2RUKB

Solution structure of the complex between p53 transactivation domain 2 and tfiih p62 ph domain
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
108
structure length
108
Chain Sequence
b'MATSSEEVLLIVKKVRQKKQDGALYLMAERIAWAPEGKDRFTISHMYADIKCQKISPEGKAKIQLQLVLHAGDTTNFHFSNESTAVKERDAVKDLLQQLLPKFKRKAN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cellular tumor antigen p53
publication title Extended String Binding Mode of the Phosphorylated Transactivation Domain of Tumor Suppressor p53
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 26
structure length 108
sequence length 108
ec nomenclature
pdb deposition date 2014-09-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF08567 PH_TFIIH TFIIH p62 subunit, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2rukB00
4HB0B 3UZTA 2DTCA 4Z2MB 3HK0A 1Y19B 1UPRA 4HB2B 4A5KA 4HDQA 1TJ6A 2DYQA 2YT0A 3P6AA 1P6SA 4TYZA 2GJYA 1B55A 4DX8A 1ZSQA 4HHVA 1DYNA 1SGHA 3D8DA 2DX5A 3KSYA 1FGZA 4KVGB 5FI0A 1Y5OA 4K2PA 1UEFA 1U5DA 3AU5A 1U5FA 2YRYA 3QBVB 1ZC3B 1XR0B 1EF1A 1AWEA 1IRSA 1ZC4B 1XD4A 3TW1A 1FAOA 3NSUA 2I5FA 3PSCA 1MIXA 4A6FA 2AL6A 4DXAB 2XQNM 4MY6A 4ZRJA 2R09A 5FI1A 1FGYA 2YSZA 5HE3A 5J3QA 2OTXA 2D9WA 2LULA 4C0AA 2LOZA 1W1DA 4D0NB 1K5DB 1RJ2A 2ELAA 2LKOA 2ROZB 2YVCA 4KHOA 5JHGA 1MPHA 4KAXB 3ULCA 2DN6A 1FHWA 5J3TA 1P5TA 4DX90 2DLWA 4GXBA 5HE2A 1DDMA 2DKPA 5C5BB 1V61A 3A8PA 2Y7BA 2P0DA 2W2XD 5C16A 5DIFB 3D8EA 2CRFA 1EAZA 3TCAA 1X86A 1I7AA 2D10A 4NY0A 2NZ8B 2LOXA 5D3XA 1U5GA 3PP2A 2J0MA 2DX1A 2RSGA 2N0YA 3QIJA 4A6HA 2DHJA 2COAA 2QKLA 2MKRA 1DDWA 3TFMA 3SO6A 2I1KA 1V89A 2H7EA 1V5PA 2DHKA 4DBBA 3KY9A 3PVWA 3SNHA 2E2XA 2I1JA 2P8VA 1DROA 2IYBA 2KUPA 3HW2B 3MDBC 1GC7A 1I2HA 3ODOA 2NMBA 5DHFB 1J0WA 4GN1A 3WYFB 2GCJA 4ZRIA 1NI2A 2K00A 2MDXA 2N23A 3AU4A 2COCA 1XKEA 3FM8C 1XODA 1TXDA 2L2IA 1KZGA 4WSFA 3SV1A 4F7GA 2YS1A 4WVFB 2RUKB 1RRPB 2YS3A 2GCLA 3T06A 1H4RA 2J0JA 1AQCA 2P0HA 4HAZB 1H10A 1Z87A 1EGXA 4B6HA 5KQ1A 2VRWB 1MK9B 4XWXA 2D9VA 4Z2NA 3KRXA 4YONA 3P7ZA 2I5CA 2MWNB 2RGNB 2D11A 1LW3A 1J19A 1KI1B 2ADZA 1P3RA 3DXCA 4ZRKA 1GG3A 1FHOA 1EVHA 3DXEA 1MK7B 2H7DA 2IFSA 3BINA 4HAXB 5HE1A 2KCJA 3GYPA 1BTKA 4GMVA 4CHJA 3ODWA 1X11A 1LB1A 2M14A 2CY5A 3PVUA 1W1HA 2HTHB 2DFKA 3SYXA 4NSWA 3WA0A 2VKIA 1OY2A 4PNKA 4MT7A 3ULBA 4L6EA 3RCPA 3PEGA 2AEHA 2D9YA 3IVFA 5KQ4A 3MPXA 1V88A 2K2JA 4HDOA 4F7UP 3ZDTA 2UVMA 3SUZA 4A6FB 4CHMA 2YF0A 2Z0OA 2EC1A 4HAVB 3F0WA 1FOEA 2X18A 5D3YA 2D9XA 2J0KA 2UZRA 1NTVA 3V5WA 1BWNA 3TVVA 2DHIA 2RVBB 3BJIA 1E5WA 1PMSA 1MKEA 1WG7A 3CIKA 3U8ZA 1WJMA 3AJ4A 1MIZB 1U29A 1XCGA 2D4QA 1M7RA 3DXDA 4HATB 2M38A 4K17A 4TKNA 3A98B 5GOWB 2R0DA 5L81A 4KHBB 4WJ7A 2W2XC 1FHXA 2RNRB 3PVLA 5LONB 3VOQA 2QKMA 3G9WA 1X1GA 4GZUA 1BTNA 4EJNA 1X1FA 3HQCA 3N7CA 2D2QA 5JP4A 4MK0A 1MAIA 1N3HA 4GPTB 5CLQB 1K5GB 2W2WA 4H8SA 1ISNA 1V5UA 1UPQA 1DDVA 4IOYX 3VIAA 4YL8A 2Z0QA 4HB4B 2EMTA 5JHHA 2PZ1A 1TQZA 1KZ7A 2GS0A 2J59M 2JP2A 2Y8GA 1U2BA 