2YT0A

Solution structure of the chimera of the c-terminal tail peptide of app and the c-terminal pid domain of fe65l
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
176
structure length
176
Chain Sequence
GSSGSSGDAAVTPEERHLSKMQQNGYENPTYKFFEQMQNSGSSGSSGSSGSSGPTPKTELVQKFRVQYLGMLPVDRPVGMDTLNSAIENLMTSSSKEDWPSVNMNVADATVTVISEKNEEEVLVECRVRFLSFMGVGKDVHTFAFIMDTGNQRFECHVFWCEPNAANVSEAVQAAC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the C-terminal phosphotyrosine interaction domain of Fe65L1 complexed with the cytoplasmic tail of amyloid precursor protein reveals a novel peptide binding mode
pubmed doi rcsb
source organism Mus musculus
molecule tags Protein binding
molecule keywords Amyloid beta A4 protein and Amyloid beta A4 precursor protei
total genus 24
structure length 176
sequence length 176
ec nomenclature
pdb deposition date 2007-04-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2yt0A01
2EC1A 1K5DB 2I5CA 1PLSA 4KHAA 4A6KA 2VSZA 2AL6A 2QKMA 2I1KA 3HQCA 5J3QA 2MFQA 5DIFB 3HK0A 2D9YA 5D27A 1DDMA 2CY5A 4TYZA 4NSWA 3M1IB 5GOWB 3WYFB 1OY2A 1EGXA 1WG7A 1SGHA 3QIJA 2YF0A 3VOQA 5HE2A 2H7DA 2NMBA 2D10A 2NZ8B 3ZDTA 3U7DA 1M7RA 4IFSA 1Y19B 5JHHA 2DA0A 2KUPA 3PEGA 2GCJA 3A98B 3TFMA 1J19A 4ZRKA 2OTXA 1KI1B 3P6AA 1UPQA 1WI1A 3VIAA 2ELBA 3OANA 1W1GA 5D3WA 4B6HA 2Z0PA 2L1CA 3TCAA 2LG1A 4MT7A 4HDOA 1V61A 2YT0A 4EKUA 5C6RA 3SO6A 1V5PA 1ZC4B 2ELAA 3KY9A 4GMVA 2MWNB 3D8DA 4YL8A 3V5WA 2R0DA 1N3HA 1UNPA 4ZRIA 5EFXA 5DHFB 5D3YA 2YSZA 1XR0B 5DH9B 1FGZA 2UZRA 2RGNB 2DYQA 2FJLA 3U8ZA 2P0DA 4HHVA 4H8SA 4K17A 2Z0QA 5CLQB 2W2XD 1P5TA 1RRPB 4A6FB 3QBVB 5J3TA 4HDQA 2G35A 1B55A 3FSSA 1PMSA 2I5FA 2N0YA 1WJMA 2DKQA 2LOXA 3P7ZA 3PSCA 3SYXA 4BBKA 3IVFA 1OQNA 4GPTB 1X1GA 3FEHA 3KSYA 2YT1A 2YS3A 3G9WA 2LOZA 2DFKA 2DKPA 1LW3A 1U5GA 2RSGA 1Q67A 4WJ7A 5D3XA 2I1JA 1UNQA 1TXDA 1U29A 3LJUX 1I7AA 4KHBB 1DROA 2YS5A 2GCLA 4DBBA 2VKIA 1XODA 2K2UA 2P0HA 1GG3A 2VRWB 2ROVA 1K5GB 3D8EA 4EMOA 2LKOA 4DX90 1SHCA 2DX1A 1KZ7A 2D9VA 2M14A 2RVBB 4PQ0A 3HW2B 4GN1A 4HATB 1V88A 3GYPA 4HAXB 1MK7B 3BINA 5KQ1A 4XWXA 3GYOA 5HE3A 1NI2A 1BWNA 2CY4A 4P7IA 2DLWA 4GMXB 3ZVRA 5KQ4A 1X05A 5LONB 2K2JA 1BTNA 3A8PA 2J59M 2YS1A 1ZC3B 2YVCA 4HB0B 2L2IA 1W1DA 2DYNA 2QKLA 2N23A 2P0FA 4NY0A 1AWEA 2P8VA 3TO1A 5KCVA 1PFJA 1X11A 2MKRA 1XD4A 3TVVA 1AQCA 2AEHA 2HE7A 1X1FA 5C5BB 1MKEA 1LB1A 3O96A 4YONA 1NTYA 2Y8FA 1E5WA 2ROZB 1NTVA 3BJIA 4F7UP 1FB8A 1IRSA 1MIZB 2YRYA 1BTKA 2EJ8A 4HAVB 5DI9B 2PZ1A 1W1HA 2RLOA 2OQBA 4A6HA 1H4RA 2DHKA 2IFSA 4Y94A 3NSUA 4HAZB 4CYEA 4HAUB 2M38A 3SUZA 3A8QA 3DXCA 2ADZA 4C0AA 1FHWA 2J0KA 4WSFA 3ODWA 1U5DA 1P6SA 2RUKB 1QQGA 2GJYA 4MY6A 5C5BA 3X23A 2DX5A 3AU5A 5L81A 1DDVA 2COCA 1V5UA 1KZGA 1X86A 2RNRB 1NU2A 1ZM0A 1H10A 2UZSA 2ZPYA 3CIKA 2D9ZA 4HB2B 2J0MA 3PVLA 2X18A 3D8FA 5CLLB 5FI0A 2D2QA 3KRXA 1OMWA 3FM8C 3WA0A 2DHIA 4ZRJA 2COAA 5D3VA 2D9XA 4KHOA 1UEFA 1ZVRA 2BCJA 3DXEA 4HB3B 3CXBB 2LULA 3SV1A 3PVUA 1QC6A 4KAXB 2COFA 4EJNA 