2YT0A

Solution structure of the chimera of the c-terminal tail peptide of app and the c-terminal pid domain of fe65l
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
176
structure length
176
Chain Sequence
b'GSSGSSGDAAVTPEERHLSKMQQNGYENPTYKFFEQMQNSGSSGSSGSSGSSGPTPKTELVQKFRVQYLGMLPVDRPVGMDTLNSAIENLMTSSSKEDWPSVNMNVADATVTVISEKNEEEVLVECRVRFLSFMGVGKDVHTFAFIMDTGNQRFECHVFWCEPNAANVSEAVQAAC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Amyloid beta A4 protein and Amyloid beta A4 precursor protei
publication title Structure of the C-terminal phosphotyrosine interaction domain of Fe65L1 complexed with the cytoplasmic tail of amyloid precursor protein reveals a novel peptide binding mode
pubmed doi rcsb
source organism Mus musculus
molecule tags Protein binding
total genus 24
structure length 176
sequence length 176
ec nomenclature
pdb deposition date 2007-04-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2yt0A01
4XWXA 1V61A 1DBHA 2HE7A 2I1KA 4HB4B 3PP2A 4HAYB 5GOWB 2R0DA 2YT0A 2UZRA 1FB8A 2DKQA 4IAPA 1BAKA 1U5EA 2NMBA 4GZUA 3U8ZA 1NTYA 1XR0B 2DA0A 1V5PA 5FI1A 2ZPYA 1H10A 1I7AA 3HK0A 4H8SA 5EFXA 1MK9B 3HW2B 3MDBC 1QQGA 3TFMA 1EF1A 1EAZA 1ZVRA 1BTKA 2CY4A 4HAWB 1KI1B 5KQ4A 2Y8FA 4A6HA 1SGHA 2D2QA 2XQNM 1WI1A 3TVVA 1MK7B 2COFA 1WJ1A 2IYBA 2YS3A 4KHAA 1P5TA 2E2XA 3QWMA 2LYDA 4HATB 2VRWB 4A6FA 2P0HA 5LOPB 1AQCA 2L1CA 2Y7BA 3DXEA 2GCJA 3T06A 3U7DA 1UEFA 4HAUB 2CRFA 3OANA 5C16A 2QKLA 1WGQA 1TQZA 4HHVA 5J3YA 2DYNA 5J3TA 3CXBB 1ZC4B 2G35A 2UZSA 3NSUA 2CAYA 2COAA 1Y19B 3BJIA 2M14A 1UNQA 1PMSA 1V89A 2X18A 4YONA 2NZ8B 4BBKA 2YRYA 5C79A 1NU2A 5C5BB 1UPQA 4GMXB 1I2HA 1XKEA 1Y5OA 2AL6A 1X1GA 3AJ4A 3GYOA 1XODA 2FJLA 4HAXB 4DX8A 3ODOA 2J0JA 1DDWA 1BTNA 3PEGA 2RSGA 1UPRA 2DTCA 1KZ7A 2D9VA 4ZRJA 2GJYA 1OMWA 1AWEA 3CIKA 1N3HA 5HE0A 4DBBA 4CHMA 1MPHA 3TCAA 1FGZA 1ZSQA 1X86A 1ZC3B 