2RUKB

Solution structure of the complex between p53 transactivation domain 2 and tfiih p62 ph domain
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
108
structure length
108
Chain Sequence
MATSSEEVLLIVKKVRQKKQDGALYLMAERIAWAPEGKDRFTISHMYADIKCQKISPEGKAKIQLQLVLHAGDTTNFHFSNESTAVKERDAVKDLLQQLLPKFKRKAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Extended String Binding Mode of the Phosphorylated Transactivation Domain of Tumor Suppressor p53
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords Cellular tumor antigen p53
total genus 26
structure length 108
sequence length 108
ec nomenclature
pdb deposition date 2014-09-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF08567 PH_TFIIH TFIIH p62 subunit, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2rukB00
2Y7BA 3KSYA 2GCJA 4WVFB 4KHOA 1ZC4B 1XCGA 4Z2NA 2DHJA 1UPRA 2VRWB 5HE0A 2K2JA 2KUPA 1RJ2A 1WG7A 2R09A 2HE7A 4ZRJA 5D3YA 2GJYA 2DYQA 4F7UP 2D4QA 1FHWA 1FGZA 4HDQA 2D9YA 2EMTA 4HHVA 1DBHA 3UZTA 5C16A 1KZGA 1W1HA 3ODXA 4HAVB 1EGXA 1OMWA 1WVHA 4MK0A 2Z0QA 3CXBB 1FGYA 2E2XA 1V89A 2CAYA 2EMSA 3T06A 4GN1A 4HB4B 1W1GA 2J59M 3AU4A 1PMSA 4WSFA 4KHBB 2D9WA 2UVMA 3D8DA 5C5BA 2BCJA 2MDXA 3N7CA 5JHGA 4L6EA 3TFMA 4WJ7A 2VSZA 1U27A 4HAUB 3QWMA 1U5FA 1J0WA 4ZRKA 5JP4A 4K2OA 3ZVRA 3ULBA 1XX0A 3KY9A 4KAXB 1XKEA 2J0JA 5KQ1A 2W2XD 4HAWB 4Y94A 5D3WA 4DBBA 2KCJA 1QQGA 1V61A 1XODA 4HAZB 3SNHA 4D0NB 2DX1A 2QKLA 3DXCA 1MK9B 1MKEA 2CODA 2YS3A 4HDOA 5FI0A 2MWNB 3HQCA 1EAZA 3WA0A 2YRYA 5C5BB 2XQNM 1XD4A 3KRXA 3NSUA 1EVHA 1GG3A 4H8SA 1U29A 4IAPA 1ZC3B 3ULCA 3O96A 4PQ0A 2YS1A 2EC1A 1ISNA 2RVBB 1P3RA 5L81A 5JHHA 4HAYB 4EJNA 4A5KA 2Q13A 3FEHA 2YT0A 2Z0OA 3M1IB 2DLWA 2COAA 3PEGA 2CY4A 1FHOA 1MK7B 1MIZB 2J0MA 1UNPA 1OY2A 4TKNA 1X1FA 1V88A 2N23A 1M7EA 1E5WA 1RRPB 1SGHA 2I1JA 4NSWA 3MDBC 1P6SA 3IVFA 1V5PA 1AQCA 4HAXB 2OQBA 4HB2B 2DN6A 2P0FA 5C6RA 1N3HA 3FM8C 4YL8A 3BINA 3F0WA 4K17A 3KRWA 2UZSA 1B55A 2DKQA 2JP2A 1U5DA 2I1KA 2NZ8B 1BWNA 2Y8GA 3X23A 1U5EA 3PG7A 4KVGB 3RCPA 1DROA 2RSGA 2PZ1A 1PFJA 2OTXA 2J0KA 2YSZA 2ELBA 2D9XA 3GYPA 5C79A 5DIFB 5HE3A 2RNRB 4KHAA 4B6HA 1ZVRA 2DFKA 5J3QA 2QKMA 2H7EA 5HE2A 5EFXA 2Y8FA 5KQ4A 2N0YA 2I5FA 4Z2MB 2LOXA 1UPQA 2DX5A 4GPTB 2I5CA 5GOWB 1PLSA 3F5RA 2Z0PA 3D8EA 2H7DA 2IYBA 4C0AA 3KZ1A 5FI1A 1IRSA 4A6FB 1WI1A 1U5GA 4CYEA 4GMXB 1FB8A 3V5WA 4CHJA 3DXEA 2R0DA 1LB1A 1ZSQA 1MIXA 3VIAA 3DXDA 4F7HA 4DXAB 1Z87A 1DDWA 3A8QA 2GCLA 2LOZA 2CRFA 4HB0B 1BTNA 4EKUA 3SO6A 3ODWA 4XWXA 1KI1B 1WGQA 2GS0A 5KCVA 2YVCA 2D2QA 3ZDTA 1V5MA 2W2XC 3A98B 1Y19B 3TO1A 2DHIA 2ROVA 1I2HA 3PSCA 1V5UA 3HK0A 3HW2B 3SV1A 3GYOA 5HE1A 1X05A 2DHKA 1FOEA 2P0HA 2MKRA 4BBKA 1K5GB 2LG1A 3PVUA 5D27A 5D3VA 5DI9B 2M38A 1TJ6A 5LONB 3ML4A 1MPHA 2ZPYA 5JLJB 5DHAB 4DX8A 3VOQA 4A6HA 2COCA 1H10A 1NTVA 1MAIA 3U7DA 1DDVA 3G9WA 5CLLB 1FAOA 2D9ZA 2LKOA 2LULA 1BAKA 2L1CA 5DHFB 5J3TA 3WYFB 5CLQB 4ZRIA 1ZM0A 4IOYX 2L2IA 2ELAA 1Q67A 2DYNA 4MY6A 2DKPA 1J19A 