2RUKB

Solution structure of the complex between p53 transactivation domain 2 and tfiih p62 ph domain
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
108
structure length
108
Chain Sequence
MATSSEEVLLIVKKVRQKKQDGALYLMAERIAWAPEGKDRFTISHMYADIKCQKISPEGKAKIQLQLVLHAGDTTNFHFSNESTAVKERDAVKDLLQQLLPKFKRKAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords Cellular tumor antigen p53
publication title Extended String Binding Mode of the Phosphorylated Transactivation Domain of Tumor Suppressor p53
pubmed doi rcsb
source organism Homo sapiens
total genus 26
structure length 108
sequence length 108
ec nomenclature
pdb deposition date 2014-09-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF08567 PH_TFIIH TFIIH p62 subunit, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2rukB00
2COCA 1B55A 2Y8FA 5HE1A 2NMBA 4GMXB 2LG1A 1E5WA 4DBBA 1XD4A 5JHHA 4HAUB 4HHVA 2M38A 2K00A 1GC7A 4GXBA 2GCJA 3FEHA 1X86A 3X23A 2HTHB 4MY6A 1TQZA 3ML4A 3BINA 4A6KA 3TO1A 4HAZB 1ZC3B 1U5EA 4BBKA 2DYQA 1MPHA 2CY5A 2I1JA 3DXEA 1MK7B 3WA0A 4TYZA 3D8FA 3PVLA 2KGXB 1EF1A 4NSWA 2EMTA 2DYNA 2D9XA 1V89A 1ZVRA 2P0DA 2P0FA 3UZTA 2YS1A 4A5KA 1OY2A 1Y19B 2DHJA 5JLJB 1MAIA 3RCPA 1KZ7A 3A8PA 4GPTB 2LKOA 2QKLA 2I5FA 4ZRIA 2DX5A 1NTYA 3A98B 2D11A 1K5GB 1UNRA 3SYXA 1AQCA 1X1FA 4K2OA 5D3YA 4K81A 2YSZA 3ULBA 4DX90 4EMOA 3DXDA 2P0HA 3PP2A 1WJ1A 1ZC4B 1UPRA 3PG7A 2CRFA 2JP2A 2L1CA 2NZ8B 2RGNB 2D10A 4B6HA 2IYBA 2D2QA 3GYPA 5JHGA 4EJNA 1FHOA 2QKMA 3N7CA 2YRYA 2XQNM 4HAVB 1V61A 2IFSA 2CAYA 2EMSA 1U29A 5DI9B 1W1GA 5KQ1A 1LW3A 5J3YA 4F7HA 2YVCA 3O96A 1QC6A 1U5DA 1WJMA 2W2XC 2EC1A 3AJ4A 2ELBA 2LOZA 4TKNA 4HAWB 1IRSA 3D8EA 2COFA 2V76A 2DN6A 1J19A 2FJLA 2P8VA 5DH9B 2YS5A 3U8ZA 4GN1A 4KHOA 1W1HA 1Z87A 1UEFA 2AL6A 1MKEA 4A6FB 5C6RA 1Q67A 2ELAA 2VRWB 3HW2B 2K2UA 2DKQA 1NTVA 2UVMA 1V5MA 2RUKB 3KSYA 2G35A 4D0NB 3PZDA 1PLSA 5LONB 1DYNA 1U5FA 2GCLA 3KZ1A 4YONA 1AWEA 1BAKA 4XWXA 1J0WA 5C79A 1RJ2A 2LYDA 1H4RA 2M14A 5FI1A 3LJUX 4P7IA 3TW1A 2K2JA 3SUZA 1XKEA 3QIJA 4YL8A 1W1DA 5HE0A 3VIAA 1V5UA 1DDWA 3QWMA 2D9YA 3U7DA 1XODA 4C0AA 4HDOA 3KRWA 4HB3B 2YF0A 1DBHA 5L81A 2LULA 3SO6A 1FHXA 3OANA 2CY4A 2J0KA 4HDQA 2KUPA 3WYFB 4H8SA 1BTNA 2AEHA 2YT1A 1M7EA 3KY9A 3SNHA 2I5CA 2MWNB 2EJ8A 3ODWA 1XR0B 2Q13A 2VKIA 1KI1B 2H7EA 1ZSQA 2H7DA 4PQ0A 2MDXA 2D4QA 4MT7A 4K17A 4HB0B 2D9VA 1BWNA 5C5BA 3ODOA 4EKUA 4IAPA 4Z2NA 1P5TA 4HATB 2ROZB 5D3WA 2ROVA 1RRPB 2DHKA 3GYOA 3IVFA 1WG7A 3A8QA 3M1IB 1UPQA 4Z2MB 2Y8GA 1MIXA 1P3RA 4F7GA 4F7UP 3F0WA 2DA0A 4PNKA 2D9WA 2BCJA 1MK9B 2RVBB 3QBVB 3G9WA 1DDMA 3CIKA 2R09A 2Z0QA 2ZPYA 2VSZA 2DLWA 5D27A 3TCAA 1NI2A 5J3QA 2DFKA 3PSCA 1EAZA 4WJ7A 2I1KA 5D3VA 1NU2A 1FB8A 2DHIA 3ZDTA 1MIZB 2GJYA 2W2WA 3ODXA 1FOEA 1TJ6A 2Z0OA 1BTKA 2OQBA 2LOXA 3CXBB 1FAOA 5KQ4A 1V88A 3FM8C 2COAA 1SGHA 1UNQA 2DTCA 3F5RA 1Y5OA 1N3HA 5DHAB 1LB1A 3KRXA 5HE3A 5D3XA 1U2BA 1OMWA 2DKPA 4ZRKA 4A6HA 4KHAA 1P6SA 3VOQA 4GMVA 3P7ZA 2UZRA 2RNRB 3HQCA 1M7RA 