2UVMA 1FAOA 4HAYB 1TQZA 1TJ6A 4PNKA 4Z2NA 1U2BA 1FHXA 3AU4A 1ISNA 1FGYA 1WGUA 1WGQA 2HTHB 4TKNA 3AJ4A 2EMTA 2W2XC 1DYNA 5LOPB 4KVGB 4MK0A 5DHAB 4HAWB 1GC6A 4DXAB 2V76A 4L6EA 1UNRA 1WJ1A 2KCJA 5HE1A 1MPHA 3PVWA 3ODOA 2CODA 1FOEA 4F7HA 2H7EA 4IAPA 5JP4A 3MPXA 4A6FA 5JLJB 2JP2A 4GXBA 1Z87A 3QWMA 2J0JA 2K00A 1MK9B 1M7EA 4D0NB 4GZUA 1DBHA 1EVHA 1FHOA 4IOYX 5HE0A 2LYDA 2MDXA 2D4QA 1XKEA 1Y5OA 2D11A 2W2WA 3ULCA 3MDBC 2Y8GA 4CHJA 4WVFB 4Z2MB 4HB4B 3PP2A 2D9WA 4K2PA 3RCPA 3KZ1A 3T06A 1WVHA 2CAYA 5FI1A 2XQNM 1J0WA 1V89A 2IYBA 1U5FA 3SNHA 2DHJA 1UPRA 2KGXB 3F0WA 5JHGA 1I2HA 3DXDA 3KRWA 1U27A 1EF1A 5C79A 4K2OA 3PG7A 1P3RA 4A5KA 1GC7A 3UZTA 3PZDA 1EAZA 1DDWA 3TW1A 2Q13A 2CRFA 1XX0A 2Z0OA 3ODXA 4F7GA 1U5EA 2Y7BA 2DTCA 3F5RA 5J3YA 3ULBA 1ZSQA 1BAKA 3ML4A 4DX8A 1XCGA 4K81A 2DN6A 2R09A 1MIXA 5C16A 4CHMA 2E2XA 2GS0A 2EMSA 1MAIA 1V5MA 3N7CA 1RJ2A
chains in the Genus database with same CATH superfamily
4GNKB 2EC1A 1K5DB 2I5CA 1PLSA 4KHAA 4A6KA 2VSZA 2AL6A 2QKMA 2I1KA 3HQCA 5J3QA 2MFQA 5M4YB 5DIFB 3HK0A 2D9YA 5D27A 1DDMA 2CY5A 4OSNA 4TYZA 4NSWA 3M1IB 5GOWB 3WYFB 1OY2A 1EGXA 1WG7A 1SGHA 3QIJA 2YF0A 3VOQA 5HE2A 2H7DA 2NMBA 2D10A 2NZ8B 3ZDTA 3U7DA 1M7RA 2YT2A 4IFSA 1Y19B 5JHHA 2DA0A 2KUPA 3PEGA 2GCJA 3A98B 3TFMA 1J19A 4ZRKA 2OTXA 1MI1A 1KI1B 3P6AA 1UPQA 1WI1A 3VIAA 2ELBA 3OANA 1W1GA 5D3WA 4B6HA 2Z0PA 2L1CA 3TCAA 2LG1A 4MT7A 4HDOA 1V61A 2YT0A 4EKUA 5C6RA 3SO6A 5I2SA 1V5PA 1ZC4B 2ELAA 3KY9A 4GMVA 2MWNB 3D8DA 4YL8A 3V5WA 2R0DA 1N3HA 1UNPA 4ZRIA 4L1RA 5EFXA 5DHFB 5D3YA 2YSZA 1XR0B 5DH9B 1FGZA 2UZRA 2RGNB 2DYQA 2FJLA 3U8ZA 4QJ4B 2P0DA 4HHVA 4H8SA 2KUQA 4K17A 4KHBA 2Z0QA 5CLQB 2W2XD 1P5TA 1RRPB 4A6FB 3QBVB 5J3TA 4HDQA 2G35A 1B55A 3FSSA 1PMSA 2I5FA 2N0YA 1WJMA 2DKQA 4QJ5B 2LOXA 3P7ZA 3PSCA 3SYXA 4BBKA 3IVFA 1OQNA 4GPTB 1X1GA 3FEHA 3KSYA 2YT1A 2YS3A 3G9WA 2LOZA 2DFKA 2DKPA 1LW3A 1U5GA 2RSGA 1Q67A 4WJ7A 5D3XA 2I1JA 2Z4DA 2FJUB 1UNQA 1TXDA 2NBVA 1U29A 3LJUX 1I7AA 4KHBB 1DROA 2YS5A 2GCLA 4DBBA 2VKIA 1XODA 2K2UA 2P0HA 1GG3A 2VRWB 2ROVA 2K8EA 1K5GB 4OT1A 4DIXA 3D8EA 2RRFA 2LKOA 4EMOA 2Z14A 4DX90 1SHCA 2DX1A 1KZ7A 2D9VA 2M14A 2RVBB 3B77A 4PQ0A 3HW2B 4GN1A 4HATB 1V88A 3GYPA 4HAXB 1MK7B 3BINA 3A58A 5KQ1A 4XWXA 3GYOA 5HE3A 1NI2A 1BWNA 2Z59A 2CY4A 4P7IA 2DLWA 4GMXB 3ZVRA 5KQ4A 1X05A 3OHMB 5LONB 2K2JA 1BTNA 3A8PA 2J59M 2YS1A 1ZC3B 5IRSA 2YVCA 4HB0B 2L2IA 1W1DA 2KIEA 2DYNA 2QKLA 2N23A 2P0FA 4NY0A 1AWEA 1ZYIA 2P8VA 3TO1A 5KCVA 1PFJA 1X11A 2MKRA 2GUMA 1XD4A 3TVVA 1AQCA 3HSAA 2AEHA 2HE7A 1X1FA 5C5BB 1MKEA 1LB1A 3O96A 4YONA 1NTYA 3DCXA 2Y8FA 1E5WA 2ROZB 1NTVA 3BJIA 4F7UP 1FB8A 5LG4B 1IRSA 1MIZB 2YRYA 1BTKA 2EJ8A 4HAVB 5DI9B 2PZ1A 3NW8A 1W1HA 2RLOA 2OQBA 4A6HA 1H4RA 2DHKA 2IFSA 4Y94A 3NSUA 4HAZB 3NWDA 4CYEA 4HAUB 2M38A 3SUZA 3A8QA 3DXCA 2ADZA 4C0AA 1FHWA 2J0KA 4WSFA 3ODWA 1U5DA 1P6SA 2RUKB 1QQGA 2GJYA 4MY6A 4CSQA 5C5BA 3X23A 2DX5A 3AU5A 5L81A 1DDVA 4QXAB 2COCA 1V5UA 1KZGA 1X86A 2RNRB 1NU2A 1ZM0A 4HSIA 1H10A 2UZSA 3HIEA 2ZPYA 3CIKA 