2RUKB

Solution structure of the complex between p53 transactivation domain 2 and tfiih p62 ph domain
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
108
structure length
108
Chain Sequence
MATSSEEVLLIVKKVRQKKQDGALYLMAERIAWAPEGKDRFTISHMYADIKCQKISPEGKAKIQLQLVLHAGDTTNFHFSNESTAVKERDAVKDLLQQLLPKFKRKAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cellular tumor antigen p53
publication title Extended String Binding Mode of the Phosphorylated Transactivation Domain of Tumor Suppressor p53
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 26
structure length 108
sequence length 108
ec nomenclature
pdb deposition date 2014-09-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF08567 PH_TFIIH TFIIH p62 subunit, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2rukB00
1ZVRA 3TFMA 1KI1B 1X86A 1UNRA 2L2IA 1WJMA 1WGUA 3AU4A 1NI2A 2Y8FA 3DXDA 3CXBB 2DN6A 4EMOA 2DKQA 4ZRIA 4DBBA 2COCA 2RVBB 2DHJA 2I5CA 3TCAA 1V5PA 3PP2A 1V61A 2J59M 3A8QA 4HB4B 5DHFB 2JP2A 2KCJA 1BAKA 1TXDA 5J3YA 2XQNM 4F7HA 2LOZA 3F5RA 4DX8A 5D3WA 1KZGA 1UNPA 3U7DA 2K2JA 2E2XA 3ULCA 2W2WA 2Z0PA 2YS3A 4KVGB 5C5BB 2AEHA 5KCVA 4Z2MB 1H4RA 5D3VA 3TW1A 2DHKA 3P7ZA 2GCLA 4CHJA 1K5DB 4Z2NA 4GZUA 1FGZA 5L81A 4K81A 2ZPYA 5KQ4A 3WA0A 1NTVA 3PEGA 5C16A 1RRPB 1IRSA 2RGNB 4XWXA 5D3YA 2DTCA 2Y7BA 1NTYA 4HDOA 2EMTA 1XODA 2HE7A 1U5FA 2CAYA 3IVFA 2I1KA 2OQBA 1ZC3B 4KHOA 2RNRB 2KUPA 1ISNA 1W1GA 2LKOA 1DDMA 1U5EA 4D0NB 4HDQA 5EFXA 3N7CA 1X11A 3AJ4A 1U29A 2HTHB 4PQ0A 2ELAA 4HAVB 3KRXA 4A5KA 2YT0A 1EVHA 3DXCA 5LOPB 2W2XC 3BINA 3LJUX 1Y5OA 3PSCA 4HAYB 4BBKA 1Q67A 1Y19B 1X1GA 1J19A 3ODOA 1MK7B 2M38A 2M14A 3KSYA 2DLWA 3NSUA 1LW3A 3ML4A 2D9XA 1V5MA 3BJIA 3D8DA 1OQNA 1V89A 3G9WA 2CODA 1PMSA 2L1CA 2VRWB 2D2QA 3QWMA 1V88A 1M7RA 1XCGA 3ODXA 1BTNA 2COFA 1E5WA 2J0KA 3HK0A 2X18A 5HE1A 1W1DA 1RJ2A 2EJ8A 1LB1A 3GYOA 4HB2B 1XX0A 2N23A 5FI0A 2OTXA 5DHAB 3KRWA 1BWNA 1WI1A 5CLLB 2AL6A 4YL8A 1WG7A 4DX90 4GXBA 4KAXB 2GCJA 3MDBC 2RSGA 4NSWA 2MDXA 2UZRA 5HE2A 1V5UA 2G35A 3AU5A 2Z0QA 5GOWB 4K2OA 3WYFB 1Z87A 3T06A 4H8SA 1KZ7A 2LOXA 2D9VA 1AWEA 2P0DA 2ROVA 4L6EA 4KHBB 3UZTA 1TJ6A 2YF0A 4A6FB 4F7UP 3TO1A 1X05A 1MK9B 1QQGA 4GMXB 5C5BA 4TKNA 4HATB 2DFKA 4WJ7A 5D3XA 1WVHA 2I5FA 3V5WA 4B6HA 3SYXA 2DKPA 3A8PA 2EC1A 1U2BA 5DI9B 1FB8A 1MIXA 2QKLA 2DYQA 3MPXA 1P5TA 1WJ1A 2LYDA 4EJNA 2NZ8B 1WGQA 3D8EA 4CYEA 1BTKA 1UNQA 1MAIA 2D10A 4HAUB 4EKUA 1I7AA 2FJLA 2H7EA 5J3QA 2D9WA 3U8ZA 1DBHA 4HAZB 2DHIA 3DXEA 2DX1A 2D4QA 4HB0B 3ZVRA 1U5DA 1GG3A 3PG7A 4WVFB 3X23A 5DH9B 3ULBA 4TYZA 1UPQA 1DDWA 4YONA 5KQ1A 1EAZA 4ZRKA 2D9ZA 2DA0A 1FHWA 5HE0A 3VIAA 2R09A 1OMWA 1ZM0A 2RLOA 1NU2A 3CIKA 3FSSA 1DYNA 2W2XD 2R0DA 2DYNA 2V76A 1UEFA 5JLJB 2CRFA 3VOQA 1OY2A 2YS1A 1SHCA 2VKIA 4MT7A 1EF1A 3P6AA 2Q13A 1SGHA 4K2PA 1PLSA 3TVVA 3QIJA 4PNKA 3SUZA 4WSFA 3FM8C 1XKEA 4MK0A 3HQCA 3KZ1A 3A98B 2LULA 2CY4A 1FHOA 3ZDTA 2COAA 2UVMA 1ZSQA 2KGXB 5CLQB 2I1JA 1J0WA 5DIFB 2MWNB 1P3RA 3QBVB 