5D3VA 4K2OA 1BAKA 2G35A 4P7IA 2Y8FA 1X05A 1DBHA 5D3WA 3ZVRA 3O96A 3F5RA 1W1GA 2P0FA 5CLLB 3U7DA 1V5MA 1UNPA 5C5BA 5LOPB 1OMWA 1ZVRA 5DH9B 4IFSA 5JLJB 3KZ1A 3FSSA 2CODA 3X23A 2COFA 4HAWB 5D27A 5C79A 1QC6A 2UZSA 2EMSA 1GC6A 1NTYA 2V76A 1PFJA 2FJLA 1QQGA 2DYNA 2ROVA 1WGUA 1M7EA 2LYDA 3KRWA 3D8FA 1U27A 2D9ZA 5DHAB 4EMOA 4K81A 2CY4A 3M1IB 2CAYA 5HE0A 2LG1A 1UNRA 1WGQA 4A6KA 1OQNA 4GMXB 2K2UA 2OQBA 2Z0PA 3FEHA 2KGXB 3QWMA 2DA0A 1FB8A 4IAPA 1PLSA 1WJ1A 1XX0A 2ZPYA 5KCVA 4BBKA 1WVHA 4HB3B 2RLOA 3ODXA 2YT1A 2EJ8A 2ELBA 1Q67A 3PZDA 4F7HA 2Q13A 5C6RA 3TO1A 3LJUX 2YS5A 3A8QA 2VSZA 2L1CA 3PG7A 1SHCA 2DKQA 4Y94A 4KHAA 1ZM0A 3ML4A 4PQ0A 4HAUB 2BCJA 5DI9B 5EFXA 1UNQA 2MFQA 3OANA 2HE7A 3GYOA 4HAYB 1U5EA 4EKUA 1NU2A 3CXBB 4CYEA 5J3YA 1WI1A
chains in the Genus database with same CATH superfamily
4HB0B 3UZTA 2DTCA 4Z2MB 3HK0A 1Y19B 1UPRA 4HB2B 4A5KA 4HDQA 1TJ6A 2DYQA 2YT0A 3P6AA 1P6SA 4TYZA 4GNKB 2GJYA 1B55A 4DX8A 1ZSQA 4HHVA 3NWFA 1DYNA 2KUQA 1SGHA 3D8DA 2DX5A 3KSYA 4HSIA 1FGZA 2R2YA 4KVGB 5FI0A 1Y5OA 4K2PA 1UEFA 1U5DA 3AU5A 1U5FA 2YRYA 3QBVB 1ZC3B 1XR0B 1EF1A 1AWEA 4QJ4B 1IRSA 1ZC4B 1XD4A 3TW1A 1FAOA 3NSUA 2I5FA 3PSCA 1MIXA 4A6FA 2AL6A 4DXAB 2XQNM 4MY6A 3HIEA 4ZRJA 2R09A 5FI1A 1FGYA 2YSZA 5HE3A 5J3QA 2OTXA 2D9WA 2LULA 4C0AA 2LOZA 1W1DA 4D0NB 1K5DB 1RJ2A 2ELAA 2LKOA 2ROZB 2YVCA 4KHOA 5JHGA 1MPHA 4KAXB 3ULCA 2DN6A 1FHWA 5J3TA 1P5TA 4DX90 5M4YB 2DLWA 4GXBA 5HE2A 1DDMA 2DKPA 5C5BB 1V61A 3A8PA 2Y7BA 2P0DA 2W2XD 5C16A 5DIFB 5I2SA 4QXAB 4OSNA 3D8EA 2ZKMX 2CRFA 1EAZA 3TCAA 1T77A 1X86A 1I7AA 2D10A 4NY0A 2NZ8B 2LOXA 5D3XA 1U5GA 2J0MA 2DX1A 2RSGA 3PP2A 2N0YA 3QIJA 4A6HA 2DHJA 2COAA 2QKLA 2MKRA 1DDWA 3TFMA 3SO6A 2I1KA 1V89A 2H7EA 1V5PA 2DHKA 2KR0A 4DBBA 3KY9A 3PVWA 3SNHA 3OHMB 2E2XA 2I1JA 2P8VA 5IRSA 1DROA 2IYBA 2YT2A 2Z59A 2KUPA 3HW2B 2KIEA 3MDBC 1GC7A 1I2HA 4QJ3B 3ODOA 2NMBA 5DHFB 1J0WA 4GN1A 3WYFB 2GCJA 4ZRIA 1NI2A 2K00A 2MDXA 2N23A 3AU4A 2COCA 4OT1A 1XKEA 3FM8C 1XODA 1ZYIA 1TXDA 2L2IA 1KZGA 4WSFA 3SV1A 4F7GA 2YS1A 2GUMA 4WVFB 2RUKB 1RRPB 2YS3A 4GOUA 2GCLA 3T06A 4D6WA 1H4RA 2J0JA 1AQCA 2P0HA 4HAZB 1H10A 1Z87A 1EGXA 4B6HA 5KQ1A 2VRWB 1MK9B 4XWXA 2D9VA 4Z2NA 3KRXA 4YONA 3P7ZA 2I5CA 3NW8A 2MWNB 2RGNB 2D11A 1LW3A 1J19A 1KI1B 2ADZA 1P3RA 3DXCA 4ZRKA 1GG3A 1FHOA 1EVHA 2RRFA 3DXEA 1MK7B 2H7DA 2IFSA 3BINA 4HAXB 5HE1A 2KCJA 3GYPA 1BTKA 2KIGA 4GMVA 4CHJA 3ODWA 1X11A 1LB1A 2M14A 2CY5A 3PVUA 1W1HA 2HTHB 2DFKA 3SYXA 4NSWA 3WA0A 2VKIA 1OY2A 4KHBA 4PNKA 4MT7A 3ULBA 4L6EA 3RCPA 3PEGA 2AEHA 2D9YA 3IVFA 5KQ4A 3MPXA 1V88A 2K2JA 4HDOA 4F7UP 3ZDTA 2UVMA 3SUZA 5LG4B 4A6FB 4CHMA 2YF0A 2Z0OA 2EC1A 4HAVB 3F0WA 1FOEA 2X18A 5D3YA 2D9XA 2J0KA 2UZRA 1NTVA 3V5WA 1BWNA 3TVVA 2DHIA 2RVBB 3NWDA 3BJIA 1E5WA 1PMSA 1MKEA 1WG7A 3CIKA 3HSAA 3U8ZA 1WJMA 3AJ4A 1MIZB 1U29A 1XCGA 2D4QA 1M7RA 3DXDA 4HATB 2M38A 4K17A 4TKNA 3A98B 5GOWB 2R0DA 5L81A 4KHBB 4WJ7A 2W2XC 1FHXA 2RNRB 3PVLA 5LONB 3VOQA 2QKMA 3G9WA 1X1GA 3B77A 4GZUA 1BTNA 4EJNA 