2YT0A

Solution structure of the chimera of the c-terminal tail peptide of app and the c-terminal pid domain of fe65l
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
176
structure length
176
Chain Sequence
GSSGSSGDAAVTPEERHLSKMQQNGYENPTYKFFEQMQNSGSSGSSGSSGSSGPTPKTELVQKFRVQYLGMLPVDRPVGMDTLNSAIENLMTSSSKEDWPSVNMNVADATVTVISEKNEEEVLVECRVRFLSFMGVGKDVHTFAFIMDTGNQRFECHVFWCEPNAANVSEAVQAAC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Amyloid beta A4 protein and Amyloid beta A4 precursor protei
publication title Structure of the C-terminal phosphotyrosine interaction domain of Fe65L1 complexed with the cytoplasmic tail of amyloid precursor protein reveals a novel peptide binding mode
pubmed doi rcsb
source organism Mus musculus
molecule tags Protein binding
total genus 24
structure length 176
sequence length 176
ec nomenclature
pdb deposition date 2007-04-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2yt0A01
3X23A 2ROZB 4PQ0A 2D11A 4HB3B 3A8QA 1EF1A 2ZPYA 3AU5A 3D8FA 2VSZA 2VKIA 1DBHA 1MIXA 2K00A 2COCA 3NSUA 2J59M 4GMVA 1P6SA 2LKOA 1XODA 4HAZB 3ODOA 2EC1A 2RLOA 2P0FA 3KRWA 3TO1A 3FM8C 4D0NB 1K5DB 3PVUA 1EVHA 3OANA 5C79A 4HAYB 2RNRB 3PSCA 1LW3A 5DHFB 2COAA 4HDOA 1WG7A 3A8PA 3ZVRA 2D9VA 3QBVB 2YSZA 5KCVA 1WGQA 4A5KA 4KHBB 1E5WA 4IOYX 1U27A 1DYNA 1W1HA 2LYDA 3QWMA 3PG7A 2AEHA 3LJUX 2DHJA 1SGHA 1IRSA 1NU2A 2E2XA 2ELBA 1UNQA 5L81A 3ML4A 1QC6A 4IAPA 1W1GA 3O96A 2W2XC 2QKLA 2ELAA 3T06A 5LOPB 1DROA 3HK0A 1W1DA 4TYZA 1PMSA 4HAWB 4GPTB 1V5UA 1KZ7A 1MK9B 4K2PA 2D9XA 2DHIA 1FAOA 1BTNA 2Q13A 2D10A 2DN6A 5J3TA 3KZ1A 2H7EA 4KHAA 2L2IA 4KVGB 3N7CA 2K2JA 4HB0B 3SV1A 3AU4A 2EJ8A 5HE2A 2N23A 3U8ZA 5C5BB 1P3RA 5DIFB 2J0JA 4HB4B 3ZDTA 4IFSA 1EGXA 1NTVA 3PVLA 2M14A 5HE0A 4MK0A 1FHWA 4NSWA 4PNKA 3IVFA 2D4QA 4YONA 1WVHA 3BJIA 2RUKB 1V61A 3F5RA 3SO6A 1TQZA 1X11A 2DKQA 1FB8A 3DXDA 4HHVA 1OY2A 5D3VA 4C0AA 2GS0A 2MKRA 5CLQB 3ULCA 1X05A 2YS5A 2GCLA 1Y5OA 2VRWB 4YL8A 2UZSA 1J0WA 2NZ8B 2YF0A 3VOQA 5DI9B 2QKMA 2COFA 4HAXB 2MDXA 3MDBC 1MAIA 1MPHA 2GCJA 2RGNB 2FJLA 1ZC4B 4A6KA 1ZVRA 2JP2A 4GZUA 3V5WA 2G35A 5FI0A 3QIJA 4KAXB 3SNHA 2IYBA 3WA0A 4NY0A 3PEGA 1XD4A 2RVBB 4CHMA 2Y7BA 3HQCA 4A6HA 4EMOA 4CYEA 2OQBA 4HAUB 1UNRA 2DA0A 1ZSQA 2YRYA 3FSSA 1I2HA 2YS3A 5JHHA 4Z2MB 3UZTA 1V88A 1FHXA 2LG1A 5FI1A 2I5CA 4P7IA 4KHOA 4MY6A 3ODWA 1TJ6A 1B55A 4K2OA 1EAZA 2W2WA 1UEFA 3CXBB 2ROVA 2DX5A 2X18A 3KRXA 4TKNA 4EKUA 4HATB 5DH9B 3HW2B 2HTHB 5JLJB 3G9WA 3FEHA 1J19A 1QQGA 3AJ4A 1FGZA 4F7HA 3P7ZA 2NMBA 5JHGA 1OMWA 4K81A 2D2QA 4H8SA 5D3XA 2N0YA 1GG3A 1V89A 2K2UA 3WYFB 2I1JA 2DYQA 1X1FA 3A98B 2P0HA 1DDWA 3TFMA 3SYXA 1GC6A 2EMTA 3MPXA 1MIZB 3ULBA 1Y19B 4EJNA 2RSGA 1Z87A 4F7UP 2OTXA 1U5DA 1U29A 2HE7A 3KY9A 5HE3A 5GOWB 2DLWA 1H10A 1H4RA 1KI1B 5J3YA 5JP4A 4WVFB 2Z0PA 4B6HA 4DXAB 2DKPA 2IFSA 4ZRJA 1AQCA 2J0KA 1FGYA 1MK7B 3P6AA 2I1KA 2PZ1A 2CY5A 1XR0B 1U5EA 2KCJA 2DFKA 3TVVA 1KZGA 5DHAB 1FOEA 1I7AA 4WJ7A 3D8DA 2MFQA 1N3HA 2LULA 1WGUA 