2J59M 3MPXA 5FI0A 2N0YA 4GZUA 2HE7A 5CLQB 3NSUA 1ISNA 1WGUA 1FGYA 3TFMA 1TXDA 2DX1A 1EVHA 1GG3A 1PMSA 1UNPA 2KCJA 3ULCA 4HB2B 5JP4A 3FSSA 1U27A 1X05A 5GOWB 2D9ZA 4K2PA 5C16A 1DROA 4L6EA 4KVGB 5KCVA 3SV1A 3D8DA 4IFSA 5CLLB 2J0MA 1GC6A 3HK0A 4NY0A 1ZM0A 2MKRA 4HAYB 5HE2A 4A6FA 3DXCA 1DDVA 3AU4A 4DXAB 1V5PA 2ADZA 2Z0PA 3PVWA 1QQGA 4IOYX 4HAXB 1XCGA 1U5GA 1KZGA 2OTXA 5DIFB 1WGQA 3ZVRA 3P6AA 5EFXA 1I7AA 1K5DB 2Y7BA 1FGZA 3AU5A 3PEGA 4DX8A 4KHBB 1EGXA 5LOPB 3MDBC 2PZ1A 4ZRJA 2YT0A 4CYEA 1X1GA 3T06A 2W2XD 5DHFB 4WSFA 4MK0A 3BJIA 3TVVA 2CODA 2MFQA 1WI1A 3PVUA 1FHWA 2GS0A 1WVHA 1X11A 2UZSA 1OQNA 4HB4B 2RSGA 2YS3A 5J3TA 1H10A 2L2IA 2X18A 2RLOA 1XX0A 1I2HA 1PFJA 4WVFB 2J0JA 2N23A 4KAXB 4CHJA 4CHMA 2R0DA 4Y94A 1SHCA 2E2XA 5C5BB 3V5WA
chains in the Genus database with same CATH superfamily
2COCA 1B55A 5IRSA 2Y8FA 5HE1A 2NMBA 4GMXB 2LG1A 1E5WA 4DBBA 1XD4A 5JHHA 4HAUB 4HHVA 1T77A 2M38A 2K00A 1GC7A 4GXBA 2Z13A 2GCJA 2K8EA 3FEHA 1X86A 3X23A 2HTHB 4MY6A 1TQZA 3ML4A 3BINA 4A6KA 3TO1A 4HAZB 1ZC3B 1U5EA 4BBKA 4QJ5B 2DYQA 1MPHA 2CY5A 2I1JA 3DXEA 1MK7B 3WA0A 4TYZA 3D8FA 3PVLA 2KGXB 2Z4DA 1EF1A 4NSWA 2EMTA 2DYNA 2D9XA 1V89A 1ZVRA 2P0DA 2P0FA 3UZTA 2YS1A 4A5KA 1OY2A 1Y19B 2DHJA 4HSIA 5JLJB 1MAIA 3RCPA 1KZ7A 3A8PA 4GPTB 3NWFA 4OT1A 2LKOA 2QKLA 2I5FA 4ZRIA 2DX5A 1NTYA 3A98B 2D11A 2FJUB 1K5GB 1UNRA 4QXAB 3SYXA 1AQCA 5LG4B 1X1FA 4K2OA 5D3YA 4K81A 2YSZA 4D6WA 3ULBA 4DX90 4EMOA 3DXDA 3U12A 2P0HA 3PP2A 1WJ1A 1ZC4B 1UPRA 3PG7A 2CRFA 2JP2A 2L1CA 2NZ8B 2RGNB 2D10A 4L1RA 4B6HA 2IYBA 2D2QA 3GYPA 5JHGA 4EJNA 1FHOA 2QKMA 3N7CA 2YRYA 2XQNM 4HAVB 1V61A 2IFSA 2CAYA 2EMSA 1U29A 5I2SA 5DI9B 1W1GA 5KQ1A 1LW3A 5J3YA 4F7HA 2YVCA 3O96A 1QC6A 1U5DA 1WJMA 2W2XC 2EC1A 3AJ4A 2ELBA 2LOZA 4TKNA 4HAWB 1IRSA 3D8EA 2COFA 2R2YA 4CSQA 2V76A 2DN6A 1J19A 2FJLA 2P8VA 5DH9B 2YS5A 3U8ZA 4GN1A 4KHOA 1W1HA 1Z87A 1UEFA 2AL6A 3NWDA 1MKEA 4A6FB 3B77A 5C6RA 1Q67A 2ELAA 2VRWB 3HW2B 2K2UA 2DKQA 1NTVA 2UVMA 1V5MA 2RUKB 3A58A 3KSYA 2G35A 4QJ4B 4D0NB 3PZDA 3OHMB 1PLSA 5LONB 1DYNA 1U5FA 2GCLA 3KZ1A 4GOUA 4YONA 1AWEA 1BAKA 4XWXA 1J0WA 5C79A 5M4YB 1RJ2A 2LYDA 1H4RA 2M14A 5FI1A 3LJUX 4P7IA 3TW1A 2K2JA 3SUZA 1XKEA 3QIJA 4YL8A 1W1DA 5HE0A 3VIAA 1V5UA 1DDWA 3QWMA 2D9YA 3U7DA 3NWAA 1XODA 4C0AA 4HDOA 3KRWA 4HB3B 2YF0A 1DBHA 4KHBA 5L81A 2LULA 3SO6A 1FHXA 3OANA 5I2MA 2Z14A 4GNKB 2CY4A 2J0KA 4HDQA 2KUPA 3WYFB 4H8SA 1BTNA 2AEHA 2YT1A 1M7EA 3KY9A 3SNHA 2I5CA 2MWNB 2EJ8A 3ODWA 1XR0B 2Q13A 3NW8A 2VKIA 1KI1B 2H7EA 1ZSQA 2H7DA 4PQ0A 2MDXA 2D4QA 4MT7A 4K17A 4HB0B 2D9VA 2YT2A 2KIEA 1BWNA 2ZKMX 5C5BA 3ODOA 4EKUA 4IAPA 4Z2NA 1P5TA 4HATB 2ROZB 5D3WA 2ROVA 1RRPB 2DHKA 3GYOA 3IVFA 1WG7A 3A8QA 3M1IB 1UPQA 4Z2MB 2Y8GA 1MIXA 1P3RA 4F7GA 4F7UP 3F0WA 2DA0A 4PNKA 2D9WA 2BCJA 1MK9B 2RVBB 3QBVB 3G9WA 1DDMA 3CIKA 2R09A 2GUMA 3FVCA 2Z0QA 2ZPYA 2VSZA 2DLWA 5D27A 3TCAA 1NI2A 5J3QA 2DFKA 4DIXA 3PSCA 1EAZA 4WJ7A 2I1KA 5D3VA 1NU2A 1FB8A 2DHIA 2K49A 3ZDTA 1MIZB 2GJYA 2W2WA 3ODXA 