2D9ZA 4HB2B 2J0MA 5I2MA 3PVLA 4QJ3B 2X18A 3D8FA 5CLLB 5FI0A 2D2QA 3KRXA 1OMWA 3FM8C 3WA0A 2DHIA 4ZRJA 2COAA 5D3VA 2D9XA 4KHOA 3U12A 1UEFA 1ZVRA 2BCJA 3DXEA 4HB3B 3CXBB 2LULA 3SV1A 3PVUA 1QC6A 4KAXB 2COFA 4EJNA 2UVMA 1FAOA 4HAYB 1TQZA 1TJ6A 4PNKA 4Z2NA 1U2BA 1FHXA 3AU4A 1ISNA 1FGYA 2KIGA 1WGUA 1WGQA 2Z13A 2HTHB 4TKNA 3AJ4A 2EMTA 3FVCA 2W2XC 1DYNA 5LOPB 4KVGB 4MK0A 5DHAB 4HAWB 1GC6A 4DXAB 2V76A 4L6EA 1UNRA 1WJ1A 2KCJA 5HE1A 1MPHA 3PVWA 3ODOA 2CODA 1FOEA 4F7HA 2H7EA 4IAPA 5JP4A 3MPXA 4A6FA 5JLJB 2JP2A 4GXBA 1Z87A 3QWMA 2J0JA 2K00A 1MK9B 1M7EA 4D0NB 4GZUA 1DBHA 1EVHA 1FHOA 4IOYX 5HE0A 2LYDA 2MDXA 2D4QA 1XKEA 1Y5OA 2D11A 2W2WA 3ULCA 3MDBC 2Y8GA 4CHJA 4WVFB 4Z2MB 4HB4B 3PP2A 2D9WA 4K2PA 3RCPA 3KZ1A 3T06A 1WVHA 2CAYA 5FI1A 2XQNM 2ZKMX 1J0WA 1V89A 3NWAA 2IYBA 2R2YA 1U5FA 3SNHA 2DHJA 1UPRA 1T77A 2KGXB 3F0WA 5JHGA 1I2HA 3DXDA 3KRWA 1U27A 2KR0A 1EF1A 5C79A 4K2OA 4D6WA 3PG7A 1P3RA 4A5KA 1GC7A 3UZTA 3PZDA 1EAZA 1DDWA 3TW1A 2Q13A 3NWFA 2CRFA 1XX0A 2K49A 2Z0OA 3ODXA 4F7GA 1U5EA 2Y7BA 2DTCA 3F5RA 5J3YA 3ULBA 1ZSQA 1BAKA 3ML4A 4DX8A 1XCGA 4K81A 2DN6A 2R09A 1MIXA 5C16A 4CHMA 2E2XA 4GOUA 2GS0A 2EMSA 1MAIA 1V5MA 3N7CA 1RJ2A
chains in the Genus database with same CATH topology
2EC1A 1K5DB 2I5CA 1PLSA 4KHAA 4A6KA 2VSZA 2AL6A 2QKMA 2I1KA 3HQCA 5J3QA 2MFQA 5DIFB 3HK0A 2D9YA 5D27A 1DDMA 2CY5A 4TYZA 4NSWA 3M1IB 5GOWB 3WYFB 1OY2A 1EGXA 1WG7A 1SGHA 3QIJA 2YF0A 3VOQA 5HE2A 2H7DA 2NMBA 2D10A 2NZ8B 3ZDTA 3U7DA 1M7RA 4IFSA 1Y19B 5JHHA 2DA0A 2KUPA 3PEGA 2GCJA 3A98B 3TFMA 1J19A 4ZRKA 2OTXA 1KI1B 3P6AA 1UPQA 1WI1A 3VIAA 2ELBA 3OANA 1W1GA 5D3WA 4B6HA 2Z0PA 2L1CA 3TCAA 2LG1A 4MT7A 4HDOA 1V61A 2YT0A 4EKUA 5C6RA 3SO6A 1V5PA 1ZC4B 2ELAA 3KY9A 4GMVA 2MWNB 3D8DA 4YL8A 3V5WA 2R0DA 1N3HA 1UNPA 4ZRIA 5EFXA 5DHFB 5D3YA 2YSZA 1XR0B 5DH9B 1FGZA 2UZRA 2RGNB 2DYQA 2FJLA 3U8ZA 2P0DA 4HHVA 4H8SA 4K17A 2Z0QA 5CLQB 2W2XD 1P5TA 1RRPB 4A6FB 3QBVB 5J3TA 4HDQA 2G35A 1B55A 3FSSA 1PMSA 2I5FA 2N0YA 1WJMA 2DKQA 2LOXA 3P7ZA 3PSCA 3SYXA 4BBKA 3IVFA 1OQNA 4GPTB 1X1GA 3FEHA 3KSYA 2YT1A 2YS3A 3G9WA 2LOZA 2DFKA 2DKPA 1LW3A 1U5GA 2RSGA 1Q67A 4WJ7A 5D3XA 2I1JA 1UNQA 1TXDA 1U29A 3LJUX 1I7AA 4KHBB 1DROA 2YS5A 2GCLA 4DBBA 2VKIA 1XODA 2K2UA 2P0HA 1GG3A 2VRWB 2ROVA 1K5GB 3D8EA 4EMOA 2LKOA 4DX90 1SHCA 2DX1A 1KZ7A 2D9VA 2M14A 2RVBB 4PQ0A 3HW2B 4GN1A 4HATB 1V88A 3GYPA 4HAXB 1MK7B 3BINA 5KQ1A 4XWXA 3GYOA 5HE3A 1NI2A 1BWNA 2CY4A 4P7IA 2DLWA 4GMXB 3ZVRA 5KQ4A 1X05A 5LONB 2K2JA 1BTNA 3A8PA 2J59M 2YS1A 1ZC3B 2YVCA 4HB0B 2L2IA 1W1DA 2DYNA 2QKLA 2N23A 2P0FA 4NY0A 1AWEA 2P8VA 3TO1A 5KCVA 1PFJA 1X11A 2MKRA 1XD4A 3TVVA 1AQCA 2AEHA 2HE7A 1X1FA 5C5BB 1MKEA 1LB1A 3O96A 4YONA 1NTYA 2Y8FA 1E5WA 2ROZB 1NTVA 3BJIA 4F7UP 1FB8A 1IRSA 1MIZB 2YRYA 1BTKA 2EJ8A 4HAVB 5DI9B 2PZ1A 1W1HA 2RLOA 2OQBA 4A6HA 1H4RA 2DHKA 2IFSA 4Y94A 3NSUA 4HAZB 4CYEA 4HAUB 2M38A 3SUZA 3A8QA 3DXCA 2ADZA 4C0AA 1FHWA 2J0KA 4WSFA 3ODWA 1U5DA 1P6SA 2RUKB 1QQGA 2GJYA 4MY6A 5C5BA 3X23A 2DX5A 3AU5A 5L81A 1DDVA 