4A6FA 1NI2A 2KGXB 2DX1A 1K5GB 2DTCA 2P0DA 2YT0A 2EMSA 4XWXA 1RJ2A 4GMXB 1FHOA 5C6RA 2CAYA 4F7GA 5EFXA 4WSFA 2DHKA 4DX8A 3GYOA 2D9ZA 5CLLB 1MKEA 1AWEA 4HDQA 3M1IB 4Y94A 1BTKA 1ZM0A 5C5BA 5KQ4A 3VIAA 1BAKA 3GYPA 3DXEA 1UPRA 2R0DA 2J0MA 2CY4A 4Z2NA 3TW1A 2CRFA 1PFJA 5LONB 2YS1A 1UNPA 1U5GA 3CIKA 1XKEA 4HAVB 3U7DA 4BBKA 5D3WA 4DBBA 1XCGA 4A6FB 4L6EA 2LOXA 1M7RA 4GN1A 5J3QA 2D9YA 1ISNA 1BWNA 4DX90 3ODXA 2H7DA 2UVMA 2L1CA 1SHCA 1V5MA 4GXBA 1UPQA 5D3YA 4ZRIA 2ADZA 1X86A 5C16A 1XX0A 2V76A 5HE1A 1V5PA 1RRPB 2Z0OA 1LB1A 1WJ1A 2MWNB 2YT1A 4MT7A 4K17A 3SUZA 3PVWA 1WI1A 2AL6A 1DDVA 5KQ1A 3DXCA 2YVCA 4ZRKA 2BCJA 2Y8FA 2Y8GA 2D9WA 1TXDA 2I5FA 2GJYA 3D8EA 3TCAA 2XQNM 2DYNA 5D27A 2CODA 1X1GA 1ZC3B 2M38A 1Q67A 1P5TA 1U2BA 2KUPA 2LOZA 2P8VA 4CHJA 1WJMA 1GC7A 3KSYA 1OQNA 1PLSA 3PP2A 3PZDA 3BINA 3F0WA 1M7EA 1U5FA 1NTYA 2W2XD 2R09A 2Z0QA 1DDMA 3RCPA 2UZRA 4HB2B
chains in the Genus database with same CATH superfamily
2YT2A 2ROZB 4PQ0A 3X23A 2D11A 4HB3B 3A8QA 1EF1A 2ZPYA 3AU5A 3D8FA 2VSZA 2VKIA 1DBHA 1MIXA 2K00A 2COCA 3NSUA 2J59M 4GMVA 1P6SA 2K49A 2LKOA 1XODA 4HAZB 3ODOA 2EC1A 2RLOA 2P0FA 3KRWA 3TO1A 3FM8C 4CSQA 4D0NB 1K5DB 3PVUA 1EVHA 3OANA 5C79A 4HAYB 2RNRB 3PSCA 1LW3A 5DHFB 2COAA 4QJ5B 4HDOA 1WG7A 4QXAB 3A8PA 3ZVRA 2D9VA 3QBVB 2YSZA 5KCVA 1WGQA 4A5KA 4KHBB 1E5WA 4IOYX 1U27A 1DYNA 1W1HA 2LYDA 3QWMA 3PG7A 5IRSA 2AEHA 3LJUX 2DHJA 1SGHA 1IRSA 1NU2A 2E2XA 2ELBA 1UNQA 5I2MA 5L81A 3ML4A 1QC6A 4IAPA 1W1GA 3O96A 2W2XC 2QKLA 4GNKB 2ELAA 3T06A 5LOPB 1DROA 3HK0A 1W1DA 4TYZA 1PMSA 4HAWB 4GPTB 1V5UA 1KZ7A 1MK9B 4K2PA 2D9XA 2DHIA 1FAOA 1BTNA 2Q13A 2D10A 2DN6A 5J3TA 3KZ1A 2H7EA 4KHAA 2K8EA 2L2IA 4KVGB 3N7CA 2K2JA 4HB0B 3SV1A 3AU4A 2EJ8A 5HE2A 2N23A 5LG4B 3U8ZA 5C5BB 3NWAA 1P3RA 5DIFB 2J0JA 4HB4B 3ZDTA 4IFSA 1EGXA 1NTVA 3PVLA 2M14A 5HE0A 4MK0A 1FHWA 4NSWA 4PNKA 3IVFA 2D4QA 4YONA 1WVHA 3DCXA 3BJIA 2RUKB 1V61A 3F5RA 3HIEA 3SO6A 1TQZA 1X11A 2DKQA 1FB8A 3DXDA 4HHVA 5I2SA 1OY2A 5D3VA 4C0AA 2GS0A 2RRFA 2MKRA 5CLQB 3ULCA 1X05A 2YS5A 2GCLA 1Y5OA 2VRWB 4YL8A 2UZSA 1J0WA 3NWDA 2NZ8B 2YF0A 3VOQA 5DI9B 2QKMA 2COFA 4HAXB 2MDXA 3MDBC 1MAIA 1MI1A 1MPHA 2GCJA 2RGNB 2FJLA 1ZC4B 4A6KA 1ZVRA 2JP2A 4GZUA 3V5WA 2G35A 5FI0A 3QIJA 4KAXB 5M4YB 3SNHA 2IYBA 3WA0A 4NY0A 3PEGA 1XD4A 2RVBB 4CHMA 2Y7BA 3HQCA 4A6HA 4EMOA 4CYEA 2OQBA 4HAUB 1UNRA 2DA0A 1ZSQA 2YRYA 3FSSA 1I2HA 2YS3A 5JHHA 4Z2MB 3UZTA 1V88A 1FHXA 2LG1A 5FI1A 2I5CA 4P7IA 4KHOA 4MY6A 3ODWA 1TJ6A 4GOUA 1B55A 4K2OA 1EAZA 2W2WA 1UEFA 3CXBB 2ROVA 2DX5A 2X18A 3KRXA 4TKNA 4EKUA 4HATB 5DH9B 3HW2B 2HTHB 5JLJB 3G9WA 3FEHA 1J19A 1QQGA 3AJ4A 1FGZA 4F7HA 3P7ZA 2NMBA 5JHGA 1OMWA 4K81A 2D2QA 4H8SA 5D3XA 2N0YA 1GG3A 1V89A 3OHMB 4QJ3B 1T77A 2K2UA 3WYFB 4HSIA 2I1JA 2DYQA 1X1FA 3A98B 2P0HA 1DDWA 3TFMA 3SYXA 1GC6A 2EMTA 3MPXA 1MIZB 3ULBA 1Y19B 4EJNA 4OT1A 2RSGA 4D6WA 1Z87A 4F7UP 2OTXA 1U5DA 1U29A 2HE7A 3KY9A 5HE3A 5GOWB 2DLWA 1ZYIA 2Z13A 1H10A 1H4RA 3NW8A 1KI1B 5J3YA 5JP4A 4WVFB 2Z0PA 2KIGA 4B6HA 4DXAB 2DKPA 