1FOEA 1TJ6A 2Z0OA 1BTKA 2OQBA 2LOXA 3CXBB 4QJ3B 1FAOA 5KQ4A 1V88A 3FM8C 2COAA 1SGHA 1UNQA 2DTCA 3F5RA 1Y5OA 1N3HA 5DHAB 1LB1A 3KRXA 5HE3A 5D3XA 1U2BA 1OMWA 2DKPA 4ZRKA 4A6HA 4KHAA 1P6SA 2KUQA 3VOQA 4GMVA 3P7ZA 2UZRA 2RNRB 3HIEA 3HQCA 1M7RA 2J59M 3MPXA 5FI0A 2N0YA 4GZUA 2HE7A 5CLQB 3NSUA 2NBVA 1ISNA 1WGUA 1FGYA 3TFMA 1MI1A 1TXDA 2DX1A 2RRFA 1EVHA 1GG3A 1PMSA 1UNPA 2KCJA 3ULCA 4HB2B 5JP4A 3FSSA 1U27A 1X05A 2Z59A 5GOWB 2D9ZA 4K2PA 5C16A 1DROA 4L6EA 4KVGB 5KCVA 3SV1A 3D8DA 4IFSA 5CLLB 2J0MA 1GC6A 3HK0A 4NY0A 1ZM0A 2MKRA 4HAYB 5HE2A 4A6FA 1ZYIA 3DXCA 1DDVA 3AU4A 2KR0A 4DXAB 1V5PA 2ADZA 2Z0PA 3PVWA 4OSNA 1QQGA 4IOYX 4HAXB 1XCGA 3HSAA 1U5GA 1KZGA 2OTXA 5DIFB 1WGQA 3ZVRA 3P6AA 5EFXA 1I7AA 1K5DB 2Y7BA 1FGZA 3AU5A 3PEGA 4DX8A 4KHBB 1EGXA 5LOPB 3MDBC 2PZ1A 4ZRJA 2YT0A 4CYEA 1X1GA 3T06A 2W2XD 5DHFB 4WSFA 4MK0A 3BJIA 3TVVA 2CODA 2MFQA 1WI1A 3PVUA 1FHWA 2GS0A 1WVHA 1X11A 2UZSA 1OQNA 4HB4B 2RSGA 2YS3A 3DCXA 5J3TA 1H10A 2L2IA 2X18A 2RLOA 1XX0A 1I2HA 1PFJA 4WVFB 2J0JA 2N23A 4KAXB 4CHJA 4CHMA 2R0DA 2KIGA 4Y94A 1SHCA 2E2XA 5C5BB 3V5WA
chains in the Genus database with same CATH topology
2COCA 1B55A 2Y8FA 5HE1A 2NMBA 4GMXB 2LG1A 1E5WA 4DBBA 1XD4A 5JHHA 4HAUB 4HHVA 2M38A 2K00A 1GC7A 4GXBA 2GCJA 3FEHA 1X86A 3X23A 2HTHB 4MY6A 1TQZA 3ML4A 3BINA 4A6KA 3TO1A 4HAZB 1ZC3B 1U5EA 4BBKA 2DYQA 1MPHA 2CY5A 2I1JA 3DXEA 1MK7B 3WA0A 4TYZA 3D8FA 3PVLA 2KGXB 1EF1A 4NSWA 2EMTA 2DYNA 2D9XA 1V89A 1ZVRA 2P0DA 2P0FA 3UZTA 2YS1A 4A5KA 1OY2A 1Y19B 2DHJA 5JLJB 1MAIA 3RCPA 1KZ7A 3A8PA 4GPTB 2LKOA 2QKLA 2I5FA 4ZRIA 2DX5A 1NTYA 3A98B 2D11A 1K5GB 1UNRA 3SYXA 1AQCA 1X1FA 4K2OA 5D3YA 4K81A 2YSZA 3ULBA 4DX90 4EMOA 3DXDA 2P0HA 3PP2A 1WJ1A 1ZC4B 1UPRA 3PG7A 2CRFA 2JP2A 2L1CA 2NZ8B 2RGNB 2D10A 4B6HA 2IYBA 2D2QA 3GYPA 5JHGA 4EJNA 1FHOA 2QKMA 3N7CA 2YRYA 2XQNM 4HAVB 1V61A 2IFSA 2CAYA 2EMSA 1U29A 5DI9B 1W1GA 5KQ1A 1LW3A 5J3YA 4F7HA 2YVCA 3O96A 1QC6A 1U5DA 1WJMA 2W2XC 2EC1A 3AJ4A 2ELBA 2LOZA 4TKNA 4HAWB 1IRSA 3D8EA 2COFA 2V76A 2DN6A 1J19A 2FJLA 2P8VA 5DH9B 2YS5A 3U8ZA 4GN1A 4KHOA 1W1HA 1Z87A 1UEFA 2AL6A 1MKEA 4A6FB 5C6RA 1Q67A 2ELAA 2VRWB 3HW2B 2K2UA 2DKQA 1NTVA 2UVMA 1V5MA 2RUKB 3KSYA 2G35A 4D0NB 3PZDA 1PLSA 5LONB 1DYNA 1U5FA 2GCLA 3KZ1A 4YONA 1AWEA 1BAKA 4XWXA 1J0WA 5C79A 1RJ2A 2LYDA 1H4RA 2M14A 5FI1A 3LJUX 4P7IA 3TW1A 2K2JA 3SUZA 1XKEA 3QIJA 4YL8A 1W1DA 5HE0A 3VIAA 1V5UA 1DDWA 3QWMA 2D9YA 3U7DA 1XODA 4C0AA 4HDOA 3KRWA 4HB3B 2YF0A 1DBHA 5L81A 2LULA 3SO6A 1FHXA 3OANA 2CY4A 2J0KA 4HDQA 2KUPA 3WYFB 4H8SA 1BTNA 2AEHA 2YT1A 1M7EA 3KY9A 3SNHA 2I5CA 2MWNB 2EJ8A 3ODWA 1XR0B 2Q13A 2VKIA 1KI1B 2H7EA 1ZSQA 2H7DA 4PQ0A 2MDXA 2D4QA 4MT7A 4K17A 4HB0B 2D9VA 1BWNA 5C5BA 3ODOA 4EKUA 4IAPA 4Z2NA 1P5TA 4HATB 2ROZB 5D3WA 2ROVA 1RRPB 2DHKA 3GYOA 3IVFA 1WG7A 3A8QA 3M1IB 1UPQA 4Z2MB 2Y8GA 1MIXA 1P3RA 4F7GA 4F7UP 3F0WA 2DA0A 4PNKA 2D9WA 2BCJA 1MK9B 2RVBB 3QBVB 3G9WA 1DDMA 3CIKA 2R09A 2Z0QA 2ZPYA 2VSZA 2DLWA 5D27A 3TCAA 1NI2A 5J3QA 2DFKA 3PSCA 1EAZA 