2DKPA 3RCPA 3GYPA 3ZVRA 1MIXA 1GC7A 4EKUA 3VIAA 4EJNA 5C6RA 5LONB 1XCGA 1U5FA 2RVBB 4ZRIA 1GG3A 1LB1A 4NY0A 2LKOA 1PFJA 2K2UA 2RLOA 1V5MA 1M7EA 3TW1A 4IOYX 5D3YA 1DDMA 1PLSA 2YT1A 4F7HA 2OTXA 4KHBB 3PVWA 2VKIA 4WSFA 4A6FB 1MIZB 3AU5A 2I5CA 2PZ1A 4GXBA 4HDOA 5D3WA 1FHWA 3M1IB 1EGXA 5HE1A 4HAVB 2IFSA 1FGYA 4C0AA 1NI2A 1V88A 4L6EA 5D3XA 1U5GA 1UNPA 3F5RA 1K5GB 2P0FA 2VSZA 3N7CA 2QKMA 3SO6A 1KZGA 2KCJA 2AEHA 1FAOA 2DHJA 1EVHA 3DXCA 2LOXA 3A8PA 4KAXB 3KZ1A 2I1JA 1DYNA 1Z87A 4K2OA 1NTVA 2H7EA 3A98B 1QC6A 1X11A 2YS1A 4GPTB 2DX1A 1IRSA 2D9XA 4TYZA 3FM8C 2UVMA 2BCJA 2Z0OA 4K17A 1FHOA 3KRXA 1E5WA 4GMVA 5JP4A 2I5FA 2RUKB 2LULA 2EJ8A 3HQCA 5DIFB 4CHJA 3MPXA 1RJ2A 2J0MA 5J3QA 2ROZB 3QIJA 1SHCA 2DLWA 4B6HA 1U5DA 3V5WA 2YSZA 1U29A 2Z0QA 3PZDA 1OY2A 4Y94A 1M7RA 2N0YA 3PG7A 3SNHA 2RGNB 5HE2A 2P8VA 2DYQA 1TJ6A 4PQ0A 2ADZA 3TO1A 1LW3A 2D10A 2HTHB 5JHHA 3ULCA 3P7ZA 5JLJB 2J59M 2JP2A 5L81A 2CY5A 1GC6A 4KVGB 4Z2MB 1P3RA 4HAZB 3FEHA 1DDVA 2DX5A 2MKRA 3PVUA 2COCA 5DHFB 2D9ZA 3KRWA 1MKEA 3VOQA 2KUPA 3P6AA 2RNRB 2W2XD 2D4QA 5KCVA 1WGUA 1TXDA 4Z2NA 1OQNA 3ULBA 5DH9B 2Y8GA 1P6SA 1V5UA 2DFKA 3FSSA 1Q67A 2YF0A 4HDQA 3LJUX 3G9WA 1B55A 3ODXA 2Z0PA 4ZRKA 4PNKA 1U2BA 2D11A 2L2IA 1FHXA 3IVFA 2GS0A 2MWNB 4IFSA 1WVHA 1W1HA 5CLLB 3ZDTA 2KGXB 1W1DA 4F7UP 3D8EA 2M38A 4DX90 2K2JA 5CLQB 3QBVB 4WVFB 3F0WA 1H4RA 3WA0A 2LOZA 1DROA 5FI0A 1BWNA 2CODA 3DXDA 2H7DA 1J0WA 4EMOA 4HB3B 4MK0A 5D27A 2EMSA 3SUZA 4KHOA 2R09A 3D8DA 4GN1A 1U27A 1WJMA 2ROVA 4K81A 1UNRA 2ELBA 2DHIA 3X23A 2J0KA 2W2XC 3PVLA 4K2PA 1WG7A 4WJ7A 3KSYA 1K5DB 1X05A 1ZM0A 1MAIA 2LG1A 2N23A 3KY9A 5KQ1A 2YS5A 3O96A 3D8FA 2EMTA 4MT7A 4YL8A 4TKNA 5D3VA 4A5KA 2ELAA 2GCLA 4NSWA 3SYXA 3UZTA 3BINA 4CYEA 2DHKA 1ISNA 2MFQA 4HB2B 3A8QA 1W1GA 3ODWA 4D0NB 2P0DA 4F7GA 1XX0A 1XD4A 1FOEA 5JHGA 2OQBA 5DI9B 2EC1A 2W2WA 2MDXA 2D9YA 1RRPB 2D9WA 2YVCA 4HB0B 3AU4A 4DXAB 3ML4A 3PSCA 1X1FA 3SV1A 4P7IA 2Q13A 5C5BA 4A6KA 2DN6A 2K00A 4MY6A 5DHAB 2V76A 5HE3A 3WYFB 1J19A