2IFSA 4ZRJA 1AQCA 2J0KA 1FGYA 1MK7B 3P6AA 2I1KA 2PZ1A 2CY5A 1XR0B 1U5EA 2KCJA 2DFKA 3TVVA 1KZGA 5DHAB 1FOEA 1I7AA 4WJ7A 3D8DA 2MFQA 1N3HA 2LULA 1WGUA 4A6FA 1NI2A 2KGXB 4DIXA 2DX1A 1K5GB 2DTCA 2P0DA 2YT0A 2EMSA 4XWXA 1RJ2A 4GMXB 1FHOA 5C6RA 2CAYA 4F7GA 5EFXA 4WSFA 2DHKA 4DX8A 3GYOA 4L1RA 2D9ZA 2Z14A 5CLLB 1MKEA 1AWEA 2Z59A 4HDQA 3M1IB 4Y94A 1BTKA 1ZM0A 3A58A 5C5BA 5KQ4A 3VIAA 1BAKA 3GYPA 2GUMA 3DXEA 1UPRA 2R0DA 2J0MA 2CY4A 4Z2NA 3TW1A 2CRFA 1PFJA 5LONB 2YS1A 1UNPA 1U5GA 3CIKA 1XKEA 2R2YA 4HAVB 3U7DA 4QJ4B 4BBKA 5D3WA 4DBBA 1XCGA 4A6FB 4L6EA 2LOXA 1M7RA 4GN1A 5J3QA 2NBVA 2D9YA 1ISNA 3FVCA 1BWNA 4DX90 3ODXA 2Z4DA 2H7DA 2UVMA 2L1CA 1SHCA 1V5MA 4GXBA 1UPQA 5D3YA 4ZRIA 2ADZA 1X86A 5C16A 1XX0A 2V76A 5HE1A 1V5PA 1RRPB 2Z0OA 1LB1A 1WJ1A 2MWNB 2YT1A 4MT7A 4K17A 3SUZA 3PVWA 1WI1A 2AL6A 1DDVA 5KQ1A 3DXCA 2YVCA 4ZRKA 2BCJA 2Y8FA 2Y8GA 2D9WA 1TXDA 2I5FA 2GJYA 3D8EA 3TCAA 2KUQA 2XQNM 2DYNA 5D27A 2CODA 1X1GA 1ZC3B 2M38A 1Q67A 2KIEA 1P5TA 3U12A 3NWFA 2KR0A 1U2BA 2KUPA 2LOZA 2P8VA 4KHBA 4CHJA 2ZKMX 2FJUB 1WJMA 1GC7A 3B77A 3KSYA 1OQNA 1PLSA 3PP2A 3PZDA 4OSNA 3BINA 3F0WA 1M7EA 1U5FA 1NTYA 2W2XD 2R09A 2Z0QA 1DDMA 3HSAA 3RCPA 2UZRA 4HB2B
chains in the Genus database with same CATH topology
3X23A 2ROZB 4PQ0A 2D11A 4HB3B 3A8QA 1EF1A 2ZPYA 3AU5A 3D8FA 2VSZA 2VKIA 1DBHA 1MIXA 2K00A 2COCA 3NSUA 2J59M 4GMVA 1P6SA 2LKOA 1XODA 4HAZB 3ODOA 2EC1A 2RLOA 2P0FA 3KRWA 3TO1A 3FM8C 4D0NB 1K5DB 3PVUA 1EVHA 3OANA 5C79A 4HAYB 2RNRB 3PSCA 1LW3A 5DHFB 2COAA 4HDOA 1WG7A 3A8PA 3ZVRA 2D9VA 3QBVB 2YSZA 5KCVA 1WGQA 4A5KA 4KHBB 1E5WA 4IOYX 1U27A 1DYNA 1W1HA 2LYDA 3QWMA 3PG7A 2AEHA 3LJUX 2DHJA 1SGHA 1IRSA 1NU2A 2E2XA 2ELBA 1UNQA 5L81A 3ML4A 1QC6A 4IAPA 1W1GA 3O96A 2W2XC 2QKLA 2ELAA 3T06A 5LOPB 1DROA 3HK0A 1W1DA 4TYZA 1PMSA 4HAWB 4GPTB 1V5UA 1KZ7A 1MK9B 4K2PA 2D9XA 2DHIA 1FAOA 1BTNA 2Q13A 2D10A 2DN6A 5J3TA 3KZ1A 2H7EA 4KHAA 2L2IA 4KVGB 3N7CA 2K2JA 4HB0B 3SV1A 3AU4A 2EJ8A 5HE2A 2N23A 3U8ZA 5C5BB 1P3RA 5DIFB 2J0JA 4HB4B 3ZDTA 4IFSA 1EGXA 1NTVA 3PVLA 2M14A 5HE0A 4MK0A 1FHWA 4NSWA 4PNKA 3IVFA 2D4QA 4YONA 1WVHA 3BJIA 2RUKB 1V61A 3F5RA 3SO6A 1TQZA 1X11A 2DKQA 1FB8A 3DXDA 4HHVA 1OY2A 5D3VA 4C0AA 2GS0A 2MKRA 5CLQB 3ULCA 1X05A 2YS5A 2GCLA 1Y5OA 2VRWB 4YL8A 2UZSA 1J0WA 2NZ8B 2YF0A 3VOQA 5DI9B 2QKMA 2COFA 4HAXB 2MDXA 3MDBC 1MAIA 1MPHA 2GCJA 2RGNB 2FJLA 1ZC4B 4A6KA 1ZVRA 2JP2A 4GZUA 3V5WA 2G35A 5FI0A 3QIJA 4KAXB 3SNHA 2IYBA 3WA0A 4NY0A 3PEGA 1XD4A 2RVBB 4CHMA 2Y7BA 3HQCA 4A6HA 4EMOA 4CYEA 2OQBA 4HAUB 1UNRA 2DA0A 1ZSQA 2YRYA 3FSSA 1I2HA 2YS3A 5JHHA 4Z2MB 3UZTA 1V88A 1FHXA 2LG1A 5FI1A 2I5CA 4P7IA 4KHOA 4MY6A 3ODWA 1TJ6A 1B55A 4K2OA 1EAZA 2W2WA 1UEFA 3CXBB 2ROVA 2DX5A 2X18A 3KRXA 4TKNA 4EKUA 4HATB 5DH9B 3HW2B 2HTHB 5JLJB 3G9WA 3FEHA 1J19A 1QQGA 3AJ4A 1FGZA 4F7HA 3P7ZA 2NMBA 5JHGA 1OMWA 4K81A 2D2QA 4H8SA 5D3XA 2N0YA 1GG3A 1V89A 2K2UA 3WYFB 2I1JA 2DYQA 1X1FA 3A98B 2P0HA 1DDWA 3TFMA 3SYXA 1GC6A 2EMTA 3MPXA 1MIZB 3ULBA 1Y19B 4EJNA 2RSGA 1Z87A 4F7UP 2OTXA 