1X1FA 3HQCA 2K49A 5I2MA 3N7CA 2D2QA 5JP4A 4MK0A 1MAIA 1N3HA 4GPTB 5CLQB 1K5GB 2W2WA 4H8SA 1ISNA 1V5UA 1UPQA 1DDVA 4IOYX 3VIAA 2Z13A 4YL8A 2Z0QA 4HB4B 3DCXA 2EMTA 3U12A 5JHHA 2PZ1A 1TQZA 1KZ7A 2GS0A 2J59M 2JP2A 2Y8GA 1U2BA 4DIXA 5D3VA 4K2OA 1BAKA 2G35A 4P7IA 2Y8FA 1X05A 1DBHA 5D3WA 3ZVRA 3O96A 3F5RA 1W1GA 2P0FA 5CLLB 2K8EA 3U7DA 1V5MA 1UNPA 5C5BA 5LOPB 1OMWA 1ZVRA 5DH9B 4IFSA 5JLJB 4QJ5B 2Z14A 3KZ1A 3FSSA 2CODA 3X23A 2COFA 4HAWB 5D27A 5C79A 1QC6A 2Z4DA 2UZSA 2EMSA 1GC6A 1NTYA 2V76A 1PFJA 2FJLA 1QQGA 2DYNA 2ROVA 1WGUA 1M7EA 3FVCA 2LYDA 3KRWA 3D8FA 1U27A 2D9ZA 5DHAB 4EMOA 4K81A 2CY4A 3M1IB 2CAYA 5HE0A 2LG1A 1UNRA 1WGQA 3NWAA 4A6KA 1OQNA 4GMXB 2K2UA 3A58A 2OQBA 2Z0PA 3FEHA 2KGXB 3QWMA 2DA0A 4L1RA 1FB8A 4IAPA 4CSQA 1PLSA 1WJ1A 1XX0A 2ZPYA 5KCVA 1MI1A 4BBKA 1WVHA 4HB3B 2RLOA 3ODXA 2YT1A 2EJ8A 2ELBA 1Q67A 3PZDA 4F7HA 2Q13A 5C6RA 3TO1A 3LJUX 2YS5A 3A8QA 2VSZA 2L1CA 3PG7A 1SHCA 2DKQA 4Y94A 4KHAA 1ZM0A 2NBVA 3ML4A 4PQ0A 4HAUB 2BCJA 5DI9B 5EFXA 1UNQA 2MFQA 3OANA 2HE7A 3GYOA 4HAYB 1U5EA 4EKUA 1NU2A 3CXBB 4CYEA 2FJUB 1WI1A 5J3YA
chains in the Genus database with same CATH topology
4HB0B 3UZTA 2DTCA 4Z2MB 3HK0A 1Y19B 1UPRA 4HB2B 4A5KA 4HDQA 1TJ6A 2DYQA 2YT0A 3P6AA 1P6SA 4TYZA 2GJYA 1B55A 4DX8A 1ZSQA 4HHVA 1DYNA 1SGHA 3D8DA 2DX5A 3KSYA 1FGZA 4KVGB 5FI0A 1Y5OA 4K2PA 1UEFA 1U5DA 3AU5A 1U5FA 2YRYA 3QBVB 1ZC3B 1XR0B 1EF1A 1AWEA 1IRSA 1ZC4B 1XD4A 3TW1A 1FAOA 3NSUA 2I5FA 3PSCA 1MIXA 4A6FA 2AL6A 4DXAB 2XQNM 4MY6A 4ZRJA 2R09A 5FI1A 1FGYA 2YSZA 5HE3A 5J3QA 2OTXA 2D9WA 2LULA 4C0AA 2LOZA 1W1DA 4D0NB 1K5DB 1RJ2A 2ELAA 2LKOA 2ROZB 2YVCA 4KHOA 5JHGA 1MPHA 4KAXB 3ULCA 2DN6A 1FHWA 5J3TA 1P5TA 4DX90 2DLWA 4GXBA 5HE2A 1DDMA 2DKPA 5C5BB 1V61A 3A8PA 2Y7BA 2P0DA 2W2XD 5C16A 5DIFB 3D8EA 2CRFA 1EAZA 3TCAA 1X86A 1I7AA 2D10A 4NY0A 2NZ8B 2LOXA 5D3XA 1U5GA 3PP2A 2J0MA 2DX1A 2RSGA 2N0YA 3QIJA 4A6HA 2DHJA 2COAA 2QKLA 2MKRA 1DDWA 3TFMA 3SO6A 2I1KA 1V89A 2H7EA 1V5PA 2DHKA 4DBBA 3KY9A 3PVWA 3SNHA 2E2XA 2I1JA 2P8VA 1DROA 2IYBA 2KUPA 3HW2B 3MDBC 1GC7A 1I2HA 3ODOA 2NMBA 5DHFB 1J0WA 4GN1A 3WYFB 2GCJA 4ZRIA 1NI2A 2K00A 2MDXA 2N23A 3AU4A 2COCA 1XKEA 3FM8C 1XODA 1TXDA 2L2IA 1KZGA 4WSFA 3SV1A 4F7GA 2YS1A 4WVFB 2RUKB 1RRPB 2YS3A 2GCLA 3T06A 1H4RA 2J0JA 1AQCA 2P0HA 4HAZB 1H10A 1Z87A 1EGXA 4B6HA 5KQ1A 2VRWB 1MK9B 4XWXA 2D9VA 4Z2NA 3KRXA 4YONA 3P7ZA 2I5CA 2MWNB 2RGNB 2D11A 1LW3A 1J19A 1KI1B 2ADZA 1P3RA 3DXCA 4ZRKA 1GG3A 1FHOA 1EVHA 3DXEA 1MK7B 2H7DA 2IFSA 3BINA 4HAXB 5HE1A 2KCJA 3GYPA 1BTKA 4GMVA 4CHJA 3ODWA 1X11A 1LB1A 2M14A 2CY5A 3PVUA 1W1HA 2HTHB 2DFKA 3SYXA 4NSWA 3WA0A 2VKIA 1OY2A 4PNKA 4MT7A 3ULBA 4L6EA 3RCPA 3PEGA 2AEHA 2D9YA 3IVFA 5KQ4A 3MPXA 1V88A 2K2JA 4HDOA 4F7UP 3ZDTA 2UVMA 3SUZA 4A6FB 4CHMA 2YF0A 2Z0OA 2EC1A 4HAVB 3F0WA 1FOEA 2X18A 5D3YA 2D9XA 2J0KA 2UZRA 1NTVA 3V5WA 1BWNA 3TVVA 2DHIA 2RVBB 3BJIA 1E5WA 1PMSA 1MKEA 1WG7A 3CIKA 3U8ZA 1WJMA 3AJ4A 1MIZB 1U29A 1XCGA 2D4QA 1M7RA 3DXDA 4HATB 2M38A 4K17A 4TKNA 3A98B 5GOWB 