1WGQA

Solution structure of the pleckstrin homology domain of mouse ethanol decreased 4 protein
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
109
structure length
109
Chain Sequence
b'GSSGSSGSTMSGYLYRSKGSKKPWKHLWFVIKNKVLYTYAASEDVAALESQPLLGFTVTLVKDENSESKVFQLLHKGMVFYVFKADDAHSTQRWIDAFQEGTVSGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FYVE, RhoGEF and PH domain containing 6; ethanol decreased 4
publication title Solution Structure of the Pleckstrin Homology Domain of Mouse Ethanol Decreased 4 Protein
rcsb
source organism Mus musculus
molecule tags Sugar binding protein
total genus 14
structure length 109
sequence length 109
ec nomenclature
pdb deposition date 2004-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00169 PH PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1wgqA00
3ODWA 1KZGA 5DH9B 4F7HA 4Z2NA 3KY9A 3KRXA 4IFSA 1WGQA 2NMBA 3BINA 5L81A 4WJ7A 2DA0A 1UNPA 2GJYA 1MIXA 2L1CA 2RNRB 4DX8A 1EVHA 1AQCA 1V61A 2D10A 2CRFA 2COAA 2X18A 4WSFA 1QC6A 1V5MA 1Y5OA 1U5GA 5C5BA 2M38A 2DHKA 3DXDA 1FHXA 2MWNB 2ZPYA 1OQNA 2Z0QA 4YL8A 2UZRA 3FEHA 2DX5A 1X05A 1BAKA 1J19A 3A8QA 4PNKA 4Z2MB 2DKPA 2DTCA 2KCJA 2R09A 3AJ4A 2ELBA 4GZUA 4TKNA 2Q13A 3T06A 5D27A 1V88A 4GXBA 1LB1A 2YVCA 3KRWA 2PZ1A 2LKOA 4C0AA 4KHAA 2YS5A 2COCA 1ISNA 3ZVRA 5C79A 1W1GA 4A6FB 3PEGA 4NSWA 3MDBC 2J0KA 2HTHB 2IFSA 4EMOA 3ODXA 2ADZA 4NY0A 5J3YA 3RCPA 4HB0B 2OQBA 1OMWA 4D0NB 3TVVA 3WA0A 1PFJA 1FGZA 1MKEA 3SNHA 3SYXA 1DYNA 3KSYA 3ML4A 4GMXB 1U27A 2H7DA 4ZRKA 5HE3A 1XKEA 3O96A 3FSSA 2DKQA 1ZM0A 2G35A 1UPQA 3ODOA 2K00A 5JHGA 4KAXB 3ZDTA 2LYDA 1DROA 1V5PA 5JHHA 1H10A 2FJLA 1XX0A 1FAOA 1UPRA 2DYQA 2J0MA 2BCJA 1GC7A 1M7EA 5DI9B 5LOPB 3DXCA 1MK7B 1ZC3B 2XQNM 5CLLB 4HAWB 4EKUA 4HB3B 1DDMA 1PMSA 4MK0A 3SO6A 4IAPA 1P5TA 4HDOA 1NTYA 3WYFB 4YONA 3TO1A 1FHOA 2L2IA 1NI2A 1U2BA 5JLJB 4K81A 1W1HA 1U5EA 2P0DA 5HE0A 1NTVA 5GOWB 3NSUA 5KQ1A 2D11A 1BTKA 4A6FA 1U5DA 1B55A 4EJNA 1XCGA 2KUPA 2CAYA 3A98B 1X1GA 2EC1A 5DIFB 1DDWA 2E2XA 4HAXB 2LOXA 1I7AA 4Y94A 4A6HA 3ULBA 2AL6A 4HAUB 5HE2A 2VKIA 1I2HA 1QQGA 1WGUA 2YS1A 5FI1A 5LONB 2I5CA 1PLSA 2MKRA 2V76A 1IRSA 1MPHA 2NZ8B 1KZ7A 1MIZB 3VOQA 1NU2A 1XD4A 5J3QA 4WVFB 1FHWA 1KI1B 5D3WA 2LULA 5KQ4A 2N0YA 5KCVA 1WJMA 2VRWB 3P6AA 4HAZB 2HE7A 2ROVA 3A8PA 2DHJA 3PZDA 2I5FA 1H4RA 4CHMA 2W2WA 3QBVB 1X11A 4ZRJA 3MPXA 1OY2A 3F5RA 1FB8A 1K5DB 2YRYA 3PG7A 1U29A 1TQZA 4DXAB 5DHFB 2D4QA 2YSZA 3N7CA 1ZC4B 3PVLA 1UNRA 4GPTB 4K2OA 3GYPA 4TYZA 4CHJA 3X23A 2W2XC 2K2UA 2QKLA 3U7DA 1XR0B 1V89A 4K2PA 1MK9B 2OTXA 2RVBB 2D9YA 3AU4A 5J3TA 2CY5A 2YF0A 2KGXB 2RUKB 1Z87A 2P0FA 3U8ZA 4A6KA 2ELAA 1X86A 1K5GB 1U5FA 4F7UP 2ROZB 3P7ZA 4A5KA 4L6EA 3QIJA 2DFKA 3DXEA 1ZVRA 1E5WA 4DBBA 2Y7BA 4H8SA 1EF1A 4HAYB 2EMTA 3OANA 4KHOA 1WJ1A 2D9WA 1MAIA 2H7EA 3TFMA 4B6HA 3PP2A 2LG1A 5JP4A 4DX90 2YT1A 2DN6A 3D8EA 2Z0OA 1V5UA 2YS3A 2VSZA 4GMVA 3PSCA 3UZTA 5D3VA 2Y8FA 4HDQA 5C6RA 2QKMA 2UZSA 3CIKA 1Q67A 4CYEA 1FOEA 1UNQA 