1U5DA 1U29A 2HE7A 3KY9A 5HE3A 5GOWB 2DLWA 1H10A 1H4RA 1KI1B 5J3YA 5JP4A 4WVFB 2Z0PA 4B6HA 4DXAB 2DKPA 2IFSA 4ZRJA 1AQCA 2J0KA 1FGYA 1MK7B 3P6AA 2I1KA 2PZ1A 2CY5A 1XR0B 1U5EA 2KCJA 2DFKA 3TVVA 1KZGA 5DHAB 1FOEA 1I7AA 4WJ7A 3D8DA 2MFQA 1N3HA 2LULA 1WGUA 4A6FA 1NI2A 2KGXB 2DX1A 1K5GB 2DTCA 2P0DA 2YT0A 2EMSA 4XWXA 1RJ2A 4GMXB 1FHOA 5C6RA 2CAYA 4F7GA 5EFXA 4WSFA 2DHKA 4DX8A 3GYOA 2D9ZA 5CLLB 1MKEA 1AWEA 4HDQA 3M1IB 4Y94A 1BTKA 1ZM0A 5C5BA 5KQ4A 3VIAA 1BAKA 3GYPA 3DXEA 1UPRA 2R0DA 2J0MA 2CY4A 4Z2NA 3TW1A 2CRFA 1PFJA 5LONB 2YS1A 1UNPA 1U5GA 3CIKA 1XKEA 4HAVB 3U7DA 4BBKA 5D3WA 4DBBA 1XCGA 4A6FB 4L6EA 2LOXA 1M7RA 4GN1A 5J3QA 2D9YA 1ISNA 1BWNA 4DX90 3ODXA 2H7DA 2UVMA 2L1CA 1SHCA 1V5MA 4GXBA 1UPQA 5D3YA 4ZRIA 2ADZA 1X86A 5C16A 1XX0A 2V76A 5HE1A 1V5PA 1RRPB 2Z0OA 1LB1A 1WJ1A 2MWNB 2YT1A 4MT7A 4K17A 3SUZA 3PVWA 1WI1A 2AL6A 1DDVA 5KQ1A 3DXCA 2YVCA 4ZRKA 2BCJA 2Y8FA 2Y8GA 2D9WA 1TXDA 2I5FA 2GJYA 3D8EA 3TCAA 2XQNM 2DYNA 5D27A 2CODA 1X1GA 1ZC3B 2M38A 1Q67A 1P5TA 1U2BA 2KUPA 2LOZA 2P8VA 4CHJA 1WJMA 1GC7A 3KSYA 1OQNA 1PLSA 3PP2A 3PZDA 3BINA 3F0WA 1M7EA 1U5FA 1NTYA 2W2XD 2R09A 2Z0QA 1DDMA 3RCPA 2UZRA 4HB2B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3X23 A;  2ROZ B;  4PQ0 A;  2D11 A;  4HB3 B;  3A8Q A;  1EF1 A;  2ZPY A;  3AU5 A;  3D8F A;  2VSZ A;  2VKI A;  1DBH A;  1MIX A;  2K00 A;  2COC A;  3NSU A;  2J59 M;  4GMV A;  1P6S A;  2LKO A;  1XOD A;  4HAZ B;  3ODO A;  2EC1 A;  2RLO A;  2P0F A;  3KRW A;  3TO1 A;  3FM8 C;  4D0N B;  1K5D B;  3PVU A;  1EVH A;  3OAN A;  5C79 A;  4HAY B;  2RNR B;  3PSC A;  1LW3 A;  5DHF B;  2COA A;  4HDO A;  1WG7 A;  3A8P A;  3ZVR A;  2D9V A;  3QBV B;  2YSZ A;  5KCV A;  1WGQ A;  4A5K A;  4KHB B;  1E5W A;  4IOY X;  1U27 A;  1DYN A;  1W1H A;  2LYD A;  3QWM A;  3PG7 A;  2AEH A;  3LJU X;  2DHJ A;  1SGH A;  1IRS A;  1NU2 A;  2E2X A;  2ELB A;  1UNQ A;  5L81 A;  3ML4 A;  1QC6 A;  4IAP A;  1W1G A;  3O96 A;  2W2X C;  2QKL A;  2ELA A;  3T06 A;  5LOP B;  1DRO A;  3HK0 A;  1W1D A;  4TYZ A;  1PMS A;  4HAW B;  4GPT B;  1V5U A;  1KZ7 A;  1MK9 B;  4K2P A;  2D9X A;  2DHI A;  1FAO A;  1BTN A;  2Q13 A;  2D10 A;  2DN6 A;  5J3T A;  3KZ1 A;  2H7E A;  4KHA A;  2L2I A;  4KVG B;  3N7C A;  2K2J A;  4HB0 B;  3SV1 A;  3AU4 A;  2EJ8 A;  5HE2 A;  2N23 A;  3U8Z A;  5C5B B;  1P3R A;  5DIF B;  2J0J A;  4HB4 B;  3ZDT A;  4IFS A;  1EGX A;  1NTV A;  3PVL A;  2M14 A;  5HE0 A;  4MK0 A;  1FHW A;  4NSW A;  4PNK A;  3IVF A;  2D4Q A;  4YON A;  1WVH A;  3BJI A;  2RUK B;  1V61 A;  3F5R A;  3SO6 A;  1TQZ A;  1X11 A;  2DKQ A;  1FB8 A;  3DXD A;  4HHV A;  1OY2 A;  5D3V A;  4C0A A;  2GS0 A;  2MKR A;  5CLQ B;  3ULC A;  1X05 A;  2YS5 A;  2GCL A;  1Y5O A;  2VRW B;  4YL8 A;  2UZS A;  1J0W A;  2NZ8 B;  2YF0 A;  3VOQ A;  5DI9 B;  2QKM A;  2COF A;  4HAX B;  2MDX A;  3MDB C;  1MAI A;  1MPH A;  2GCJ A;  2RGN B;  2FJL A;  1ZC4 B;  4A6K A;  1ZVR A;  2JP2 A;  4GZU A;  3V5W A;  2G35 A;  5FI0 A;  3QIJ A;  4KAX B;  3SNH A;  2IYB A;  3WA0 