2R0DA 5L81A 4KHBB 4WJ7A 2W2XC 1FHXA 2RNRB 3PVLA 5LONB 3VOQA 2QKMA 3G9WA 1X1GA 4GZUA 1BTNA 4EJNA 1X1FA 3HQCA 3N7CA 2D2QA 5JP4A 4MK0A 1MAIA 1N3HA 4GPTB 5CLQB 1K5GB 2W2WA 4H8SA 1ISNA 1V5UA 1UPQA 1DDVA 4IOYX 3VIAA 4YL8A 2Z0QA 4HB4B 2EMTA 5JHHA 2PZ1A 1TQZA 1KZ7A 2GS0A 2J59M 2JP2A 2Y8GA 1U2BA 5D3VA 4K2OA 1BAKA 2G35A 4P7IA 2Y8FA 1X05A 1DBHA 5D3WA 3ZVRA 3O96A 3F5RA 1W1GA 2P0FA 5CLLB 3U7DA 1V5MA 1UNPA 5C5BA 5LOPB 1OMWA 1ZVRA 5DH9B 4IFSA 5JLJB 3KZ1A 3FSSA 2CODA 3X23A 2COFA 4HAWB 5D27A 5C79A 1QC6A 2UZSA 2EMSA 1GC6A 1NTYA 2V76A 1PFJA 2FJLA 1QQGA 2DYNA 2ROVA 1WGUA 1M7EA 2LYDA 3KRWA 3D8FA 1U27A 2D9ZA 5DHAB 4EMOA 4K81A 2CY4A 3M1IB 2CAYA 5HE0A 2LG1A 1UNRA 1WGQA 4A6KA 1OQNA 4GMXB 2K2UA 2OQBA 2Z0PA 3FEHA 2KGXB 3QWMA 2DA0A 1FB8A 4IAPA 1PLSA 1WJ1A 1XX0A 2ZPYA 5KCVA 4BBKA 1WVHA 4HB3B 2RLOA 3ODXA 2YT1A 2EJ8A 2ELBA 1Q67A 3PZDA 4F7HA 2Q13A 5C6RA 3TO1A 3LJUX 2YS5A 3A8QA 2VSZA 2L1CA 3PG7A 1SHCA 2DKQA 4Y94A 4KHAA 1ZM0A 3ML4A 4PQ0A 4HAUB 2BCJA 5DI9B 5EFXA 1UNQA 2MFQA 3OANA 2HE7A 3GYOA 4HAYB 1U5EA 4EKUA 1NU2A 3CXBB 4CYEA 5J3YA 1WI1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HB0 B;  3UZT A;  2DTC A;  4Z2M B;  3HK0 A;  1Y19 B;  1UPR A;  4HB2 B;  4A5K A;  4HDQ A;  1TJ6 A;  2DYQ A;  2YT0 A;  3P6A A;  1P6S A;  4TYZ A;  2GJY A;  1B55 A;  4DX8 A;  1ZSQ A;  4HHV A;  1DYN A;  1SGH A;  3D8D A;  2DX5 A;  3KSY A;  1FGZ A;  4KVG B;  5FI0 A;  1Y5O A;  4K2P A;  1UEF A;  1U5D A;  3AU5 A;  1U5F A;  2YRY A;  3QBV B;  1ZC3 B;  1XR0 B;  1EF1 A;  1AWE A;  1IRS A;  1ZC4 B;  1XD4 A;  3TW1 A;  1FAO A;  3NSU A;  2I5F A;  3PSC A;  1MIX A;  4A6F A;  2AL6 A;  4DXA B;  2XQN M;  4MY6 A;  4ZRJ A;  2R09 A;  5FI1 A;  1FGY A;  2YSZ A;  5HE3 A;  5J3Q A;  2OTX A;  2D9W A;  2LUL A;  4C0A A;  2LOZ A;  1W1D A;  4D0N B;  1K5D B;  1RJ2 A;  2ELA A;  2LKO A;  2ROZ B;  2YVC A;  4KHO A;  5JHG A;  1MPH A;  4KAX B;  3ULC A;  2DN6 A;  1FHW A;  5J3T A;  1P5T A;  4DX9 0;  2DLW A;  4GXB A;  5HE2 A;  1DDM A;  2DKP A;  5C5B B;  1V61 A;  3A8P A;  2Y7B A;  2P0D A;  2W2X D;  5C16 A;  5DIF B;  3D8E A;  2CRF A;  1EAZ A;  3TCA A;  1X86 A;  1I7A A;  2D10 A;  4NY0 A;  2NZ8 B;  2LOX A;  5D3X A;  1U5G A;  3PP2 A;  2J0M A;  2DX1 A;  2RSG A;  2N0Y A;  3QIJ A;  4A6H A;  2DHJ A;  2COA A;  2QKL A;  2MKR A;  1DDW A;  3TFM A;  3SO6 A;  2I1K A;  1V89 A;  2H7E A;  1V5P A;  2DHK A;  4DBB A;  3KY9 A;  3PVW A;  3SNH A;  2E2X A;  2I1J A;  2P8V A;  1DRO A;  2IYB A;  2KUP A;  3HW2 B;  3MDB C;  1GC7 A;  1I2H A;  3ODO A;  2NMB A;  5DHF B;  1J0W A;  4GN1 A;  3WYF B;  2GCJ A;  4ZRI A;  1NI2 A;  2K00 A;  2MDX A;  2N23 A;  3AU4 A;  2COC A;  1XKE A;  3FM8 C;  1XOD A;  1TXD A;  2L2I A;  1KZG A;  4WSF A;  3SV1 A;  4F7G A;  2YS1 A;  4WVF B;  2RUK B;  1RRP B;  2YS3 A;  2GCL A;  3T06 A;  1H4R A;  2J0J A;  1AQC A;  2P0H A;  4HAZ B;  1H10 A;  1Z87 A;  1EGX A;  4B6H A;  5KQ1 A;  2VRW B;  1MK9 B;  4XWX A;  2D9V A;  4Z2N A;  3KRX A;  4YON A;  3P7Z A;  2I5C A;  2MWN B;  2RGN B;  