2YT1A 2ROZB 3PVLA 2YVCA 5JP4A 3PZDA 1U5GA 4K17A 1FAOA 2YRYA 1QC6A 1EGXA 2DX5A 3SO6A 1N3HA 2GJYA 5JHGA 5LONB 4Y94A 4A6FA 1DDVA 1H10A 2H7DA 4GN1A 4HAXB 5C79A 3SNHA 2BCJA 2P0HA 3PVWA 3SV1A 3OANA 2N0YA 2P8VA 2PZ1A 4KHAA 1MKEA 2EMSA 4HB3B 2VSZA 4MY6A 5FI1A 1XD4A 2CY5A 1P6SA 4P7IA 1DROA 2YSZA 2QKMA 1MPHA 1FGYA 1U27A 1ZC4B 4IFSA 4CHMA 1GC7A 1MIZB 2K2UA 2ADZA 2UZSA 2YS5A 2P0FA 2J0MA 5JHHA 2Z0OA 2Y8GA 3KY9A 4IAPA 1X1FA 1B55A 4HAWB 4GMVA 1FOEA 1XR0B 3GYPA 1K5GB 2K00A 3RCPA 4GPTB 1I2HA 2D9YA 2MKRA 4C0AA 5HE3A 3M1IB 4IOYX 4A6KA 3O96A 1UPRA 4ZRJA 4A6HA 1TQZA 2IFSA 5D27A 2D11A 3D8FA 2ELBA 1M7EA 2J0JA 3F0WA 4F7GA 2LG1A 3HW2B 5J3TA 3PVUA 2GS0A 1W1HA 2NMBA 1FHXA 4HHVA 4NY0A 1AQCA 3ODWA 2RUKB 1GC6A 4DXAB 5C6RA 1PFJA 2IYBA 3FEHA 2MFQA
chains in the Genus database with same CATH superfamily
1ZVRA 3TFMA 1KI1B 1X86A 1UNRA 2L2IA 1WJMA 3DCXA 1WGUA 3AU4A 1NI2A 2Y8FA 3DXDA 3CXBB 2DN6A 4EMOA 2DKQA 4ZRIA 4DBBA 2COCA 4OT1A 2RVBB 2DHJA 2I5CA 3TCAA 1V5PA 2Z14A 3PP2A 1V61A 2J59M 3A8QA 4HB4B 5DHFB 2JP2A 2KCJA 1BAKA 1TXDA 5J3YA 2XQNM 4F7HA 2LOZA 3F5RA 4DX8A 5D3WA 4QJ5B 1KZGA 2Z4DA 1UNPA 3U7DA 2K2JA 2E2XA 3ULCA 2W2WA 2Z0PA 2YS3A 4KVGB 5C5BB 2AEHA 5KCVA 4Z2MB 1H4RA 5D3VA 3OHMB 3TW1A 2DHKA 3P7ZA 2GCLA 4CHJA 1K5DB 4Z2NA 4GZUA 1FGZA 4QJ3B 5L81A 4K81A 2ZPYA 5KQ4A 3WA0A 1NTVA 2FJUB 3PEGA 1RRPB 5C16A 1IRSA 2RGNB 4XWXA 5D3YA 4CSQA 2DTCA 2K49A 2RRFA 2Y7BA 1NTYA 4HDOA 2EMTA 1XODA 2HE7A 1U5FA 2CAYA 3IVFA 2I1KA 2OQBA 1ZC3B 4KHOA 2RNRB 5IRSA 2KUPA 1ISNA 1W1GA 2LKOA 1DDMA 1U5EA 2Z59A 4D0NB 4HDQA 5EFXA 5I2MA 3N7CA 1X11A 3AJ4A 3FVCA 3U12A 1U29A 2HTHB 4PQ0A 2ELAA 4HAVB 3KRXA 4A5KA 2YT0A 1EVHA 3DXCA 5LOPB 2W2XC 3BINA 3NWAA 3LJUX 1Y5OA 3PSCA 4HAYB 4BBKA 1Q67A 1Y19B 1X1GA 1J19A 3ODOA 1MK7B 2M38A 2M14A 3KSYA 2DLWA 3NSUA 1LW3A 3ML4A 2D9XA 1V5MA 3BJIA 3D8DA 1OQNA 1V89A 3G9WA 2CODA 1PMSA 2L1CA 2VRWB 4GNKB 2D2QA 3QWMA 1V88A 1M7RA 1XCGA 2YT2A 3ODXA 1BTNA 2COFA 1E5WA 2J0KA 3HK0A 2X18A 5HE1A 1W1DA 1RJ2A 2EJ8A 1LB1A 3GYOA 4HB2B 4OSNA 1XX0A 4DIXA 2N23A 4D6WA 5FI0A 2OTXA 5DHAB 3KRWA 1BWNA 1WI1A 5CLLB 2AL6A 4YL8A 1WG7A 4DX90 4GXBA 4KAXB 2GCJA 3MDBC 2RSGA 4NSWA 2MDXA 2UZRA 5HE2A 1V5UA 2G35A 3AU5A 2Z0QA 5GOWB 4K2OA 3WYFB 1Z87A 4QXAB 3T06A 4H8SA 1KZ7A 2R2YA 2LOXA 2D9VA 1AWEA 2P0DA 2ROVA 4L6EA 4KHBB 3UZTA 1TJ6A 2YF0A 4A6FB 4F7UP 3TO1A 3NWFA 1X05A 1MK9B 1QQGA 4GMXB 5C5BA 4TKNA 2Z13A 4HATB 2DFKA 4WJ7A 5D3XA 1WVHA 2I5FA 3V5WA 4B6HA 3SYXA 2DKPA 3A8PA 2EC1A 1U2BA 5DI9B 1FB8A 1MIXA 2QKLA 2DYQA 3MPXA 1P5TA 1WJ1A 2KUQA 2LYDA 4EJNA 2NZ8B 1WGQA 3D8EA 4CYEA 4L1RA 1BTKA 1UNQA 1MAIA 2D10A 4HAUB 4EKUA 3NW8A 1I7AA 1T77A 2FJLA 2H7EA 5J3QA 2D9WA 3U8ZA 1DBHA 1MI1A 4HAZB 2ZKMX 2DHIA 3DXEA 2DX1A 2D4QA 4HB0B 3ZVRA 1U5DA 1GG3A 3PG7A 2KIGA 4WVFB 3X23A 5DH9B 3ULBA 4TYZA 5I2SA 1UPQA 1DDWA 4YONA 5KQ1A 1EAZA 4ZRKA 2D9ZA 2DA0A 1FHWA 5HE0A 3VIAA 2R09A 1OMWA 1ZM0A 2RLOA 1NU2A 3CIKA 3FSSA 1DYNA 2W2XD 2R0DA 2DYNA 2V76A 1UEFA 5JLJB 2CRFA 3VOQA 1OY2A 2YS1A 1SHCA 2VKIA 