A;  4NY0 A;  3PEG A;  1XD4 A;  2RVB B;  4CHM A;  2Y7B A;  3HQC A;  4A6H A;  4EMO A;  4CYE A;  2OQB A;  4HAU B;  1UNR A;  2DA0 A;  1ZSQ A;  2YRY A;  3FSS A;  1I2H A;  2YS3 A;  5JHH A;  4Z2M B;  3UZT A;  1V88 A;  1FHX A;  2LG1 A;  5FI1 A;  2I5C A;  4P7I A;  4KHO A;  4MY6 A;  3ODW A;  1TJ6 A;  1B55 A;  4K2O A;  1EAZ A;  2W2W A;  1UEF A;  3CXB B;  2ROV A;  2DX5 A;  2X18 A;  3KRX A;  4TKN A;  4EKU A;  4HAT B;  5DH9 B;  3HW2 B;  2HTH B;  5JLJ B;  3G9W A;  3FEH A;  1J19 A;  1QQG A;  3AJ4 A;  1FGZ A;  4F7H A;  3P7Z A;  2NMB A;  5JHG A;  1OMW A;  4K81 A;  2D2Q A;  4H8S A;  5D3X A;  2N0Y A;  1GG3 A;  1V89 A;  2K2U A;  3WYF B;  2I1J A;  2DYQ A;  1X1F A;  3A98 B;  2P0H A;  1DDW A;  3TFM A;  3SYX A;  1GC6 A;  2EMT A;  3MPX A;  1MIZ B;  3ULB A;  1Y19 B;  4EJN A;  2RSG A;  1Z87 A;  4F7U P;  2OTX A;  1U5D A;  1U29 A;  2HE7 A;  3KY9 A;  5HE3 A;  5GOW B;  2DLW A;  1H10 A;  1H4R A;  1KI1 B;  5J3Y A;  5JP4 A;  4WVF B;  2Z0P A;  4B6H A;  4DXA B;  2DKP A;  2IFS A;  4ZRJ A;  1AQC A;  2J0K A;  1FGY A;  1MK7 B;  3P6A A;  2I1K A;  2PZ1 A;  2CY5 A;  1XR0 B;  1U5E A;  2KCJ A;  2DFK A;  3TVV A;  1KZG A;  5DHA B;  1FOE A;  1I7A A;  4WJ7 A;  3D8D A;  2MFQ A;  1N3H A;  2LUL A;  1WGU A;  4A6F A;  1NI2 A;  2KGX B;  2DX1 A;  1K5G B;  2DTC A;  2P0D A;  2YT0 A;  2EMS A;  4XWX A;  1RJ2 A;  4GMX B;  1FHO A;  5C6R A;  2CAY A;  4F7G A;  5EFX A;  4WSF A;  2DHK A;  4DX8 A;  3GYO A;  2D9Z A;  5CLL B;  1MKE A;  1AWE A;  4HDQ A;  3M1I B;  4Y94 A;  1BTK A;  1ZM0 A;  5C5B A;  5KQ4 A;  3VIA A;  1BAK A;  3GYP A;  3DXE A;  1UPR A;  2R0D A;  2J0M A;  2CY4 A;  4Z2N A;  3TW1 A;  2CRF A;  1PFJ A;  5LON B;  2YS1 A;  1UNP A;  1U5G A;  3CIK A;  1XKE A;  4HAV B;  3U7D A;  4BBK A;  5D3W A;  4DBB A;  1XCG A;  4A6F B;  4L6E A;  2LOX A;  1M7R A;  4GN1 A;  5J3Q A;  2D9Y A;  1ISN A;  1BWN A;  4DX9 0;  3ODX A;  2H7D A;  2UVM A;  2L1C A;  1SHC A;  1V5M A;  4GXB A;  1UPQ A;  5D3Y A;  4ZRI A;  2ADZ A;  1X86 A;  5C16 A;  1XX0 A;  2V76 A;  5HE1 A;  1V5P A;  1RRP B;  2Z0O A;  1LB1 A;  1WJ1 A;  2MWN B;  2YT1 A;  4MT7 A;  4K17 A;  3SUZ A;  3PVW A;  1WI1 A;  2AL6 A;  1DDV A;  5KQ1 A;  3DXC A;  2YVC A;  4ZRK A;  2BCJ A;  2Y8F A;  2Y8G A;  2D9W A;  1TXD A;  2I5F A;  2GJY A;  3D8E A;  3TCA A;  2XQN M;  2DYN A;  5D27 A;  2COD A;  1X1G A;  1ZC3 B;  2M38 A;  1Q67 A;  1P5T A;  1U2B A;  2KUP A;  2LOZ A;  2P8V A;  4CHJ A;  1WJM A;  1GC7 A;  3KSY A;  1OQN A;  1PLS A;  3PP2 A;  3PZD A;  3BIN A;  3F0W A;  1M7E A;  1U5F A;  1NTY A;  2W2X D;  2R09 A;  2Z0Q A;  1DDM A;  3RCP A;  2UZR A;  4HB2 B; 
#chains in the Genus database with same CATH topology
