1WGQA

Solution structure of the pleckstrin homology domain of mouse ethanol decreased 4 protein
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
109
structure length
109
Chain Sequence
GSSGSSGSTMSGYLYRSKGSKKPWKHLWFVIKNKVLYTYAASEDVAALESQPLLGFTVTLVKDENSESKVFQLLHKGMVFYVFKADDAHSTQRWIDAFQEGTVSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Sugar binding protein
molecule keywords FYVE, RhoGEF and PH domain containing 6; ethanol decreased 4
publication title Solution Structure of the Pleckstrin Homology Domain of Mouse Ethanol Decreased 4 Protein
rcsb
source organism Mus musculus
total genus 14
structure length 109
sequence length 109
ec nomenclature
pdb deposition date 2004-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00169 PH PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1wgqA00
2MWNB 4EJNA 1SGHA 2EMTA 1DYNA 4Y94A 1X1FA 4A6HA 2VKIA 4ZRKA 2L2IA 3SUZA 2QKMA 4WVFB 4F7HA 3PG7A 2K2JA 1GG3A 4KVGB 2D9VA 2V76A 5D3YA 2HE7A 2BCJA 2RGNB 5CLQB 2AL6A 1GC6A 5C5BB 4YL8A 1U5DA 1ZC4B 5L81A 5D3VA 1PFJA 1W1GA 2I5CA 4GXBA 2D10A 2J59M 2Q13A 5LONB 3RCPA 1XR0B 2DA0A 5JP4A 4HB2B 1FAOA 3IVFA 2DHJA 4EMOA 2J0JA 3O96A 4IAPA 4DX90 2CAYA 3PSCA 1MK9B 2K00A 1WG7A 3UZTA 4KAXB 1MKEA 2GS0A 2XQNM 4B6HA 3QBVB 2COCA 3FEHA 3ODXA 3SV1A 3AJ4A 1XODA 5D27A 1KI1B 1UNRA 2Z0PA 1NU2A 1W1DA 2DHKA 4XWXA 4D0NB 5KQ4A 1U5EA 2YRYA 1TJ6A 2RNRB 5J3QA 3A98B 1XD4A 4HAWB 2DYNA 1I2HA 4TKNA 4HAXB 3A8QA 5DHFB 3TCAA 1NI2A 1EAZA 3PZDA 2W2WA 4MT7A 2N0YA 2P0DA 4MY6A 1DDWA 4ZRJA 2KGXB 1WI1A 4GZUA 1ZSQA 2LG1A 2D11A 3N7CA 4NY0A 1J0WA 1FGYA 1J19A 3CIKA 5D3WA 1Q67A 3KRXA 1ISNA 4DXAB 2LKOA 2H7EA 4DBBA 3ZVRA 2ELBA 4GPTB 4WSFA 2HTHB 5HE1A 3GYOA 4K17A 4MK0A 2M14A 5C6RA 3DXCA 2YSZA 3BJIA 4CYEA 2YT0A 1XX0A 1P6SA 4YONA 1DROA 1UPQA 1X86A 5EFXA 3HW2B 3TW1A 4HB0B 1PLSA 4KHAA 2MFQA 3KZ1A 1TQZA 2N23A 2D9ZA 3SNHA 4HAUB 1BAKA 4HDQA 1OMWA 2CRFA 1RRPB 4L6EA 2DN6A 4NSWA 4IOYX 5GOWB 2Y7BA 1W1HA 2UZSA 3X23A 2ROVA 2D4QA 2UZRA 2COAA 4C0AA 1LW3A 1DDMA 4A6KA 1X11A 1UNQA 2GCLA 1U5FA 4HATB 2NZ8B 1NTVA 1FOEA 2YT1A 5HE2A 4HB3B 2NMBA 5DIFB 2I5FA 5CLLB 3ML4A 2J0KA 3ULBA 1IRSA 3VOQA 1K5DB 1H4RA 3QIJA 2J0MA 1MK7B 4KHBB 2I1KA 1AWEA 1KZ7A 2OQBA 2QKLA 4KHOA 1V5PA 3TO1A 3ODOA 3WA0A 3KRWA 5C5BA 2CY4A 2YS5A 4H8SA 4HAVB 1U2BA 2RLOA 4A6FB 4DX8A 4TYZA 2FJLA 2R09A 2Z0QA 5JHGA 2RSGA 3U7DA 3MDBC 3M1IB 3U8ZA 2OTXA 2DKPA 1X1GA 2M38A 4IFSA 1WGQA 3HK0A 4GMVA 4HAZB 3PEGA 5J3YA 1B55A 2E2XA 1FHWA 2YF0A 2CODA 3QWMA 2DHIA 1M7EA 1Y19B 1Z87A 1MPHA 3F0WA 1V61A 1ZVRA 3DXEA 2DX5A 1TXDA 2CY5A 1PMSA 4ZRIA 1K5GB 4PQ0A 2MDXA 2KUPA 4F7UP 3D8DA 2COFA 2G35A 4F7GA 1E5WA 3PP2A 1P5TA 1WJMA 3ULCA 2ZPYA 2D2QA 5DI9B 3WYFB 2ELAA 2ROZB 5HE0A 3F5RA 1BWNA 3KSYA 1QQGA 1WJ1A 2LOXA 2DKQA 5D3XA 2EC1A 3TVVA 1SHCA 4HDOA 2LYDA 1MIZB 2D9YA 2EMSA 3BINA 5DH9B 5J3TA 1BTNA 1M7RA 1V5MA 2PZ1A 1U5GA 3P7ZA 3PVWA 5DHAB 3D8EA 1V88A 3NSUA 5FI1A 3P6AA 5C16A 3ZDTA 1ZM0A 2DTCA 2D9XA 5HE3A 2K2UA 1MAIA 2X18A 