4WJ7A 2I1KA 5D3VA 1NU2A 1FB8A 2DHIA 3ZDTA 1MIZB 2GJYA 2W2WA 3ODXA 1FOEA 1TJ6A 2Z0OA 1BTKA 2OQBA 2LOXA 3CXBB 1FAOA 5KQ4A 1V88A 3FM8C 2COAA 1SGHA 1UNQA 2DTCA 3F5RA 1Y5OA 1N3HA 5DHAB 1LB1A 3KRXA 5HE3A 5D3XA 1U2BA 1OMWA 2DKPA 4ZRKA 4A6HA 4KHAA 1P6SA 3VOQA 4GMVA 3P7ZA 2UZRA 2RNRB 3HQCA 1M7RA 2J59M 3MPXA 5FI0A 2N0YA 4GZUA 2HE7A 5CLQB 3NSUA 1ISNA 1WGUA 1FGYA 3TFMA 1TXDA 2DX1A 1EVHA 1GG3A 1PMSA 1UNPA 2KCJA 3ULCA 4HB2B 5JP4A 3FSSA 1U27A 1X05A 5GOWB 2D9ZA 4K2PA 5C16A 1DROA 4L6EA 4KVGB 5KCVA 3SV1A 3D8DA 4IFSA 5CLLB 2J0MA 1GC6A 3HK0A 4NY0A 1ZM0A 2MKRA 4HAYB 5HE2A 4A6FA 3DXCA 1DDVA 3AU4A 4DXAB 1V5PA 2ADZA 2Z0PA 3PVWA 1QQGA 4IOYX 4HAXB 1XCGA 1U5GA 1KZGA 2OTXA 5DIFB 1WGQA 3ZVRA 3P6AA 5EFXA 1I7AA 1K5DB 2Y7BA 1FGZA 3AU5A 3PEGA 4DX8A 4KHBB 1EGXA 5LOPB 3MDBC 2PZ1A 4ZRJA 2YT0A 4CYEA 1X1GA 3T06A 2W2XD 5DHFB 4WSFA 4MK0A 3BJIA 3TVVA 2CODA 2MFQA 1WI1A 3PVUA 1FHWA 2GS0A 1WVHA 1X11A 2UZSA 1OQNA 4HB4B 2RSGA 2YS3A 5J3TA 1H10A 2L2IA 2X18A 2RLOA 1XX0A 1I2HA 1PFJA 4WVFB 2J0JA 2N23A 4KAXB 4CHJA 4CHMA 2R0DA 4Y94A 1SHCA 2E2XA 5C5BB 3V5WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2COC A;  1B55 A;  2Y8F A;  5HE1 A;  2NMB A;  4GMX B;  2LG1 A;  1E5W A;  4DBB A;  1XD4 A;  5JHH A;  4HAU B;  4HHV A;  2M38 A;  2K00 A;  1GC7 A;  4GXB A;  2GCJ A;  3FEH A;  1X86 A;  3X23 A;  2HTH B;  4MY6 A;  1TQZ A;  3ML4 A;  3BIN A;  4A6K A;  3TO1 A;  4HAZ B;  1ZC3 B;  1U5E A;  4BBK A;  2DYQ A;  1MPH A;  2CY5 A;  2I1J A;  3DXE A;  1MK7 B;  3WA0 A;  4TYZ A;  3D8F A;  3PVL A;  2KGX B;  1EF1 A;  4NSW A;  2EMT A;  2DYN A;  2D9X A;  1V89 A;  1ZVR A;  2P0D A;  2P0F A;  3UZT A;  2YS1 A;  4A5K A;  1OY2 A;  1Y19 B;  2DHJ A;  5JLJ B;  1MAI A;  3RCP A;  1KZ7 A;  3A8P A;  4GPT B;  2LKO A;  2QKL A;  2I5F A;  4ZRI A;  2DX5 A;  1NTY A;  3A98 B;  2D11 A;  1K5G B;  1UNR A;  3SYX A;  1AQC A;  1X1F A;  4K2O A;  5D3Y A;  4K81 A;  2YSZ A;  3ULB A;  4DX9 0;  4EMO A;  3DXD A;  2P0H A;  3PP2 A;  1WJ1 A;  1ZC4 B;  1UPR A;  3PG7 A;  2CRF A;  2JP2 A;  2L1C A;  2NZ8 B;  2RGN B;  2D10 A;  4B6H A;  2IYB A;  2D2Q A;  3GYP A;  5JHG A;  4EJN A;  1FHO A;  2QKM A;  3N7C A;  2YRY A;  2XQN M;  4HAV B;  1V61 A;  2IFS A;  2CAY A;  2EMS A;  1U29 A;  5DI9 B;  1W1G A;  5KQ1 A;  1LW3 A;  5J3Y A;  4F7H A;  2YVC A;  3O96 A;  1QC6 A;  1U5D A;  1WJM A;  2W2X C;  2EC1 A;  3AJ4 A;  2ELB A;  2LOZ A;  4TKN A;  4HAW B;  1IRS A;  3D8E A;  2COF A;  2V76 A;  2DN6 A;  1J19 A;  2FJL A;  2P8V A;  5DH9 B;  2YS5 A;  3U8Z A;  4GN1 A;  4KHO A;  1W1H A;  1Z87 A;  1UEF A;  2AL6 A;  1MKE A;  4A6F B;  5C6R A;  1Q67 A;  2ELA A;  2VRW B;  3HW2 B;  2K2U A;  2DKQ A;  1NTV A;  2UVM A;  1V5M A;  2RUK B;  3KSY A;  2G35 A;  4D0N B;  3PZD A;  1PLS A;  5LON B;  1DYN A;  1U5F A;  2GCL A;  3KZ1 A;  4YON A;  1AWE A;  1BAK A;  4XWX A;  1J0W A;  5C79 A;  1RJ2 A;  2LYD A;  1H4R A;  2M14 A;  5FI1 A;  3LJU X;  4P7I A;  3TW1 A;  2K2J A;  3SUZ A;  1XKE A;  3QIJ A;  4YL8 A;  1W1D A;  5HE0 A;  3VIA