2COCA 1V5UA 1KZGA 1X86A 2RNRB 1NU2A 1ZM0A 1H10A 2UZSA 2ZPYA 3CIKA 2D9ZA 4HB2B 2J0MA 3PVLA 2X18A 3D8FA 5CLLB 5FI0A 2D2QA 3KRXA 1OMWA 3FM8C 3WA0A 2DHIA 4ZRJA 2COAA 5D3VA 2D9XA 4KHOA 1UEFA 1ZVRA 2BCJA 3DXEA 4HB3B 3CXBB 2LULA 3SV1A 3PVUA 1QC6A 4KAXB 2COFA 4EJNA 2UVMA 1FAOA 4HAYB 1TQZA 1TJ6A 4PNKA 4Z2NA 1U2BA 1FHXA 3AU4A 1ISNA 1FGYA 1WGUA 1WGQA 2HTHB 4TKNA 3AJ4A 2EMTA 2W2XC 1DYNA 5LOPB 4KVGB 4MK0A 5DHAB 4HAWB 1GC6A 4DXAB 2V76A 4L6EA 1UNRA 1WJ1A 2KCJA 5HE1A 1MPHA 3PVWA 3ODOA 2CODA 1FOEA 4F7HA 2H7EA 4IAPA 5JP4A 3MPXA 4A6FA 5JLJB 2JP2A 4GXBA 1Z87A 3QWMA 2J0JA 2K00A 1MK9B 1M7EA 4D0NB 4GZUA 1DBHA 1EVHA 1FHOA 4IOYX 5HE0A 2LYDA 2MDXA 2D4QA 1XKEA 1Y5OA 2D11A 2W2WA 3ULCA 3MDBC 2Y8GA 4CHJA 4WVFB 4Z2MB 4HB4B 3PP2A 2D9WA 4K2PA 3RCPA 3KZ1A 3T06A 1WVHA 2CAYA 5FI1A 2XQNM 1J0WA 1V89A 2IYBA 1U5FA 3SNHA 2DHJA 1UPRA 2KGXB 3F0WA 5JHGA 1I2HA 3DXDA 3KRWA 1U27A 1EF1A 5C79A 4K2OA 3PG7A 1P3RA 4A5KA 1GC7A 3UZTA 3PZDA 1EAZA 1DDWA 3TW1A 2Q13A 2CRFA 1XX0A 2Z0OA 3ODXA 4F7GA 1U5EA 2Y7BA 2DTCA 3F5RA 5J3YA 3ULBA 1ZSQA 1BAKA 3ML4A 4DX8A 1XCGA 4K81A 2DN6A 2R09A 1MIXA 5C16A 4CHMA 2E2XA 2GS0A 2EMSA 1MAIA 1V5MA 3N7CA 1RJ2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EC1 A;  1K5D B;  2I5C A;  1PLS A;  4KHA A;  4A6K A;  2VSZ A;  2AL6 A;  2QKM A;  2I1K A;  3HQC A;  5J3Q A;  2MFQ A;  5DIF B;  3HK0 A;  2D9Y A;  5D27 A;  1DDM A;  2CY5 A;  4TYZ A;  4NSW A;  3M1I B;  5GOW B;  3WYF B;  1OY2 A;  1EGX A;  1WG7 A;  1SGH A;  3QIJ A;  2YF0 A;  3VOQ A;  5HE2 A;  2H7D A;  2NMB A;  2D10 A;  2NZ8 B;  3ZDT A;  3U7D A;  1M7R A;  4IFS A;  1Y19 B;  5JHH A;  2DA0 A;  2KUP A;  3PEG A;  2GCJ A;  3A98 B;  3TFM A;  1J19 A;  4ZRK A;  2OTX A;  1KI1 B;  3P6A A;  1UPQ A;  1WI1 A;  3VIA A;  2ELB A;  3OAN A;  1W1G A;  5D3W A;  4B6H A;  2Z0P A;  2L1C A;  3TCA A;  2LG1 A;  4MT7 A;  4HDO A;  1V61 A;  2YT0 A;  4EKU A;  5C6R A;  3SO6 A;  1V5P A;  1ZC4 B;  2ELA A;  3KY9 A;  4GMV A;  2MWN B;  3D8D A;  4YL8 A;  3V5W A;  2R0D A;  1N3H A;  1UNP A;  4ZRI A;  5EFX A;  5DHF B;  5D3Y A;  2YSZ A;  1XR0 B;  5DH9 B;  1FGZ A;  2UZR A;  2RGN B;  2DYQ A;  2FJL A;  3U8Z A;  2P0D A;  4HHV A;  4H8S A;  4K17 A;  2Z0Q A;  5CLQ B;  2W2X D;  1P5T A;  1RRP B;  4A6F B;  3QBV B;  5J3T A;  4HDQ A;  2G35 A;  1B55 A;  3FSS A;  1PMS A;  2I5F A;  2N0Y A;  1WJM A;  2DKQ A;  2LOX A;  3P7Z A;  3PSC A;  3SYX A;  4BBK A;  3IVF A;  1OQN A;  4GPT B;  1X1G A;  3FEH A;  3KSY A;  2YT1 A;  2YS3 A;  3G9W A;  2LOZ A;  2DFK A;  2DKP A;  1LW3 A;  1U5G A;  2RSG A;  1Q67 A;  4WJ7 A;  5D3X A;  2I1J A;  1UNQ A;  1TXD A;  1U29 A;  3LJU X;  1I7A A;  4KHB B;  1DRO A;  2YS5 A;  2GCL A;  4DBB A;  2VKI A;  1XOD A;  2K2U A;  2P0H A;  1GG3 A;  2VRW B;  2ROV A;  1K5G B;  3D8E A;  4EMO A;  2LKO A;  4DX9 0;  1SHC A;  2DX1 A;  1KZ7 A;  2D9V A;  2M14 A;  2RVB B;  4PQ0 A;  3HW2 B;  4GN1 A;  4HAT B;  1V88 A;  3GYP A;  4HAX B;  1MK7 B;  3BIN A;  5KQ1 A;  4XWX A;  3GYO A;  5HE3 A;  1NI2 A;  1BWN A;  2CY4 A;  4P7I A;  