5KQ1A 5LOPB 1N3HA 1H10A 1DDVA 1FGZA 1UPRA 2AEHA 4WJ7A 2GJYA 3SYXA 3LJUX 4P7IA 3PVUA 3ODWA 1V89A 1NTYA 1UNPA 2UVMA 1LB1A 2I1JA 2KCJA 1WVHA 4K81A 3SO6A 1XCGA 1UEFA 2L1CA 4K2OA 2LULA 2DFKA 3MPXA 1FHXA 4Z2MB 1FHOA 1BTKA 3AU4A 3GYPA 1DBHA 1U27A 1EVHA 3HQCA 1MIXA 3CXBB 4EKUA 2P8VA 3OANA 3FSSA 1ZC3B 2LOZA 2Y8GA 4CHMA 1U29A 2P0HA 4K2PA 2JP2A 5KCVA 2IFSA 3FM8C 3PVLA 2RUKB 4GMXB 1EF1A 3KY9A 1GC7A 4GN1A 3AU5A 2EJ8A 2P0FA 4A6FA 2RVBB 4PNKA 3G9WA 4BBKA 1Y5OA 2IYBA 5FI0A 1P3RA 2YS1A 2VRWB 3T06A 1FB8A 4Z2NA 3D8FA 2W2XC 3DXDA 2VSZA 5C79A 1WGUA 3TFMA 1V5UA 1KZGA 4HB4B 4A5KA 4HAYB 2D9WA 2GCJA 2ADZA 2MKRA 2W2XD 5JHHA 3VIAA 1RJ2A 2DYQA 1X05A 2YS3A 2H7DA 1QC6A 2YVCA 2Y8FA 2Z0OA 2R0DA 2DX1A 3A8PA 4HHVA 1OQNA 4CHJA 2DLWA 3V5WA 1AQCA 1XKEA 5JLJB 1EGXA 1OY2A 1I7AA
chains in the Genus database with same CATH superfamily
2MWNB 4EJNA 1SGHA 2EMTA 1DYNA 4Y94A 1X1FA 4A6HA 2VKIA 4ZRKA 2L2IA 3NW8A 3SUZA 2QKMA 4WVFB 4F7HA 3PG7A 2K2JA 4GOUA 1GG3A 4KVGB 2D9VA 2V76A 5D3YA 2HE7A 2BCJA 2RGNB 4HSIA 2Z4DA 5CLQB 2AL6A 1GC6A 5C5BB 4YL8A 1U5DA 1ZC4B 5L81A 5D3VA 1PFJA 1W1GA 3OHMB 2I5CA 4GXBA 2D10A 4DIXA 2J59M 2Q13A 5LONB 3RCPA 1XR0B 2DA0A 5JP4A 4HB2B 1FAOA 3IVFA 2DHJA 4EMOA 2K49A 2J0JA 3O96A 4IAPA 4DX90 2CAYA 5I2SA 3PSCA 1MK9B 2K00A 1WG7A 2R2YA 3UZTA 1T77A 4KAXB 1MKEA 2GS0A 2XQNM 4B6HA 3QBVB 2COCA 3FEHA 3ODXA 3SV1A 3AJ4A 1XODA 5D27A 1ZYIA 3FVCA 1KI1B 1UNRA 2Z0PA 1NU2A 1W1DA 2DHKA 4XWXA 4D0NB 5KQ4A 1U5EA 2YRYA 1TJ6A 2RNRB 4CSQA 5J3QA 3A98B 1XD4A 4HAWB 2DYNA 1I2HA 4TKNA 4HAXB 3A8QA 5DHFB 3TCAA 1NI2A 1EAZA 3PZDA 2W2WA 4MT7A 2N0YA 2P0DA 4MY6A 1DDWA 4ZRJA 2KGXB 1WI1A 4GZUA 1ZSQA 2LG1A 2D11A 3N7CA 4NY0A 1J0WA 1FGYA 1J19A 3CIKA 5D3WA 1Q67A 3KRXA 1ISNA 4DXAB 2LKOA 2H7EA 4DBBA 3ZVRA 2ELBA 4GPTB 4WSFA 2HTHB 5HE1A 3GYOA 4K17A 4MK0A 2M14A 5C6RA 3DXCA 2YSZA 3BJIA 4QJ4B 4CYEA 2YT0A 1XX0A 1P6SA 4YONA 1DROA 1UPQA 4GNKB 5LG4B 1X86A 4QJ5B 5EFXA 3HW2B 3TW1A 4HB0B 5I2MA 1PLSA 4KHAA 2MFQA 3KZ1A 1TQZA 2N23A 2D9ZA 3SNHA 4HAUB 1BAKA 4HDQA 1OMWA 2FJUB 2CRFA 1RRPB 3NWFA 4L6EA 2DN6A 4NSWA 4IOYX 5GOWB 2Y7BA 1W1HA 2UZSA 3X23A 2ROVA 2D4QA 2UZRA 2COAA 4C0AA 1LW3A 1DDMA 4A6KA 1X11A 1UNQA 2GCLA 3DCXA 1U5FA 2Z14A 4HATB 2NZ8B 1NTVA 1FOEA 2YT1A 5HE2A 4HB3B 2NMBA 5DIFB 2I5FA 5CLLB 3ML4A 2J0KA 3ULBA 1IRSA 3VOQA 1K5DB 3A58A 1H4RA 3QIJA 2J0MA 1MK7B 4KHBB 2I1KA 1AWEA 1KZ7A 2OQBA 2QKLA 4KHOA 1V5PA 3NWDA 3TO1A 3ODOA 3WA0A 3KRWA 5IRSA 5C5BA 2CY4A 2YS5A 4H8SA 4HAVB 1U2BA 2KIGA 2RLOA 4A6FB 4DX8A 4TYZA 2FJLA 2Z13A 2R09A 2Z0QA 5JHGA 2RSGA 3U7DA 3MDBC 3M1IB 3U8ZA 2OTXA 2DKPA 1X1GA 2M38A 4IFSA 1WGQA 3HK0A 4GMVA 4HAZB 3PEGA 5J3YA 3HSAA 1B55A 2E2XA 1FHWA 2YF0A 2CODA 3QWMA 2DHIA 1M7EA 1Y19B 1Z87A 4QXAB 1MPHA 1MI1A 3F0WA 1V61A 1ZVRA 3DXEA 2DX5A 1TXDA 2CY5A 1PMSA 4ZRIA 1K5GB 4PQ0A 2KR0A 2MDXA 2KUPA 4F7UP 3D8DA 2COFA 2G35A 4F7GA 1E5WA 3PP2A 1P5TA 1WJMA 3ULCA 2ZPYA 2D2QA 5DI9B 3WYFB 4D6WA 2ELAA 2ROZB 5HE0A 3F5RA 1BWNA 3KSYA 1QQGA 5M4YB 1WJ1A 2LOXA 2DKQA 5D3XA 2EC1A 3TVVA 