1LW3A 1DDVA 2I1KA 2RGNB 3TCAA 4HB2B 3SUZA 1X1FA 2R0DA 2YT0A 1UEFA 1DBHA 5D3YA 1AWEA 4KVGB 2COFA 2JP2A 4XWXA 3PVWA 5D3XA 2Z0PA 1RRPB 2D9ZA 1N3HA 1SGHA 2UVMA 1P3RA 3HQCA 1W1DA 2EJ8A 3D8DA 2N23A 3ULCA 1WI1A 2AEHA 1TXDA 2D9VA 5DHAB 2I1JA 4F7GA 2RLOA 1XODA 2P8VA 2J59M 2W2XD 2MFQA 2CODA 4HAVB 2GCLA 2GS0A 2DHIA 3VIAA 1EGXA 3PVUA 1ZSQA 2DLWA 2K2JA 2DX1A 2D9XA 4BBKA 2CY4A 2D2QA 2GCJA 3GYOA 4IOYX 1J0WA 1GC6A 5C5BB 5EFXA 4K17A 2J0JA 2P0HA 3TW1A 1TJ6A 4KHBB 2LOZA 2DYNA 3AU5A 4PQ0A 4HB4B 2RSGA 1GG3A 1RJ2A 4MT7A 1Y19B 5FI0A 4GN1A 5HE1A 5CLQB 1BTNA 3LJUX 3D8FA 3SV1A 2EMSA 5C16A 3FM8C 1FGYA 3M1IB 2Y8GA 3V5WA 4ZRIA 4HATB 1EAZA 3HW2B 2M14A 3F0WA 3QWMA 2IYBA 1BWNA 2MDXA 3G9WA 1SHCA 3BJIA 1WG7A 3KZ1A 3IVFA 1M7RA 1P6SA 3HK0A 4HHVA 4P7IA 4MY6A 1WVHA 3CXBB
chains in the Genus database with same CATH superfamily
3ODWA 1KZGA 3NWAA 5DH9B 4F7HA 4Z2NA 3KY9A 2Z59A 3KRXA 4IFSA 1WGQA 2NMBA 3BINA 5L81A 4WJ7A 2DA0A 1UNPA 2GJYA 4OT1A 1MIXA 2L1CA 2RNRB 4DX8A 4GNKB 1EVHA 1AQCA 1V61A 2D10A 2CRFA 2COAA 2X18A 4WSFA 1QC6A 2FJUB 1V5MA 1Y5OA 1U5GA 5C5BA 2M38A 2DHKA 3DXDA 1FHXA 2MWNB 2ZPYA 1OQNA 2Z0QA 4YL8A 4KHBA 2UZRA 3FEHA 2DX5A 1X05A 1BAKA 1J19A 3A8QA 4PNKA 4Z2MB 2DKPA 2DTCA 2KCJA 2R09A 3AJ4A 4DIXA 2ELBA 4GZUA 4TKNA 2ZKMX 2Q13A 3T06A 5D27A 1V88A 4GXBA 5I2MA 1LB1A 2YVCA 3KRWA 2PZ1A 2LKOA 4C0AA 4KHAA 2YS5A 2COCA 1ISNA 3ZVRA 2NBVA 1W1GA 5C79A 4A6FB 3PEGA 4NSWA 3MDBC 2J0KA 2HTHB 2IFSA 4EMOA 3ODXA 2ADZA 4NY0A 5J3YA 3RCPA 4HB0B 2OQBA 1OMWA 4D0NB 3TVVA 3WA0A 1PFJA 1FGZA 1MKEA 3SNHA 3SYXA 1DYNA 3KSYA 3ML4A 4GMXB 1U27A 2H7DA 2KUQA 4ZRKA 5HE3A 1XKEA 3O96A 3FSSA 2DKQA 1ZM0A 2G35A 1UPQA 3ODOA 2K00A 5JHGA 4KAXB 3ZDTA 2LYDA 1DROA 1V5PA 5JHHA 1H10A 2FJLA 1XX0A 1FAOA 1UPRA 2DYQA 2J0MA 2BCJA 1GC7A 1M7EA 5DI9B 5LOPB 3DXCA 1MK7B 1ZC3B 2XQNM 5CLLB 4HAWB 4EKUA 4HB3B 1DDMA 1MI1A 1PMSA 4MK0A 3SO6A 4IAPA 1P5TA 4HDOA 4L1RA 3U12A 1NTYA 3WYFB 4YONA 3TO1A 1FHOA 2L2IA 1NI2A 1U2BA 5JLJB 4K81A 2Z13A 3A58A 1W1HA 5I2SA 1U5EA 4QJ5B 2P0DA 5HE0A 1NTVA 5GOWB 3NSUA 5KQ1A 2D11A 1BTKA 4A6FA 1U5DA 1B55A 4EJNA 1XCGA 2RRFA 2KUPA 2CAYA 3A98B 1X1GA 2EC1A 2K8EA 5DIFB 1DDWA 2E2XA 4HAXB 2LOXA 1I7AA 4Y94A 4A6HA 3ULBA 2AL6A 4HAUB 5HE2A 2VKIA 1I2HA 1QQGA 1WGUA 2YS1A 5FI1A 5LONB 2I5CA 1PLSA 2MKRA 2V76A 1IRSA 1MPHA 2NZ8B 1KZ7A 1MIZB 3VOQA 1NU2A 1XD4A 5J3QA 4WVFB 1FHWA 4QJ3B 1KI1B 5D3WA 2LULA 5KQ4A 2N0YA 5KCVA 1WJMA 2VRWB 3P6AA 4HAZB 2HE7A 2ROVA 3A8PA 2DHJA 3PZDA 2I5FA 1H4RA 4CHMA 2W2WA 3QBVB 1X11A 4ZRJA 3MPXA 1OY2A 3F5RA 1FB8A 1K5DB 2KIGA 3B77A 2YRYA 3PG7A 1U29A 1TQZA 4DXAB 5DHFB 2D4QA 2YSZA 3N7CA 1ZC4B 3PVLA 1UNRA 2KIEA 4GPTB 4K2OA 3GYPA 4TYZA 4GOUA 4CHJA 3X23A 2W2XC 1T77A 2K2UA 1ZYIA 2Z14A 2QKLA 3U7DA 1XR0B 1V89A 4K2PA 1MK9B 2OTXA 2RVBB 2D9YA 3AU4A 5J3TA 2CY5A 2YF0A 2KGXB 2RUKB 5LG4B 1Z87A 2P0FA 3U8ZA 4A6KA 2ELAA 1X86A 5IRSA 1K5GB 1U5FA 4F7UP 2ROZB 3P7ZA 4A5KA 4L6EA 3QIJA 2DFKA 3DXEA 1ZVRA 1E5WA 4DBBA 2Y7BA 4H8SA 1EF1A 2Z4DA 4HAYB 2EMTA 3OANA 4KHOA 5M4YB 