2DLW A;  4GMX B;  3ZVR A;  5KQ4 A;  1X05 A;  5LON B;  2K2J A;  1BTN A;  3A8P A;  2J59 M;  2YS1 A;  1ZC3 B;  2YVC A;  4HB0 B;  2L2I A;  1W1D A;  2DYN A;  2QKL A;  2N23 A;  2P0F A;  4NY0 A;  1AWE A;  2P8V A;  3TO1 A;  5KCV A;  1PFJ A;  1X11 A;  2MKR A;  1XD4 A;  3TVV A;  1AQC A;  2AEH A;  2HE7 A;  1X1F A;  5C5B B;  1MKE A;  1LB1 A;  3O96 A;  4YON A;  1NTY A;  2Y8F A;  1E5W A;  2ROZ B;  1NTV A;  3BJI A;  4F7U P;  1FB8 A;  1IRS A;  1MIZ B;  2YRY A;  1BTK A;  2EJ8 A;  4HAV B;  5DI9 B;  2PZ1 A;  1W1H A;  2RLO A;  2OQB A;  4A6H A;  1H4R A;  2DHK A;  2IFS A;  4Y94 A;  3NSU A;  4HAZ B;  4CYE A;  4HAU B;  2M38 A;  3SUZ A;  3A8Q A;  3DXC A;  2ADZ A;  4C0A A;  1FHW A;  2J0K A;  4WSF A;  3ODW A;  1U5D A;  1P6S A;  2RUK B;  1QQG A;  2GJY A;  4MY6 A;  5C5B A;  3X23 A;  2DX5 A;  3AU5 A;  5L81 A;  1DDV A;  2COC A;  1V5U A;  1KZG A;  1X86 A;  2RNR B;  1NU2 A;  1ZM0 A;  1H10 A;  2UZS A;  2ZPY A;  3CIK A;  2D9Z A;  4HB2 B;  2J0M A;  3PVL A;  2X18 A;  3D8F A;  5CLL B;  5FI0 A;  2D2Q A;  3KRX A;  1OMW A;  3FM8 C;  3WA0 A;  2DHI A;  4ZRJ A;  2COA A;  5D3V A;  2D9X A;  4KHO A;  1UEF A;  1ZVR A;  2BCJ A;  3DXE A;  4HB3 B;  3CXB B;  2LUL A;  3SV1 A;  3PVU A;  1QC6 A;  4KAX B;  2COF A;  4EJN A;  2UVM A;  1FAO A;  4HAY B;  1TQZ A;  1TJ6 A;  4PNK A;  4Z2N A;  1U2B A;  1FHX A;  3AU4 A;  1ISN A;  1FGY A;  1WGU A;  1WGQ A;  2HTH B;  4TKN A;  3AJ4 A;  2EMT A;  2W2X C;  1DYN A;  5LOP B;  4KVG B;  4MK0 A;  5DHA B;  4HAW B;  1GC6 A;  4DXA B;  2V76 A;  4L6E A;  1UNR A;  1WJ1 A;  2KCJ A;  5HE1 A;  1MPH A;  3PVW A;  3ODO A;  2COD A;  1FOE A;  4F7H A;  2H7E A;  4IAP A;  5JP4 A;  3MPX A;  4A6F A;  5JLJ B;  2JP2 A;  4GXB A;  1Z87 A;  3QWM A;  2J0J A;  2K00 A;  1MK9 B;  1M7E A;  4D0N B;  4GZU A;  1DBH A;  1EVH A;  1FHO A;  4IOY X;  5HE0 A;  2LYD A;  2MDX A;  2D4Q A;  1XKE A;  1Y5O A;  2D11 A;  2W2W A;  3ULC A;  3MDB C;  2Y8G A;  4CHJ A;  4WVF B;  4Z2M B;  4HB4 B;  3PP2 A;  2D9W A;  4K2P A;  3RCP A;  3KZ1 A;  3T06 A;  1WVH A;  2CAY A;  5FI1 A;  2XQN M;  1J0W A;  1V89 A;  2IYB A;  1U5F A;  3SNH A;  2DHJ A;  1UPR A;  2KGX B;  3F0W A;  5JHG A;  1I2H A;  3DXD A;  3KRW A;  1U27 A;  1EF1 A;  5C79 A;  4K2O A;  3PG7 A;  1P3R A;  4A5K A;  1GC7 A;  3UZT A;  3PZD A;  1EAZ A;  1DDW A;  3TW1 A;  2Q13 A;  2CRF A;  1XX0 A;  2Z0O A;  3ODX A;  4F7G A;  1U5E A;  2Y7B A;  2DTC A;  3F5R A;  5J3Y A;  3ULB A;  1ZSQ A;  1BAK A;  3ML4 A;  4DX8 A;  1XCG A;  4K81 A;  2DN6 A;  2R09 A;  1MIX A;  5C16 A;  4CHM A;  2E2X A;  2GS0 A;  2EMS A;  1MAI A;  1V5M A;  3N7C A;  1RJ2 A; 
#chains in the Genus database with same CATH topology