1SHCA 4HDOA 2LYDA 1MIZB 2D9YA 2EMSA 3BINA 5DH9B 5J3TA 1BTNA 1M7RA 1V5MA 2PZ1A 1U5GA 3P7ZA 3PVWA 5DHAB 3D8EA 1V88A 3NSUA 5FI1A 3P6AA 2GUMA 5C16A 3ZDTA 1ZM0A 2DTCA 2ZKMX 4QJ3B 2D9XA 5HE3A 2K2UA 1MAIA 2X18A 5KQ1A 5LOPB 1N3HA 1H10A 1DDVA 1FGZA 1UPRA 2AEHA 4WJ7A 2GJYA 3SYXA 3LJUX 4P7IA 3PVUA 3ODWA 1V89A 4OT1A 1NTYA 1UNPA 2YT2A 2UVMA 1LB1A 2I1JA 2KCJA 2RRFA 4L1RA 1WVHA 4K81A 3SO6A 1XCGA 1UEFA 2L1CA 4K2OA 2KIEA 2LULA 3HIEA 2DFKA 3MPXA 1FHXA 4Z2MB 1FHOA 1BTKA 3AU4A 3GYPA 1DBHA 1U27A 1EVHA 3HQCA 1MIXA 3CXBB 4EKUA 2P8VA 3OANA 3FSSA 4KHBA 1ZC3B 2LOZA 2Y8GA 4CHMA 1U29A 2P0HA 4K2PA 2JP2A 5KCVA 3FM8C 2IFSA 3PVLA 2RUKB 4OSNA 4GMXB 1EF1A 3KY9A 1GC7A 4GN1A 3AU5A 2EJ8A 2P0FA 4A6FA 2RVBB 4PNKA 3G9WA 4BBKA 1Y5OA 2IYBA 5FI0A 1P3RA 2YS1A 2VRWB 3NWAA 3U12A 3T06A 1FB8A 3B77A 4Z2NA 2Z59A 3D8FA 2W2XC 3DXDA 2VSZA 5C79A 1WGUA 3TFMA 1V5UA 1KZGA 4HB4B 4A5KA 4HAYB 2D9WA 2GCJA 2ADZA 2MKRA 2W2XD 5JHHA 3VIAA 1RJ2A 2DYQA 1X05A 2YS3A 2K8EA 2H7DA 1QC6A 2YVCA 2Y8FA 2Z0OA 2R0DA 2DX1A 3A8PA 4HHVA 1OQNA 2NBVA 4CHJA 2DLWA 3V5WA 1AQCA 1XKEA 5JLJB 2KUQA 1EGXA 1OY2A 1I7AA
chains in the Genus database with same CATH topology
2MWNB 4EJNA 1SGHA 2EMTA 1DYNA 4Y94A 1X1FA 4A6HA 2VKIA 4ZRKA 2L2IA 3SUZA 2QKMA 4WVFB 4F7HA 3PG7A 2K2JA 1GG3A 4KVGB 2D9VA 2V76A 5D3YA 2HE7A 2BCJA 2RGNB 5CLQB 2AL6A 1GC6A 5C5BB 4YL8A 1U5DA 1ZC4B 5L81A 5D3VA 1PFJA 1W1GA 2I5CA 4GXBA 2D10A 2J59M 2Q13A 5LONB 3RCPA 1XR0B 2DA0A 5JP4A 4HB2B 1FAOA 3IVFA 2DHJA 4EMOA 2J0JA 3O96A 4IAPA 4DX90 2CAYA 3PSCA 1MK9B 2K00A 1WG7A 3UZTA 4KAXB 1MKEA 2GS0A 2XQNM 4B6HA 3QBVB 2COCA 3FEHA 3ODXA 3SV1A 3AJ4A 1XODA 5D27A 1KI1B 1UNRA 2Z0PA 1NU2A 1W1DA 2DHKA 4XWXA 4D0NB 5KQ4A 1U5EA 2YRYA 1TJ6A 2RNRB 5J3QA 3A98B 1XD4A 4HAWB 2DYNA 1I2HA 4TKNA 4HAXB 3A8QA 5DHFB 3TCAA 1NI2A 1EAZA 3PZDA 2W2WA 4MT7A 2N0YA 2P0DA 4MY6A 1DDWA 4ZRJA 2KGXB 1WI1A 4GZUA 1ZSQA 2LG1A 2D11A 3N7CA 4NY0A 1J0WA 1FGYA 1J19A 3CIKA 5D3WA 1Q67A 3KRXA 1ISNA 4DXAB 2LKOA 2H7EA 4DBBA 3ZVRA 2ELBA 4GPTB 4WSFA 2HTHB 5HE1A 3GYOA 4K17A 4MK0A 2M14A 5C6RA 3DXCA 2YSZA 3BJIA 4CYEA 2YT0A 1XX0A 1P6SA 4YONA 1DROA 1UPQA 1X86A 5EFXA 3HW2B 3TW1A 4HB0B 1PLSA 4KHAA 2MFQA 3KZ1A 1TQZA 2N23A 2D9ZA 3SNHA 4HAUB 1BAKA 4HDQA 1OMWA 2CRFA 1RRPB 4L6EA 2DN6A 4NSWA 4IOYX 5GOWB 2Y7BA 1W1HA 2UZSA 3X23A 2ROVA 2D4QA 2UZRA 2COAA 4C0AA 1LW3A 1DDMA 4A6KA 1X11A 1UNQA 2GCLA 1U5FA 4HATB 2NZ8B 1NTVA 1FOEA 2YT1A 5HE2A 4HB3B 2NMBA 5DIFB 2I5FA 5CLLB 3ML4A 2J0KA 3ULBA 1IRSA 3VOQA 1K5DB 1H4RA 3QIJA 2J0MA 1MK7B 4KHBB 2I1KA 1AWEA 1KZ7A 2OQBA 2QKLA 4KHOA 1V5PA 3TO1A 3ODOA 3WA0A 3KRWA 5C5BA 2CY4A 2YS5A 4H8SA 4HAVB 1U2BA 2RLOA 4A6FB 4DX8A 4TYZA 2FJLA 2R09A 2Z0QA 5JHGA 2RSGA 3U7DA 3MDBC 3M1IB 3U8ZA 2OTXA 2DKPA 1X1GA 2M38A 4IFSA 1WGQA 3HK0A 4GMVA 4HAZB 3PEGA 5J3YA 1B55A 2E2XA 1FHWA 2YF0A 2CODA 3QWMA 2DHIA 1M7EA 1Y19B 1Z87A 1MPHA 3F0WA 1V61A 1ZVRA 3DXEA 2DX5A 1TXDA 2CY5A 1PMSA 4ZRIA 1K5GB 4PQ0A 2MDXA 2KUPA 4F7UP 3D8DA 2COFA 2G35A 4F7GA 1E5WA 3PP2A 1P5TA 1WJMA 3ULCA 2ZPYA 