2D11 A;  1LW3 A;  1J19 A;  1KI1 B;  2ADZ A;  1P3R A;  3DXC A;  4ZRK A;  1GG3 A;  1FHO A;  1EVH A;  3DXE A;  1MK7 B;  2H7D A;  2IFS A;  3BIN A;  4HAX B;  5HE1 A;  2KCJ A;  3GYP A;  1BTK A;  4GMV A;  4CHJ A;  3ODW A;  1X11 A;  1LB1 A;  2M14 A;  2CY5 A;  3PVU A;  1W1H A;  2HTH B;  2DFK A;  3SYX A;  4NSW A;  3WA0 A;  2VKI A;  1OY2 A;  4PNK A;  4MT7 A;  3ULB A;  4L6E A;  3RCP A;  3PEG A;  2AEH A;  2D9Y A;  3IVF A;  5KQ4 A;  3MPX A;  1V88 A;  2K2J A;  4HDO A;  4F7U P;  3ZDT A;  2UVM A;  3SUZ A;  4A6F B;  4CHM A;  2YF0 A;  2Z0O A;  2EC1 A;  4HAV B;  3F0W A;  1FOE A;  2X18 A;  5D3Y A;  2D9X A;  2J0K A;  2UZR A;  1NTV A;  3V5W A;  1BWN A;  3TVV A;  2DHI A;  2RVB B;  3BJI A;  1E5W A;  1PMS A;  1MKE A;  1WG7 A;  3CIK A;  3U8Z A;  1WJM A;  3AJ4 A;  1MIZ B;  1U29 A;  1XCG A;  2D4Q A;  1M7R A;  3DXD A;  4HAT B;  2M38 A;  4K17 A;  4TKN A;  3A98 B;  5GOW B;  2R0D A;  5L81 A;  4KHB B;  4WJ7 A;  2W2X C;  1FHX A;  2RNR B;  3PVL A;  5LON B;  3VOQ A;  2QKM A;  3G9W A;  1X1G A;  4GZU A;  1BTN A;  4EJN A;  1X1F A;  3HQC A;  3N7C A;  2D2Q A;  5JP4 A;  4MK0 A;  1MAI A;  1N3H A;  4GPT B;  5CLQ B;  1K5G B;  2W2W A;  4H8S A;  1ISN A;  1V5U A;  1UPQ A;  1DDV A;  4IOY X;  3VIA A;  4YL8 A;  2Z0Q A;  4HB4 B;  2EMT A;  5JHH A;  2PZ1 A;  1TQZ A;  1KZ7 A;  2GS0 A;  2J59 M;  2JP2 A;  2Y8G A;  1U2B A;  5D3V A;  4K2O A;  1BAK A;  2G35 A;  4P7I A;  2Y8F A;  1X05 A;  1DBH A;  5D3W A;  3ZVR A;  3O96 A;  3F5R A;  1W1G A;  2P0F A;  5CLL B;  3U7D A;  1V5M A;  1UNP A;  5C5B A;  5LOP B;  1OMW A;  1ZVR A;  5DH9 B;  4IFS A;  5JLJ B;  3KZ1 A;  3FSS A;  2COD A;  3X23 A;  2COF A;  4HAW B;  5D27 A;  5C79 A;  1QC6 A;  2UZS A;  2EMS A;  1GC6 A;  1NTY A;  2V76 A;  1PFJ A;  2FJL A;  1QQG A;  2DYN A;  2ROV A;  1WGU A;  1M7E A;  2LYD A;  3KRW A;  3D8F A;  1U27 A;  2D9Z A;  5DHA B;  4EMO A;  4K81 A;  2CY4 A;  3M1I B;  2CAY A;  5HE0 A;  2LG1 A;  1UNR A;  1WGQ A;  4A6K A;  1OQN A;  4GMX B;  2K2U A;  2OQB A;  2Z0P A;  3FEH A;  2KGX B;  3QWM A;  2DA0 A;  1FB8 A;  4IAP A;  1PLS A;  1WJ1 A;  1XX0 A;  2ZPY A;  5KCV A;  4BBK A;  1WVH A;  4HB3 B;  2RLO A;  3ODX A;  2YT1 A;  2EJ8 A;  2ELB A;  1Q67 A;  3PZD A;  4F7H A;  2Q13 A;  5C6R A;  3TO1 A;  3LJU X;  2YS5 A;  3A8Q A;  2VSZ A;  2L1C A;  3PG7 A;  1SHC A;  2DKQ A;  4Y94 A;  4KHA A;  1ZM0 A;  3ML4 A;  4PQ0 A;  4HAU B;  2BCJ A;  5DI9 B;  5EFX A;  1UNQ A;  2MFQ A;  3OAN A;  2HE7 A;  3GYO A;  4HAY B;  1U5E A;  4EKU A;  1NU2 A;  3CXB B;  4CYE A;  5J3Y A;  1WI1 A; 
#chains in the Genus database with same CATH topology