A;  1V5U A;  1DDW A;  3QWM A;  2D9Y A;  3U7D A;  1XOD A;  4C0A A;  4HDO A;  3KRW A;  4HB3 B;  2YF0 A;  1DBH A;  5L81 A;  2LUL A;  3SO6 A;  1FHX A;  3OAN A;  2CY4 A;  2J0K A;  4HDQ A;  2KUP A;  3WYF B;  4H8S A;  1BTN A;  2AEH A;  2YT1 A;  1M7E A;  3KY9 A;  3SNH A;  2I5C A;  2MWN B;  2EJ8 A;  3ODW A;  1XR0 B;  2Q13 A;  2VKI A;  1KI1 B;  2H7E A;  1ZSQ A;  2H7D A;  4PQ0 A;  2MDX A;  2D4Q A;  4MT7 A;  4K17 A;  4HB0 B;  2D9V A;  1BWN A;  5C5B A;  3ODO A;  4EKU A;  4IAP A;  4Z2N A;  1P5T A;  4HAT B;  2ROZ B;  5D3W A;  2ROV A;  1RRP B;  2DHK A;  3GYO A;  3IVF A;  1WG7 A;  3A8Q A;  3M1I B;  1UPQ A;  4Z2M B;  2Y8G A;  1MIX A;  1P3R A;  4F7G A;  4F7U P;  3F0W A;  2DA0 A;  4PNK A;  2D9W A;  2BCJ A;  1MK9 B;  2RVB B;  3QBV B;  3G9W A;  1DDM A;  3CIK A;  2R09 A;  2Z0Q A;  2ZPY A;  2VSZ A;  2DLW A;  5D27 A;  3TCA A;  1NI2 A;  5J3Q A;  2DFK A;  3PSC A;  1EAZ A;  4WJ7 A;  2I1K A;  5D3V A;  1NU2 A;  1FB8 A;  2DHI A;  3ZDT A;  1MIZ B;  2GJY A;  2W2W A;  3ODX A;  1FOE A;  1TJ6 A;  2Z0O A;  1BTK A;  2OQB A;  2LOX A;  3CXB B;  1FAO A;  5KQ4 A;  1V88 A;  3FM8 C;  2COA A;  1SGH A;  1UNQ A;  2DTC A;  3F5R A;  1Y5O A;  1N3H A;  5DHA B;  1LB1 A;  3KRX A;  5HE3 A;  5D3X A;  1U2B A;  1OMW A;  2DKP A;  4ZRK A;  4A6H A;  4KHA A;  1P6S A;  3VOQ A;  4GMV A;  3P7Z A;  2UZR A;  2RNR B;  3HQC A;  1M7R A;  2J59 M;  3MPX A;  5FI0 A;  2N0Y A;  4GZU A;  2HE7 A;  5CLQ B;  3NSU A;  1ISN A;  1WGU A;  1FGY A;  3TFM A;  1TXD A;  2DX1 A;  1EVH A;  1GG3 A;  1PMS A;  1UNP A;  2KCJ A;  3ULC A;  4HB2 B;  5JP4 A;  3FSS A;  1U27 A;  1X05 A;  5GOW B;  2D9Z A;  4K2P A;  5C16 A;  1DRO A;  4L6E A;  4KVG B;  5KCV A;  3SV1 A;  3D8D A;  4IFS A;  5CLL B;  2J0M A;  1GC6 A;  3HK0 A;  4NY0 A;  1ZM0 A;  2MKR A;  4HAY B;  5HE2 A;  4A6F A;  3DXC A;  1DDV A;  3AU4 A;  4DXA B;  1V5P A;  2ADZ A;  2Z0P A;  3PVW A;  1QQG A;  4IOY X;  4HAX B;  1XCG A;  1U5G A;  1KZG A;  2OTX A;  5DIF B;  1WGQ A;  3ZVR A;  3P6A A;  5EFX A;  1I7A A;  1K5D B;  2Y7B A;  1FGZ A;  3AU5 A;  3PEG A;  4DX8 A;  4KHB B;  1EGX A;  5LOP B;  3MDB C;  2PZ1 A;  4ZRJ A;  2YT0 A;  4CYE A;  1X1G A;  3T06 A;  2W2X D;  5DHF B;  4WSF A;  4MK0 A;  3BJI A;  3TVV A;  2COD A;  2MFQ A;  1WI1 A;  3PVU A;  1FHW A;  2GS0 A;  1WVH A;  1X11 A;  2UZS A;  1OQN A;  4HB4 B;  2RSG A;  2YS3 A;  5J3T A;  1H10 A;  2L2I A;  2X18 A;  2RLO A;  1XX0 A;  1I2H A;  1PFJ A;  4WVF B;  2J0J A;  2N23 A;  4KAX B;  4CHJ A;  4CHM A;  2R0D A;  4Y94 A;  1SHC A;  2E2X A;  5C5B B;  3V5W A; 
#chains in the Genus database with same CATH topology