 2YT2 A;  2ROZ B;  4PQ0 A;  3X23 A;  2D11 A;  4HB3 B;  3A8Q A;  1EF1 A;  2ZPY A;  3AU5 A;  3D8F A;  2VSZ A;  2VKI A;  1DBH A;  1MIX A;  2K00 A;  2COC A;  3NSU A;  2J59 M;  4GMV A;  1P6S A;  2K49 A;  2LKO A;  1XOD A;  4HAZ B;  3ODO A;  2EC1 A;  2RLO A;  2P0F A;  3KRW A;  3TO1 A;  3FM8 C;  4CSQ A;  4D0N B;  1K5D B;  3PVU A;  1EVH A;  3OAN A;  5C79 A;  4HAY B;  2RNR B;  3PSC A;  1LW3 A;  5DHF B;  2COA A;  4QJ5 B;  4HDO A;  1WG7 A;  4QXA B;  3A8P A;  3ZVR A;  2D9V A;  3QBV B;  2YSZ A;  5KCV A;  1WGQ A;  4A5K A;  4KHB B;  1E5W A;  4IOY X;  1U27 A;  1DYN A;  1W1H A;  2LYD A;  3QWM A;  3PG7 A;  5IRS A;  2AEH A;  3LJU X;  2DHJ A;  1SGH A;  1IRS A;  1NU2 A;  2E2X A;  2ELB A;  1UNQ A;  5I2M A;  5L81 A;  3ML4 A;  1QC6 A;  4IAP A;  1W1G A;  3O96 A;  2W2X C;  2QKL A;  4GNK B;  2ELA A;  3T06 A;  5LOP B;  1DRO A;  3HK0 A;  1W1D A;  4TYZ A;  1PMS A;  4HAW B;  4GPT B;  1V5U A;  1KZ7 A;  1MK9 B;  4K2P A;  2D9X A;  2DHI A;  1FAO A;  1BTN A;  2Q13 A;  2D10 A;  2DN6 A;  5J3T A;  3KZ1 A;  2H7E A;  4KHA A;  2K8E A;  2L2I A;  4KVG B;  3N7C A;  2K2J A;  4HB0 B;  3SV1 A;  3AU4 A;  2EJ8 A;  5HE2 A;  2N23 A;  5LG4 B;  3U8Z A;  5C5B B;  3NWA A;  1P3R A;  5DIF B;  2J0J A;  4HB4 B;  3ZDT A;  4IFS A;  1EGX A;  1NTV A;  3PVL A;  2M14 A;  5HE0 A;  4MK0 A;  1FHW A;  4NSW A;  4PNK A;  3IVF A;  2D4Q A;  4YON A;  1WVH A;  3DCX A;  3BJI A;  2RUK B;  1V61 A;  3F5R A;  3HIE A;  3SO6 A;  1TQZ A;  1X11 A;  2DKQ A;  1FB8 A;  3DXD A;  4HHV A;  5I2S A;  1OY2 A;  5D3V A;  4C0A A;  2GS0 A;  2RRF A;  2MKR A;  5CLQ B;  3ULC A;  1X05 A;  2YS5 A;  2GCL A;  1Y5O A;  2VRW B;  4YL8 A;  2UZS A;  1J0W A;  3NWD A;  2NZ8 B;  2YF0 A;  3VOQ A;  5DI9 B;  2QKM A;  2COF A;  4HAX B;  2MDX A;  3MDB C;  1MAI A;  1MI1 A;  1MPH A;  2GCJ A;  2RGN B;  2FJL A;  1ZC4 B;  4A6K A;  1ZVR A;  2JP2 A;  4GZU A;  3V5W A;  2G35 A;  5FI0 A;  3QIJ A;  4KAX B;  5M4Y B;  3SNH A;  2IYB A;  3WA0 A;  4NY0 A;  3PEG A;  1XD4 A;  2RVB B;  4CHM A;  2Y7B A;  3HQC A;  4A6H A;  4EMO A;  4CYE A;  2OQB A;  4HAU B;  1UNR A;  2DA0 A;  1ZSQ A;  2YRY A;  3FSS A;  1I2H A;  2YS3 A;  5JHH A;  4Z2M B;  3UZT A;  1V88 A;  1FHX A;  2LG1 A;  5FI1 A;  2I5C A;  4P7I A;  4KHO A;  4MY6 A;  3ODW A;  1TJ6 A;  4GOU A;  1B55 A;  4K2O A;  1EAZ A;  2W2W A;  1UEF A;  3CXB B;  2ROV A;  2DX5 A;  2X18 A;  3KRX A;  4TKN A;  4EKU A;  4HAT B;  5DH9 B;  3HW2 B;  2HTH B;  5JLJ B;  3G9W A;  3FEH A;  1J19 A;  1QQG A;  3AJ4 A;  1FGZ A;  4F7H A;  3P7Z A;  2NMB A;  5JHG A;  1OMW A;  4K81 A;  2D2Q A;  4H8S A;  5D3X A;  2N0Y A;  1GG3 A;  1V89 A;  3OHM B;  4QJ3 B;  1T77 A;  2K2U A;  3WYF B;  4HSI A;  2I1J A;  2DYQ A;  1X1F A;  3A98 B;  2P0H A;  1DDW A;  3TFM A;  3SYX A;  1GC6 A;  2EMT A;  3MPX A;  1MIZ B;  3ULB A;  1Y19 B;  4EJN A;  4OT1 A;  2RSG A;  4D6W A;  1Z87 A;  4F7U P;  2OTX A;  1U5D A;  1U29 A;  2HE7 A;  3KY9 A;  5HE3 A;  5GOW B;  2DLW A;  1ZYI A;  2Z13 A;  1H10 A;  1H4R A;  3NW8 A;  1KI1 B;  5J3Y A;  5JP4 A;  4WVF B;  2Z0P A;  2KIG A;  4B6H A;  4DXA B;  2DKP A;  2IFS A;  4ZRJ A;  1AQC A;  2J0K A;  1FGY A;  1MK7 B;  3P6A A;  2I1K A;  2PZ1 A;  2CY5 A;  1XR0 B;  1U5E A;  2KCJ A;  2DFK A;  3TVV A;  1KZG A;  5DHA B;  1FOE A;  1I7A A;  4WJ7 A;  3D8D A;  2MFQ A;  1N3H A;  2LUL A;  1WGU A;  4A6F A;  1NI2 A;  2KGX B;  4DIX A;  2DX1 A;  