 4HB0 B;  3UZT A;  2DTC A;  4Z2M B;  3HK0 A;  1Y19 B;  1UPR A;  4HB2 B;  4A5K A;  4HDQ A;  1TJ6 A;  2DYQ A;  2YT0 A;  3P6A A;  1P6S A;  4TYZ A;  4GNK B;  2GJY A;  1B55 A;  4DX8 A;  1ZSQ A;  4HHV A;  3NWF A;  1DYN A;  2KUQ A;  1SGH A;  3D8D A;  2DX5 A;  3KSY A;  4HSI A;  1FGZ A;  2R2Y A;  4KVG B;  5FI0 A;  1Y5O A;  4K2P A;  1UEF A;  1U5D A;  3AU5 A;  1U5F A;  2YRY A;  3QBV B;  1ZC3 B;  1XR0 B;  1EF1 A;  1AWE A;  4QJ4 B;  1IRS A;  1ZC4 B;  1XD4 A;  3TW1 A;  1FAO A;  3NSU A;  2I5F A;  3PSC A;  1MIX A;  4A6F A;  2AL6 A;  4DXA B;  2XQN M;  4MY6 A;  3HIE A;  4ZRJ A;  2R09 A;  5FI1 A;  1FGY A;  2YSZ A;  5HE3 A;  5J3Q A;  2OTX A;  2D9W A;  2LUL A;  4C0A A;  2LOZ A;  1W1D A;  4D0N B;  1K5D B;  1RJ2 A;  2ELA A;  2LKO A;  2ROZ B;  2YVC A;  4KHO A;  5JHG A;  1MPH A;  4KAX B;  3ULC A;  2DN6 A;  1FHW A;  5J3T A;  1P5T A;  4DX9 0;  5M4Y B;  2DLW A;  4GXB A;  5HE2 A;  1DDM A;  2DKP A;  5C5B B;  1V61 A;  3A8P A;  2Y7B A;  2P0D A;  2W2X D;  5C16 A;  5DIF B;  5I2S A;  4QXA B;  4OSN A;  3D8E A;  2ZKM X;  2CRF A;  1EAZ A;  3TCA A;  1T77 A;  1X86 A;  1I7A A;  2D10 A;  4NY0 A;  2NZ8 B;  2LOX A;  5D3X A;  1U5G A;  2J0M A;  2DX1 A;  2RSG A;  3PP2 A;  2N0Y A;  3QIJ A;  4A6H A;  2DHJ A;  2COA A;  2QKL A;  2MKR A;  1DDW A;  3TFM A;  3SO6 A;  2I1K A;  1V89 A;  2H7E A;  1V5P A;  2DHK A;  2KR0 A;  4DBB A;  3KY9 A;  3PVW A;  3SNH A;  3OHM B;  2E2X A;  2I1J A;  2P8V A;  5IRS A;  1DRO A;  2IYB A;  2YT2 A;  2Z59 A;  2KUP A;  3HW2 B;  2KIE A;  3MDB C;  1GC7 A;  1I2H A;  4QJ3 B;  3ODO A;  2NMB A;  5DHF B;  1J0W A;  4GN1 A;  3WYF B;  2GCJ A;  4ZRI A;  1NI2 A;  2K00 A;  2MDX A;  2N23 A;  3AU4 A;  2COC A;  4OT1 A;  1XKE A;  3FM8 C;  1XOD A;  1ZYI A;  1TXD A;  2L2I A;  1KZG A;  4WSF A;  3SV1 A;  4F7G A;  2YS1 A;  2GUM A;  4WVF B;  2RUK B;  1RRP B;  2YS3 A;  4GOU A;  2GCL A;  3T06 A;  4D6W A;  1H4R A;  2J0J A;  1AQC A;  2P0H A;  4HAZ B;  1H10 A;  1Z87 A;  1EGX A;  4B6H A;  5KQ1 A;  2VRW B;  1MK9 B;  4XWX A;  2D9V A;  4Z2N A;  3KRX A;  4YON A;  3P7Z A;  2I5C A;  3NW8 A;  2MWN B;  2RGN B;  2D11 A;  1LW3 A;  1J19 A;  1KI1 B;  2ADZ A;  1P3R A;  3DXC A;  4ZRK A;  1GG3 A;  1FHO A;  1EVH A;  2RRF A;  3DXE A;  1MK7 B;  2H7D A;  2IFS A;  3BIN A;  4HAX B;  5HE1 A;  2KCJ A;  3GYP A;  1BTK A;  2KIG A;  4GMV A;  4CHJ A;  3ODW A;  1X11 A;  1LB1 A;  2M14 A;  2CY5 A;  3PVU A;  1W1H A;  2HTH B;  2DFK A;  3SYX A;  4NSW A;  3WA0 A;  2VKI A;  1OY2 A;  4KHB A;  4PNK A;  4MT7 A;  3ULB A;  4L6E A;  3RCP A;  3PEG A;  2AEH A;  2D9Y A;  3IVF A;  5KQ4 A;  3MPX A;  1V88 A;  2K2J A;  4HDO A;  4F7U P;  3ZDT A;  2UVM A;  3SUZ A;  5LG4 B;  4A6F B;  4CHM A;  2YF0 A;  2Z0O A;  2EC1 A;  4HAV B;  3F0W A;  1FOE A;  2X18 A;  5D3Y A;  2D9X A;  2J0K A;  2UZR A;  1NTV A;  3V5W A;  1BWN A;  3TVV A;  2DHI A;  2RVB B;  3NWD A;  3BJI A;  1E5W A;  1PMS A;  1MKE A;  1WG7 A;  3CIK A;  3HSA A;  3U8Z A;  1WJM A;  3AJ4 A;  1MIZ B;  1U29 A;  1XCG A;  2D4Q A;  1M7R A;  3DXD A;  4HAT B;  2M38 A;  4K17 A;  4TKN A;  3A98 B;  5GOW B;  2R0D A;  5L81 A;  4KHB B;  4WJ7 A;  2W2X C;  1FHX A;  2RNR B;  3PVL A;  5LON B;  3VOQ A;  2QKM A;  3G9W A;  1X1G A;  3B77 A;  4GZU A;  1BTN A;  4EJN A;  1X1F A;  3HQC A;  2K49 A;  5I2M A;  3N7C A;  2D2Q A;  5JP4 A;  4MK0 A;  1MAI A;  1N3H A;  4GPT B;  5CLQ B;  1K5G B;  2W2W A;  4H8S A;  1ISN A;  1V5U A;  