2K8EA 4MT7A 1EF1A 3P6AA 2Q13A 1SGHA 4K2PA 1PLSA 3TVVA 3QIJA 4PNKA 3SUZA 4WSFA 3FM8C 1XKEA 4MK0A 3HQCA 3KZ1A 3A98B 2LULA 1ZYIA 2CY4A 1FHOA 3ZDTA 2COAA 2UVMA 1ZSQA 2KGXB 5CLQB 2I1JA 1J0WA 5DIFB 2MWNB 1P3RA 3QBVB 2YT1A 2ROZB 3PVLA 2YVCA 5JP4A 3PZDA 1U5GA 4K17A 1FAOA 2YRYA 1QC6A 1EGXA 2DX5A 3HSAA 3SO6A 1N3HA 2KIEA 2GJYA 5JHGA 5LONB 4KHBA 4Y94A 4A6FA 1DDVA 1H10A 2H7DA 4GN1A 4HAXB 5C79A 3SNHA 2BCJA 2P0HA 3PVWA 3SV1A 3OANA 2N0YA 2P8VA 2PZ1A 4KHAA 1MKEA 2EMSA 4HB3B 3A58A 2VSZA 2KR0A 4MY6A 3HIEA 5FI1A 1XD4A 2CY5A 3NWDA 1P6SA 4P7IA 1DROA 2YSZA 4QJ4B 2QKMA 1MPHA 1FGYA 1U27A 1ZC4B 4IFSA 4CHMA 1GC7A 1MIZB 2K2UA 2ADZA 2UZSA 2YS5A 5M4YB 2P0FA 2J0MA 5JHHA 2GUMA 2Z0OA 2Y8GA 3KY9A 4IAPA 5LG4B 1X1FA 1B55A 4HAWB 4GMVA 1FOEA 1XR0B 3GYPA 1K5GB 2K00A 3RCPA 4GPTB 1I2HA 3B77A 2D9YA 2MKRA 4C0AA 5HE3A 3M1IB 4IOYX 4A6KA 3O96A 4GOUA 1UPRA 4ZRJA 4A6HA 1TQZA 2IFSA 5D27A 2D11A 3D8FA 2ELBA 1M7EA 2J0JA 3F0WA 4F7GA 2LG1A 3HW2B 5J3TA 3PVUA 2GS0A 1W1HA 2NMBA 1FHXA 4HHVA 4NY0A 1AQCA 3ODWA 2NBVA 2RUKB 1GC6A 4DXAB 5C6RA 4HSIA 1PFJA 2IYBA 3FEHA 2MFQA
chains in the Genus database with same CATH topology
1ZVRA 3TFMA 1KI1B 1X86A 1UNRA 2L2IA 1WJMA 1WGUA 3AU4A 1NI2A 2Y8FA 3DXDA 3CXBB 2DN6A 4EMOA 2DKQA 4ZRIA 4DBBA 2COCA 2RVBB 2DHJA 2I5CA 3TCAA 1V5PA 3PP2A 1V61A 2J59M 3A8QA 4HB4B 5DHFB 2JP2A 2KCJA 1BAKA 1TXDA 5J3YA 2XQNM 4F7HA 2LOZA 3F5RA 4DX8A 5D3WA 1KZGA 1UNPA 3U7DA 2K2JA 2E2XA 3ULCA 2W2WA 2Z0PA 2YS3A 4KVGB 5C5BB 2AEHA 5KCVA 4Z2MB 1H4RA 5D3VA 3TW1A 2DHKA 3P7ZA 2GCLA 4CHJA 1K5DB 4Z2NA 4GZUA 1FGZA 5L81A 4K81A 2ZPYA 5KQ4A 3WA0A 1NTVA 3PEGA 5C16A 1RRPB 1IRSA 2RGNB 4XWXA 5D3YA 2DTCA 2Y7BA 1NTYA 4HDOA 2EMTA 1XODA 2HE7A 1U5FA 2CAYA 3IVFA 2I1KA 2OQBA 1ZC3B 4KHOA 2RNRB 2KUPA 1ISNA 1W1GA 2LKOA 1DDMA 1U5EA 4D0NB 4HDQA 5EFXA 3N7CA 1X11A 3AJ4A 1U29A 2HTHB 4PQ0A 2ELAA 4HAVB 3KRXA 4A5KA 2YT0A 1EVHA 3DXCA 5LOPB 2W2XC 3BINA 3LJUX 1Y5OA 3PSCA 4HAYB 4BBKA 1Q67A 1Y19B 1X1GA 1J19A 3ODOA 1MK7B 2M38A 2M14A 3KSYA 2DLWA 3NSUA 1LW3A 3ML4A 2D9XA 1V5MA 3BJIA 3D8DA 1OQNA 1V89A 3G9WA 2CODA 1PMSA 2L1CA 2VRWB 2D2QA 3QWMA 1V88A 1M7RA 1XCGA 3ODXA 1BTNA 2COFA 1E5WA 2J0KA 3HK0A 2X18A 5HE1A 1W1DA 1RJ2A 2EJ8A 1LB1A 3GYOA 4HB2B 1XX0A 2N23A 5FI0A 2OTXA 5DHAB 3KRWA 1BWNA 1WI1A 5CLLB 2AL6A 4YL8A 1WG7A 4DX90 4GXBA 4KAXB 2GCJA 3MDBC 2RSGA 4NSWA 2MDXA 2UZRA 5HE2A 1V5UA 2G35A 3AU5A 2Z0QA 5GOWB 4K2OA 3WYFB 1Z87A 3T06A 4H8SA 1KZ7A 2LOXA 2D9VA 1AWEA 2P0DA 2ROVA 4L6EA 4KHBB 3UZTA 1TJ6A 2YF0A 4A6FB 4F7UP 3TO1A 1X05A 1MK9B 1QQGA 4GMXB 5C5BA 4TKNA 4HATB 2DFKA 4WJ7A 5D3XA 1WVHA 2I5FA 3V5WA 4B6HA 3SYXA 2DKPA 3A8PA 2EC1A 1U2BA 5DI9B 1FB8A 1MIXA 2QKLA 2DYQA 3MPXA 1P5TA 1WJ1A 2LYDA 4EJNA 2NZ8B 1WGQA 3D8EA 4CYEA 1BTKA 1UNQA 1MAIA 2D10A 4HAUB 4EKUA 1I7AA 2FJLA 2H7EA 5J3QA 2D9WA 3U8ZA 1DBHA 4HAZB 2DHIA 3DXEA 2DX1A 2D4QA 4HB0B 3ZVRA 1U5DA 1GG3A 3PG7A 4WVFB 3X23A 5DH9B 3ULBA 4TYZA 1UPQA 1DDWA 4YONA 5KQ1A 1EAZA 4ZRKA 2D9ZA 2DA0A 1FHWA 5HE0A 3VIAA 2R09A 1OMWA 1ZM0A 2RLOA 