1WJ1A 2D9WA 1MAIA 2H7EA 3TFMA 4B6HA 3PP2A 2LG1A 5JP4A 4DX90 4QJ4B 2YT1A 2DN6A 3D8EA 2Z0OA 1V5UA 2YS3A 2VSZA 4GMVA 3PSCA 3UZTA 5D3VA 2Y8FA 4HDQA 5C6RA 2QKMA 2UZSA 3CIKA 4CSQA 1Q67A 4CYEA 1FOEA 3NWFA 1UNQA 1LW3A 1DDVA 2I1KA 2RGNB 3TCAA 4HB2B 3HSAA 3SUZA 2YT2A 3NWDA 1X1FA 2YT0A 2R0DA 1UEFA 1DBHA 5D3YA 1AWEA 4KVGB 2COFA 2JP2A 4XWXA 3PVWA 5D3XA 2Z0PA 1RRPB 2D9ZA 1N3HA 1SGHA 2UVMA 1P3RA 3HQCA 4HSIA 1W1DA 2EJ8A 3D8DA 2N23A 3ULCA 1WI1A 2AEHA 1TXDA 2D9VA 3HIEA 5DHAB 2I1JA 4F7GA 2RLOA 1XODA 2P8VA 2J59M 2W2XD 2MFQA 2CODA 4HAVB 2GCLA 2GS0A 2DHIA 3OHMB 3VIAA 1EGXA 3PVUA 1ZSQA 2DLWA 2K2JA 2DX1A 2D9XA 4BBKA 2CY4A 2D2QA 2GCJA 3GYOA 4IOYX 1J0WA 1GC6A 4OSNA 5C5BB 5EFXA 3FVCA 4K17A 2KR0A 2J0JA 3DCXA 2P0HA 3TW1A 1TJ6A 4KHBB 2LOZA 4QXAB 2DYNA 3AU5A 4PQ0A 4HB4B 2RSGA 1GG3A 1RJ2A 4MT7A 2R2YA 1Y19B 5FI0A 4GN1A 5HE1A 5CLQB 1BTNA 3LJUX 3D8FA 3SV1A 2EMSA 5C16A 3FM8C 1FGYA 3M1IB 2Y8GA 3V5WA 4ZRIA 4HATB 1EAZA 3HW2B 2M14A 3F0WA 3QWMA 4D6WA 2IYBA 1BWNA 2MDXA 3G9WA 1SHCA 2K49A 3BJIA 1WG7A 3KZ1A 3IVFA 1M7RA 2GUMA 3NW8A 1P6SA 3HK0A 4HHVA 4P7IA 4MY6A 1WVHA 3CXBB
chains in the Genus database with same CATH topology
3ODWA 1KZGA 5DH9B 4F7HA 4Z2NA 3KY9A 3KRXA 4IFSA 1WGQA 2NMBA 3BINA 5L81A 4WJ7A 2DA0A 1UNPA 2GJYA 1MIXA 2L1CA 2RNRB 4DX8A 1EVHA 1AQCA 1V61A 2D10A 2CRFA 2COAA 2X18A 4WSFA 1QC6A 1V5MA 1Y5OA 1U5GA 5C5BA 2M38A 2DHKA 3DXDA 1FHXA 2MWNB 2ZPYA 1OQNA 2Z0QA 4YL8A 2UZRA 3FEHA 2DX5A 1X05A 1BAKA 1J19A 3A8QA 4PNKA 4Z2MB 2DKPA 2DTCA 2KCJA 2R09A 3AJ4A 2ELBA 4GZUA 4TKNA 2Q13A 3T06A 5D27A 1V88A 4GXBA 1LB1A 2YVCA 3KRWA 2PZ1A 2LKOA 4C0AA 4KHAA 2YS5A 2COCA 1ISNA 3ZVRA 5C79A 1W1GA 4A6FB 3PEGA 4NSWA 3MDBC 2J0KA 2HTHB 2IFSA 4EMOA 3ODXA 2ADZA 4NY0A 5J3YA 3RCPA 4HB0B 2OQBA 1OMWA 4D0NB 3TVVA 3WA0A 1PFJA 1FGZA 1MKEA 3SNHA 3SYXA 1DYNA 3KSYA 3ML4A 4GMXB 1U27A 2H7DA 4ZRKA 5HE3A 1XKEA 3O96A 3FSSA 2DKQA 1ZM0A 2G35A 1UPQA 3ODOA 2K00A 5JHGA 4KAXB 3ZDTA 2LYDA 1DROA 1V5PA 5JHHA 1H10A 2FJLA 1XX0A 1FAOA 1UPRA 2DYQA 2J0MA 2BCJA 1GC7A 1M7EA 5DI9B 5LOPB 3DXCA 1MK7B 1ZC3B 2XQNM 5CLLB 4HAWB 4EKUA 4HB3B 1DDMA 1PMSA 4MK0A 3SO6A 4IAPA 1P5TA 4HDOA 1NTYA 3WYFB 4YONA 3TO1A 1FHOA 2L2IA 1NI2A 1U2BA 5JLJB 4K81A 1W1HA 1U5EA 2P0DA 5HE0A 1NTVA 5GOWB 3NSUA 5KQ1A 2D11A 1BTKA 4A6FA 1U5DA 1B55A 4EJNA 1XCGA 2KUPA 2CAYA 3A98B 1X1GA 2EC1A 5DIFB 1DDWA 2E2XA 4HAXB 2LOXA 1I7AA 4Y94A 4A6HA 3ULBA 2AL6A 4HAUB 5HE2A 2VKIA 1I2HA 1QQGA 1WGUA 2YS1A 5FI1A 5LONB 2I5CA 1PLSA 2MKRA 2V76A 1IRSA 1MPHA 2NZ8B 1KZ7A 1MIZB 3VOQA 1NU2A 1XD4A 5J3QA 4WVFB 1FHWA 1KI1B 5D3WA 2LULA 5KQ4A 2N0YA 5KCVA 1WJMA 2VRWB 3P6AA 4HAZB 2HE7A 2ROVA 3A8PA 2DHJA 3PZDA 2I5FA 1H4RA 4CHMA 2W2WA 3QBVB 1X11A 4ZRJA 3MPXA 1OY2A 3F5RA 1FB8A 1K5DB 2YRYA 3PG7A 1U29A 1TQZA 4DXAB 5DHFB 2D4QA 2YSZA 3N7CA 1ZC4B 3PVLA 1UNRA 4GPTB 4K2OA 3GYPA 4TYZA 4CHJA 3X23A 2W2XC 2K2UA 2QKLA 3U7DA 1XR0B 1V89A 4K2PA 1MK9B 2OTXA 2RVBB 2D9YA 3AU4A 5J3TA 2CY5A 2YF0A 2KGXB 2RUKB 1Z87A 2P0FA 3U8ZA 4A6KA 2ELAA 1X86A 1K5GB 1U5FA 4F7UP 