2D2QA 5DI9B 3WYFB 2ELAA 2ROZB 5HE0A 3F5RA 1BWNA 3KSYA 1QQGA 1WJ1A 2LOXA 2DKQA 5D3XA 2EC1A 3TVVA 1SHCA 4HDOA 2LYDA 1MIZB 2D9YA 2EMSA 3BINA 5DH9B 5J3TA 1BTNA 1M7RA 1V5MA 2PZ1A 1U5GA 3P7ZA 3PVWA 5DHAB 3D8EA 1V88A 3NSUA 5FI1A 3P6AA 5C16A 3ZDTA 1ZM0A 2DTCA 2D9XA 5HE3A 2K2UA 1MAIA 2X18A 5KQ1A 5LOPB 1N3HA 1H10A 1DDVA 1FGZA 1UPRA 2AEHA 4WJ7A 2GJYA 3SYXA 3LJUX 4P7IA 3PVUA 3ODWA 1V89A 1NTYA 1UNPA 2UVMA 1LB1A 2I1JA 2KCJA 1WVHA 4K81A 3SO6A 1XCGA 1UEFA 2L1CA 4K2OA 2LULA 2DFKA 3MPXA 1FHXA 4Z2MB 1FHOA 1BTKA 3AU4A 3GYPA 1DBHA 1U27A 1EVHA 3HQCA 1MIXA 3CXBB 4EKUA 2P8VA 3OANA 3FSSA 1ZC3B 2LOZA 2Y8GA 4CHMA 1U29A 2P0HA 4K2PA 2JP2A 5KCVA 2IFSA 3FM8C 3PVLA 2RUKB 4GMXB 1EF1A 3KY9A 1GC7A 4GN1A 3AU5A 2EJ8A 2P0FA 4A6FA 2RVBB 4PNKA 3G9WA 4BBKA 1Y5OA 2IYBA 5FI0A 1P3RA 2YS1A 2VRWB 3T06A 1FB8A 4Z2NA 3D8FA 2W2XC 3DXDA 2VSZA 5C79A 1WGUA 3TFMA 1V5UA 1KZGA 4HB4B 4A5KA 4HAYB 2D9WA 2GCJA 2ADZA 2MKRA 2W2XD 5JHHA 3VIAA 1RJ2A 2DYQA 1X05A 2YS3A 2H7DA 1QC6A 2YVCA 2Y8FA 2Z0OA 2R0DA 2DX1A 3A8PA 4HHVA 1OQNA 4CHJA 2DLWA 3V5WA 1AQCA 1XKEA 5JLJB 1EGXA 1OY2A 1I7AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MWN B;  4EJN A;  1SGH A;  2EMT A;  1DYN A;  4Y94 A;  1X1F A;  4A6H A;  2VKI A;  4ZRK A;  2L2I A;  3SUZ A;  2QKM A;  4WVF B;  4F7H A;  3PG7 A;  2K2J A;  1GG3 A;  4KVG B;  2D9V A;  2V76 A;  5D3Y A;  2HE7 A;  2BCJ A;  2RGN B;  5CLQ B;  2AL6 A;  1GC6 A;  5C5B B;  4YL8 A;  1U5D A;  1ZC4 B;  5L81 A;  5D3V A;  1PFJ A;  1W1G A;  2I5C A;  4GXB A;  2D10 A;  2J59 M;  2Q13 A;  5LON B;  3RCP A;  1XR0 B;  2DA0 A;  5JP4 A;  4HB2 B;  1FAO A;  3IVF A;  2DHJ A;  4EMO A;  2J0J A;  3O96 A;  4IAP A;  4DX9 0;  2CAY A;  3PSC A;  1MK9 B;  2K00 A;  1WG7 A;  3UZT A;  4KAX B;  1MKE A;  2GS0 A;  2XQN M;  4B6H A;  3QBV B;  2COC A;  3FEH A;  3ODX A;  3SV1 A;  3AJ4 A;  1XOD A;  5D27 A;  1KI1 B;  1UNR A;  2Z0P A;  1NU2 A;  1W1D A;  2DHK A;  4XWX A;  4D0N B;  5KQ4 A;  1U5E A;  2YRY A;  1TJ6 A;  2RNR B;  5J3Q A;  3A98 B;  1XD4 A;  4HAW B;  2DYN A;  1I2H A;  4TKN A;  4HAX B;  3A8Q A;  5DHF B;  3TCA A;  1NI2 A;  1EAZ A;  3PZD A;  2W2W A;  4MT7 A;  2N0Y A;  2P0D A;  4MY6 A;  1DDW A;  4ZRJ A;  2KGX B;  1WI1 A;  4GZU A;  1ZSQ A;  2LG1 A;  2D11 A;  3N7C A;  4NY0 A;  1J0W A;  1FGY A;  1J19 A;  3CIK A;  5D3W A;  1Q67 A;  3KRX A;  1ISN A;  4DXA B;  2LKO A;  2H7E A;  4DBB A;  3ZVR A;  2ELB A;  4GPT B;  4WSF A;  2HTH B;  5HE1 A;  3GYO A;  4K17 A;  4MK0 A;  2M14 A;  5C6R A;  3DXC A;  2YSZ A;  3BJI A;  4CYE A;  2YT0 A;  1XX0 A;  1P6S A;  4YON A;  1DRO A;  1UPQ A;  1X86 A;  5EFX A;  3HW2 B;  3TW1 A;  4HB0 B;  1PLS A;  4KHA A;  2MFQ A;  3KZ1 A;  1TQZ A;  2N23 A;  2D9Z A;  3SNH A;  4HAU B;  1BAK A;  4HDQ A;  1OMW A;  2CRF A;  1RRP B;  4L6E A;  2DN6 A;  4NSW A;  4IOY X;  5GOW B;  2Y7B A;  1W1H A;  2UZS A;  3X23 A;  2ROV A;  2D4Q A;  2UZR A;  2COA A;  4C0A A;  1LW3 A;  1DDM A;  4A6K A;  1X11 A;  1UNQ A;  2GCL A;  1U5F A;  4HAT B;  2NZ8 B;  1NTV A;  1FOE A;  