chains in the Genus database with same CATH superfamily
4QXAB 1V61A 4XWXA 1DBHA 2HE7A 2I1KA 4HB4B 3PP2A 4HAYB 2Z13A 5GOWB 2R0DA 2YT0A 2UZRA 1FB8A 2R2YA 2K8EA 2DKQA 4IAPA 1BAKA 1U5EA 2KIEA 2NMBA 4GZUA 4D6WA 3U8ZA 1NTYA 1XR0B 2DA0A 1V5PA 5FI1A 2ZPYA 1H10A 1I7AA 3HK0A 4H8SA 5EFXA 1MK9B 3HW2B 3MDBC 1QQGA 3TFMA 3FVCA 1EF1A 3NWDA 1EAZA 1ZVRA 1BTKA 2CY4A 3NWAA 1KI1B 4HAWB 5KQ4A 2Y8FA 4A6HA 1SGHA 2D2QA 2XQNM 1WI1A 3TVVA 1MK7B 2COFA 1WJ1A 2IYBA 2YS3A 4KHAA 1P5TA 2E2XA 3QWMA 4KHBA 2Z59A 2LYDA 4HATB 2VRWB 4A6FA 2P0HA 5LOPB 1AQCA 2L1CA 2Y7BA 3DXEA 2GCJA 3T06A 3U7DA 1UEFA 4HAUB 2CRFA 3OANA 4QJ4B 5C16A 2QKLA 1WGQA 1TQZA 4HHVA 5J3YA 2ZKMX 2DYNA 5J3TA 3CXBB 1ZC4B 2G35A 2UZSA 3NSUA 2CAYA 2COAA 1Y19B 3NWFA 3BJIA 2M14A 1UNQA 3DCXA 1PMSA 1V89A 2X18A 4OT1A 4YONA 2NZ8B 4BBKA 2YRYA 5C79A 1NU2A 2KR0A 5C5BB 1UPQA 4GMXB 1I2HA 1XKEA 1Y5OA 2AL6A 1X1GA 3AJ4A 3GYOA 1XODA 2FJLA 4HAXB 5M4YB 4DX8A 3ODOA 2J0JA 1DDWA 1BTNA 3PEGA 2RSGA 1UPRA 2DTCA 1KZ7A 2D9VA 4ZRJA 2GJYA 1OMWA 1AWEA 3CIKA 1N3HA 5HE0A 4DBBA 5LG4B 4CHMA 1MPHA 3TCAA 1FGZA 1ZSQA 1X86A 1ZC3B 2DKPA 3RCPA 2Z4DA 3GYPA 3ZVRA 1MIXA 1GC7A 4EKUA 3VIAA 4EJNA 5C6RA 5LONB 1XCGA 1U5FA 2RVBB 4L1RA 4ZRIA 1GG3A 1LB1A 4NY0A 2LKOA 1PFJA 2K2UA 2RLOA 1V5MA 1M7EA 3TW1A 4IOYX 5D3YA 1DDMA 1PLSA 1T77A 2YT1A 4F7HA 2OTXA 4KHBB 3PVWA 2KUQA 2VKIA 4WSFA 4A6FB 1MIZB 3AU5A 2I5CA 2PZ1A 4GXBA 4HDOA 5D3WA 1FHWA 3M1IB 1EGXA 5HE1A 4HAVB 2IFSA 1FGYA 4C0AA 1NI2A 1V88A 2K49A 4L6EA 4HSIA 5D3XA 1U5GA 1UNPA 3F5RA 1K5GB 2P0FA 2VSZA 3N7CA 2RRFA 2QKMA 3SO6A 1KZGA 2KCJA 3B77A 2AEHA 1FAOA 2DHJA 1EVHA 3DXCA 2GUMA 2LOXA 3A8PA 4KAXB 3KZ1A 2I1JA 1DYNA 1Z87A 4K2OA 1NTVA 2H7EA 3A98B 1QC6A 1X11A 2YS1A 4GPTB 2DX1A 1IRSA 2D9XA 4TYZA 3FM8C 2UVMA 2BCJA 2Z0OA 4K17A 1FHOA 3KRXA 1E5WA 4GMVA 5JP4A 2I5FA 2RUKB 