 2COC A;  1B55 A;  5IRS A;  2Y8F A;  5HE1 A;  2NMB A;  4GMX B;  2LG1 A;  1E5W A;  4DBB A;  1XD4 A;  5JHH A;  4HAU B;  4HHV A;  1T77 A;  2M38 A;  2K00 A;  1GC7 A;  4GXB A;  2Z13 A;  2GCJ A;  2K8E A;  3FEH A;  1X86 A;  3X23 A;  2HTH B;  4MY6 A;  1TQZ A;  3ML4 A;  3BIN A;  4A6K A;  3TO1 A;  4HAZ B;  1ZC3 B;  1U5E A;  4BBK A;  4QJ5 B;  2DYQ A;  1MPH A;  2CY5 A;  2I1J A;  3DXE A;  1MK7 B;  3WA0 A;  4TYZ A;  3D8F A;  3PVL A;  2KGX B;  2Z4D A;  1EF1 A;  4NSW A;  2EMT A;  2DYN A;  2D9X A;  1V89 A;  1ZVR A;  2P0D A;  2P0F A;  3UZT A;  2YS1 A;  4A5K A;  1OY2 A;  1Y19 B;  2DHJ A;  4HSI A;  5JLJ B;  1MAI A;  3RCP A;  1KZ7 A;  3A8P A;  4GPT B;  3NWF A;  4OT1 A;  2LKO A;  2QKL A;  2I5F A;  4ZRI A;  2DX5 A;  1NTY A;  3A98 B;  2D11 A;  2FJU B;  1K5G B;  1UNR A;  4QXA B;  3SYX A;  1AQC A;  5LG4 B;  1X1F A;  4K2O A;  5D3Y A;  4K81 A;  2YSZ A;  4D6W A;  3ULB A;  4DX9 0;  4EMO A;  3DXD A;  3U12 A;  2P0H A;  3PP2 A;  1WJ1 A;  1ZC4 B;  1UPR A;  3PG7 A;  2CRF A;  2JP2 A;  2L1C A;  2NZ8 B;  2RGN B;  2D10 A;  4L1R A;  4B6H A;  2IYB A;  2D2Q A;  3GYP A;  5JHG A;  4EJN A;  1FHO A;  2QKM A;  3N7C A;  2YRY A;  2XQN M;  4HAV B;  1V61 A;  2IFS A;  2CAY A;  2EMS A;  1U29 A;  5I2S A;  5DI9 B;  1W1G A;  5KQ1 A;  1LW3 A;  5J3Y A;  4F7H A;  2YVC A;  3O96 A;  1QC6 A;  1U5D A;  1WJM A;  2W2X C;  2EC1 A;  3AJ4 A;  2ELB A;  2LOZ A;  4TKN A;  4HAW B;  1IRS A;  3D8E A;  2COF A;  2R2Y A;  4CSQ A;  2V76 A;  2DN6 A;  1J19 A;  2FJL A;  2P8V A;  5DH9 B;  2YS5 A;  3U8Z A;  4GN1 A;  4KHO A;  1W1H A;  1Z87 A;  1UEF A;  2AL6 A;  3NWD A;  1MKE A;  4A6F B;  3B77 A;  5C6R A;  1Q67 A;  2ELA A;  2VRW B;  3HW2 B;  2K2U A;  2DKQ A;  1NTV A;  2UVM A;  1V5M A;  2RUK B;  3A58 A;  3KSY A;  2G35 A;  4QJ4 B;  4D0N B;  3PZD A;  3OHM B;  1PLS A;  5LON B;  1DYN A;  1U5F A;  2GCL A;  3KZ1 A;  4GOU A;  4YON A;  1AWE A;  1BAK A;  4XWX A;  1J0W A;  5C79 A;  5M4Y B;  1RJ2 A;  2LYD A;  1H4R A;  2M14 A;  5FI1 A;  3LJU X;  4P7I A;  3TW1 A;  2K2J A;  3SUZ A;  1XKE A;  3QIJ A;  4YL8 A;  1W1D A;  5HE0 A;  3VIA A;  1V5U A;  1DDW A;  3QWM A;  2D9Y A;  3U7D A;  3NWA A;  1XOD A;  4C0A A;  4HDO A;  3KRW A;  4HB3 B;  2YF0 A;  1DBH A;  4KHB A;  5L81 A;  2LUL A;  3SO6 A;  1FHX A;  3OAN A;  5I2M A;  2Z14 A;  4GNK B;  2CY4 A;  2J0K A;  4HDQ A;  2KUP A;  3WYF B;  4H8S A;  1BTN A;  2AEH A;  2YT1 A;  1M7E A;  3KY9 A;  3SNH A;  2I5C A;  2MWN B;  2EJ8 A;  3ODW A;  1XR0 B;  2Q13 A;  3NW8 A;  2VKI A;  1KI1 B;  2H7E A;  1ZSQ A;  2H7D A;  4PQ0 A;  2MDX A;  2D4Q A;  4MT7 A;  4K17 A;  4HB0 B;  2D9V A;  2YT2 A;  2KIE A;  1BWN A;  2ZKM X;  5C5B A;  3ODO A;  4EKU A;  4IAP A;  4Z2N A;  1P5T A;  4HAT B;  2ROZ B;  5D3W A;  2ROV A;  1RRP B;  2DHK A;  3GYO A;  3IVF A;  1WG7 A;  3A8Q A;  3M1I B;  1UPQ A;  4Z2M B;  2Y8G A;  1MIX A;  1P3R A;  4F7G A;  4F7U P;  3F0W A;  2DA0 A;  4PNK A;  2D9W A;  2BCJ A;  1MK9 B;  2RVB B;  3QBV B;  3G9W A;  1DDM A;  3CIK A;  2R09 A;  2GUM A;  3FVC A;  2Z0Q A;  2ZPY A;  2VSZ A;  2DLW A;  5D27 A;  3TCA A;  1NI2 A;  5J3Q A;  2DFK A;  4DIX A;  3PSC A;  1EAZ A;  4WJ7 A;  2I1K A;  5D3V A;  1NU2 A;  1FB8 A;  2DHI A;  2K49 A;  3ZDT A;  1MIZ B;  2GJY A;  2W2W A;  3ODX A;  1FOE A;  1TJ6 A;  2Z0O A;  1BTK A;  2OQB A;  2LOX A;  3CXB B;  4QJ3 B;  1FAO A;  5KQ4 A;  1V88 A;  3FM8 C;  2COA A;  1SGH A;  1UNQ A;  2DTC A;  3F5R