2YT1 A;  5HE2 A;  4HB3 B;  2NMB A;  5DIF B;  2I5F A;  5CLL B;  3ML4 A;  2J0K A;  3ULB A;  1IRS A;  3VOQ A;  1K5D B;  1H4R A;  3QIJ A;  2J0M A;  1MK7 B;  4KHB B;  2I1K A;  1AWE A;  1KZ7 A;  2OQB A;  2QKL A;  4KHO A;  1V5P A;  3TO1 A;  3ODO A;  3WA0 A;  3KRW A;  5C5B A;  2CY4 A;  2YS5 A;  4H8S A;  4HAV B;  1U2B A;  2RLO A;  4A6F B;  4DX8 A;  4TYZ A;  2FJL A;  2R09 A;  2Z0Q A;  5JHG A;  2RSG A;  3U7D A;  3MDB C;  3M1I B;  3U8Z A;  2OTX A;  2DKP A;  1X1G A;  2M38 A;  4IFS A;  1WGQ A;  3HK0 A;  4GMV A;  4HAZ B;  3PEG A;  5J3Y A;  1B55 A;  2E2X A;  1FHW A;  2YF0 A;  2COD A;  3QWM A;  2DHI A;  1M7E A;  1Y19 B;  1Z87 A;  1MPH A;  3F0W A;  1V61 A;  1ZVR A;  3DXE A;  2DX5 A;  1TXD A;  2CY5 A;  1PMS A;  4ZRI A;  1K5G B;  4PQ0 A;  2MDX A;  2KUP A;  4F7U P;  3D8D A;  2COF A;  2G35 A;  4F7G A;  1E5W A;  3PP2 A;  1P5T A;  1WJM A;  3ULC A;  2ZPY A;  2D2Q A;  5DI9 B;  3WYF B;  2ELA A;  2ROZ B;  5HE0 A;  3F5R A;  1BWN A;  3KSY A;  1QQG A;  1WJ1 A;  2LOX A;  2DKQ A;  5D3X A;  2EC1 A;  3TVV A;  1SHC A;  4HDO A;  2LYD A;  1MIZ B;  2D9Y A;  2EMS A;  3BIN A;  5DH9 B;  5J3T A;  1BTN A;  1M7R A;  1V5M A;  2PZ1 A;  1U5G A;  3P7Z A;  3PVW A;  5DHA B;  3D8E A;  1V88 A;  3NSU A;  5FI1 A;  3P6A A;  5C16 A;  3ZDT A;  1ZM0 A;  2DTC A;  2D9X A;  5HE3 A;  2K2U A;  1MAI A;  2X18 A;  5KQ1 A;  5LOP B;  1N3H A;  1H10 A;  1DDV A;  1FGZ A;  1UPR A;  2AEH A;  4WJ7 A;  2GJY A;  3SYX A;  3LJU X;  4P7I A;  3PVU A;  3ODW A;  1V89 A;  1NTY A;  1UNP A;  2UVM A;  1LB1 A;  2I1J A;  2KCJ A;  1WVH A;  4K81 A;  3SO6 A;  1XCG A;  1UEF A;  2L1C A;  4K2O A;  2LUL A;  2DFK A;  3MPX A;  1FHX A;  4Z2M B;  1FHO A;  1BTK A;  3AU4 A;  3GYP A;  1DBH A;  1U27 A;  1EVH A;  3HQC A;  1MIX A;  3CXB B;  4EKU A;  2P8V A;  3OAN A;  3FSS A;  1ZC3 B;  2LOZ A;  2Y8G A;  4CHM A;  1U29 A;  2P0H A;  4K2P A;  2JP2 A;  5KCV A;  2IFS A;  3FM8 C;  3PVL A;  2RUK B;  4GMX B;  1EF1 A;  3KY9 A;  1GC7 A;  4GN1 A;  3AU5 A;  2EJ8 A;  2P0F A;  4A6F A;  2RVB B;  4PNK A;  3G9W A;  4BBK A;  1Y5O A;  2IYB A;  5FI0 A;  1P3R A;  2YS1 A;  2VRW B;  3T06 A;  1FB8 A;  4Z2N A;  3D8F A;  2W2X C;  3DXD A;  2VSZ A;  5C79 A;  1WGU A;  3TFM A;  1V5U A;  1KZG A;  4HB4 B;  4A5K A;  4HAY B;  2D9W A;  2GCJ A;  2ADZ A;  2MKR A;  2W2X D;  5JHH A;  3VIA A;  1RJ2 A;  2DYQ A;  1X05 A;  2YS3 A;  2H7D A;  1QC6 A;  2YVC A;  2Y8F A;  2Z0O A;  2R0D A;  2DX1 A;  3A8P A;  4HHV A;  1OQN A;  4CHJ A;  2DLW A;  3V5W A;  1AQC A;  1XKE A;  5JLJ B;  1EGX A;  1OY2 A;  1I7A A; 
#chains in the Genus database with same CATH topology