1NU2A 3CIKA 3FSSA 1DYNA 2W2XD 2R0DA 2DYNA 2V76A 1UEFA 5JLJB 2CRFA 3VOQA 1OY2A 2YS1A 1SHCA 2VKIA 4MT7A 1EF1A 3P6AA 2Q13A 1SGHA 4K2PA 1PLSA 3TVVA 3QIJA 4PNKA 3SUZA 4WSFA 3FM8C 1XKEA 4MK0A 3HQCA 3KZ1A 3A98B 2LULA 2CY4A 1FHOA 3ZDTA 2COAA 2UVMA 1ZSQA 2KGXB 5CLQB 2I1JA 1J0WA 5DIFB 2MWNB 1P3RA 3QBVB 2YT1A 2ROZB 3PVLA 2YVCA 5JP4A 3PZDA 1U5GA 4K17A 1FAOA 2YRYA 1QC6A 1EGXA 2DX5A 3SO6A 1N3HA 2GJYA 5JHGA 5LONB 4Y94A 4A6FA 1DDVA 1H10A 2H7DA 4GN1A 4HAXB 5C79A 3SNHA 2BCJA 2P0HA 3PVWA 3SV1A 3OANA 2N0YA 2P8VA 2PZ1A 4KHAA 1MKEA 2EMSA 4HB3B 2VSZA 4MY6A 5FI1A 1XD4A 2CY5A 1P6SA 4P7IA 1DROA 2YSZA 2QKMA 1MPHA 1FGYA 1U27A 1ZC4B 4IFSA 4CHMA 1GC7A 1MIZB 2K2UA 2ADZA 2UZSA 2YS5A 2P0FA 2J0MA 5JHHA 2Z0OA 2Y8GA 3KY9A 4IAPA 1X1FA 1B55A 4HAWB 4GMVA 1FOEA 1XR0B 3GYPA 1K5GB 2K00A 3RCPA 4GPTB 1I2HA 2D9YA 2MKRA 4C0AA 5HE3A 3M1IB 4IOYX 4A6KA 3O96A 1UPRA 4ZRJA 4A6HA 1TQZA 2IFSA 5D27A 2D11A 3D8FA 2ELBA 1M7EA 2J0JA 3F0WA 4F7GA 2LG1A 3HW2B 5J3TA 3PVUA 2GS0A 1W1HA 2NMBA 1FHXA 4HHVA 4NY0A 1AQCA 3ODWA 2RUKB 1GC6A 4DXAB 5C6RA 1PFJA 2IYBA 3FEHA 2MFQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZVR A;  3TFM A;  1KI1 B;  1X86 A;  1UNR A;  2L2I A;  1WJM A;  1WGU A;  3AU4 A;  1NI2 A;  2Y8F A;  3DXD A;  3CXB B;  2DN6 A;  4EMO A;  2DKQ A;  4ZRI A;  4DBB A;  2COC A;  2RVB B;  2DHJ A;  2I5C A;  3TCA A;  1V5P A;  3PP2 A;  1V61 A;  2J59 M;  3A8Q A;  4HB4 B;  5DHF B;  2JP2 A;  2KCJ A;  1BAK A;  1TXD A;  5J3Y A;  2XQN M;  4F7H A;  2LOZ A;  3F5R A;  4DX8 A;  5D3W A;  1KZG A;  1UNP A;  3U7D A;  2K2J A;  2E2X A;  3ULC A;  2W2W A;  2Z0P A;  2YS3 A;  4KVG B;  5C5B B;  2AEH A;  5KCV A;  4Z2M B;  1H4R A;  5D3V A;  3TW1 A;  2DHK A;  3P7Z A;  2GCL A;  4CHJ A;  1K5D B;  4Z2N A;  4GZU A;  1FGZ A;  5L81 A;  4K81 A;  2ZPY A;  5KQ4 A;  3WA0 A;  1NTV A;  3PEG A;  5C16 A;  1RRP B;  1IRS A;  2RGN B;  4XWX A;  5D3Y A;  2DTC A;  2Y7B A;  1NTY A;  4HDO A;  2EMT A;  1XOD A;  2HE7 A;  1U5F A;  2CAY A;  3IVF A;  2I1K A;  2OQB A;  1ZC3 B;  4KHO A;  2RNR B;  2KUP A;  1ISN A;  1W1G A;  2LKO A;  1DDM A;  1U5E A;  4D0N B;  4HDQ A;  5EFX A;  3N7C A;  1X11 A;  3AJ4 A;  1U29 A;  2HTH B;  4PQ0 A;  2ELA A;  4HAV B;  3KRX A;  4A5K A;  2YT0 A;  1EVH A;  3DXC A;  5LOP B;  2W2X C;  3BIN A;  3LJU X;  1Y5O A;  3PSC A;  4HAY B;  4BBK A;  1Q67 A;  1Y19 B;  1X1G A;  1J19 A;  3ODO A;  1MK7 B;  2M38 A;  2M14 A;  3KSY A;  2DLW A;  3NSU A;  1LW3 A;  3ML4 A;  2D9X A;  1V5M A;  3BJI A;  3D8D A;  1OQN A;  1V89 A;  3G9W A;  2COD A;  1PMS A;  2L1C A;  2VRW B;  2D2Q A;  3QWM A;  1V88 A;  1M7R A;  1XCG A;  3ODX A;  1BTN A;  2COF A;  1E5W A;  2J0K A;  3HK0 A;  2X18 A;  5HE1 A;  1W1D A;  1RJ2 A;  2EJ8 A;  1LB1 A;  3GYO A;  4HB2 B;  1XX0 A;  2N23 A;  5FI0 A;  2OTX A;  5DHA B;  3KRW A;  1BWN A;  1WI1 A;  5CLL B;  2AL6 A;  4YL8 A;  1WG7 A;  4DX9 0;  4GXB A;  4KAX B;  2GCJ A;  3MDB C;  2RSG A;  4NSW A;  2MDX A;  2UZR A;  5HE2 A;  1V5U A;  2G35 A;  3AU5 A;  2Z0Q A;  5GOW B;  