM A;  2J0M A;  1UNQ A;  1WGU A;  1J0W A;  2D4Q A;  5DHA B;  4HB0 B;  2KCJ A;  1M7E A;  3FEH A;  4DX8 A;  1X1G A;  1NTY A;  1K5G B;  1MAI A;  3KSY A;  1XKE A;  3A98 B;  3KY9 A;  3NSU A;  2D2Q A;  1WJ1 A;  4ZRJ A;  2K2U A;  1TXD A;  1K5D B;  1MKE A;  4HAT B;  2DA0 A;  3SYX A;  2MKR A;  3KZ1 A;  5JP4 A;  4WVF B;  4GMV A;  4GN1 A;  2RSG A;  1X1F A;  2P0F A;  3MDB C;  4TKN A;  3X23 A;  4A6H A;  5HE2 A;  3PEG A;  1DDW A;  4Z2M B;  2P0D A;  1FGY A;  1ZC3 B;  4HAW B;  1KI1 B;  3P6A A;  4KHA A;  1XCG A;  1MIX A;  4GXB A;  2ZPY A;  1TJ6 A;  3GYP A;  4CHJ A;  5LOP B;  4NSW A;  5D3Y A;  3LJU X;  3ODO A;  4ZRK A;  4HAZ B;  1FGZ A;  3SO6 A;  5D3V A;  2Q13 A;  1Y19 B;  1FHO A;  3P7Z A;  1WVH A;  1ZC4 B;  4L6E A;  1E5W A;  2COA A;  4P7I A;  3TW1 A;  1I2H A;  3A8P A;  1ISN A;  4HHV A;  5DI9 B;  1NI2 A;  2YT1 A;  2J0K A;  3DXD A;  2DFK A;  1QC6 A;  2COD A;  1UEF A;  3WYF B;  4DBB A;  2DHJ A;  2P8V A;  2CRF A;  1UNP A;  2ROZ B;  1PMS A;  2EJ8 A;  3ULC A;  2NMB A;  2D10 A;  2MFQ A;  1U5D A;  3SNH A;  1PFJ A;  3M1I B;  1OQN A;  2DX5 A;  4A6F B;  2IYB A;  2D11 A;  2YF0 A;  1W1D A;  2RUK B;  3VIA A;  1EGX A;  4K17 A;  5CLL B;  3QBV B;  2KUP A;  3KRW A;  2ROV A;  3ML4 A;  4TYZ A;  3QWM A;  2N0Y A;  1LB1 A;  4K2O A;  2UZS A;  3CIK A;  1W1H A;  2DHK A;  3ODW A;  2W2X C;  4KHB B;  2COF A;  3G9W A;  1XD4 A;  3N7C A;  2OTX A;  1U5F A;  3TCA A;  4C0A A;  3AJ4 A;  3PVU A;  1X86 A;  2L2I A;  1M7R A;  4ZRI A;  2Y7B A;  3CXB B;  4B6H A;  1MPH A;  2EMS A;  1LW3 A;  1SHC A;  4PNK A;  2DHI A;  3D8D A;  4HAV B;  3RCP A;  5JHG A;  2DTC A;  5HE3 A;  3BIN A;  4HB2 B;  1H4R A;  4EJN A;  2K00 A;  3IVF A;  3VOQ A;  2L1C A;  1WGQ A;  2CY4 A;  1MK7 B;  2D9X A;  2RGN B;  3DXC A;  2LYD A;  1Z87 A;  1P5T A;  4A6K A;  4MY6 A;  3AU4 A;  2E2X A;  1RRP B;  4HB4 B;  5L81 A;  1QQG A;  1ZM0 A;  5JHH A;  1AQC A;  3OAN A;  1KZ7 A;  4DX9 0;  5C5B A;  1FHX A;  2YVC A;  3KRX A;  1SGH A;  5C5B B;  4EMO A;  2Z0O A;  1DRO A;  1XX0 A;  1ZVR A;  1BTK A;  1U27 A;  5HE0 A;  4KAX B;  2YS1 A;  3PSC A;  1TQZ A;  4WSF A;  5LON B;  2P0H A;  1V5U A;  4IAP A;  4MK0 A;  2AL6 A;  1V88 A;  2M38 A;  2D9V A;  1X05 A;  3PVW A;  5CLQ B;  1NTV A;  2MDX A;  3HW2 B;  3FM8 C;  2D9W A;  2FJL A;  2J59 M;  2GCL A;  2Z0Q A;  5FI0 A;  4A6F A;  4Z2N A;  2LOZ A;  4YON A;  1P3R A;  1U29 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...