 2MWN B;  4EJN A;  1SGH A;  2EMT A;  1DYN A;  4Y94 A;  1X1F A;  4A6H A;  2VKI A;  4ZRK A;  2L2I A;  3NW8 A;  3SUZ A;  2QKM A;  4WVF B;  4F7H A;  3PG7 A;  2K2J A;  4GOU A;  1GG3 A;  4KVG B;  2D9V A;  2V76 A;  5D3Y A;  2HE7 A;  2BCJ A;  2RGN B;  4HSI A;  2Z4D A;  5CLQ B;  2AL6 A;  1GC6 A;  5C5B B;  4YL8 A;  1U5D A;  1ZC4 B;  5L81 A;  5D3V A;  1PFJ A;  1W1G A;  3OHM B;  2I5C A;  4GXB A;  2D10 A;  4DIX A;  2J59 M;  2Q13 A;  5LON B;  3RCP A;  1XR0 B;  2DA0 A;  5JP4 A;  4HB2 B;  1FAO A;  3IVF A;  2DHJ A;  4EMO A;  2K49 A;  2J0J A;  3O96 A;  4IAP A;  4DX9 0;  2CAY A;  5I2S A;  3PSC A;  1MK9 B;  2K00 A;  1WG7 A;  2R2Y A;  3UZT A;  1T77 A;  4KAX B;  1MKE A;  2GS0 A;  2XQN M;  4B6H A;  3QBV B;  2COC A;  3FEH A;  3ODX A;  3SV1 A;  3AJ4 A;  1XOD A;  5D27 A;  1ZYI A;  3FVC A;  1KI1 B;  1UNR A;  2Z0P A;  1NU2 A;  1W1D A;  2DHK A;  4XWX A;  4D0N B;  5KQ4 A;  1U5E A;  2YRY A;  1TJ6 A;  2RNR B;  4CSQ A;  5J3Q A;  3A98 B;  1XD4 A;  4HAW B;  2DYN A;  1I2H A;  4TKN A;  4HAX B;  3A8Q A;  5DHF B;  3TCA A;  1NI2 A;  1EAZ A;  3PZD A;  2W2W A;  4MT7 A;  2N0Y A;  2P0D A;  4MY6 A;  1DDW A;  4ZRJ A;  2KGX B;  1WI1 A;  4GZU A;  1ZSQ A;  2LG1 A;  2D11 A;  3N7C A;  4NY0 A;  1J0W A;  1FGY A;  1J19 A;  3CIK A;  5D3W A;  1Q67 A;  3KRX A;  1ISN A;  4DXA B;  2LKO A;  2H7E A;  4DBB A;  3ZVR A;  2ELB A;  4GPT B;  4WSF A;  2HTH B;  5HE1 A;  3GYO A;  4K17 A;  4MK0 A;  2M14 A;  5C6R A;  3DXC A;  2YSZ A;  3BJI A;  4QJ4 B;  4CYE A;  2YT0 A;  1XX0 A;  1P6S A;  4YON A;  1DRO A;  1UPQ A;  4GNK B;  5LG4 B;  1X86 A;  4QJ5 B;  5EFX A;  3HW2 B;  3TW1 A;  4HB0 B;  5I2M A;  1PLS A;  4KHA A;  2MFQ A;  3KZ1 A;  1TQZ A;  2N23 A;  2D9Z A;  3SNH A;  4HAU B;  1BAK A;  4HDQ A;  1OMW A;  2FJU B;  2CRF A;  1RRP B;  3NWF A;  4L6E A;  2DN6 A;  4NSW A;  4IOY X;  5GOW B;  2Y7B A;  1W1H A;  2UZS A;  3X23 A;  2ROV A;  2D4Q A;  2UZR A;  2COA A;  4C0A A;  1LW3 A;  1DDM A;  4A6K A;  1X11 A;  1UNQ A;  2GCL A;  3DCX A;  1U5F A;  2Z14 A;  4HAT B;  2NZ8 B;  1NTV A;  1FOE A;  2YT1 A;  5HE2 A;  4HB3 B;  2NMB A;  5DIF B;  2I5F A;  5CLL B;  3ML4 A;  2J0K A;  3ULB A;  1IRS A;  3VOQ A;  1K5D B;  3A58 A;  1H4R A;  3QIJ A;  2J0M A;  1MK7 B;  4KHB B;  2I1K A;  1AWE A;  1KZ7 A;  2OQB A;  2QKL A;  4KHO A;  1V5P A;  3NWD A;  3TO1 A;  3ODO A;  3WA0 A;  3KRW A;  5IRS A;  5C5B A;  2CY4 A;  2YS5 A;  4H8S A;  4HAV B;  1U2B A;  2KIG A;  2RLO A;  4A6F B;  4DX8 A;  4TYZ A;  2FJL A;  2Z13 A;  2R09 A;  2Z0Q A;  5JHG A;  2RSG A;  3U7D A;  3MDB C;  3M1I B;  3U8Z A;  2OTX A;  2DKP A;  1X1G A;  2M38 A;  4IFS A;  1WGQ A;  3HK0 A;  4GMV A;  4HAZ B;  3PEG A;  5J3Y A;  3HSA A;  1B55 A;  2E2X A;  1FHW A;  2YF0 A;  2COD A;  3QWM A;  2DHI A;  1M7E A;  1Y19 B;  1Z87 A;  4QXA B;  1MPH A;  1MI1 A;  3F0W A;  1V61 A;  1ZVR A;  3DXE A;  2DX5 A;  1TXD A;  2CY5 A;  1PMS A;  4ZRI A;  1K5G B;  4PQ0 A;  2KR0 A;  2MDX A;  2KUP A;  4F7U P;  3D8D A;  2COF A;  2G35 A;  4F7G A;  1E5W A;  3PP2 A;  1P5T A;  1WJM A;  3ULC A;  2ZPY A;  2D2Q A;  5DI9 B;  3WYF B;  4D6W A;  2ELA A;  2ROZ B;  5HE0 A;  3F5R A;  1BWN A;  3KSY A;  1QQG A;  5M4Y B;  1WJ1 A;  2LOX A;  2DKQ A;  5D3X A;  2EC1 A;  3TVV A;  1SHC A;  4HDO A;  2LYD A;  1MIZ B;  2D9Y A;  2EMS A;  3BIN A;  5DH9 B;  5J3T A;  1BTN A;  1M7R A;  1V5M A;  2PZ1 A;  1U5G A;  3P7Z A;  3PVW A;  5DHA B;  3D8E A;  1V88 