A;  1Y5O A;  1N3H A;  5DHA B;  1LB1 A;  3KRX A;  5HE3 A;  5D3X A;  1U2B A;  1OMW A;  2DKP A;  4ZRK A;  4A6H A;  4KHA A;  1P6S A;  2KUQ A;  3VOQ A;  4GMV A;  3P7Z A;  2UZR A;  2RNR B;  3HIE A;  3HQC A;  1M7R A;  2J59 M;  3MPX A;  5FI0 A;  2N0Y A;  4GZU A;  2HE7 A;  5CLQ B;  3NSU A;  2NBV A;  1ISN A;  1WGU A;  1FGY A;  3TFM A;  1MI1 A;  1TXD A;  2DX1 A;  2RRF A;  1EVH A;  1GG3 A;  1PMS A;  1UNP A;  2KCJ A;  3ULC A;  4HB2 B;  5JP4 A;  3FSS A;  1U27 A;  1X05 A;  2Z59 A;  5GOW B;  2D9Z A;  4K2P A;  5C16 A;  1DRO A;  4L6E A;  4KVG B;  5KCV A;  3SV1 A;  3D8D A;  4IFS A;  5CLL B;  2J0M A;  1GC6 A;  3HK0 A;  4NY0 A;  1ZM0 A;  2MKR A;  4HAY B;  5HE2 A;  4A6F A;  1ZYI A;  3DXC A;  1DDV A;  3AU4 A;  2KR0 A;  4DXA B;  1V5P A;  2ADZ A;  2Z0P A;  3PVW A;  4OSN A;  1QQG A;  4IOY X;  4HAX B;  1XCG A;  3HSA A;  1U5G A;  1KZG A;  2OTX A;  5DIF B;  1WGQ A;  3ZVR A;  3P6A A;  5EFX A;  1I7A A;  1K5D B;  2Y7B A;  1FGZ A;  3AU5 A;  3PEG A;  4DX8 A;  4KHB B;  1EGX A;  5LOP B;  3MDB C;  2PZ1 A;  4ZRJ A;  2YT0 A;  4CYE A;  1X1G A;  3T06 A;  2W2X D;  5DHF B;  4WSF A;  4MK0 A;  3BJI A;  3TVV A;  2COD A;  2MFQ A;  1WI1 A;  3PVU A;  1FHW A;  2GS0 A;  1WVH A;  1X11 A;  2UZS A;  1OQN A;  4HB4 B;  2RSG A;  2YS3 A;  3DCX A;  5J3T A;  1H10 A;  2L2I A;  2X18 A;  2RLO A;  1XX0 A;  1I2H A;  1PFJ A;  4WVF B;  2J0J A;  2N23 A;  4KAX B;  4CHJ A;  4CHM A;  2R0D A;  2KIG A;  4Y94 A;  1SHC A;  2E2X A;  5C5B B;  3V5W A; 
#chains in the Genus database with same CATH homology
 2COC A;  1B55 A;  2Y8F A;  5HE1 A;  2NMB A;  4GMX B;  2LG1 A;  1E5W A;  4DBB A;  1XD4 A;  5JHH A;  4HAU B;  4HHV A;  2M38 A;  2K00 A;  1GC7 A;  4GXB A;  2GCJ A;  3FEH A;  1X86 A;  3X23 A;  2HTH B;  4MY6 A;  1TQZ A;  3ML4 A;  3BIN A;  4A6K A;  3TO1 A;  4HAZ B;  1ZC3 B;  1U5E A;  4BBK A;  2DYQ A;  1MPH A;  2CY5 A;  2I1J A;  3DXE A;  1MK7 B;  3WA0 A;  4TYZ A;  3D8F A;  3PVL A;  2KGX B;  1EF1 A;  4NSW A;  2EMT A;  2DYN A;  2D9X A;  1V89 A;  1ZVR A;  2P0D A;  2P0F A;  3UZT A;  2YS1 A;  4A5K A;  1OY2 A;  1Y19 B;  2DHJ A;  5JLJ B;  1MAI A;  3RCP A;  1KZ7 A;  3A8P A;  4GPT B;  2LKO A;  2QKL A;  2I5F A;  4ZRI A;  2DX5 A;  1NTY A;  3A98 B;  2D11 A;  1K5G B;  1UNR A;  3SYX A;  1AQC A;  1X1F A;  4K2O A;  5D3Y A;  4K81 A;  2YSZ A;  3ULB A;  4DX9 0;  4EMO A;  3DXD A;  2P0H A;  3PP2 A;  1WJ1 A;  1ZC4 B;  1UPR A;  3PG7 A;  2CRF A;  2JP2 A;  2L1C A;  2NZ8 B;  2RGN B;  2D10 A;  4B6H A;  2IYB A;  2D2Q A;  3GYP A;  5JHG A;  4EJN A;  1FHO A;  2QKM A;  3N7C A;  2YRY A;  2XQN M;  4HAV B;  1V61 A;  2IFS A;  2CAY A;  2EMS A;  1U29 A;  5DI9 B;  1W1G A;  5KQ1 A;  1LW3 A;  5J3Y A;  4F7H A;  2YVC A;  3O96 A;  1QC6 A;  1U5D A;  1WJM A;  2W2X C;  2EC1 A;  3AJ4 A;  2ELB A;  2LOZ A;  4TKN A;  4HAW B;  1IRS A;  3D8E A;  2COF A;  2V76 A;  2DN6 A;  1J19 A;  2FJL A;  2P8V A;  5DH9 B;  2YS5 A;  3U8Z A;  4GN1 A;  4KHO A;  1W1H A;  1Z87 A;  1UEF A;  2AL6 A;  1MKE A;  4A6F B;  5C6R