4K2O A;  3WYF B;  1Z87 A;  3T06 A;  4H8S A;  1KZ7 A;  2LOX A;  2D9V A;  1AWE A;  2P0D A;  2ROV A;  4L6E A;  4KHB B;  3UZT A;  1TJ6 A;  2YF0 A;  4A6F B;  4F7U P;  3TO1 A;  1X05 A;  1MK9 B;  1QQG A;  4GMX B;  5C5B A;  4TKN A;  4HAT B;  2DFK A;  4WJ7 A;  5D3X A;  1WVH A;  2I5F A;  3V5W A;  4B6H A;  3SYX A;  2DKP A;  3A8P A;  2EC1 A;  1U2B A;  5DI9 B;  1FB8 A;  1MIX A;  2QKL A;  2DYQ A;  3MPX A;  1P5T A;  1WJ1 A;  2LYD A;  4EJN A;  2NZ8 B;  1WGQ A;  3D8E A;  4CYE A;  1BTK A;  1UNQ A;  1MAI A;  2D10 A;  4HAU B;  4EKU A;  1I7A A;  2FJL A;  2H7E A;  5J3Q A;  2D9W A;  3U8Z A;  1DBH A;  4HAZ B;  2DHI A;  3DXE A;  2DX1 A;  2D4Q A;  4HB0 B;  3ZVR A;  1U5D A;  1GG3 A;  3PG7 A;  4WVF B;  3X23 A;  5DH9 B;  3ULB A;  4TYZ A;  1UPQ A;  1DDW A;  4YON A;  5KQ1 A;  1EAZ A;  4ZRK A;  2D9Z A;  2DA0 A;  1FHW A;  5HE0 A;  3VIA A;  2R09 A;  1OMW A;  1ZM0 A;  2RLO A;  1NU2 A;  3CIK A;  3FSS A;  1DYN A;  2W2X D;  2R0D A;  2DYN A;  2V76 A;  1UEF A;  5JLJ B;  2CRF A;  3VOQ A;  1OY2 A;  2YS1 A;  1SHC A;  2VKI A;  4MT7 A;  1EF1 A;  3P6A A;  2Q13 A;  1SGH A;  4K2P A;  1PLS A;  3TVV A;  3QIJ A;  4PNK A;  3SUZ A;  4WSF A;  3FM8 C;  1XKE A;  4MK0 A;  3HQC A;  3KZ1 A;  3A98 B;  2LUL A;  2CY4 A;  1FHO A;  3ZDT A;  2COA A;  2UVM A;  1ZSQ A;  2KGX B;  5CLQ B;  2I1J A;  1J0W A;  5DIF B;  2MWN B;  1P3R A;  3QBV B;  2YT1 A;  2ROZ B;  3PVL A;  2YVC A;  5JP4 A;  3PZD A;  1U5G A;  4K17 A;  1FAO A;  2YRY A;  1QC6 A;  1EGX A;  2DX5 A;  3SO6 A;  1N3H A;  2GJY A;  5JHG A;  5LON B;  4Y94 A;  4A6F A;  1DDV A;  1H10 A;  2H7D A;  4GN1 A;  4HAX B;  5C79 A;  3SNH A;  2BCJ A;  2P0H A;  3PVW A;  3SV1 A;  3OAN A;  2N0Y A;  2P8V A;  2PZ1 A;  4KHA A;  1MKE A;  2EMS A;  4HB3 B;  2VSZ A;  4MY6 A;  5FI1 A;  1XD4 A;  2CY5 A;  1P6S A;  4P7I A;  1DRO A;  2YSZ A;  2QKM A;  1MPH A;  1FGY A;  1U27 A;  1ZC4 B;  4IFS A;  4CHM A;  1GC7 A;  1MIZ B;  2K2U A;  2ADZ A;  2UZS A;  2YS5 A;  2P0F A;  2J0M A;  5JHH A;  2Z0O A;  2Y8G A;  3KY9 A;  4IAP A;  1X1F A;  1B55 A;  4HAW B;  4GMV A;  1FOE A;  1XR0 B;  3GYP A;  1K5G B;  2K00 A;  3RCP A;  4GPT B;  1I2H A;  2D9Y A;  2MKR A;  4C0A A;  5HE3 A;  3M1I B;  4IOY X;  4A6K A;  3O96 A;  1UPR A;  4ZRJ A;  4A6H A;  1TQZ A;  2IFS A;  5D27 A;  2D11 A;  3D8F A;  2ELB A;  1M7E A;  2J0J A;  3F0W A;  4F7G A;  2LG1 A;  3HW2 B;  5J3T A;  3PVU A;  2GS0 A;  1W1H A;  2NMB A;  1FHX A;  4HHV A;  4NY0 A;  1AQC A;  3ODW A;  2RUK B;  1GC6 A;  4DXA B;  5C6R A;  1PFJ A;  2IYB A;  3FEH A;  2MFQ A; 
#chains in the Genus database with same CATH topology