2NMBA 3TVVA 4EMOA 1GC7A 5D3XA 2K2UA 1BTKA 1DYNA 2D11A 1WGUA 1NU2A 2YF0A 1WJ1A 3TCAA 2RLOA 3AJ4A 3PVWA 4F7GA 1W1DA 2P0DA 3A8PA 4DX90 3TW1A 1U2BA 1X1GA 1DDMA 1QC6A 1TQZA 1P5TA 2ADZA 2X18A 2VKIA 3PVLA 1NTYA 2UZRA 4GXBA 2MFQA 1I7AA 1UEFA 1EF1A 3U8ZA 3QBVB 1WJMA 1X86A 4P7IA 1FHXA 2ROZB 1TXDA 3PZDA 5J3YA 1GC6A 1X11A 3P7ZA 3ODOA 3SUZA 2DA0A 1SHCA 4PNKA 2DTCA 2COFA 2FJLA 2IFSA 4K2PA 1Y5OA 2D9VA 2EJ8A 2RGNB 3OANA 2D10A 3BJIA 2P8VA 2V76A 4MT7A 2W2WA 1UNQA 2CY5A 2HTHB 4HATB 5LOPB 3LJUX 1K5DB 4K81A 2AEHA 2KGXB 4GMVA 3P6AA 4IFSA 2YT1A 3AU5A 4CHMA 1XR0B 3SYXA 4HB3B 1OQNA 1M7RA 5DH9B 1KZ7A 4NY0A 2YS5A 4TYZA 3QIJA 3FSSA 4A6KA 2LYDA 4A6FA 4YONA 2G35A 1NI2A 4GZUA 1AWEA 3MPXA 2AL6A 3D8FA 2M14A 1LW3A 3CIKA 1UNRA 3PP2A 1H4RA 2K00A 2RUKB
chains in the Genus database with same CATH superfamily
4QJ5B 2Y7BA 3KSYA 2KIGA 2GCJA 4WVFB 4KHOA 1ZC4B 1XCGA 4Z2NA 2DHJA 1UPRA 4QXAB 2VRWB 5HE0A 2K2JA 2KUPA 1RJ2A 1WG7A 2R09A 2HE7A 4ZRJA 2K49A 5D3YA 2GJYA 2DYQA 4F7UP 2D4QA 1FHWA 1FGZA 4HDQA 2D9YA 2EMTA 4HHVA 1DBHA 3UZTA 5C16A 1KZGA 1W1HA 3ODXA 4HAVB 1EGXA 3A58A 1OMWA 1WVHA 4MK0A 2Z0QA 3CXBB 1FGYA 2E2XA 1V89A 1T77A 2CAYA 2EMSA 3T06A 4GN1A 4HB4B 1W1GA 2J59M 3AU4A 1PMSA 4WSFA 4KHBB 2D9WA 2UVMA 3D8DA 3HIEA 5C5BA 2BCJA 2MDXA 3N7CA 5JHGA 4L6EA 3TFMA 4WJ7A 2VSZA 1U27A 4HAUB 3B77A 3QWMA 1U5FA 3NW8A 1J0WA 4ZRKA 5JP4A 4K2OA 2KR0A 3ZVRA 3ULBA 4QJ4B 1XX0A 3KY9A 4KAXB 1XKEA 2J0JA 5KQ1A 2W2XD 4HAWB 4Y94A 5D3WA 4DBBA 2Z14A 2KCJA 1QQGA 1V61A 1XODA 4HAZB 3SNHA 4D0NB 2DX1A 2QKLA 4OT1A 2K8EA 2Z4DA 3DXCA 1MK9B 1MKEA 2YT2A 2CODA 2R2YA 2YS3A 4QJ3B 5M4YB 4HDOA 5FI0A 2MWNB 3HQCA 1EAZA 3WA0A 2YRYA 5C5BB 2XQNM 1XD4A 3KRXA 3NSUA 1EVHA 1GG3A 2GUMA 1U29A 4H8SA 4IAPA 1ZC3B 3ULCA 3O96A 4PQ0A 2YS1A 2EC1A 1ISNA 2RVBB 1P3RA 5L81A 5JHHA 4HAYB 4EJNA 4A5KA 2Q13A 3FEHA 2YT0A 2Z0OA 3M1IB 2DLWA 2COAA 3PEGA 2CY4A 1FHOA 1MK7B 1MIZB 2J0MA 1UNPA 1OY2A 3OHMB 4TKNA 3NWDA 1X1FA 1V88A 2N23A 1M7EA 1E5WA 1RRPB 3DCXA 1SGHA 4DIXA 2I1JA 4NSWA 3MDBC 1P6SA 3IVFA 1V5PA 1AQCA 4HAXB 2OQBA 3U12A 4HB2B 2DN6A 2P0FA 5C6RA 1N3HA 3FM8C 4YL8A 3BINA 3F0WA 4K17A 3KRWA 2UZSA 1B55A 2DKQA 2JP2A 1U5DA 2I1KA 2NZ8B 1BWNA 2Y8GA 3X23A 5IRSA 1U5EA 3PG7A 4KVGB 3RCPA 1DROA 2RSGA 2PZ1A 1PFJA 2OTXA 2J0KA 2YSZA 2ELBA 2D9XA 1MI1A 3GYPA 5C79A 5DIFB 5HE3A 2RNRB 4KHAA 4B6HA 1ZVRA 2DFKA 5J3QA 2QKMA 2H7EA 2KIEA 5HE2A 5EFXA 2Z13A 2Y8FA 5KQ4A 2N0YA 2I5FA 2RRFA 4Z2MB 4GNKB 2LOXA 1UPQA 2DX5A 4GPTB 1ZYIA 2I5CA 5GOWB 1PLSA 3F5RA 4CSQA 2Z0PA 3D8EA 2H7DA 2IYBA 4C0AA 3KZ1A 5FI1A 2FJUB 1IRSA 4A6FB 1WI1A 1U5GA 4CYEA 4GMXB 1FB8A 3V5WA 4CHJA 3DXEA 5LG4B 2R0DA 1LB1A 1ZSQA 1MIXA 3VIAA 3DXDA 4F7HA 4DXAB 1Z87A 1DDWA 3A8QA 2GCLA 2LOZA 2CRFA 4HB0B 1BTNA 4EKUA 3SO6A 3ODWA 4XWXA 1KI1B 1WGQA 2GS0A 4HSIA 5KCVA 2YVCA 2D2QA 3ZDTA 1V5MA 2W2XC 3A98B 1Y19B 2NBVA 5I2SA 3TO1A 2DHIA 2ROVA 1I2HA 3PSCA 1V5UA 3HK0A 3HW2B 3SV1A 3GYOA 5HE1A 1X05A 2DHKA 1FOEA 2P0HA 2MKRA 4D6WA 4BBKA 1K5GB 2LG1A 3PVUA 5D27A 5D3VA 5DI9B 2M38A 