2ROZB 3P7ZA 4A5KA 4L6EA 3QIJA 2DFKA 3DXEA 1ZVRA 1E5WA 4DBBA 2Y7BA 4H8SA 1EF1A 4HAYB 2EMTA 3OANA 4KHOA 1WJ1A 2D9WA 1MAIA 2H7EA 3TFMA 4B6HA 3PP2A 2LG1A 5JP4A 4DX90 2YT1A 2DN6A 3D8EA 2Z0OA 1V5UA 2YS3A 2VSZA 4GMVA 3PSCA 3UZTA 5D3VA 2Y8FA 4HDQA 5C6RA 2QKMA 2UZSA 3CIKA 1Q67A 4CYEA 1FOEA 1UNQA 1LW3A 1DDVA 2I1KA 2RGNB 3TCAA 4HB2B 3SUZA 1X1FA 2R0DA 2YT0A 1UEFA 1DBHA 5D3YA 1AWEA 4KVGB 2COFA 2JP2A 4XWXA 3PVWA 5D3XA 2Z0PA 1RRPB 2D9ZA 1N3HA 1SGHA 2UVMA 1P3RA 3HQCA 1W1DA 2EJ8A 3D8DA 2N23A 3ULCA 1WI1A 2AEHA 1TXDA 2D9VA 5DHAB 2I1JA 4F7GA 2RLOA 1XODA 2P8VA 2J59M 2W2XD 2MFQA 2CODA 4HAVB 2GCLA 2GS0A 2DHIA 3VIAA 1EGXA 3PVUA 1ZSQA 2DLWA 2K2JA 2DX1A 2D9XA 4BBKA 2CY4A 2D2QA 2GCJA 3GYOA 4IOYX 1J0WA 1GC6A 5C5BB 5EFXA 4K17A 2J0JA 2P0HA 3TW1A 1TJ6A 4KHBB 2LOZA 2DYNA 3AU5A 4PQ0A 4HB4B 2RSGA 1GG3A 1RJ2A 4MT7A 1Y19B 5FI0A 4GN1A 5HE1A 5CLQB 1BTNA 3LJUX 3D8FA 3SV1A 2EMSA 5C16A 3FM8C 1FGYA 3M1IB 2Y8GA 3V5WA 4ZRIA 4HATB 1EAZA 3HW2B 2M14A 3F0WA 3QWMA 2IYBA 1BWNA 2MDXA 3G9WA 1SHCA 3BJIA 1WG7A 3KZ1A 3IVFA 1M7RA 1P6SA 3HK0A 4HHVA 4P7IA 4MY6A 1WVHA 3CXBB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ODW A;  1KZG A;  5DH9 B;  4F7H A;  4Z2N A;  3KY9 A;  3KRX A;  4IFS A;  1WGQ A;  2NMB A;  3BIN A;  5L81 A;  4WJ7 A;  2DA0 A;  1UNP A;  2GJY A;  1MIX A;  2L1C A;  2RNR B;  4DX8 A;  1EVH A;  1AQC A;  1V61 A;  2D10 A;  2CRF A;  2COA A;  2X18 A;  4WSF A;  1QC6 A;  1V5M A;  1Y5O A;  1U5G A;  5C5B A;  2M38 A;  2DHK A;  3DXD A;  1FHX A;  2MWN B;  2ZPY A;  1OQN A;  2Z0Q A;  4YL8 A;  2UZR A;  3FEH A;  2DX5 A;  1X05 A;  1BAK A;  1J19 A;  3A8Q A;  4PNK A;  4Z2M B;  2DKP A;  2DTC A;  2KCJ A;  2R09 A;  3AJ4 A;  2ELB A;  4GZU A;  4TKN A;  2Q13 A;  3T06 A;  5D27 A;  1V88 A;  4GXB A;  1LB1 A;  2YVC A;  3KRW A;  2PZ1 A;  2LKO A;  4C0A A;  4KHA A;  2YS5 A;  2COC A;  1ISN A;  3ZVR A;  5C79 A;  1W1G A;  4A6F B;  3PEG A;  4NSW A;  3MDB C;  2J0K A;  2HTH B;  2IFS A;  4EMO A;  3ODX A;  2ADZ A;  4NY0 A;  5J3Y A;  3RCP A;  4HB0 B;  2OQB A;  1OMW A;  4D0N B;  3TVV A;  3WA0 A;  1PFJ A;  1FGZ A;  1MKE A;  3SNH A;  3SYX A;  1DYN A;  3KSY A;  3ML4 A;  4GMX B;  1U27 A;  2H7D A;  4ZRK A;  5HE3 A;  1XKE A;  3O96 A;  3FSS A;  2DKQ A;  1ZM0 A;  2G35 A;  1UPQ A;  3ODO A;  2K00 A;  5JHG A;  4KAX B;  3ZDT A;  2LYD A;  1DRO A;  1V5P A;  5JHH A;  1H10 A;  2FJL A;  1XX0 A;  1FAO A;  1UPR A;  2DYQ A;  2J0M A;  2BCJ A;  1GC7 A;  1M7E A;  5DI9 B;  5LOP B;  3DXC A;  1MK7 B;  1ZC3 B;  2XQN M;  5CLL B;  4HAW B;  4EKU A;  4HB3 B;  1DDM A;  1PMS A;  4MK0 A;  3SO6 A;  4IAP A;  1P5T A;  4HDO A;  1NTY A;  3WYF B;  4YON A;  3TO1 A;  1FHO A;  2L2I A;  1NI2 A;  1U2B A;  5JLJ B;  4K81 A;  1W1H A;  1U5E A;  2P0D A;  5HE0 A;  1NTV A;  5GOW B;  3NSU A;  5KQ1 A;  2D11 A;  1BTK A;  4A6F A;  1U5D A;  1B55 A;  4EJN A;  1XCG A;  2KUP A;  2CAY A;  3A98 B;  1X1G A;  2EC1 A;  5DIF B;  1DDW A;  2E2X A;  4HAX B;  2LOX A;  1I7A A;  4Y94 A;  4A6H A;  3ULB A;  2AL6 A;  4HAU B;  