 1ZVR A;  3TFM A;  1KI1 B;  1X86 A;  1UNR A;  2L2I A;  1WJM A;  3DCX A;  1WGU A;  3AU4 A;  1NI2 A;  2Y8F A;  3DXD A;  3CXB B;  2DN6 A;  4EMO A;  2DKQ A;  4ZRI A;  4DBB A;  2COC A;  4OT1 A;  2RVB B;  2DHJ A;  2I5C A;  3TCA A;  1V5P A;  2Z14 A;  3PP2 A;  1V61 A;  2J59 M;  3A8Q A;  4HB4 B;  5DHF B;  2JP2 A;  2KCJ A;  1BAK A;  1TXD A;  5J3Y A;  2XQN M;  4F7H A;  2LOZ A;  3F5R A;  4DX8 A;  5D3W A;  4QJ5 B;  1KZG A;  2Z4D A;  1UNP A;  3U7D A;  2K2J A;  2E2X A;  3ULC A;  2W2W A;  2Z0P A;  2YS3 A;  4KVG B;  5C5B B;  2AEH A;  5KCV A;  4Z2M B;  1H4R A;  5D3V A;  3OHM B;  3TW1 A;  2DHK A;  3P7Z A;  2GCL A;  4CHJ A;  1K5D B;  4Z2N A;  4GZU A;  1FGZ A;  4QJ3 B;  5L81 A;  4K81 A;  2ZPY A;  5KQ4 A;  3WA0 A;  1NTV A;  2FJU B;  3PEG A;  1RRP B;  5C16 A;  1IRS A;  2RGN B;  4XWX A;  5D3Y A;  4CSQ A;  2DTC A;  2K49 A;  2RRF A;  2Y7B A;  1NTY A;  4HDO A;  2EMT A;  1XOD A;  2HE7 A;  1U5F A;  2CAY A;  3IVF A;  2I1K A;  2OQB A;  1ZC3 B;  4KHO A;  2RNR B;  5IRS A;  2KUP A;  1ISN A;  1W1G A;  2LKO A;  1DDM A;  1U5E A;  2Z59 A;  4D0N B;  4HDQ A;  5EFX A;  5I2M A;  3N7C A;  1X11 A;  3AJ4 A;  3FVC A;  3U12 A;  1U29 A;  2HTH B;  4PQ0 A;  2ELA A;  4HAV B;  3KRX A;  4A5K A;  2YT0 A;  1EVH A;  3DXC A;  5LOP B;  2W2X C;  3BIN A;  3NWA A;  3LJU X;  1Y5O A;  3PSC A;  4HAY B;  4BBK A;  1Q67 A;  1Y19 B;  1X1G A;  1J19 A;  3ODO A;  1MK7 B;  2M38 A;  2M14 A;  3KSY A;  2DLW A;  3NSU A;  1LW3 A;  3ML4 A;  2D9X A;  1V5M A;  3BJI A;  3D8D A;  1OQN A;  1V89 A;  3G9W A;  2COD A;  1PMS A;  2L1C A;  2VRW B;  4GNK B;  2D2Q A;  3QWM A;  1V88 A;  1M7R A;  1XCG A;  2YT2 A;  3ODX A;  1BTN A;  2COF A;  1E5W A;  2J0K A;  3HK0 A;  2X18 A;  5HE1 A;  1W1D A;  1RJ2 A;  2EJ8 A;  1LB1 A;  3GYO A;  4HB2 B;  4OSN A;  1XX0 A;  4DIX A;  2N23 A;  4D6W A;  5FI0 A;  2OTX A;  5DHA B;  3KRW A;  1BWN A;  1WI1 A;  5CLL B;  2AL6 A;  4YL8 A;  1WG7 A;  4DX9 0;  4GXB A;  4KAX B;  2GCJ A;  3MDB C;  2RSG A;  4NSW A;  2MDX A;  2UZR A;  5HE2 A;  1V5U A;  2G35 A;  3AU5 A;  2Z0Q A;  5GOW B;  4K2O A;  3WYF B;  1Z87 A;  4QXA B;  3T06 A;  4H8S A;  1KZ7 A;  2R2Y A;  2LOX A;  2D9V A;  1AWE A;  2P0D A;  2ROV A;  4L6E A;  4KHB B;  3UZT A;  1TJ6 A;  2YF0 A;  4A6F B;  4F7U P;  3TO1 A;  3NWF A;  1X05 A;  1MK9 B;  1QQG A;  4GMX B;  5C5B A;  4TKN A;  2Z13 A;  4HAT B;  2DFK A;  4WJ7 A;  5D3X A;  1WVH A;  2I5F A;  3V5W A;  4B6H A;  3SYX A;  2DKP A;  3A8P A;  2EC1 A;  1U2B A;  5DI9 B;  1FB8 A;  1MIX A;  2QKL A;  2DYQ A;  3MPX A;  1P5T A;  1WJ1 A;  2KUQ A;  2LYD A;  4EJN A;  2NZ8 B;  1WGQ A;  3D8E A;  4CYE A;  4L1R A;  1BTK A;  1UNQ A;  1MAI A;  2D10 A;  4HAU B;  4EKU A;  3NW8 A;  1I7A A;  1T77 A;  2FJL A;  2H7E A;  5J3Q A;  2D9W A;  3U8Z A;  1DBH A;  1MI1 A;  4HAZ B;  2ZKM X;  2DHI A;  3DXE A;  2DX1 A;  2D4Q A;  4HB0 B;  3ZVR A;  1U5D A;  1GG3 A;  3PG7 A;  2KIG A;  4WVF B;  3X23 A;  5DH9 B;  3ULB A;  4TYZ A;  5I2S A;  1UPQ A;  1DDW A;  4YON A;  5KQ1 A;  1EAZ A;  4ZRK A;  2D9Z A;  2DA0 A;  1FHW A;  5HE0 A;  3VIA A;  2R09 A;  1OMW A;  1ZM0 A;  2RLO A;  1NU2 A;  3CIK A;  3FSS A;  1DYN A;  2W2X D;  2R0D A;  2DYN A;  2V76 A;  1UEF A;  5JLJ B;  2CRF A;  3VOQ A;  1OY2 A;  2YS1 A;  1SHC A;  2VKI A;  2K8E A;  4MT7 A;  1EF1 A;  3P6A A;  2Q13 A;  1SGH A;  4K2P A;  1PLS A;  3TVV A;  3QIJ A;  4PNK A;  3SUZ A;  4WSF A;  3FM8 C;  1XKE A;  4MK0 A;  