1TJ6A 5LONB 3ML4A 1MPHA 2ZPYA 5JLJB 5DHAB 4DX8A 3VOQA 4A6HA 2COCA 1H10A 1NTVA 1MAIA 3U7DA 4L1RA 1DDVA 3G9WA 5CLLB 1FAOA 2Z59A 2D9ZA 2LKOA 2LULA 1BAKA 2L1CA 5DHFB 5J3TA 3WYFB 5CLQB 3NWFA 4ZRIA 1ZM0A 4IOYX 2L2IA 2ELAA 1Q67A 2DYNA 4MY6A 2DKPA 1J19A 2NMBA 3TVVA 4EMOA 1GC7A 5D3XA 2K2UA 1BTKA 1DYNA 2D11A 1WGUA 1NU2A 2YF0A 1WJ1A 3TCAA 2RLOA 3AJ4A 3PVWA 3NWAA 4F7GA 1W1DA 2P0DA 3A8PA 4DX90 3TW1A 1U2BA 1X1GA 1DDMA 1QC6A 1TQZA 1P5TA 2ADZA 4OSNA 2X18A 2VKIA 3PVLA 1NTYA 2UZRA 4GXBA 2MFQA 1I7AA 1UEFA 1EF1A 3U8ZA 4KHBA 3QBVB 1WJMA 1X86A 4P7IA 1FHXA 2ROZB 1TXDA 3PZDA 5J3YA 1GC6A 1X11A 3P7ZA 3ODOA 3SUZA 2DA0A 1SHCA 4PNKA 2DTCA 2COFA 2FJLA 2IFSA 4K2PA 1Y5OA 2D9VA 2EJ8A 2RGNB 3OANA 2D10A 3BJIA 2P8VA 2V76A 4MT7A 2W2WA 1UNQA 2CY5A 2HTHB 3HSAA 4HATB 5LOPB 3LJUX 1K5DB 4GOUA 4K81A 2AEHA 2KGXB 4GMVA 3FVCA 3P6AA 4IFSA 2YT1A 3AU5A 4CHMA 1XR0B 3SYXA 4HB3B 1OQNA 1M7RA 5DH9B 1KZ7A 4NY0A 2YS5A 4TYZA 3QIJA 3FSSA 4A6KA 2LYDA 4A6FA 4YONA 2G35A 1NI2A 2KUQA 4GZUA 1AWEA 3MPXA 2AL6A 3D8FA 2M14A 1LW3A 3CIKA 1UNRA 3PP2A 1H4RA 5I2MA 2K00A 2RUKB 2ZKMX
chains in the Genus database with same CATH topology
2Y7BA 3KSYA 2GCJA 4WVFB 4KHOA 1ZC4B 1XCGA 4Z2NA 2DHJA 1UPRA 2VRWB 5HE0A 2K2JA 2KUPA 1RJ2A 1WG7A 2R09A 2HE7A 4ZRJA 5D3YA 2GJYA 2DYQA 4F7UP 2D4QA 1FHWA 1FGZA 4HDQA 2D9YA 2EMTA 4HHVA 1DBHA 3UZTA 5C16A 1KZGA 1W1HA 3ODXA 4HAVB 1EGXA 1OMWA 1WVHA 4MK0A 2Z0QA 3CXBB 1FGYA 2E2XA 1V89A 2CAYA 2EMSA 3T06A 4GN1A 4HB4B 1W1GA 2J59M 3AU4A 1PMSA 4WSFA 4KHBB 2D9WA 2UVMA 3D8DA 5C5BA 2BCJA 2MDXA 3N7CA 5JHGA 4L6EA 3TFMA 4WJ7A 2VSZA 1U27A 4HAUB 3QWMA 1U5FA 1J0WA 4ZRKA 5JP4A 4K2OA 3ZVRA 3ULBA 1XX0A 3KY9A 4KAXB 1XKEA 2J0JA 5KQ1A 2W2XD 4HAWB 4Y94A 5D3WA 4DBBA 2KCJA 1QQGA 1V61A 1XODA 4HAZB 3SNHA 4D0NB 2DX1A 2QKLA 3DXCA 1MK9B 1MKEA 2CODA 2YS3A 4HDOA 5FI0A 2MWNB 3HQCA 1EAZA 3WA0A 2YRYA 5C5BB 2XQNM 1XD4A 3KRXA 3NSUA 1EVHA 1GG3A 4H8SA 1U29A 4IAPA 1ZC3B 3ULCA 3O96A 4PQ0A 2YS1A 2EC1A 1ISNA 2RVBB 1P3RA 5L81A 5JHHA 4HAYB 4EJNA 4A5KA 2Q13A 3FEHA 2YT0A 2Z0OA 3M1IB 2DLWA 2COAA 3PEGA 2CY4A 1FHOA 1MK7B 1MIZB 2J0MA 1UNPA 1OY2A 4TKNA 1X1FA 1V88A 2N23A 1M7EA 1E5WA 1RRPB 1SGHA 2I1JA 4NSWA 3MDBC 1P6SA 3IVFA 1V5PA 1AQCA 4HAXB 2OQBA 4HB2B 2DN6A 2P0FA 5C6RA 1N3HA 3FM8C 4YL8A 3BINA 3F0WA 4K17A 3KRWA 2UZSA 1B55A 2DKQA 2JP2A 1U5DA 2I1KA 2NZ8B 1BWNA 2Y8GA 3X23A 1U5EA 3PG7A 4KVGB 3RCPA 1DROA 2RSGA 2PZ1A 1PFJA 2OTXA 2J0KA 2YSZA 2ELBA 2D9XA 3GYPA 5C79A 5DIFB 5HE3A 2RNRB 4KHAA 4B6HA 1ZVRA 2DFKA 5J3QA 2QKMA 2H7EA 5HE2A 5EFXA 2Y8FA 5KQ4A 2N0YA 2I5FA 4Z2MB 2LOXA 1UPQA 2DX5A 4GPTB 2I5CA 5GOWB 1PLSA 3F5RA 2Z0PA 3D8EA 2H7DA 2IYBA 4C0AA 3KZ1A 5FI1A 1IRSA 4A6FB 1WI1A 1U5GA 4CYEA 4GMXB 1FB8A 3V5WA 4CHJA 3DXEA 2R0DA 1LB1A 1ZSQA 1MIXA 3VIAA 3DXDA 4F7HA 4DXAB 1Z87A 1DDWA 3A8QA 2GCLA 2LOZA 2CRFA 4HB0B 1BTNA 4EKUA 3SO6A 3ODWA 4XWXA 1KI1B 1WGQA 2GS0A 5KCVA 2YVCA 2D2QA 3ZDTA 1V5MA 2W2XC 3A98B 1Y19B 3TO1A 2DHIA 2ROVA 1I2HA 3PSCA 1V5UA 3HK0A 3HW2B 3SV1A 3GYOA 5HE1A 1X05A 2DHKA 1FOEA 