A;  3NSU A;  5FI1 A;  3P6A A;  2GUM A;  5C16 A;  3ZDT A;  1ZM0 A;  2DTC A;  2ZKM X;  4QJ3 B;  2D9X A;  5HE3 A;  2K2U A;  1MAI A;  2X18 A;  5KQ1 A;  5LOP B;  1N3H A;  1H10 A;  1DDV A;  1FGZ A;  1UPR A;  2AEH A;  4WJ7 A;  2GJY A;  3SYX A;  3LJU X;  4P7I A;  3PVU A;  3ODW A;  1V89 A;  4OT1 A;  1NTY A;  1UNP A;  2YT2 A;  2UVM A;  1LB1 A;  2I1J A;  2KCJ A;  2RRF A;  4L1R A;  1WVH A;  4K81 A;  3SO6 A;  1XCG A;  1UEF A;  2L1C A;  4K2O A;  2KIE A;  2LUL A;  3HIE A;  2DFK A;  3MPX A;  1FHX A;  4Z2M B;  1FHO A;  1BTK A;  3AU4 A;  3GYP A;  1DBH A;  1U27 A;  1EVH A;  3HQC A;  1MIX A;  3CXB B;  4EKU A;  2P8V A;  3OAN A;  3FSS A;  4KHB A;  1ZC3 B;  2LOZ A;  2Y8G A;  4CHM A;  1U29 A;  2P0H A;  4K2P A;  2JP2 A;  5KCV A;  3FM8 C;  2IFS A;  3PVL A;  2RUK B;  4OSN A;  4GMX B;  1EF1 A;  3KY9 A;  1GC7 A;  4GN1 A;  3AU5 A;  2EJ8 A;  2P0F A;  4A6F A;  2RVB B;  4PNK A;  3G9W A;  4BBK A;  1Y5O A;  2IYB A;  5FI0 A;  1P3R A;  2YS1 A;  2VRW B;  3NWA A;  3U12 A;  3T06 A;  1FB8 A;  3B77 A;  4Z2N A;  2Z59 A;  3D8F A;  2W2X C;  3DXD A;  2VSZ A;  5C79 A;  1WGU A;  3TFM A;  1V5U A;  1KZG A;  4HB4 B;  4A5K A;  4HAY B;  2D9W A;  2GCJ A;  2ADZ A;  2MKR A;  2W2X D;  5JHH A;  3VIA A;  1RJ2 A;  2DYQ A;  1X05 A;  2YS3 A;  2K8E A;  2H7D A;  1QC6 A;  2YVC A;  2Y8F A;  2Z0O A;  2R0D A;  2DX1 A;  3A8P A;  4HHV A;  1OQN A;  2NBV A;  4CHJ A;  2DLW A;  3V5W A;  1AQC A;  1XKE A;  5JLJ B;  2KUQ A;  1EGX A;  1OY2 A;  1I7A A; 
#chains in the Genus database with same CATH homology
 2MWN B;  4EJN A;  1SGH A;  2EMT A;  1DYN A;  4Y94 A;  1X1F A;  4A6H A;  2VKI A;  4ZRK A;  2L2I A;  3SUZ A;  2QKM A;  4WVF B;  4F7H A;  3PG7 A;  2K2J A;  1GG3 A;  4KVG B;  2D9V A;  2V76 A;  5D3Y A;  2HE7 A;  2BCJ A;  2RGN B;  5CLQ B;  2AL6 A;  1GC6 A;  5C5B B;  4YL8 A;  1U5D A;  1ZC4 B;  5L81 A;  5D3V A;  1PFJ A;  1W1G A;  2I5C A;  4GXB A;  2D10 A;  2J59 M;  2Q13 A;  5LON B;  3RCP A;  1XR0 B;  2DA0 A;  5JP4 A;  4HB2 B;  1FAO A;  3IVF A;  2DHJ A;  4EMO A;  2J0J A;  3O96 A;  4IAP A;  4DX9 0;  2CAY A;  3PSC A;  1MK9 B;  2K00 A;  1WG7 A;  3UZT A;  4KAX B;  1MKE A;  2GS0 A;  2XQN M;  4B6H A;  3QBV B;  2COC A;  3FEH A;  3ODX A;  3SV1 A;  3AJ4 A;  1XOD A;  5D27 A;  1KI1 B;  1UNR A;  2Z0P A;  1NU2 A;  1W1D A;  2DHK A;  4XWX A;  4D0N B;  5KQ4 A;  1U5E A;  2YRY A;  1TJ6 A;  2RNR B;  5J3Q A;  3A98 B;  1XD4 A;  4HAW B;  2DYN A;  1I2H A;  4TKN A;  4HAX B;  3A8Q A;  5DHF B;  3TCA A;  1NI2 A;  1EAZ A;  3PZD A;  2W2W A;  4MT7 A;  2N0Y A;  2P0D A;  4MY6 A;  1DDW A;  4ZRJ A;  2KGX B;  1WI1 A;  4GZU A;  1ZSQ A;  2LG1 A;  2D11 A;  3N7C A;  4NY0 A;  1J0W A;  1FGY A;  1J19 A;  3CIK A;  5D3W A;  1Q67 A;  3KRX A;  1ISN A;  4DXA B;  2LKO A;  2H7E A;  4DBB A;  3ZVR A;  2ELB A;  4GPT B;  4WSF A;  2HTH B;  5HE1 A;  3GYO A;  4K17 A;  4MK0 A;  2M14 A;  5C6R A;  3DXC A;  2YSZ A;  3BJI A;  4CYE A;  2YT0 A;  1XX0 A;  1P6S A;  4YON A;  1DRO A;  1UPQ A;  1X86 A;  5EFX A;  3HW2 