1K5G B;  2DTC A;  2P0D A;  2YT0 A;  2EMS A;  4XWX A;  1RJ2 A;  4GMX B;  1FHO A;  5C6R A;  2CAY A;  4F7G A;  5EFX A;  4WSF A;  2DHK A;  4DX8 A;  3GYO A;  4L1R A;  2D9Z A;  2Z14 A;  5CLL B;  1MKE A;  1AWE A;  2Z59 A;  4HDQ A;  3M1I B;  4Y94 A;  1BTK A;  1ZM0 A;  3A58 A;  5C5B A;  5KQ4 A;  3VIA A;  1BAK A;  3GYP A;  2GUM A;  3DXE A;  1UPR A;  2R0D A;  2J0M A;  2CY4 A;  4Z2N A;  3TW1 A;  2CRF A;  1PFJ A;  5LON B;  2YS1 A;  1UNP A;  1U5G A;  3CIK A;  1XKE A;  2R2Y A;  4HAV B;  3U7D A;  4QJ4 B;  4BBK A;  5D3W A;  4DBB A;  1XCG A;  4A6F B;  4L6E A;  2LOX A;  1M7R A;  4GN1 A;  5J3Q A;  2NBV A;  2D9Y A;  1ISN A;  3FVC A;  1BWN A;  4DX9 0;  3ODX A;  2Z4D A;  2H7D A;  2UVM A;  2L1C A;  1SHC A;  1V5M A;  4GXB A;  1UPQ A;  5D3Y A;  4ZRI A;  2ADZ A;  1X86 A;  5C16 A;  1XX0 A;  2V76 A;  5HE1 A;  1V5P A;  1RRP B;  2Z0O A;  1LB1 A;  1WJ1 A;  2MWN B;  2YT1 A;  4MT7 A;  4K17 A;  3SUZ A;  3PVW A;  1WI1 A;  2AL6 A;  1DDV A;  5KQ1 A;  3DXC A;  2YVC A;  4ZRK A;  2BCJ A;  2Y8F A;  2Y8G A;  2D9W A;  1TXD A;  2I5F A;  2GJY A;  3D8E A;  3TCA A;  2KUQ A;  2XQN M;  2DYN A;  5D27 A;  2COD A;  1X1G A;  1ZC3 B;  2M38 A;  1Q67 A;  2KIE A;  1P5T A;  3U12 A;  3NWF A;  2KR0 A;  1U2B A;  2KUP A;  2LOZ A;  2P8V A;  4KHB A;  4CHJ A;  2ZKM X;  2FJU B;  1WJM A;  1GC7 A;  3B77 A;  3KSY A;  1OQN A;  1PLS A;  3PP2 A;  3PZD A;  4OSN A;  3BIN A;  3F0W A;  1M7E A;  1U5F A;  1NTY A;  2W2X D;  2R09 A;  2Z0Q A;  1DDM A;  3HSA A;  3RCP A;  2UZR A;  4HB2 B; 
#chains in the Genus database with same CATH homology
 3X23 A;  2ROZ B;  4PQ0 A;  2D11 A;  4HB3 B;  3A8Q A;  1EF1 A;  2ZPY A;  3AU5 A;  3D8F A;  2VSZ A;  2VKI A;  1DBH A;  1MIX A;  2K00 A;  2COC A;  3NSU A;  2J59 M;  4GMV A;  1P6S A;  2LKO A;  1XOD A;  4HAZ B;  3ODO A;  2EC1 A;  2RLO A;  2P0F A;  3KRW A;  3TO1 A;  3FM8 C;  4D0N B;  1K5D B;  3PVU A;  1EVH A;  3OAN A;  5C79 A;  4HAY B;  2RNR B;  3PSC A;  1LW3 A;  5DHF B;  2COA A;  4HDO A;  1WG7 A;  3A8P A;  3ZVR A;  2D9V A;  3QBV B;  2YSZ A;  5KCV A;  1WGQ A;  4A5K A;  4KHB B;  1E5W A;  4IOY X;  1U27 A;  1DYN A;  1W1H A;  2LYD A;  3QWM A;  3PG7 A;  2AEH A;  3LJU X;  2DHJ A;  1SGH A;  1IRS A;  1NU2 A;  2E2X A;  2ELB A;  1UNQ A;  5L81 A;  3ML4 A;  1QC6 A;  4IAP A;  1W1G A;  3O96 A;  2W2X C;  2QKL A;  2ELA A;  3T06 A;  5LOP B;  1DRO A;  3HK0 A;  1W1D A;  4TYZ A;  1PMS A;  4HAW B;  4GPT B;  1V5U A;  1KZ7 A;  1MK9 B;  4K2P A;  2D9X A;  2DHI A;  1FAO A;  1BTN A;  2Q13 A;  2D10 A;  2DN6 A;  5J3T A;  3KZ1 A;  2H7E A;  4KHA A;  2L2I A;  4KVG B;  3N7C A;  2K2J A;  4HB0 B;  3SV1 A;  3AU4 A;  2EJ8 A;  5HE2 A;  2N23 A;  3U8Z A;  5C5B B;  1P3R A;  5DIF B;  2J0J A;  4HB4 B;  3ZDT A;  4IFS A;  1EGX A;  1NTV A;  3PVL A;  2M14 A;  5HE0 A;  4MK0 A;  1FHW A;  4NSW A;  4PNK A;  3IVF A;  2D4Q A;  4YON A;  1WVH A;  3BJI A;  2RUK B;  1V61 A;  3F5R A;  3SO6 A;  1TQZ A;  1X11 A;  2DKQ A;  1FB8 A;  3DXD A;  4HHV A;  1OY2 A;  5D3V A;  4C0A A;  2GS0 A;  2MKR A;  