 4GNK B;  2EC1 A;  1K5D B;  2I5C A;  1PLS A;  4KHA A;  4A6K A;  2VSZ A;  2AL6 A;  2QKM A;  2I1K A;  3HQC A;  5J3Q A;  2MFQ A;  5M4Y B;  5DIF B;  3HK0 A;  2D9Y A;  5D27 A;  1DDM A;  2CY5 A;  4OSN A;  4TYZ A;  4NSW A;  3M1I B;  5GOW B;  3WYF B;  1OY2 A;  1EGX A;  1WG7 A;  1SGH A;  3QIJ A;  2YF0 A;  3VOQ A;  5HE2 A;  2H7D A;  2NMB A;  2D10 A;  2NZ8 B;  3ZDT A;  3U7D A;  1M7R A;  2YT2 A;  4IFS A;  1Y19 B;  5JHH A;  2DA0 A;  2KUP A;  3PEG A;  2GCJ A;  3A98 B;  3TFM A;  1J19 A;  4ZRK A;  2OTX A;  1MI1 A;  1KI1 B;  3P6A A;  1UPQ A;  1WI1 A;  3VIA A;  2ELB A;  3OAN A;  1W1G A;  5D3W A;  4B6H A;  2Z0P A;  2L1C A;  3TCA A;  2LG1 A;  4MT7 A;  4HDO A;  1V61 A;  2YT0 A;  4EKU A;  5C6R A;  3SO6 A;  5I2S A;  1V5P A;  1ZC4 B;  2ELA A;  3KY9 A;  4GMV A;  2MWN B;  3D8D A;  4YL8 A;  3V5W A;  2R0D A;  1N3H A;  1UNP A;  4ZRI A;  4L1R A;  5EFX A;  5DHF B;  5D3Y A;  2YSZ A;  1XR0 B;  5DH9 B;  1FGZ A;  2UZR A;  2RGN B;  2DYQ A;  2FJL A;  3U8Z A;  4QJ4 B;  2P0D A;  4HHV A;  4H8S A;  2KUQ A;  4K17 A;  4KHB A;  2Z0Q A;  5CLQ B;  2W2X D;  1P5T A;  1RRP B;  4A6F B;  3QBV B;  5J3T A;  4HDQ A;  2G35 A;  1B55 A;  3FSS A;  1PMS A;  2I5F A;  2N0Y A;  1WJM A;  2DKQ A;  4QJ5 B;  2LOX A;  3P7Z A;  3PSC A;  3SYX A;  4BBK A;  3IVF A;  1OQN A;  4GPT B;  1X1G A;  3FEH A;  3KSY A;  2YT1 A;  2YS3 A;  3G9W A;  2LOZ A;  2DFK A;  2DKP A;  1LW3 A;  1U5G A;  2RSG A;  1Q67 A;  4WJ7 A;  5D3X A;  2I1J A;  2Z4D A;  2FJU B;  1UNQ A;  1TXD A;  2NBV A;  1U29 A;  3LJU X;  1I7A A;  4KHB B;  1DRO A;  2YS5 A;  2GCL A;  4DBB A;  2VKI A;  1XOD A;  2K2U A;  2P0H A;  1GG3 A;  2VRW B;  2ROV A;  2K8E A;  1K5G B;  4OT1 A;  4DIX A;  3D8E A;  2RRF A;  2LKO A;  4EMO A;  2Z14 A;  4DX9 0;  1SHC A;  2DX1 A;  1KZ7 A;  2D9V A;  2M14 A;  2RVB B;  3B77 A;  4PQ0 A;  3HW2 B;  4GN1 A;  4HAT B;  1V88 A;  3GYP A;  4HAX B;  1MK7 B;  3BIN A;  3A58 A;  5KQ1 A;  4XWX A;  3GYO A;  5HE3 A;  1NI2 A;  1BWN A;  2Z59 A;  2CY4 A;  4P7I A;  2DLW A;  4GMX B;  3ZVR A;  5KQ4 A;  1X05 A;  3OHM B;  5LON B;  2K2J A;  1BTN A;  3A8P A;  2J59 M;  2YS1 A;  1ZC3 B;  5IRS A;  2YVC A;  4HB0 B;  2L2I A;  1W1D A;  2KIE A;  2DYN A;  2QKL A;  2N23 A;  2P0F A;  4NY0 A;  1AWE A;  1ZYI A;  2P8V A;  3TO1 A;  5KCV A;  1PFJ A;  1X11 A;  2MKR A;  2GUM A;  1XD4 A;  3TVV A;  1AQC A;  3HSA A;  2AEH A;  2HE7 A;  1X1F A;  5C5B B;  1MKE A;  1LB1 A;  3O96 A;  4YON A;  1NTY A;  3DCX A;  2Y8F A;  1E5W A;  2ROZ B;  1NTV A;  3BJI A;  4F7U P;  1FB8 A;  5LG4 B;  1IRS A;  1MIZ B;  2YRY A;  1BTK A;  2EJ8 A;  4HAV B;  5DI9 B;  2PZ1 A;  3NW8 A;  1W1H A;  2RLO A;  2OQB A;  4A6H A;  1H4R A;  2DHK A;  2IFS A;  4Y94 A;  3NSU A;  4HAZ B;  3NWD A;  4CYE A;  4HAU B;  2M38 A;  3SUZ A;  3A8Q A;  3DXC A;  2ADZ A;  4C0A A;  1FHW A;  2J0K A;  4WSF A;  3ODW A;  1U5D A;  1P6S A;  2RUK B;  1QQG A;  2GJY A;  4MY6 A;  4CSQ A;  5C5B A;  3X23 A;  2DX5 A;  3AU5 A;  5L81 A;  1DDV A;  4QXA B;  2COC A;  1V5U A;  1KZG A;  1X86 A;  2RNR B;  1NU2 A;  1ZM0 A;  4HSI A;  1H10 A;  2UZS A;  3HIE A;  2ZPY A;  3CIK A;  2D9Z A;  4HB2 B;  2J0M A;  5I2M A;  3PVL A;  4QJ3 B;  2X18 A;  3D8F A;  5CLL B;  5FI0 A;  2D2Q A;  3KRX A;  1OMW A;  3FM8 C;  3WA0 A;  2DHI A;  4ZRJ A;  2COA A;  5D3V A;  2D9X A;  4KHO A;  3U12 A;  1UEF A;  1ZVR A;  2BCJ A;  3DXE A;  4HB3 B;  3CXB B;  2LUL