3HQC A;  3KZ1 A;  3A98 B;  2LUL A;  1ZYI A;  2CY4 A;  1FHO A;  3ZDT A;  2COA A;  2UVM A;  1ZSQ A;  2KGX B;  5CLQ B;  2I1J A;  1J0W A;  5DIF B;  2MWN B;  1P3R A;  3QBV B;  2YT1 A;  2ROZ B;  3PVL A;  2YVC A;  5JP4 A;  3PZD A;  1U5G A;  4K17 A;  1FAO A;  2YRY A;  1QC6 A;  1EGX A;  2DX5 A;  3HSA A;  3SO6 A;  1N3H A;  2KIE A;  2GJY A;  5JHG A;  5LON B;  4KHB A;  4Y94 A;  4A6F A;  1DDV A;  1H10 A;  2H7D A;  4GN1 A;  4HAX B;  5C79 A;  3SNH A;  2BCJ A;  2P0H A;  3PVW A;  3SV1 A;  3OAN A;  2N0Y A;  2P8V A;  2PZ1 A;  4KHA A;  1MKE A;  2EMS A;  4HB3 B;  3A58 A;  2VSZ A;  2KR0 A;  4MY6 A;  3HIE A;  5FI1 A;  1XD4 A;  2CY5 A;  3NWD A;  1P6S A;  4P7I A;  1DRO A;  2YSZ A;  4QJ4 B;  2QKM A;  1MPH A;  1FGY A;  1U27 A;  1ZC4 B;  4IFS A;  4CHM A;  1GC7 A;  1MIZ B;  2K2U A;  2ADZ A;  2UZS A;  2YS5 A;  5M4Y B;  2P0F A;  2J0M A;  5JHH A;  2GUM A;  2Z0O A;  2Y8G A;  3KY9 A;  4IAP A;  5LG4 B;  1X1F A;  1B55 A;  4HAW B;  4GMV A;  1FOE A;  1XR0 B;  3GYP A;  1K5G B;  2K00 A;  3RCP A;  4GPT B;  1I2H A;  3B77 A;  2D9Y A;  2MKR A;  4C0A A;  5HE3 A;  3M1I B;  4IOY X;  4A6K A;  3O96 A;  4GOU A;  1UPR A;  4ZRJ A;  4A6H A;  1TQZ A;  2IFS A;  5D27 A;  2D11 A;  3D8F A;  2ELB A;  1M7E A;  2J0J A;  3F0W A;  4F7G A;  2LG1 A;  3HW2 B;  5J3T A;  3PVU A;  2GS0 A;  1W1H A;  2NMB A;  1FHX A;  4HHV A;  4NY0 A;  1AQC A;  3ODW A;  2NBV A;  2RUK B;  1GC6 A;  4DXA B;  5C6R A;  4HSI A;  1PFJ A;  2IYB A;  3FEH A;  2MFQ A; 
#chains in the Genus database with same CATH homology
 1ZVR A;  3TFM A;  1KI1 B;  1X86 A;  1UNR A;  2L2I A;  1WJM A;  1WGU A;  3AU4 A;  1NI2 A;  2Y8F A;  3DXD A;  3CXB B;  2DN6 A;  4EMO A;  2DKQ A;  4ZRI A;  4DBB A;  2COC A;  2RVB B;  2DHJ A;  2I5C A;  3TCA A;  1V5P A;  3PP2 A;  1V61 A;  2J59 M;  3A8Q A;  4HB4 B;  5DHF B;  2JP2 A;  2KCJ A;  1BAK A;  1TXD A;  5J3Y A;  2XQN M;  4F7H A;  2LOZ A;  3F5R A;  4DX8 A;  5D3W A;  1KZG A;  1UNP A;  3U7D A;  2K2J A;  2E2X A;  3ULC A;  2W2W A;  2Z0P A;  2YS3 A;  4KVG B;  5C5B B;  2AEH A;  5KCV A;  4Z2M B;  1H4R A;  5D3V A;  3TW1 A;  2DHK A;  3P7Z A;  2GCL A;  4CHJ A;  1K5D B;  4Z2N A;  4GZU A;  1FGZ A;  5L81 A;  4K81 A;  2ZPY A;  5KQ4 A;  3WA0 A;  1NTV A;  3PEG A;  5C16 A;  1RRP B;  1IRS A;  2RGN B;  4XWX A;  5D3Y A;  2DTC A;  2Y7B A;  1NTY A;  4HDO A;  2EMT A;  1XOD A;  2HE7 A;  1U5F A;  2CAY A;  3IVF A;  2I1K A;  2OQB A;  1ZC3 B;  4KHO A;  2RNR B;  2KUP A;  1ISN A;  1W1G A;  2LKO A;  1DDM A;  1U5E A;  4D0N B;  4HDQ A;  5EFX A;  3N7C A;  1X11 A;  3AJ4 A;  1U29 A;  2HTH B;  4PQ0 A;  2ELA A;  4HAV B;  3KRX A;  4A5K A;  2YT0 A;  1EVH A;  3DXC A;  5LOP B;  2W2X C;  3BIN A;  3LJU X;  1Y5O A;  3PSC A;  4HAY B;  4BBK A;  1Q67 A;  1Y19 B;  1X1G A;  1J19 A;  3ODO A;  1MK7 B;  2M38 A;  2M14 A;  3KSY A;  2DLW A;  3NSU A;  1LW3 A;  3ML4 A;  2D9X A;  1V5M A;  3BJI A;  3D8D A;  1OQN A;  1V89 A;  3G9W A;  2COD A;  1PMS A;  2L1C A;  2VRW B;  2D2Q A;  3QWM A;  1V88 A;  1M7R