5HE2 A;  2VKI A;  1I2H A;  1QQG A;  1WGU A;  2YS1 A;  5FI1 A;  5LON B;  2I5C A;  1PLS A;  2MKR A;  2V76 A;  1IRS A;  1MPH A;  2NZ8 B;  1KZ7 A;  1MIZ B;  3VOQ A;  1NU2 A;  1XD4 A;  5J3Q A;  4WVF B;  1FHW A;  1KI1 B;  5D3W A;  2LUL A;  5KQ4 A;  2N0Y A;  5KCV A;  1WJM A;  2VRW B;  3P6A A;  4HAZ B;  2HE7 A;  2ROV A;  3A8P A;  2DHJ A;  3PZD A;  2I5F A;  1H4R A;  4CHM A;  2W2W A;  3QBV B;  1X11 A;  4ZRJ A;  3MPX A;  1OY2 A;  3F5R A;  1FB8 A;  1K5D B;  2YRY A;  3PG7 A;  1U29 A;  1TQZ A;  4DXA B;  5DHF B;  2D4Q A;  2YSZ A;  3N7C A;  1ZC4 B;  3PVL A;  1UNR A;  4GPT B;  4K2O A;  3GYP A;  4TYZ A;  4CHJ A;  3X23 A;  2W2X C;  2K2U A;  2QKL A;  3U7D A;  1XR0 B;  1V89 A;  4K2P A;  1MK9 B;  2OTX A;  2RVB B;  2D9Y A;  3AU4 A;  5J3T A;  2CY5 A;  2YF0 A;  2KGX B;  2RUK B;  1Z87 A;  2P0F A;  3U8Z A;  4A6K A;  2ELA A;  1X86 A;  1K5G B;  1U5F A;  4F7U P;  2ROZ B;  3P7Z A;  4A5K A;  4L6E A;  3QIJ A;  2DFK A;  3DXE A;  1ZVR A;  1E5W A;  4DBB A;  2Y7B A;  4H8S A;  1EF1 A;  4HAY B;  2EMT A;  3OAN A;  4KHO A;  1WJ1 A;  2D9W A;  1MAI A;  2H7E A;  3TFM A;  4B6H A;  3PP2 A;  2LG1 A;  5JP4 A;  4DX9 0;  2YT1 A;  2DN6 A;  3D8E A;  2Z0O A;  1V5U A;  2YS3 A;  2VSZ A;  4GMV A;  3PSC A;  3UZT A;  5D3V A;  2Y8F A;  4HDQ A;  5C6R A;  2QKM A;  2UZS A;  3CIK A;  1Q67 A;  4CYE A;  1FOE A;  1UNQ A;  1LW3 A;  1DDV A;  2I1K A;  2RGN B;  3TCA A;  4HB2 B;  3SUZ A;  1X1F A;  2R0D A;  2YT0 A;  1UEF A;  1DBH A;  5D3Y A;  1AWE A;  4KVG B;  2COF A;  2JP2 A;  4XWX A;  3PVW A;  5D3X A;  2Z0P A;  1RRP B;  2D9Z A;  1N3H A;  1SGH A;  2UVM A;  1P3R A;  3HQC A;  1W1D A;  2EJ8 A;  3D8D A;  2N23 A;  3ULC A;  1WI1 A;  2AEH A;  1TXD A;  2D9V A;  5DHA B;  2I1J A;  4F7G A;  2RLO A;  1XOD A;  2P8V A;  2J59 M;  2W2X D;  2MFQ A;  2COD A;  4HAV B;  2GCL A;  2GS0 A;  2DHI A;  3VIA A;  1EGX A;  3PVU A;  1ZSQ A;  2DLW A;  2K2J A;  2DX1 A;  2D9X A;  4BBK A;  2CY4 A;  2D2Q A;  2GCJ A;  3GYO A;  4IOY X;  1J0W A;  1GC6 A;  5C5B B;  5EFX A;  4K17 A;  2J0J A;  2P0H A;  3TW1 A;  1TJ6 A;  4KHB B;  2LOZ A;  2DYN A;  3AU5 A;  4PQ0 A;  4HB4 B;  2RSG A;  1GG3 A;  1RJ2 A;  4MT7 A;  1Y19 B;  5FI0 A;  4GN1 A;  5HE1 A;  5CLQ B;  1BTN A;  3LJU X;  3D8F A;  3SV1 A;  2EMS A;  5C16 A;  3FM8 C;  1FGY A;  3M1I B;  2Y8G A;  3V5W A;  4ZRI A;  4HAT B;  1EAZ A;  3HW2 B;  2M14 A;  3F0W A;  3QWM A;  2IYB A;  1BWN A;  2MDX A;  3G9W A;  1SHC A;  3BJI A;  1WG7 A;  3KZ1 A;  3IVF A;  1M7R A;  1P6S A;  3HK0 A;  4HHV A;  4P7I A;  4MY6 A;  1WVH A;  3CXB B; 
#chains in the Genus database with same CATH topology