2P0HA 2MKRA 4BBKA 1K5GB 2LG1A 3PVUA 5D27A 5D3VA 5DI9B 2M38A 1TJ6A 5LONB 3ML4A 1MPHA 2ZPYA 5JLJB 5DHAB 4DX8A 3VOQA 4A6HA 2COCA 1H10A 1NTVA 1MAIA 3U7DA 1DDVA 3G9WA 5CLLB 1FAOA 2D9ZA 2LKOA 2LULA 1BAKA 2L1CA 5DHFB 5J3TA 3WYFB 5CLQB 4ZRIA 1ZM0A 4IOYX 2L2IA 2ELAA 1Q67A 2DYNA 4MY6A 2DKPA 1J19A 2NMBA 3TVVA 4EMOA 1GC7A 5D3XA 2K2UA 1BTKA 1DYNA 2D11A 1WGUA 1NU2A 2YF0A 1WJ1A 3TCAA 2RLOA 3AJ4A 3PVWA 4F7GA 1W1DA 2P0DA 3A8PA 4DX90 3TW1A 1U2BA 1X1GA 1DDMA 1QC6A 1TQZA 1P5TA 2ADZA 2X18A 2VKIA 3PVLA 1NTYA 2UZRA 4GXBA 2MFQA 1I7AA 1UEFA 1EF1A 3U8ZA 3QBVB 1WJMA 1X86A 4P7IA 1FHXA 2ROZB 1TXDA 3PZDA 5J3YA 1GC6A 1X11A 3P7ZA 3ODOA 3SUZA 2DA0A 1SHCA 4PNKA 2DTCA 2COFA 2FJLA 2IFSA 4K2PA 1Y5OA 2D9VA 2EJ8A 2RGNB 3OANA 2D10A 3BJIA 2P8VA 2V76A 4MT7A 2W2WA 1UNQA 2CY5A 2HTHB 4HATB 5LOPB 3LJUX 1K5DB 4K81A 2AEHA 2KGXB 4GMVA 3P6AA 4IFSA 2YT1A 3AU5A 4CHMA 1XR0B 3SYXA 4HB3B 1OQNA 1M7RA 5DH9B 1KZ7A 4NY0A 2YS5A 4TYZA 3QIJA 3FSSA 4A6KA 2LYDA 4A6FA 4YONA 2G35A 1NI2A 4GZUA 1AWEA 3MPXA 2AL6A 3D8FA 2M14A 1LW3A 3CIKA 1UNRA 3PP2A 1H4RA 2K00A 2RUKB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Y7B A;  3KSY A;  2GCJ A;  4WVF B;  4KHO A;  1ZC4 B;  1XCG A;  4Z2N A;  2DHJ A;  1UPR A;  2VRW B;  5HE0 A;  2K2J A;  2KUP A;  1RJ2 A;  1WG7 A;  2R09 A;  2HE7 A;  4ZRJ A;  5D3Y A;  2GJY A;  2DYQ A;  4F7U P;  2D4Q A;  1FHW A;  1FGZ A;  4HDQ A;  2D9Y A;  2EMT A;  4HHV A;  1DBH A;  3UZT A;  5C16 A;  1KZG A;  1W1H A;  3ODX A;  4HAV B;  1EGX A;  1OMW A;  1WVH A;  4MK0 A;  2Z0Q A;  3CXB B;  1FGY A;  2E2X A;  1V89 A;  2CAY A;  2EMS A;  3T06 A;  4GN1 A;  4HB4 B;  1W1G A;  2J59 M;  3AU4 A;  1PMS A;  4WSF A;  4KHB B;  2D9W A;  2UVM A;  3D8D A;  5C5B A;  2BCJ A;  2MDX A;  3N7C A;  5JHG A;  4L6E A;  3TFM A;  4WJ7 A;  2VSZ A;  1U27 A;  4HAU B;  3QWM A;  1U5F A;  1J0W A;  4ZRK A;  5JP4 A;  4K2O A;  3ZVR A;  3ULB A;  1XX0 A;  3KY9 A;  4KAX B;  1XKE A;  2J0J A;  5KQ1 A;  2W2X D;  4HAW B;  4Y94 A;  5D3W A;  4DBB A;  2KCJ A;  1QQG A;  1V61 A;  1XOD A;  4HAZ B;  3SNH A;  4D0N B;  2DX1 A;  2QKL A;  3DXC A;  1MK9 B;  1MKE A;  2COD A;  2YS3 A;  4HDO A;  5FI0 A;  2MWN B;  3HQC A;  1EAZ A;  3WA0 A;  2YRY A;  5C5B B;  2XQN M;  1XD4 A;  3KRX A;  3NSU A;  1EVH A;  1GG3 A;  4H8S A;  1U29 A;  4IAP A;  1ZC3 B;  3ULC A;  3O96 A;  4PQ0 A;  2YS1 A;  2EC1 A;  1ISN A;  2RVB B;  1P3R A;  5L81 A;  5JHH A;  4HAY B;  4EJN A;  4A5K A;  2Q13 A;  3FEH A;  2YT0 A;  2Z0O A;  3M1I B;  2DLW A;  2COA A;  3PEG A;  2CY4 A;  1FHO A;  1MK7 B;  1MIZ B;  2J0M A;  1UNP A;  1OY2 A;  4TKN A;  1X1F A;  1V88 A;  2N23 A;  1M7E A;  1E5W A;  1RRP B;  1SGH A;  2I1J A;  4NSW A;  3MDB C;  1P6S A;  3IVF A;  1V5P A;  1AQC A;  4HAX B;  2OQB A;  4HB2 B;  2DN6 A;  2P0F A;  5C6R A;  1N3H A;  3FM8 C;  4YL8 A;  3BIN A;  3F0W A;  4K17 A;  3KRW A;  2UZS A;  1B55 A;  2DKQ A;  2JP2 A;  1U5D A;  2I1K A;  2NZ8 B;  1BWN A;  2Y8G A;  3X23 A;  1U5E A;  3PG7 A;  4KVG B;  3RCP A;  1DRO A;  2RSG A;  2PZ1 