A;  3SV1 A;  3PVU A;  1QC6 A;  4KAX B;  2COF A;  4EJN A;  2UVM A;  1FAO A;  4HAY B;  1TQZ A;  1TJ6 A;  4PNK A;  4Z2N A;  1U2B A;  1FHX A;  3AU4 A;  1ISN A;  1FGY A;  2KIG A;  1WGU A;  1WGQ A;  2Z13 A;  2HTH B;  4TKN A;  3AJ4 A;  2EMT A;  3FVC A;  2W2X C;  1DYN A;  5LOP B;  4KVG B;  4MK0 A;  5DHA B;  4HAW B;  1GC6 A;  4DXA B;  2V76 A;  4L6E A;  1UNR A;  1WJ1 A;  2KCJ A;  5HE1 A;  1MPH A;  3PVW A;  3ODO A;  2COD A;  1FOE A;  4F7H A;  2H7E A;  4IAP A;  5JP4 A;  3MPX A;  4A6F A;  5JLJ B;  2JP2 A;  4GXB A;  1Z87 A;  3QWM A;  2J0J A;  2K00 A;  1MK9 B;  1M7E A;  4D0N B;  4GZU A;  1DBH A;  1EVH A;  1FHO A;  4IOY X;  5HE0 A;  2LYD A;  2MDX A;  2D4Q A;  1XKE A;  1Y5O A;  2D11 A;  2W2W A;  3ULC A;  3MDB C;  2Y8G A;  4CHJ A;  4WVF B;  4Z2M B;  4HB4 B;  3PP2 A;  2D9W A;  4K2P A;  3RCP A;  3KZ1 A;  3T06 A;  1WVH A;  2CAY A;  5FI1 A;  2XQN M;  2ZKM X;  1J0W A;  1V89 A;  3NWA A;  2IYB A;  2R2Y A;  1U5F A;  3SNH A;  2DHJ A;  1UPR A;  1T77 A;  2KGX B;  3F0W A;  5JHG A;  1I2H A;  3DXD A;  3KRW A;  1U27 A;  2KR0 A;  1EF1 A;  5C79 A;  4K2O A;  4D6W A;  3PG7 A;  1P3R A;  4A5K A;  1GC7 A;  3UZT A;  3PZD A;  1EAZ A;  1DDW A;  3TW1 A;  2Q13 A;  3NWF A;  2CRF A;  1XX0 A;  2K49 A;  2Z0O A;  3ODX A;  4F7G A;  1U5E A;  2Y7B A;  2DTC A;  3F5R A;  5J3Y A;  3ULB A;  1ZSQ A;  1BAK A;  3ML4 A;  4DX8 A;  1XCG A;  4K81 A;  2DN6 A;  2R09 A;  1MIX A;  5C16 A;  4CHM A;  2E2X A;  4GOU A;  2GS0 A;  2EMS A;  1MAI A;  1V5M A;  3N7C A;  1RJ2 A; 
#chains in the Genus database with same CATH homology
 2EC1 A;  1K5D B;  2I5C A;  1PLS A;  4KHA A;  4A6K A;  2VSZ A;  2AL6 A;  2QKM A;  2I1K A;  3HQC A;  5J3Q A;  2MFQ A;  5DIF B;  3HK0 A;  2D9Y A;  5D27 A;  1DDM A;  2CY5 A;  4TYZ A;  4NSW A;  3M1I B;  5GOW B;  3WYF B;  1OY2 A;  1EGX A;  1WG7 A;  1SGH A;  3QIJ A;  2YF0 A;  3VOQ A;  5HE2 A;  2H7D A;  2NMB A;  2D10 A;  2NZ8 B;  3ZDT A;  3U7D A;  1M7R A;  4IFS A;  1Y19 B;  5JHH A;  2DA0 A;  2KUP A;  3PEG A;  2GCJ A;  3A98 B;  3TFM A;  1J19 A;  4ZRK A;  2OTX A;  1KI1 B;  3P6A A;  1UPQ A;  1WI1 A;  3VIA A;  2ELB A;  3OAN A;  1W1G A;  5D3W A;  4B6H A;  2Z0P A;  2L1C A;  3TCA A;  2LG1 A;  4MT7 A;  4HDO A;  1V61 A;  2YT0 A;  4EKU A;  5C6R A;  3SO6 A;  1V5P A;  1ZC4 B;  2ELA A;  3KY9 A;  4GMV A;  2MWN B;  3D8D A;  4YL8 A;  3V5W A;  2R0D A;  1N3H A;  1UNP A;  4ZRI A;  5EFX A;  5DHF B;  5D3Y A;  2YSZ A;  1XR0 B;  5DH9 B;  1FGZ A;  2UZR A;  2RGN B;  2DYQ A;  2FJL A;  3U8Z A;  2P0D A;  4HHV A;  4H8S A;  4K17 A;  2Z0Q A;  5CLQ B;  2W2X D;  1P5T A;  1RRP B;  4A6F B;  3QBV B;  5J3T A;  4HDQ A;  2G35 A;  1B55 A;  3FSS A;  1PMS A;  2I5F A;  2N0Y A;  1WJM A;  2DKQ A;  2LOX A;  3P7Z A;  3PSC A;  3SYX A;  4BBK A;  3IVF A;  1OQN A;  4GPT B;  1X1G A;  3FEH A;  3KSY A;  2YT1 A;  2YS3 A;  3G9W A;  2LOZ A;  2DFK A;  2DKP A;  1LW3 A;  1U5G A;  2RSG A;  1Q67 A;  4WJ7 A;  5D3X A;  2I1J A;  1UNQ A;  1TXD A;  1U29 A;  3LJU X;  1I7A A;  4KHB B;  1DRO A;  2YS5 A;  