A;  1XCG A;  3ODX A;  1BTN A;  2COF A;  1E5W A;  2J0K A;  3HK0 A;  2X18 A;  5HE1 A;  1W1D A;  1RJ2 A;  2EJ8 A;  1LB1 A;  3GYO A;  4HB2 B;  1XX0 A;  2N23 A;  5FI0 A;  2OTX A;  5DHA B;  3KRW A;  1BWN A;  1WI1 A;  5CLL B;  2AL6 A;  4YL8 A;  1WG7 A;  4DX9 0;  4GXB A;  4KAX B;  2GCJ A;  3MDB C;  2RSG A;  4NSW A;  2MDX A;  2UZR A;  5HE2 A;  1V5U A;  2G35 A;  3AU5 A;  2Z0Q A;  5GOW B;  4K2O A;  3WYF B;  1Z87 A;  3T06 A;  4H8S A;  1KZ7 A;  2LOX A;  2D9V A;  1AWE A;  2P0D A;  2ROV A;  4L6E A;  4KHB B;  3UZT A;  1TJ6 A;  2YF0 A;  4A6F B;  4F7U P;  3TO1 A;  1X05 A;  1MK9 B;  1QQG A;  4GMX B;  5C5B A;  4TKN A;  4HAT B;  2DFK A;  4WJ7 A;  5D3X A;  1WVH A;  2I5F A;  3V5W A;  4B6H A;  3SYX A;  2DKP A;  3A8P A;  2EC1 A;  1U2B A;  5DI9 B;  1FB8 A;  1MIX A;  2QKL A;  2DYQ A;  3MPX A;  1P5T A;  1WJ1 A;  2LYD A;  4EJN A;  2NZ8 B;  1WGQ A;  3D8E A;  4CYE A;  1BTK A;  1UNQ A;  1MAI A;  2D10 A;  4HAU B;  4EKU A;  1I7A A;  2FJL A;  2H7E A;  5J3Q A;  2D9W A;  3U8Z A;  1DBH A;  4HAZ B;  2DHI A;  3DXE A;  2DX1 A;  2D4Q A;  4HB0 B;  3ZVR A;  1U5D A;  1GG3 A;  3PG7 A;  4WVF B;  3X23 A;  5DH9 B;  3ULB A;  4TYZ A;  1UPQ A;  1DDW A;  4YON A;  5KQ1 A;  1EAZ A;  4ZRK A;  2D9Z A;  2DA0 A;  1FHW A;  5HE0 A;  3VIA A;  2R09 A;  1OMW A;  1ZM0 A;  2RLO A;  1NU2 A;  3CIK A;  3FSS A;  1DYN A;  2W2X D;  2R0D A;  2DYN A;  2V76 A;  1UEF A;  5JLJ B;  2CRF A;  3VOQ A;  1OY2 A;  2YS1 A;  1SHC A;  2VKI A;  4MT7 A;  1EF1 A;  3P6A A;  2Q13 A;  1SGH A;  4K2P A;  1PLS A;  3TVV A;  3QIJ A;  4PNK A;  3SUZ A;  4WSF A;  3FM8 C;  1XKE A;  4MK0 A;  3HQC A;  3KZ1 A;  3A98 B;  2LUL A;  2CY4 A;  1FHO A;  3ZDT A;  2COA A;  2UVM A;  1ZSQ A;  2KGX B;  5CLQ B;  2I1J A;  1J0W A;  5DIF B;  2MWN B;  1P3R A;  3QBV B;  2YT1 A;  2ROZ B;  3PVL A;  2YVC A;  5JP4 A;  3PZD A;  1U5G A;  4K17 A;  1FAO A;  2YRY A;  1QC6 A;  1EGX A;  2DX5 A;  3SO6 A;  1N3H A;  2GJY A;  5JHG A;  5LON B;  4Y94 A;  4A6F A;  1DDV A;  1H10 A;  2H7D A;  4GN1 A;  4HAX B;  5C79 A;  3SNH A;  2BCJ A;  2P0H A;  3PVW A;  3SV1 A;  3OAN A;  2N0Y A;  2P8V A;  2PZ1 A;  4KHA A;  1MKE A;  2EMS A;  4HB3 B;  2VSZ A;  4MY6 A;  5FI1 A;  1XD4 A;  2CY5 A;  1P6S A;  4P7I A;  1DRO A;  2YSZ A;  2QKM A;  1MPH A;  1FGY A;  1U27 A;  1ZC4 B;  4IFS A;  4CHM A;  1GC7 A;  1MIZ B;  2K2U A;  2ADZ A;  2UZS A;  2YS5 A;  2P0F A;  2J0M A;  5JHH A;  2Z0O A;  2Y8G A;  3KY9 A;  4IAP A;  1X1F A;  1B55 A;  4HAW B;  4GMV A;  1FOE A;  1XR0 B;  3GYP A;  1K5G B;  2K00 A;  3RCP A;  4GPT B;  1I2H A;  2D9Y A;  2MKR A;  4C0A A;  5HE3 A;  3M1I B;  4IOY X;  4A6K A;  3O96 A;  1UPR A;  4ZRJ A;  4A6H A;  1TQZ A;  2IFS A;  5D27 A;  2D11 A;  3D8F A;  2ELB A;  1M7E A;  2J0J A;  3F0W A;  4F7G A;  2LG1 A;  3HW2 B;  5J3T A;  3PVU A;  2GS0 A;  1W1H A;  2NMB A;  1FHX A;  4HHV A;  4NY0 A;  1AQC A;  3ODW A;  2RUK B;  1GC6 A;  4DXA B;  5C6R A;  1PFJ A;  2IYB A;  3FEH A;  2MFQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...