A;  1PFJ A;  2OTX A;  2J0K A;  2YSZ A;  2ELB A;  2D9X A;  3GYP A;  5C79 A;  5DIF B;  5HE3 A;  2RNR B;  4KHA A;  4B6H A;  1ZVR A;  2DFK A;  5J3Q A;  2QKM A;  2H7E A;  5HE2 A;  5EFX A;  2Y8F A;  5KQ4 A;  2N0Y A;  2I5F A;  4Z2M B;  2LOX A;  1UPQ A;  2DX5 A;  4GPT B;  2I5C A;  5GOW B;  1PLS A;  3F5R A;  2Z0P A;  3D8E A;  2H7D A;  2IYB A;  4C0A A;  3KZ1 A;  5FI1 A;  1IRS A;  4A6F B;  1WI1 A;  1U5G A;  4CYE A;  4GMX B;  1FB8 A;  3V5W A;  4CHJ A;  3DXE A;  2R0D A;  1LB1 A;  1ZSQ A;  1MIX A;  3VIA A;  3DXD A;  4F7H A;  4DXA B;  1Z87 A;  1DDW A;  3A8Q A;  2GCL A;  2LOZ A;  2CRF A;  4HB0 B;  1BTN A;  4EKU A;  3SO6 A;  3ODW A;  4XWX A;  1KI1 B;  1WGQ A;  2GS0 A;  5KCV A;  2YVC A;  2D2Q A;  3ZDT A;  1V5M A;  2W2X C;  3A98 B;  1Y19 B;  3TO1 A;  2DHI A;  2ROV A;  1I2H A;  3PSC A;  1V5U A;  3HK0 A;  3HW2 B;  3SV1 A;  3GYO A;  5HE1 A;  1X05 A;  2DHK A;  1FOE A;  2P0H A;  2MKR A;  4BBK A;  1K5G B;  2LG1 A;  3PVU A;  5D27 A;  5D3V A;  5DI9 B;  2M38 A;  1TJ6 A;  5LON B;  3ML4 A;  1MPH A;  2ZPY A;  5JLJ B;  5DHA B;  4DX8 A;  3VOQ A;  4A6H A;  2COC A;  1H10 A;  1NTV A;  1MAI A;  3U7D A;  1DDV A;  3G9W A;  5CLL B;  1FAO A;  2D9Z A;  2LKO A;  2LUL A;  1BAK A;  2L1C A;  5DHF B;  5J3T A;  3WYF B;  5CLQ B;  4ZRI A;  1ZM0 A;  4IOY X;  2L2I A;  2ELA A;  1Q67 A;  2DYN A;  4MY6 A;  2DKP A;  1J19 A;  2NMB A;  3TVV A;  4EMO A;  1GC7 A;  5D3X A;  2K2U A;  1BTK A;  1DYN A;  2D11 A;  1WGU A;  1NU2 A;  2YF0 A;  1WJ1 A;  3TCA A;  2RLO A;  3AJ4 A;  3PVW A;  4F7G A;  1W1D A;  2P0D A;  3A8P A;  4DX9 0;  3TW1 A;  1U2B A;  1X1G A;  1DDM A;  1QC6 A;  1TQZ A;  1P5T A;  2ADZ A;  2X18 A;  2VKI A;  3PVL A;  1NTY A;  2UZR A;  4GXB A;  2MFQ A;  1I7A A;  1UEF A;  1EF1 A;  3U8Z A;  3QBV B;  1WJM A;  1X86 A;  4P7I A;  1FHX A;  2ROZ B;  1TXD A;  3PZD A;  5J3Y A;  1GC6 A;  1X11 A;  3P7Z A;  3ODO A;  3SUZ A;  2DA0 A;  1SHC A;  4PNK A;  2DTC A;  2COF A;  2FJL A;  2IFS A;  4K2P A;  1Y5O A;  2D9V A;  2EJ8 A;  2RGN B;  3OAN A;  2D10 A;  3BJI A;  2P8V A;  2V76 A;  4MT7 A;  2W2W A;  1UNQ A;  2CY5 A;  2HTH B;  4HAT B;  5LOP B;  3LJU X;  1K5D B;  4K81 A;  2AEH A;  2KGX B;  4GMV A;  3P6A A;  4IFS A;  2YT1 A;  3AU5 A;  4CHM A;  1XR0 B;  3SYX A;  4HB3 B;  1OQN A;  1M7R A;  5DH9 B;  1KZ7 A;  4NY0 A;  2YS5 A;  4TYZ A;  3QIJ A;  3FSS A;  4A6K A;  2LYD A;  4A6F A;  4YON A;  2G35 A;  1NI2 A;  4GZU A;  1AWE A;  3MPX A;  2AL6 A;  3D8F A;  2M14 A;  1LW3 A;  3CIK A;  1UNR A;  3PP2 A;  1H4R A;  2K00 A;  2RUK B; 
#chains in the Genus database with same CATH topology