2GCL A;  4DBB A;  2VKI A;  1XOD A;  2K2U A;  2P0H A;  1GG3 A;  2VRW B;  2ROV A;  1K5G B;  3D8E A;  4EMO A;  2LKO A;  4DX9 0;  1SHC A;  2DX1 A;  1KZ7 A;  2D9V A;  2M14 A;  2RVB B;  4PQ0 A;  3HW2 B;  4GN1 A;  4HAT B;  1V88 A;  3GYP A;  4HAX B;  1MK7 B;  3BIN A;  5KQ1 A;  4XWX A;  3GYO A;  5HE3 A;  1NI2 A;  1BWN A;  2CY4 A;  4P7I A;  2DLW A;  4GMX B;  3ZVR A;  5KQ4 A;  1X05 A;  5LON B;  2K2J A;  1BTN A;  3A8P A;  2J59 M;  2YS1 A;  1ZC3 B;  2YVC A;  4HB0 B;  2L2I A;  1W1D A;  2DYN A;  2QKL A;  2N23 A;  2P0F A;  4NY0 A;  1AWE A;  2P8V A;  3TO1 A;  5KCV A;  1PFJ A;  1X11 A;  2MKR A;  1XD4 A;  3TVV A;  1AQC A;  2AEH A;  2HE7 A;  1X1F A;  5C5B B;  1MKE A;  1LB1 A;  3O96 A;  4YON A;  1NTY A;  2Y8F A;  1E5W A;  2ROZ B;  1NTV A;  3BJI A;  4F7U P;  1FB8 A;  1IRS A;  1MIZ B;  2YRY A;  1BTK A;  2EJ8 A;  4HAV B;  5DI9 B;  2PZ1 A;  1W1H A;  2RLO A;  2OQB A;  4A6H A;  1H4R A;  2DHK A;  2IFS A;  4Y94 A;  3NSU A;  4HAZ B;  4CYE A;  4HAU B;  2M38 A;  3SUZ A;  3A8Q A;  3DXC A;  2ADZ A;  4C0A A;  1FHW A;  2J0K A;  4WSF A;  3ODW A;  1U5D A;  1P6S A;  2RUK B;  1QQG A;  2GJY A;  4MY6 A;  5C5B A;  3X23 A;  2DX5 A;  3AU5 A;  5L81 A;  1DDV A;  2COC A;  1V5U A;  1KZG A;  1X86 A;  2RNR B;  1NU2 A;  1ZM0 A;  1H10 A;  2UZS A;  2ZPY A;  3CIK A;  2D9Z A;  4HB2 B;  2J0M A;  3PVL A;  2X18 A;  3D8F A;  5CLL B;  5FI0 A;  2D2Q A;  3KRX A;  1OMW A;  3FM8 C;  3WA0 A;  2DHI A;  4ZRJ A;  2COA A;  5D3V A;  2D9X A;  4KHO A;  1UEF A;  1ZVR A;  2BCJ A;  3DXE A;  4HB3 B;  3CXB B;  2LUL A;  3SV1 A;  3PVU A;  1QC6 A;  4KAX B;  2COF A;  4EJN A;  2UVM A;  1FAO A;  4HAY B;  1TQZ A;  1TJ6 A;  4PNK A;  4Z2N A;  1U2B A;  1FHX A;  3AU4 A;  1ISN A;  1FGY A;  1WGU A;  1WGQ A;  2HTH B;  4TKN A;  3AJ4 A;  2EMT A;  2W2X C;  1DYN A;  5LOP B;  4KVG B;  4MK0 A;  5DHA B;  4HAW B;  1GC6 A;  4DXA B;  2V76 A;  4L6E A;  1UNR A;  1WJ1 A;  2KCJ A;  5HE1 A;  1MPH A;  3PVW A;  3ODO A;  2COD A;  1FOE A;  4F7H A;  2H7E A;  4IAP A;  5JP4 A;  3MPX A;  4A6F A;  5JLJ B;  2JP2 A;  4GXB A;  1Z87 A;  3QWM A;  2J0J A;  2K00 A;  1MK9 B;  1M7E A;  4D0N B;  4GZU A;  1DBH A;  1EVH A;  1FHO A;  4IOY X;  5HE0 A;  2LYD A;  2MDX A;  2D4Q A;  1XKE A;  1Y5O A;  2D11 A;  2W2W A;  3ULC A;  3MDB C;  2Y8G A;  4CHJ A;  4WVF B;  4Z2M B;  4HB4 B;  3PP2 A;  2D9W A;  4K2P A;  3RCP A;  3KZ1 A;  3T06 A;  1WVH A;  2CAY A;  5FI1 A;  2XQN M;  1J0W A;  1V89 A;  2IYB A;  1U5F A;  3SNH A;  2DHJ A;  1UPR A;  2KGX B;  3F0W A;  5JHG A;  1I2H A;  3DXD A;  3KRW A;  1U27 A;  1EF1 A;  5C79 A;  4K2O A;  3PG7 A;  1P3R A;  4A5K A;  1GC7 A;  3UZT A;  3PZD A;  1EAZ A;  1DDW A;  3TW1 A;  2Q13 A;  2CRF A;  1XX0 A;  2Z0O A;  3ODX A;  4F7G A;  1U5E A;  2Y7B A;  2DTC A;  3F5R A;  5J3Y A;  3ULB A;  1ZSQ A;  1BAK A;  3ML4 A;  4DX8 A;  1XCG A;  4K81 A;  2DN6 A;  2R09 A;  1MIX A;  5C16 A;  4CHM A;  2E2X A;  2GS0 A;  2EMS A;  1MAI A;  1V5M A;  3N7C A;  1RJ2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...