5CLQ B;  3ULC A;  1X05 A;  2YS5 A;  2GCL A;  1Y5O A;  2VRW B;  4YL8 A;  2UZS A;  1J0W A;  2NZ8 B;  2YF0 A;  3VOQ A;  5DI9 B;  2QKM A;  2COF A;  4HAX B;  2MDX A;  3MDB C;  1MAI A;  1MPH A;  2GCJ A;  2RGN B;  2FJL A;  1ZC4 B;  4A6K A;  1ZVR A;  2JP2 A;  4GZU A;  3V5W A;  2G35 A;  5FI0 A;  3QIJ A;  4KAX B;  3SNH A;  2IYB A;  3WA0 A;  4NY0 A;  3PEG A;  1XD4 A;  2RVB B;  4CHM A;  2Y7B A;  3HQC A;  4A6H A;  4EMO A;  4CYE A;  2OQB A;  4HAU B;  1UNR A;  2DA0 A;  1ZSQ A;  2YRY A;  3FSS A;  1I2H A;  2YS3 A;  5JHH A;  4Z2M B;  3UZT A;  1V88 A;  1FHX A;  2LG1 A;  5FI1 A;  2I5C A;  4P7I A;  4KHO A;  4MY6 A;  3ODW A;  1TJ6 A;  1B55 A;  4K2O A;  1EAZ A;  2W2W A;  1UEF A;  3CXB B;  2ROV A;  2DX5 A;  2X18 A;  3KRX A;  4TKN A;  4EKU A;  4HAT B;  5DH9 B;  3HW2 B;  2HTH B;  5JLJ B;  3G9W A;  3FEH A;  1J19 A;  1QQG A;  3AJ4 A;  1FGZ A;  4F7H A;  3P7Z A;  2NMB A;  5JHG A;  1OMW A;  4K81 A;  2D2Q A;  4H8S A;  5D3X A;  2N0Y A;  1GG3 A;  1V89 A;  2K2U A;  3WYF B;  2I1J A;  2DYQ A;  1X1F A;  3A98 B;  2P0H A;  1DDW A;  3TFM A;  3SYX A;  1GC6 A;  2EMT A;  3MPX A;  1MIZ B;  3ULB A;  1Y19 B;  4EJN A;  2RSG A;  1Z87 A;  4F7U P;  2OTX A;  1U5D A;  1U29 A;  2HE7 A;  3KY9 A;  5HE3 A;  5GOW B;  2DLW A;  1H10 A;  1H4R A;  1KI1 B;  5J3Y A;  5JP4 A;  4WVF B;  2Z0P A;  4B6H A;  4DXA B;  2DKP A;  2IFS A;  4ZRJ A;  1AQC A;  2J0K A;  1FGY A;  1MK7 B;  3P6A A;  2I1K A;  2PZ1 A;  2CY5 A;  1XR0 B;  1U5E A;  2KCJ A;  2DFK A;  3TVV A;  1KZG A;  5DHA B;  1FOE A;  1I7A A;  4WJ7 A;  3D8D A;  2MFQ A;  1N3H A;  2LUL A;  1WGU A;  4A6F A;  1NI2 A;  2KGX B;  2DX1 A;  1K5G B;  2DTC A;  2P0D A;  2YT0 A;  2EMS A;  4XWX A;  1RJ2 A;  4GMX B;  1FHO A;  5C6R A;  2CAY A;  4F7G A;  5EFX A;  4WSF A;  2DHK A;  4DX8 A;  3GYO A;  2D9Z A;  5CLL B;  1MKE A;  1AWE A;  4HDQ A;  3M1I B;  4Y94 A;  1BTK A;  1ZM0 A;  5C5B A;  5KQ4 A;  3VIA A;  1BAK A;  3GYP A;  3DXE A;  1UPR A;  2R0D A;  2J0M A;  2CY4 A;  4Z2N A;  3TW1 A;  2CRF A;  1PFJ A;  5LON B;  2YS1 A;  1UNP A;  1U5G A;  3CIK A;  1XKE A;  4HAV B;  3U7D A;  4BBK A;  5D3W A;  4DBB A;  1XCG A;  4A6F B;  4L6E A;  2LOX A;  1M7R A;  4GN1 A;  5J3Q A;  2D9Y A;  1ISN A;  1BWN A;  4DX9 0;  3ODX A;  2H7D A;  2UVM A;  2L1C A;  1SHC A;  1V5M A;  4GXB A;  1UPQ A;  5D3Y A;  4ZRI A;  2ADZ A;  1X86 A;  5C16 A;  1XX0 A;  2V76 A;  5HE1 A;  1V5P A;  1RRP B;  2Z0O A;  1LB1 A;  1WJ1 A;  2MWN B;  2YT1 A;  4MT7 A;  4K17 A;  3SUZ A;  3PVW A;  1WI1 A;  2AL6 A;  1DDV A;  5KQ1 A;  3DXC A;  2YVC A;  4ZRK A;  2BCJ A;  2Y8F A;  2Y8G A;  2D9W A;  1TXD A;  2I5F A;  2GJY A;  3D8E A;  3TCA A;  2XQN M;  2DYN A;  5D27 A;  2COD A;  1X1G A;  1ZC3 B;  2M38 A;  1Q67 A;  1P5T A;  1U2B A;  2KUP A;  2LOZ A;  2P8V A;  4CHJ A;  1WJM A;  1GC7 A;  3KSY A;  1OQN A;  1PLS A;  3PP2 A;  3PZD A;  3BIN A;  3F0W A;  1M7E A;  1U5F A;  1NTY A;  2W2X D;  2R09 A;  2Z0Q A;  1DDM A;  3RCP A;  2UZR A;  4HB2 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...