 3ODW A;  1KZG A;  3NWA A;  5DH9 B;  4F7H A;  4Z2N A;  3KY9 A;  2Z59 A;  3KRX A;  4IFS A;  1WGQ A;  2NMB A;  3BIN A;  5L81 A;  4WJ7 A;  2DA0 A;  1UNP A;  2GJY A;  4OT1 A;  1MIX A;  2L1C A;  2RNR B;  4DX8 A;  4GNK B;  1EVH A;  1AQC A;  1V61 A;  2D10 A;  2CRF A;  2COA A;  2X18 A;  4WSF A;  1QC6 A;  2FJU B;  1V5M A;  1Y5O A;  1U5G A;  5C5B A;  2M38 A;  2DHK A;  3DXD A;  1FHX A;  2MWN B;  2ZPY A;  1OQN A;  2Z0Q A;  4YL8 A;  4KHB A;  2UZR A;  3FEH A;  2DX5 A;  1X05 A;  1BAK A;  1J19 A;  3A8Q A;  4PNK A;  4Z2M B;  2DKP A;  2DTC A;  2KCJ A;  2R09 A;  3AJ4 A;  4DIX A;  2ELB A;  4GZU A;  4TKN A;  2ZKM X;  2Q13 A;  3T06 A;  5D27 A;  1V88 A;  4GXB A;  5I2M A;  1LB1 A;  2YVC A;  3KRW A;  2PZ1 A;  2LKO A;  4C0A A;  4KHA A;  2YS5 A;  2COC A;  1ISN A;  3ZVR A;  2NBV A;  1W1G A;  5C79 A;  4A6F B;  3PEG A;  4NSW A;  3MDB C;  2J0K A;  2HTH B;  2IFS A;  4EMO A;  3ODX A;  2ADZ A;  4NY0 A;  5J3Y A;  3RCP A;  4HB0 B;  2OQB A;  1OMW A;  4D0N B;  3TVV A;  3WA0 A;  1PFJ A;  1FGZ A;  1MKE A;  3SNH A;  3SYX A;  1DYN A;  3KSY A;  3ML4 A;  4GMX B;  1U27 A;  2H7D A;  2KUQ A;  4ZRK A;  5HE3 A;  1XKE A;  3O96 A;  3FSS A;  2DKQ A;  1ZM0 A;  2G35 A;  1UPQ A;  3ODO A;  2K00 A;  5JHG A;  4KAX B;  3ZDT A;  2LYD A;  1DRO A;  1V5P A;  5JHH A;  1H10 A;  2FJL A;  1XX0 A;  1FAO A;  1UPR A;  2DYQ A;  2J0M A;  2BCJ A;  1GC7 A;  1M7E A;  5DI9 B;  5LOP B;  3DXC A;  1MK7 B;  1ZC3 B;  2XQN M;  5CLL B;  4HAW B;  4EKU A;  4HB3 B;  1DDM A;  1MI1 A;  1PMS A;  4MK0 A;  3SO6 A;  4IAP A;  1P5T A;  4HDO A;  4L1R A;  3U12 A;  1NTY A;  3WYF B;  4YON A;  3TO1 A;  1FHO A;  2L2I A;  1NI2 A;  1U2B A;  5JLJ B;  4K81 A;  2Z13 A;  3A58 A;  1W1H A;  5I2S A;  1U5E A;  4QJ5 B;  2P0D A;  5HE0 A;  1NTV A;  5GOW B;  3NSU A;  5KQ1 A;  2D11 A;  1BTK A;  4A6F A;  1U5D A;  1B55 A;  4EJN A;  1XCG A;  2RRF A;  2KUP A;  2CAY A;  3A98 B;  1X1G A;  2EC1 A;  2K8E A;  5DIF B;  1DDW A;  2E2X A;  4HAX B;  2LOX A;  1I7A A;  4Y94 A;  4A6H A;  3ULB A;  2AL6 A;  4HAU B;  5HE2 A;  2VKI A;  1I2H A;  1QQG A;  1WGU A;  2YS1 A;  5FI1 A;  5LON B;  2I5C A;  1PLS A;  2MKR A;  2V76 A;  1IRS A;  1MPH A;  2NZ8 B;  1KZ7 A;  1MIZ B;  3VOQ A;  1NU2 A;  1XD4 A;  5J3Q A;  4WVF B;  1FHW A;  4QJ3 B;  1KI1 B;  5D3W A;  2LUL A;  5KQ4 A;  2N0Y A;  5KCV A;  1WJM A;  2VRW B;  3P6A A;  4HAZ B;  2HE7 A;  2ROV A;  3A8P A;  2DHJ A;  3PZD A;  2I5F A;  1H4R A;  4CHM A;  2W2W A;  3QBV B;  1X11 A;  4ZRJ A;  3MPX A;  1OY2 A;  3F5R A;  1FB8 A;  1K5D B;  2KIG A;  3B77 A;  2YRY A;  3PG7 A;  1U29 A;  1TQZ A;  4DXA B;  5DHF B;  2D4Q A;  2YSZ A;  3N7C A;  1ZC4 B;  3PVL A;  1UNR A;  2KIE A;  4GPT B;  4K2O A;  3GYP A;  4TYZ A;  4GOU A;  4CHJ A;  3X23 A;  2W2X C;  1T77 A;  2K2U A;  1ZYI A;  2Z14 A;  2QKL A;  3U7D A;  1XR0 B;  1V89 A;  4K2P A;  1MK9 B;  2OTX A;  2RVB B;  2D9Y A;  3AU4 A;  5J3T A;  2CY5 A;  2YF0 A;  2KGX B;  2RUK B;  5LG4 B;  1Z87 A;  2P0F A;  3U8Z A;  4A6K A;  2ELA A;  1X86 A;  5IRS A;  1K5G B;  1U5F A;  4F7U P;  2ROZ B;  3P7Z A;  4A5K A;  4L6E A;  3QIJ A;  2DFK A;  3DXE A;  1ZVR A;  1E5W A;  4DBB A;  2Y7B A;  4H8S A;  1EF1 A;  2Z4D A;  4HAY B;  2EMT A;  3OAN A;  4KHO A;  5M4Y B;  1WJ1 A;  2D9W A;  1MAI A;  2H7E A;  3TFM A;  4B6H A;  3PP2 A;  2LG1 A;  5JP4 A;  4DX9 0;  4QJ4 B;  2YT1 A;  2DN6 A;  3D8E A;  2Z0O A;  1V5U A;  2YS3 A;  2VSZ A;  4GMV