 4QJ5 B;  2Y7B A;  3KSY A;  2KIG A;  2GCJ A;  4WVF B;  4KHO A;  1ZC4 B;  1XCG A;  4Z2N A;  2DHJ A;  1UPR A;  4QXA B;  2VRW B;  5HE0 A;  2K2J A;  2KUP A;  1RJ2 A;  1WG7 A;  2R09 A;  2HE7 A;  4ZRJ A;  2K49 A;  5D3Y A;  2GJY A;  2DYQ A;  4F7U P;  2D4Q A;  1FHW A;  1FGZ A;  4HDQ A;  2D9Y A;  2EMT A;  4HHV A;  1DBH A;  3UZT A;  5C16 A;  1KZG A;  1W1H A;  3ODX A;  4HAV B;  1EGX A;  3A58 A;  1OMW A;  1WVH A;  4MK0 A;  2Z0Q A;  3CXB B;  1FGY A;  2E2X A;  1V89 A;  1T77 A;  2CAY A;  2EMS A;  3T06 A;  4GN1 A;  4HB4 B;  1W1G A;  2J59 M;  3AU4 A;  1PMS A;  4WSF A;  4KHB B;  2D9W A;  2UVM A;  3D8D A;  3HIE A;  5C5B A;  2BCJ A;  2MDX A;  3N7C A;  5JHG A;  4L6E A;  3TFM A;  4WJ7 A;  2VSZ A;  1U27 A;  4HAU B;  3B77 A;  3QWM A;  1U5F A;  3NW8 A;  1J0W A;  4ZRK A;  5JP4 A;  4K2O A;  2KR0 A;  3ZVR A;  3ULB A;  4QJ4 B;  1XX0 A;  3KY9 A;  4KAX B;  1XKE A;  2J0J A;  5KQ1 A;  2W2X D;  4HAW B;  4Y94 A;  5D3W A;  4DBB A;  2Z14 A;  2KCJ A;  1QQG A;  1V61 A;  1XOD A;  4HAZ B;  3SNH A;  4D0N B;  2DX1 A;  2QKL A;  4OT1 A;  2K8E A;  2Z4D A;  3DXC A;  1MK9 B;  1MKE A;  2YT2 A;  2COD A;  2R2Y A;  2YS3 A;  4QJ3 B;  5M4Y B;  4HDO A;  5FI0 A;  2MWN B;  3HQC A;  1EAZ A;  3WA0 A;  2YRY A;  5C5B B;  2XQN M;  1XD4 A;  3KRX A;  3NSU A;  1EVH A;  1GG3 A;  2GUM A;  1U29 A;  4H8S A;  4IAP A;  1ZC3 B;  3ULC A;  3O96 A;  4PQ0 A;  2YS1 A;  2EC1 A;  1ISN A;  2RVB B;  1P3R A;  5L81 A;  5JHH A;  4HAY B;  4EJN A;  4A5K A;  2Q13 A;  3FEH A;  2YT0 A;  2Z0O A;  3M1I B;  2DLW A;  2COA A;  3PEG A;  2CY4 A;  1FHO A;  1MK7 B;  1MIZ B;  2J0M A;  1UNP A;  1OY2 A;  3OHM B;  4TKN A;  3NWD A;  1X1F A;  1V88 A;  2N23 A;  1M7E A;  1E5W A;  1RRP B;  3DCX A;  1SGH A;  4DIX A;  2I1J A;  4NSW A;  3MDB C;  1P6S A;  3IVF A;  1V5P A;  1AQC A;  4HAX B;  2OQB A;  3U12 A;  4HB2 B;  2DN6 A;  2P0F A;  5C6R A;  1N3H A;  3FM8 C;  4YL8 A;  3BIN A;  3F0W A;  4K17 A;  3KRW A;  2UZS A;  1B55 A;  2DKQ A;  2JP2 A;  1U5D A;  2I1K A;  2NZ8 B;  1BWN A;  2Y8G A;  3X23 A;  5IRS A;  1U5E A;  3PG7 A;  4KVG B;  3RCP A;  1DRO A;  2RSG A;  2PZ1 A;  1PFJ A;  2OTX A;  2J0K A;  2YSZ A;  2ELB A;  2D9X A;  1MI1 A;  3GYP A;  5C79 A;  5DIF B;  5HE3 A;  2RNR B;  4KHA A;  4B6H A;  1ZVR A;  2DFK A;  5J3Q A;  2QKM A;  2H7E A;  2KIE A;  5HE2 A;  5EFX A;  2Z13 A;  2Y8F A;  5KQ4 A;  2N0Y A;  2I5F A;  2RRF A;  4Z2M B;  4GNK B;  2LOX A;  1UPQ A;  2DX5 A;  4GPT B;  1ZYI A;  2I5C A;  5GOW B;  1PLS A;  3F5R A;  4CSQ A;  2Z0P A;  3D8E A;  2H7D A;  2IYB A;  4C0A A;  3KZ1 A;  5FI1 A;  2FJU B;  1IRS A;  4A6F B;  1WI1 A;  1U5G A;  4CYE A;  4GMX B;  1FB8 A;  3V5W A;  4CHJ A;  3DXE A;  5LG4 B;  2R0D A;  1LB1 A;  1ZSQ A;  1MIX A;  3VIA A;  3DXD A;  4F7H A;  4DXA B;  1Z87 A;  1DDW A;  3A8Q A;  2GCL A;  2LOZ A;  2CRF A;  4HB0 B;  1BTN A;  4EKU A;  3SO6 A;  3ODW A;  4XWX A;  1KI1 B;  1WGQ A;  2GS0 A;  4HSI A;  5KCV A;  2YVC A;  2D2Q A;  3ZDT A;  1V5M A;  2W2X C;  3A98 B;  1Y19 B;  2NBV A;  5I2S A;  3TO1 A;  2DHI A;  2ROV A;  1I2H A;  3PSC A;  1V5U A;  3HK0 A;  3HW2 B;  3SV1 A;  3GYO A;  5HE1 A;  1X05 A;  2DHK A;  1FOE A;  2P0H A;  2MKR A;  4D6W A;  4BBK A;  1K5G B;  2LG1 A;  3PVU A;  5D27 A;  5D3V A;  5DI9 B;  2M38 A;  1TJ6 A;  5LON B;  3ML4 A;  1MPH A;  2ZPY A;  5JLJ B;  5DHA B;  4DX8 A;  3VOQ A;  4A6H A;  2COC A;  1H10 A;  1NTV A;  1MAI A;  3U7D A;  4L1R A;  