1UPQ A;  1DDV A;  4IOY X;  3VIA A;  2Z13 A;  4YL8 A;  2Z0Q A;  4HB4 B;  3DCX A;  2EMT A;  3U12 A;  5JHH A;  2PZ1 A;  1TQZ A;  1KZ7 A;  2GS0 A;  2J59 M;  2JP2 A;  2Y8G A;  1U2B A;  4DIX A;  5D3V A;  4K2O A;  1BAK A;  2G35 A;  4P7I A;  2Y8F A;  1X05 A;  1DBH A;  5D3W A;  3ZVR A;  3O96 A;  3F5R A;  1W1G A;  2P0F A;  5CLL B;  2K8E A;  3U7D A;  1V5M A;  1UNP A;  5C5B A;  5LOP B;  1OMW A;  1ZVR A;  5DH9 B;  4IFS A;  5JLJ B;  4QJ5 B;  2Z14 A;  3KZ1 A;  3FSS A;  2COD A;  3X23 A;  2COF A;  4HAW B;  5D27 A;  5C79 A;  1QC6 A;  2Z4D A;  2UZS A;  2EMS A;  1GC6 A;  1NTY A;  2V76 A;  1PFJ A;  2FJL A;  1QQG A;  2DYN A;  2ROV A;  1WGU A;  1M7E A;  3FVC A;  2LYD A;  3KRW A;  3D8F A;  1U27 A;  2D9Z A;  5DHA B;  4EMO A;  4K81 A;  2CY4 A;  3M1I B;  2CAY A;  5HE0 A;  2LG1 A;  1UNR A;  1WGQ A;  3NWA A;  4A6K A;  1OQN A;  4GMX B;  2K2U A;  3A58 A;  2OQB A;  2Z0P A;  3FEH A;  2KGX B;  3QWM A;  2DA0 A;  4L1R A;  1FB8 A;  4IAP A;  4CSQ A;  1PLS A;  1WJ1 A;  1XX0 A;  2ZPY A;  5KCV A;  1MI1 A;  4BBK A;  1WVH A;  4HB3 B;  2RLO A;  3ODX A;  2YT1 A;  2EJ8 A;  2ELB A;  1Q67 A;  3PZD A;  4F7H A;  2Q13 A;  5C6R A;  3TO1 A;  3LJU X;  2YS5 A;  3A8Q A;  2VSZ A;  2L1C A;  3PG7 A;  1SHC A;  2DKQ A;  4Y94 A;  4KHA A;  1ZM0 A;  2NBV A;  3ML4 A;  4PQ0 A;  4HAU B;  2BCJ A;  5DI9 B;  5EFX A;  1UNQ A;  2MFQ A;  3OAN A;  2HE7 A;  3GYO A;  4HAY B;  1U5E A;  4EKU A;  1NU2 A;  3CXB B;  4CYE A;  2FJU B;  1WI1 A;  5J3Y A; 
#chains in the Genus database with same CATH homology
 4HB0 B;  3UZT A;  2DTC A;  4Z2M B;  3HK0 A;  1Y19 B;  1UPR A;  4HB2 B;  4A5K A;  4HDQ A;  1TJ6 A;  2DYQ A;  2YT0 A;  3P6A A;  1P6S A;  4TYZ A;  2GJY A;  1B55 A;  4DX8 A;  1ZSQ A;  4HHV A;  1DYN A;  1SGH A;  3D8D A;  2DX5 A;  3KSY A;  1FGZ A;  4KVG B;  5FI0 A;  1Y5O A;  4K2P A;  1UEF A;  1U5D A;  3AU5 A;  1U5F A;  2YRY A;  3QBV B;  1ZC3 B;  1XR0 B;  1EF1 A;  1AWE A;  1IRS A;  1ZC4 B;  1XD4 A;  3TW1 A;  1FAO A;  3NSU A;  2I5F A;  3PSC A;  1MIX A;  4A6F A;  2AL6 A;  4DXA B;  2XQN M;  4MY6 A;  4ZRJ A;  2R09 A;  5FI1 A;  1FGY A;  2YSZ A;  5HE3 A;  5J3Q A;  2OTX A;  2D9W A;  2LUL A;  4C0A A;  2LOZ A;  1W1D A;  4D0N B;  1K5D B;  1RJ2 A;  2ELA A;  2LKO A;  2ROZ B;  2YVC A;  4KHO A;  5JHG A;  1MPH A;  4KAX B;  3ULC A;  2DN6 A;  1FHW A;  5J3T A;  1P5T A;  4DX9 0;  2DLW A;  4GXB A;  5HE2 A;  1DDM A;  2DKP A;  5C5B B;  1V61 A;  3A8P A;  2Y7B A;  2P0D A;  2W2X D;  5C16 A;  5DIF B;  3D8E A;  2CRF A;  1EAZ A;  3TCA A;  1X86 A;  1I7A A;  2D10 A;  4NY0 A;  2NZ8 B;  2LOX A;  5D3X A;  1U5G A;  3PP2 A;  2J0M A;  2DX1 A;  2RSG A;  2N0Y A;  3QIJ A;  4A6H A;  2DHJ A;  2COA A;  2QKL A;  2MKR A;  1DDW A;  3TFM A;  3SO6 A;  2I1K A;  1V89 A;  2H7E A;  1V5P A;  2DHK A;  4DBB A;  3KY9 A;  3PVW A;  3SNH A;  2E2X A;  2I1J A;  2P8V A;  1DRO A;  2IYB A;  2KUP A;  3HW2 B;  3MDB C;  1GC7 A;  1I2H A;  3ODO A;  2NMB A;  5DHF B;  1J0W A;  4GN1 A;  3WYF B;  2GCJ A;  4ZRI A;  1NI2 