A;  3PSC A;  3UZT A;  5D3V A;  2Y8F A;  4HDQ A;  5C6R A;  2QKM A;  2UZS A;  3CIK A;  4CSQ A;  1Q67 A;  4CYE A;  1FOE A;  3NWF A;  1UNQ A;  1LW3 A;  1DDV A;  2I1K A;  2RGN B;  3TCA A;  4HB2 B;  3HSA A;  3SUZ A;  2YT2 A;  3NWD A;  1X1F A;  2YT0 A;  2R0D A;  1UEF A;  1DBH A;  5D3Y A;  1AWE A;  4KVG B;  2COF A;  2JP2 A;  4XWX A;  3PVW A;  5D3X A;  2Z0P A;  1RRP B;  2D9Z A;  1N3H A;  1SGH A;  2UVM A;  1P3R A;  3HQC A;  4HSI A;  1W1D A;  2EJ8 A;  3D8D A;  2N23 A;  3ULC A;  1WI1 A;  2AEH A;  1TXD A;  2D9V A;  3HIE A;  5DHA B;  2I1J A;  4F7G A;  2RLO A;  1XOD A;  2P8V A;  2J59 M;  2W2X D;  2MFQ A;  2COD A;  4HAV B;  2GCL A;  2GS0 A;  2DHI A;  3OHM B;  3VIA A;  1EGX A;  3PVU A;  1ZSQ A;  2DLW A;  2K2J A;  2DX1 A;  2D9X A;  4BBK A;  2CY4 A;  2D2Q A;  2GCJ A;  3GYO A;  4IOY X;  1J0W A;  1GC6 A;  4OSN A;  5C5B B;  5EFX A;  3FVC A;  4K17 A;  2KR0 A;  2J0J A;  3DCX A;  2P0H A;  3TW1 A;  1TJ6 A;  4KHB B;  2LOZ A;  4QXA B;  2DYN A;  3AU5 A;  4PQ0 A;  4HB4 B;  2RSG A;  1GG3 A;  1RJ2 A;  4MT7 A;  2R2Y A;  1Y19 B;  5FI0 A;  4GN1 A;  5HE1 A;  5CLQ B;  1BTN A;  3LJU X;  3D8F A;  3SV1 A;  2EMS A;  5C16 A;  3FM8 C;  1FGY A;  3M1I B;  2Y8G A;  3V5W A;  4ZRI A;  4HAT B;  1EAZ A;  3HW2 B;  2M14 A;  3F0W A;  3QWM A;  4D6W A;  2IYB A;  1BWN A;  2MDX A;  3G9W A;  1SHC A;  2K49 A;  3BJI A;  1WG7 A;  3KZ1 A;  3IVF A;  1M7R A;  2GUM A;  3NW8 A;  1P6S A;  3HK0 A;  4HHV A;  4P7I A;  4MY6 A;  1WVH A;  3CXB B; 
#chains in the Genus database with same CATH homology
 3ODW A;  1KZG A;  5DH9 B;  4F7H A;  4Z2N A;  3KY9 A;  3KRX A;  4IFS A;  1WGQ A;  2NMB A;  3BIN A;  5L81 A;  4WJ7 A;  2DA0 A;  1UNP A;  2GJY A;  1MIX A;  2L1C A;  2RNR B;  4DX8 A;  1EVH A;  1AQC A;  1V61 A;  2D10 A;  2CRF A;  2COA A;  2X18 A;  4WSF A;  1QC6 A;  1V5M A;  1Y5O A;  1U5G A;  5C5B A;  2M38 A;  2DHK A;  3DXD A;  1FHX A;  2MWN B;  2ZPY A;  1OQN A;  2Z0Q A;  4YL8 A;  2UZR A;  3FEH A;  2DX5 A;  1X05 A;  1BAK A;  1J19 A;  3A8Q A;  4PNK A;  4Z2M B;  2DKP A;  2DTC A;  2KCJ A;  2R09 A;  3AJ4 A;  2ELB A;  4GZU A;  4TKN A;  2Q13 A;  3T06 A;  5D27 A;  1V88 A;  4GXB A;  1LB1 A;  2YVC A;  3KRW A;  2PZ1 A;  2LKO A;  4C0A A;  4KHA A;  2YS5 A;  2COC A;  1ISN A;  3ZVR A;  5C79 A;  1W1G A;  4A6F B;  3PEG A;  4NSW A;  3MDB C;  2J0K A;  2HTH B;  2IFS A;  4EMO A;  3ODX A;  2ADZ A;  4NY0 A;  5J3Y A;  3RCP A;  4HB0 B;  2OQB A;  1OMW A;  4D0N B;  3TVV A;  3WA0 A;  1PFJ A;  1FGZ A;  1MKE A;  3SNH A;  3SYX A;  1DYN A;  3KSY A;  3ML4 A;  4GMX B;  1U27 A;  2H7D A;  4ZRK A;  5HE3 A;  1XKE A;  3O96 A;  3FSS A;  2DKQ A;  1ZM0 A;  2G35 A;  1UPQ A;  3ODO A;  2K00 A;  5JHG A;  4KAX B;  3ZDT A;  2LYD A;  1DRO A;  1V5P A;  5JHH A;  1H10 A;  2FJL A;  1XX0 A;  1FAO A;  1UPR A;  2DYQ A;  2J0M A;  2BCJ A;  1GC7 A;  1M7E A;  5DI9 B;  5LOP B;  3DXC A;  1MK7 B;  1ZC3 B;  2XQN M;  5CLL B;  4HAW B;  4EKU A;  4HB3 B;  1DDM A;  1PMS A;  4MK0 A;  3SO6 A;  4IAP A;  1P5T A;  4HDO