1DDV A;  3G9W A;  5CLL B;  1FAO A;  2Z59 A;  2D9Z A;  2LKO A;  2LUL A;  1BAK A;  2L1C A;  5DHF B;  5J3T A;  3WYF B;  5CLQ B;  3NWF A;  4ZRI A;  1ZM0 A;  4IOY X;  2L2I A;  2ELA A;  1Q67 A;  2DYN A;  4MY6 A;  2DKP A;  1J19 A;  2NMB A;  3TVV A;  4EMO A;  1GC7 A;  5D3X A;  2K2U A;  1BTK A;  1DYN A;  2D11 A;  1WGU A;  1NU2 A;  2YF0 A;  1WJ1 A;  3TCA A;  2RLO A;  3AJ4 A;  3PVW A;  3NWA A;  4F7G A;  1W1D A;  2P0D A;  3A8P A;  4DX9 0;  3TW1 A;  1U2B A;  1X1G A;  1DDM A;  1QC6 A;  1TQZ A;  1P5T A;  2ADZ A;  4OSN A;  2X18 A;  2VKI A;  3PVL A;  1NTY A;  2UZR A;  4GXB A;  2MFQ A;  1I7A A;  1UEF A;  1EF1 A;  3U8Z A;  4KHB A;  3QBV B;  1WJM A;  1X86 A;  4P7I A;  1FHX A;  2ROZ B;  1TXD A;  3PZD A;  5J3Y A;  1GC6 A;  1X11 A;  3P7Z A;  3ODO A;  3SUZ A;  2DA0 A;  1SHC A;  4PNK A;  2DTC A;  2COF A;  2FJL A;  2IFS A;  4K2P A;  1Y5O A;  2D9V A;  2EJ8 A;  2RGN B;  3OAN A;  2D10 A;  3BJI A;  2P8V A;  2V76 A;  4MT7 A;  2W2W A;  1UNQ A;  2CY5 A;  2HTH B;  3HSA A;  4HAT B;  5LOP B;  3LJU X;  1K5D B;  4GOU A;  4K81 A;  2AEH A;  2KGX B;  4GMV A;  3FVC A;  3P6A A;  4IFS A;  2YT1 A;  3AU5 A;  4CHM A;  1XR0 B;  3SYX A;  4HB3 B;  1OQN A;  1M7R A;  5DH9 B;  1KZ7 A;  4NY0 A;  2YS5 A;  4TYZ A;  3QIJ A;  3FSS A;  4A6K A;  2LYD A;  4A6F A;  4YON A;  2G35 A;  1NI2 A;  2KUQ A;  4GZU A;  1AWE A;  3MPX A;  2AL6 A;  3D8F A;  2M14 A;  1LW3 A;  3CIK A;  1UNR A;  3PP2 A;  1H4R A;  5I2M A;  2K00 A;  2RUK B;  2ZKM X; 
#chains in the Genus database with same CATH homology
 2Y7B A;  3KSY A;  2GCJ A;  4WVF B;  4KHO A;  1ZC4 B;  1XCG A;  4Z2N A;  2DHJ A;  1UPR A;  2VRW B;  5HE0 A;  2K2J A;  2KUP A;  1RJ2 A;  1WG7 A;  2R09 A;  2HE7 A;  4ZRJ A;  5D3Y A;  2GJY A;  2DYQ A;  4F7U P;  2D4Q A;  1FHW A;  1FGZ A;  4HDQ A;  2D9Y A;  2EMT A;  4HHV A;  1DBH A;  3UZT A;  5C16 A;  1KZG A;  1W1H A;  3ODX A;  4HAV B;  1EGX A;  1OMW A;  1WVH A;  4MK0 A;  2Z0Q A;  3CXB B;  1FGY A;  2E2X A;  1V89 A;  2CAY A;  2EMS A;  3T06 A;  4GN1 A;  4HB4 B;  1W1G A;  2J59 M;  3AU4 A;  1PMS A;  4WSF A;  4KHB B;  2D9W A;  2UVM A;  3D8D A;  5C5B A;  2BCJ A;  2MDX A;  3N7C A;  5JHG A;  4L6E A;  3TFM A;  4WJ7 A;  2VSZ A;  1U27 A;  4HAU B;  3QWM A;  1U5F A;  1J0W A;  4ZRK A;  5JP4 A;  4K2O A;  3ZVR A;  3ULB A;  1XX0 A;  3KY9 A;  4KAX B;  1XKE A;  2J0J A;  5KQ1 A;  2W2X D;  4HAW B;  4Y94 A;  5D3W A;  4DBB A;  2KCJ A;  1QQG A;  1V61 A;  1XOD A;  4HAZ B;  3SNH A;  4D0N B;  2DX1 A;  2QKL A;  3DXC A;  1MK9 B;  1MKE A;  2COD A;  2YS3 A;  4HDO A;  5FI0 A;  2MWN B;  3HQC A;  1EAZ A;  3WA0 A;  2YRY A;  5C5B B;  2XQN M;  1XD4 A;  3KRX A;  3NSU A;  1EVH A;  1GG3 A;  4H8S A;  1U29 A;  4IAP A;  1ZC3 B;  3ULC A;  3O96 A;  4PQ0 A;  2YS1 A;  2EC1 A;  1ISN A;  2RVB B;  1P3R A;  5L81 A;  5JHH A;  4HAY B;  4EJN A;  4A5K A;  2Q13 A;  3FEH A;  2YT0 A;  2Z0O A;  3M1I B;  2DLW A;  2COA A;  3PEG A;  2CY4 A;  1FHO A;  1MK7 B;  1MIZ B;  2J0M A;  1UNP A;  1OY2 A;  4TKN A;  1X1F A;  