A;  2K00 A;  2MDX A;  2N23 A;  3AU4 A;  2COC A;  1XKE A;  3FM8 C;  1XOD A;  1TXD A;  2L2I A;  1KZG A;  4WSF A;  3SV1 A;  4F7G A;  2YS1 A;  4WVF B;  2RUK B;  1RRP B;  2YS3 A;  2GCL A;  3T06 A;  1H4R A;  2J0J A;  1AQC A;  2P0H A;  4HAZ B;  1H10 A;  1Z87 A;  1EGX A;  4B6H A;  5KQ1 A;  2VRW B;  1MK9 B;  4XWX A;  2D9V A;  4Z2N A;  3KRX A;  4YON A;  3P7Z A;  2I5C A;  2MWN B;  2RGN B;  2D11 A;  1LW3 A;  1J19 A;  1KI1 B;  2ADZ A;  1P3R A;  3DXC A;  4ZRK A;  1GG3 A;  1FHO A;  1EVH A;  3DXE A;  1MK7 B;  2H7D A;  2IFS A;  3BIN A;  4HAX B;  5HE1 A;  2KCJ A;  3GYP A;  1BTK A;  4GMV A;  4CHJ A;  3ODW A;  1X11 A;  1LB1 A;  2M14 A;  2CY5 A;  3PVU A;  1W1H A;  2HTH B;  2DFK A;  3SYX A;  4NSW A;  3WA0 A;  2VKI A;  1OY2 A;  4PNK A;  4MT7 A;  3ULB A;  4L6E A;  3RCP A;  3PEG A;  2AEH A;  2D9Y A;  3IVF A;  5KQ4 A;  3MPX A;  1V88 A;  2K2J A;  4HDO A;  4F7U P;  3ZDT A;  2UVM A;  3SUZ A;  4A6F B;  4CHM A;  2YF0 A;  2Z0O A;  2EC1 A;  4HAV B;  3F0W A;  1FOE A;  2X18 A;  5D3Y A;  2D9X A;  2J0K A;  2UZR A;  1NTV A;  3V5W A;  1BWN A;  3TVV A;  2DHI A;  2RVB B;  3BJI A;  1E5W A;  1PMS A;  1MKE A;  1WG7 A;  3CIK A;  3U8Z A;  1WJM A;  3AJ4 A;  1MIZ B;  1U29 A;  1XCG A;  2D4Q A;  1M7R A;  3DXD A;  4HAT B;  2M38 A;  4K17 A;  4TKN A;  3A98 B;  5GOW B;  2R0D A;  5L81 A;  4KHB B;  4WJ7 A;  2W2X C;  1FHX A;  2RNR B;  3PVL A;  5LON B;  3VOQ A;  2QKM A;  3G9W A;  1X1G A;  4GZU A;  1BTN A;  4EJN A;  1X1F A;  3HQC A;  3N7C A;  2D2Q A;  5JP4 A;  4MK0 A;  1MAI A;  1N3H A;  4GPT B;  5CLQ B;  1K5G B;  2W2W A;  4H8S A;  1ISN A;  1V5U A;  1UPQ A;  1DDV A;  4IOY X;  3VIA A;  4YL8 A;  2Z0Q A;  4HB4 B;  2EMT A;  5JHH A;  2PZ1 A;  1TQZ A;  1KZ7 A;  2GS0 A;  2J59 M;  2JP2 A;  2Y8G A;  1U2B A;  5D3V A;  4K2O A;  1BAK A;  2G35 A;  4P7I A;  2Y8F A;  1X05 A;  1DBH A;  5D3W A;  3ZVR A;  3O96 A;  3F5R A;  1W1G A;  2P0F A;  5CLL B;  3U7D A;  1V5M A;  1UNP A;  5C5B A;  5LOP B;  1OMW A;  1ZVR A;  5DH9 B;  4IFS A;  5JLJ B;  3KZ1 A;  3FSS A;  2COD A;  3X23 A;  2COF A;  4HAW B;  5D27 A;  5C79 A;  1QC6 A;  2UZS A;  2EMS A;  1GC6 A;  1NTY A;  2V76 A;  1PFJ A;  2FJL A;  1QQG A;  2DYN A;  2ROV A;  1WGU A;  1M7E A;  2LYD A;  3KRW A;  3D8F A;  1U27 A;  2D9Z A;  5DHA B;  4EMO A;  4K81 A;  2CY4 A;  3M1I B;  2CAY A;  5HE0 A;  2LG1 A;  1UNR A;  1WGQ A;  4A6K A;  1OQN A;  4GMX B;  2K2U A;  2OQB A;  2Z0P A;  3FEH A;  2KGX B;  3QWM A;  2DA0 A;  1FB8 A;  4IAP A;  1PLS A;  1WJ1 A;  1XX0 A;  2ZPY A;  5KCV A;  4BBK A;  1WVH A;  4HB3 B;  2RLO A;  3ODX A;  2YT1 A;  2EJ8 A;  2ELB A;  1Q67 A;  3PZD A;  4F7H A;  2Q13 A;  5C6R A;  3TO1 A;  3LJU X;  2YS5 A;  3A8Q A;  2VSZ A;  2L1C A;  3PG7 A;  1SHC A;  2DKQ A;  4Y94 A;  4KHA A;  1ZM0 A;  3ML4 A;  4PQ0 A;  4HAU B;  2BCJ A;  5DI9 B;  5EFX A;  1UNQ A;  2MFQ A;  3OAN A;  2HE7 A;  3GYO A;  4HAY B;  1U5E A;  4EKU A;  1NU2 A;  3CXB B;  4CYE A;  5J3Y A;  1WI1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...