A;  1NTY A;  3WYF B;  4YON A;  3TO1 A;  1FHO A;  2L2I A;  1NI2 A;  1U2B A;  5JLJ B;  4K81 A;  1W1H A;  1U5E A;  2P0D A;  5HE0 A;  1NTV A;  5GOW B;  3NSU A;  5KQ1 A;  2D11 A;  1BTK A;  4A6F A;  1U5D A;  1B55 A;  4EJN A;  1XCG A;  2KUP A;  2CAY A;  3A98 B;  1X1G A;  2EC1 A;  5DIF B;  1DDW A;  2E2X A;  4HAX B;  2LOX A;  1I7A A;  4Y94 A;  4A6H A;  3ULB A;  2AL6 A;  4HAU B;  5HE2 A;  2VKI A;  1I2H A;  1QQG A;  1WGU A;  2YS1 A;  5FI1 A;  5LON B;  2I5C A;  1PLS A;  2MKR A;  2V76 A;  1IRS A;  1MPH A;  2NZ8 B;  1KZ7 A;  1MIZ B;  3VOQ A;  1NU2 A;  1XD4 A;  5J3Q A;  4WVF B;  1FHW A;  1KI1 B;  5D3W A;  2LUL A;  5KQ4 A;  2N0Y A;  5KCV A;  1WJM A;  2VRW B;  3P6A A;  4HAZ B;  2HE7 A;  2ROV A;  3A8P A;  2DHJ A;  3PZD A;  2I5F A;  1H4R A;  4CHM A;  2W2W A;  3QBV B;  1X11 A;  4ZRJ A;  3MPX A;  1OY2 A;  3F5R A;  1FB8 A;  1K5D B;  2YRY A;  3PG7 A;  1U29 A;  1TQZ A;  4DXA B;  5DHF B;  2D4Q A;  2YSZ A;  3N7C A;  1ZC4 B;  3PVL A;  1UNR A;  4GPT B;  4K2O A;  3GYP A;  4TYZ A;  4CHJ A;  3X23 A;  2W2X C;  2K2U A;  2QKL A;  3U7D A;  1XR0 B;  1V89 A;  4K2P A;  1MK9 B;  2OTX A;  2RVB B;  2D9Y A;  3AU4 A;  5J3T A;  2CY5 A;  2YF0 A;  2KGX B;  2RUK B;  1Z87 A;  2P0F A;  3U8Z A;  4A6K A;  2ELA A;  1X86 A;  1K5G B;  1U5F A;  4F7U P;  2ROZ B;  3P7Z A;  4A5K A;  4L6E A;  3QIJ A;  2DFK A;  3DXE A;  1ZVR A;  1E5W A;  4DBB A;  2Y7B A;  4H8S A;  1EF1 A;  4HAY B;  2EMT A;  3OAN A;  4KHO A;  1WJ1 A;  2D9W A;  1MAI A;  2H7E A;  3TFM A;  4B6H A;  3PP2 A;  2LG1 A;  5JP4 A;  4DX9 0;  2YT1 A;  2DN6 A;  3D8E A;  2Z0O A;  1V5U A;  2YS3 A;  2VSZ A;  4GMV A;  3PSC A;  3UZT A;  5D3V A;  2Y8F A;  4HDQ A;  5C6R A;  2QKM A;  2UZS A;  3CIK A;  1Q67 A;  4CYE A;  1FOE A;  1UNQ A;  1LW3 A;  1DDV A;  2I1K A;  2RGN B;  3TCA A;  4HB2 B;  3SUZ A;  1X1F A;  2R0D A;  2YT0 A;  1UEF A;  1DBH A;  5D3Y A;  1AWE A;  4KVG B;  2COF A;  2JP2 A;  4XWX A;  3PVW A;  5D3X A;  2Z0P A;  1RRP B;  2D9Z A;  1N3H A;  1SGH A;  2UVM A;  1P3R A;  3HQC A;  1W1D A;  2EJ8 A;  3D8D A;  2N23 A;  3ULC A;  1WI1 A;  2AEH A;  1TXD A;  2D9V A;  5DHA B;  2I1J A;  4F7G A;  2RLO A;  1XOD A;  2P8V A;  2J59 M;  2W2X D;  2MFQ A;  2COD A;  4HAV B;  2GCL A;  2GS0 A;  2DHI A;  3VIA A;  1EGX A;  3PVU A;  1ZSQ A;  2DLW A;  2K2J A;  2DX1 A;  2D9X A;  4BBK A;  2CY4 A;  2D2Q A;  2GCJ A;  3GYO A;  4IOY X;  1J0W A;  1GC6 A;  5C5B B;  5EFX A;  4K17 A;  2J0J A;  2P0H A;  3TW1 A;  1TJ6 A;  4KHB B;  2LOZ A;  2DYN A;  3AU5 A;  4PQ0 A;  4HB4 B;  2RSG A;  1GG3 A;  1RJ2 A;  4MT7 A;  1Y19 B;  5FI0 A;  4GN1 A;  5HE1 A;  5CLQ B;  1BTN A;  3LJU X;  3D8F A;  3SV1 A;  2EMS A;  5C16 A;  3FM8 C;  1FGY A;  3M1I B;  2Y8G A;  3V5W A;  4ZRI A;  4HAT B;  1EAZ A;  3HW2 B;  2M14 A;  3F0W A;  3QWM A;  2IYB A;  1BWN A;  2MDX A;  3G9W A;  1SHC A;  3BJI A;  1WG7 A;  3KZ1 A;  3IVF A;  1M7R A;  1P6S A;  3HK0 A;  4HHV A;  4P7I A;  4MY6 A;  1WVH A;  3CXB B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...