A;  1Q67 A;  2ELA A;  2VRW B;  3HW2 B;  2K2U A;  2DKQ A;  1NTV A;  2UVM A;  1V5M A;  2RUK B;  3KSY A;  2G35 A;  4D0N B;  3PZD A;  1PLS A;  5LON B;  1DYN A;  1U5F A;  2GCL A;  3KZ1 A;  4YON A;  1AWE A;  1BAK A;  4XWX A;  1J0W A;  5C79 A;  1RJ2 A;  2LYD A;  1H4R A;  2M14 A;  5FI1 A;  3LJU X;  4P7I A;  3TW1 A;  2K2J A;  3SUZ A;  1XKE A;  3QIJ A;  4YL8 A;  1W1D A;  5HE0 A;  3VIA A;  1V5U A;  1DDW A;  3QWM A;  2D9Y A;  3U7D A;  1XOD A;  4C0A A;  4HDO A;  3KRW A;  4HB3 B;  2YF0 A;  1DBH A;  5L81 A;  2LUL A;  3SO6 A;  1FHX A;  3OAN A;  2CY4 A;  2J0K A;  4HDQ A;  2KUP A;  3WYF B;  4H8S A;  1BTN A;  2AEH A;  2YT1 A;  1M7E A;  3KY9 A;  3SNH A;  2I5C A;  2MWN B;  2EJ8 A;  3ODW A;  1XR0 B;  2Q13 A;  2VKI A;  1KI1 B;  2H7E A;  1ZSQ A;  2H7D A;  4PQ0 A;  2MDX A;  2D4Q A;  4MT7 A;  4K17 A;  4HB0 B;  2D9V A;  1BWN A;  5C5B A;  3ODO A;  4EKU A;  4IAP A;  4Z2N A;  1P5T A;  4HAT B;  2ROZ B;  5D3W A;  2ROV A;  1RRP B;  2DHK A;  3GYO A;  3IVF A;  1WG7 A;  3A8Q A;  3M1I B;  1UPQ A;  4Z2M B;  2Y8G A;  1MIX A;  1P3R A;  4F7G A;  4F7U P;  3F0W A;  2DA0 A;  4PNK A;  2D9W A;  2BCJ A;  1MK9 B;  2RVB B;  3QBV B;  3G9W A;  1DDM A;  3CIK A;  2R09 A;  2Z0Q A;  2ZPY A;  2VSZ A;  2DLW A;  5D27 A;  3TCA A;  1NI2 A;  5J3Q A;  2DFK A;  3PSC A;  1EAZ A;  4WJ7 A;  2I1K A;  5D3V A;  1NU2 A;  1FB8 A;  2DHI A;  3ZDT A;  1MIZ B;  2GJY A;  2W2W A;  3ODX A;  1FOE A;  1TJ6 A;  2Z0O A;  1BTK A;  2OQB A;  2LOX A;  3CXB B;  1FAO A;  5KQ4 A;  1V88 A;  3FM8 C;  2COA A;  1SGH A;  1UNQ A;  2DTC A;  3F5R A;  1Y5O A;  1N3H A;  5DHA B;  1LB1 A;  3KRX A;  5HE3 A;  5D3X A;  1U2B A;  1OMW A;  2DKP A;  4ZRK A;  4A6H A;  4KHA A;  1P6S A;  3VOQ A;  4GMV A;  3P7Z A;  2UZR A;  2RNR B;  3HQC A;  1M7R A;  2J59 M;  3MPX A;  5FI0 A;  2N0Y A;  4GZU A;  2HE7 A;  5CLQ B;  3NSU A;  1ISN A;  1WGU A;  1FGY A;  3TFM A;  1TXD A;  2DX1 A;  1EVH A;  1GG3 A;  1PMS A;  1UNP A;  2KCJ A;  3ULC A;  4HB2 B;  5JP4 A;  3FSS A;  1U27 A;  1X05 A;  5GOW B;  2D9Z A;  4K2P A;  5C16 A;  1DRO A;  4L6E A;  4KVG B;  5KCV A;  3SV1 A;  3D8D A;  4IFS A;  5CLL B;  2J0M A;  1GC6 A;  3HK0 A;  4NY0 A;  1ZM0 A;  2MKR A;  4HAY B;  5HE2 A;  4A6F A;  3DXC A;  1DDV A;  3AU4 A;  4DXA B;  1V5P A;  2ADZ A;  2Z0P A;  3PVW A;  1QQG A;  4IOY X;  4HAX B;  1XCG A;  1U5G A;  1KZG A;  2OTX A;  5DIF B;  1WGQ A;  3ZVR A;  3P6A A;  5EFX A;  1I7A A;  1K5D B;  2Y7B A;  1FGZ A;  3AU5 A;  3PEG A;  4DX8 A;  4KHB B;  1EGX A;  5LOP B;  3MDB C;  2PZ1 A;  4ZRJ A;  2YT0 A;  4CYE A;  1X1G A;  3T06 A;  2W2X D;  5DHF B;  4WSF A;  4MK0 A;  3BJI A;  3TVV A;  2COD A;  2MFQ A;  1WI1 A;  3PVU A;  1FHW A;  2GS0 A;  1WVH A;  1X11 A;  2UZS A;  1OQN A;  4HB4 B;  2RSG A;  2YS3 A;  5J3T A;  1H10 A;  2L2I A;  2X18 A;  2RLO A;  1XX0 A;  1I2H A;  1PFJ A;  4WVF B;  2J0J A;  2N23 A;  4KAX B;  4CHJ A;  4CHM A;  2R0D A;  4Y94 A;  1SHC A;  2E2X A;  5C5B B;  3V5W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...