1V88 A;  2N23 A;  1M7E A;  1E5W A;  1RRP B;  1SGH A;  2I1J A;  4NSW A;  3MDB C;  1P6S A;  3IVF A;  1V5P A;  1AQC A;  4HAX B;  2OQB A;  4HB2 B;  2DN6 A;  2P0F A;  5C6R A;  1N3H A;  3FM8 C;  4YL8 A;  3BIN A;  3F0W A;  4K17 A;  3KRW A;  2UZS A;  1B55 A;  2DKQ A;  2JP2 A;  1U5D A;  2I1K A;  2NZ8 B;  1BWN A;  2Y8G A;  3X23 A;  1U5E A;  3PG7 A;  4KVG B;  3RCP A;  1DRO A;  2RSG A;  2PZ1 A;  1PFJ A;  2OTX A;  2J0K A;  2YSZ A;  2ELB A;  2D9X A;  3GYP A;  5C79 A;  5DIF B;  5HE3 A;  2RNR B;  4KHA A;  4B6H A;  1ZVR A;  2DFK A;  5J3Q A;  2QKM A;  2H7E A;  5HE2 A;  5EFX A;  2Y8F A;  5KQ4 A;  2N0Y A;  2I5F A;  4Z2M B;  2LOX A;  1UPQ A;  2DX5 A;  4GPT B;  2I5C A;  5GOW B;  1PLS A;  3F5R A;  2Z0P A;  3D8E A;  2H7D A;  2IYB A;  4C0A A;  3KZ1 A;  5FI1 A;  1IRS A;  4A6F B;  1WI1 A;  1U5G A;  4CYE A;  4GMX B;  1FB8 A;  3V5W A;  4CHJ A;  3DXE A;  2R0D A;  1LB1 A;  1ZSQ A;  1MIX A;  3VIA A;  3DXD A;  4F7H A;  4DXA B;  1Z87 A;  1DDW A;  3A8Q A;  2GCL A;  2LOZ A;  2CRF A;  4HB0 B;  1BTN A;  4EKU A;  3SO6 A;  3ODW A;  4XWX A;  1KI1 B;  1WGQ A;  2GS0 A;  5KCV A;  2YVC A;  2D2Q A;  3ZDT A;  1V5M A;  2W2X C;  3A98 B;  1Y19 B;  3TO1 A;  2DHI A;  2ROV A;  1I2H A;  3PSC A;  1V5U A;  3HK0 A;  3HW2 B;  3SV1 A;  3GYO A;  5HE1 A;  1X05 A;  2DHK A;  1FOE A;  2P0H A;  2MKR A;  4BBK A;  1K5G B;  2LG1 A;  3PVU A;  5D27 A;  5D3V A;  5DI9 B;  2M38 A;  1TJ6 A;  5LON B;  3ML4 A;  1MPH A;  2ZPY A;  5JLJ B;  5DHA B;  4DX8 A;  3VOQ A;  4A6H A;  2COC A;  1H10 A;  1NTV A;  1MAI A;  3U7D A;  1DDV A;  3G9W A;  5CLL B;  1FAO A;  2D9Z A;  2LKO A;  2LUL A;  1BAK A;  2L1C A;  5DHF B;  5J3T A;  3WYF B;  5CLQ B;  4ZRI A;  1ZM0 A;  4IOY X;  2L2I A;  2ELA A;  1Q67 A;  2DYN A;  4MY6 A;  2DKP A;  1J19 A;  2NMB A;  3TVV A;  4EMO A;  1GC7 A;  5D3X A;  2K2U A;  1BTK A;  1DYN A;  2D11 A;  1WGU A;  1NU2 A;  2YF0 A;  1WJ1 A;  3TCA A;  2RLO A;  3AJ4 A;  3PVW A;  4F7G A;  1W1D A;  2P0D A;  3A8P A;  4DX9 0;  3TW1 A;  1U2B A;  1X1G A;  1DDM A;  1QC6 A;  1TQZ A;  1P5T A;  2ADZ A;  2X18 A;  2VKI A;  3PVL A;  1NTY A;  2UZR A;  4GXB A;  2MFQ A;  1I7A A;  1UEF A;  1EF1 A;  3U8Z A;  3QBV B;  1WJM A;  1X86 A;  4P7I A;  1FHX A;  2ROZ B;  1TXD A;  3PZD A;  5J3Y A;  1GC6 A;  1X11 A;  3P7Z A;  3ODO A;  3SUZ A;  2DA0 A;  1SHC A;  4PNK A;  2DTC A;  2COF A;  2FJL A;  2IFS A;  4K2P A;  1Y5O A;  2D9V A;  2EJ8 A;  2RGN B;  3OAN A;  2D10 A;  3BJI A;  2P8V A;  2V76 A;  4MT7 A;  2W2W A;  1UNQ A;  2CY5 A;  2HTH B;  4HAT B;  5LOP B;  3LJU X;  1K5D B;  4K81 A;  2AEH A;  2KGX B;  4GMV A;  3P6A A;  4IFS A;  2YT1 A;  3AU5 A;  4CHM A;  1XR0 B;  3SYX A;  4HB3 B;  1OQN A;  1M7R A;  5DH9 B;  1KZ7 A;  4NY0 A;  2YS5 A;  4TYZ A;  3QIJ A;  3FSS A;  4A6K A;  2LYD A;  4A6F A;  4YON A;  2G35 A;  1NI2 A;  4GZU A;  1AWE A;  3MPX A;  2AL6 A;  3D8F A;  2M14 A;  1LW3 A;  3CIK A;  1UNR A;  3PP2 A;  1H4R A;  2K00 A;  2RUK B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...