B;  3TW1 A;  4HB0 B;  1PLS A;  4KHA A;  2MFQ A;  3KZ1 A;  1TQZ A;  2N23 A;  2D9Z A;  3SNH A;  4HAU B;  1BAK A;  4HDQ A;  1OMW A;  2CRF A;  1RRP B;  4L6E A;  2DN6 A;  4NSW A;  4IOY X;  5GOW B;  2Y7B A;  1W1H A;  2UZS A;  3X23 A;  2ROV A;  2D4Q A;  2UZR A;  2COA A;  4C0A A;  1LW3 A;  1DDM A;  4A6K A;  1X11 A;  1UNQ A;  2GCL A;  1U5F A;  4HAT B;  2NZ8 B;  1NTV A;  1FOE A;  2YT1 A;  5HE2 A;  4HB3 B;  2NMB A;  5DIF B;  2I5F A;  5CLL B;  3ML4 A;  2J0K A;  3ULB A;  1IRS A;  3VOQ A;  1K5D B;  1H4R A;  3QIJ A;  2J0M A;  1MK7 B;  4KHB B;  2I1K A;  1AWE A;  1KZ7 A;  2OQB A;  2QKL A;  4KHO A;  1V5P A;  3TO1 A;  3ODO A;  3WA0 A;  3KRW A;  5C5B A;  2CY4 A;  2YS5 A;  4H8S A;  4HAV B;  1U2B A;  2RLO A;  4A6F B;  4DX8 A;  4TYZ A;  2FJL A;  2R09 A;  2Z0Q A;  5JHG A;  2RSG A;  3U7D A;  3MDB C;  3M1I B;  3U8Z A;  2OTX A;  2DKP A;  1X1G A;  2M38 A;  4IFS A;  1WGQ A;  3HK0 A;  4GMV A;  4HAZ B;  3PEG A;  5J3Y A;  1B55 A;  2E2X A;  1FHW A;  2YF0 A;  2COD A;  3QWM A;  2DHI A;  1M7E A;  1Y19 B;  1Z87 A;  1MPH A;  3F0W A;  1V61 A;  1ZVR A;  3DXE A;  2DX5 A;  1TXD A;  2CY5 A;  1PMS A;  4ZRI A;  1K5G B;  4PQ0 A;  2MDX A;  2KUP A;  4F7U P;  3D8D A;  2COF A;  2G35 A;  4F7G A;  1E5W A;  3PP2 A;  1P5T A;  1WJM A;  3ULC A;  2ZPY A;  2D2Q A;  5DI9 B;  3WYF B;  2ELA A;  2ROZ B;  5HE0 A;  3F5R A;  1BWN A;  3KSY A;  1QQG A;  1WJ1 A;  2LOX A;  2DKQ A;  5D3X A;  2EC1 A;  3TVV A;  1SHC A;  4HDO A;  2LYD A;  1MIZ B;  2D9Y A;  2EMS A;  3BIN A;  5DH9 B;  5J3T A;  1BTN A;  1M7R A;  1V5M A;  2PZ1 A;  1U5G A;  3P7Z A;  3PVW A;  5DHA B;  3D8E A;  1V88 A;  3NSU A;  5FI1 A;  3P6A A;  5C16 A;  3ZDT A;  1ZM0 A;  2DTC A;  2D9X A;  5HE3 A;  2K2U A;  1MAI A;  2X18 A;  5KQ1 A;  5LOP B;  1N3H A;  1H10 A;  1DDV A;  1FGZ A;  1UPR A;  2AEH A;  4WJ7 A;  2GJY A;  3SYX A;  3LJU X;  4P7I A;  3PVU A;  3ODW A;  1V89 A;  1NTY A;  1UNP A;  2UVM A;  1LB1 A;  2I1J A;  2KCJ A;  1WVH A;  4K81 A;  3SO6 A;  1XCG A;  1UEF A;  2L1C A;  4K2O A;  2LUL A;  2DFK A;  3MPX A;  1FHX A;  4Z2M B;  1FHO A;  1BTK A;  3AU4 A;  3GYP A;  1DBH A;  1U27 A;  1EVH A;  3HQC A;  1MIX A;  3CXB B;  4EKU A;  2P8V A;  3OAN A;  3FSS A;  1ZC3 B;  2LOZ A;  2Y8G A;  4CHM A;  1U29 A;  2P0H A;  4K2P A;  2JP2 A;  5KCV A;  2IFS A;  3FM8 C;  3PVL A;  2RUK B;  4GMX B;  1EF1 A;  3KY9 A;  1GC7 A;  4GN1 A;  3AU5 A;  2EJ8 A;  2P0F A;  4A6F A;  2RVB B;  4PNK A;  3G9W A;  4BBK A;  1Y5O A;  2IYB A;  5FI0 A;  1P3R A;  2YS1 A;  2VRW B;  3T06 A;  1FB8 A;  4Z2N A;  3D8F A;  2W2X C;  3DXD A;  2VSZ A;  5C79 A;  1WGU A;  3TFM A;  1V5U A;  1KZG A;  4HB4 B;  4A5K A;  4HAY B;  2D9W A;  2GCJ A;  2ADZ A;  2MKR A;  2W2X D;  5JHH A;  3VIA A;  1RJ2 A;  2DYQ A;  1X05 A;  2YS3 A;  2H7D A;  1QC6 A;  2YVC A;  2Y8F A;  2Z0O A;  2R0D A;  2DX1 A;  3A8P A;  4HHV A;  1OQN A;  4CHJ A;  2DLW A;  3V5W A;  1AQC A;  1XKE A;  5JLJ B;  1EGX A;  1OY2 A;  1I7A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...