2LULA 2EJ8A 3HQCA 5DIFB 4CHJA 3MPXA 1RJ2A 2J0MA 4QJ3B 5J3QA 2ROZB 3QIJA 1SHCA 2DLWA 4B6HA 1U5DA 3V5WA 2YSZA 1U29A 2Z0QA 3PZDA 1OY2A 4Y94A 1M7RA 2N0YA 3PG7A 4OSNA 3SNHA 2RGNB 5HE2A 3U12A 2P8VA 2DYQA 1TJ6A 4PQ0A 2ADZA 3TO1A 2NBVA 1LW3A 2D10A 2FJUB 1ZYIA 2HTHB 5JHHA 3ULCA 3P7ZA 5JLJB 2J59M 2JP2A 5L81A 3A58A 2CY5A 1GC6A 4KVGB 4CSQA 4Z2MB 1P3RA 4HAZB 3FEHA 1DDVA 2DX5A 2MKRA 3PVUA 2COCA 2Z14A 5DHFB 2D9ZA 3KRWA 1MKEA 3VOQA 2KUPA 4GNKB 3P6AA 2RNRB 2W2XD 2D4QA 5KCVA 1WGUA 1TXDA 4Z2NA 1OQNA 3ULBA 1MI1A 5DH9B 2Y8GA 1P6SA 1V5UA 2DFKA 3FSSA 1Q67A 2YF0A 4HDQA 3LJUX 3G9WA 1B55A 3ODXA 2Z0PA 4ZRKA 4PNKA 1U2BA 2D11A 2L2IA 1FHXA 4DIXA 3IVFA 2GS0A 2MWNB 4IFSA 1WVHA 1W1HA 5CLLB 3ZDTA 2KGXB 1W1DA 4F7UP 3D8EA 2M38A 4DX90 2K2JA 5CLQB 3QBVB 4WVFB 3F0WA 1H4RA 3WA0A 2LOZA 1DROA 5FI0A 1BWNA 2CODA 3DXDA 2H7DA 1J0WA 4EMOA 4HB3B 4MK0A 5D27A 2EMSA 3SUZA 4KHOA 2R09A 3D8DA 4GN1A 1U27A 1WJMA 2ROVA 4K81A 1UNRA 2ELBA 2DHIA 3X23A 2J0KA 2W2XC 3PVLA 4K2PA 1WG7A 4WJ7A 3KSYA 1K5DB 1X05A 1ZM0A 1MAIA 2LG1A 2N23A 3KY9A 5KQ1A 2YS5A 3O96A 3D8FA 2EMTA 4MT7A 4YL8A 2YT2A 4TKNA 5D3VA 4A5KA 2KIGA 2ELAA 2GCLA 4NSWA 3OHMB 3SYXA 3UZTA 5I2SA 3BINA 4CYEA 2DHKA 1ISNA 2MFQA 4HB2B 5I2MA 3NW8A 3A8QA 1W1GA 3ODWA 4D0NB 2P0DA 4F7GA 1XX0A 1XD4A 1FOEA 5JHGA 2OQBA 5DI9B 2EC1A 5IRSA 2W2WA 4GOUA 2MDXA 2D9YA 1RRPB 2D9WA 2YVCA 4HB0B 3AU4A 3HSAA 4DXAB 3ML4A 3PSCA 1X1FA 3SV1A 4P7IA 2Q13A 5C5BA 4A6KA 3HIEA 2DN6A 2K00A 4MY6A 5DHAB 2V76A 4QJ5B 5HE3A 3WYFB 1J19A
chains in the Genus database with same CATH topology
4XWXA 1V61A 1DBHA 2HE7A 2I1KA 4HB4B 3PP2A 4HAYB 5GOWB 2R0DA 2YT0A 2UZRA 1FB8A 2DKQA 4IAPA 1BAKA 1U5EA 2NMBA 4GZUA 3U8ZA 1NTYA 1XR0B 2DA0A 1V5PA 5FI1A 2ZPYA 1H10A 1I7AA 3HK0A 4H8SA 5EFXA 1MK9B 3HW2B 3MDBC 1QQGA 3TFMA 1EF1A 1EAZA 1ZVRA 1BTKA 2CY4A 4HAWB 1KI1B 5KQ4A 2Y8FA 4A6HA 1SGHA 2D2QA 2XQNM 1WI1A 3TVVA 1MK7B 2COFA 1WJ1A 2IYBA 2YS3A 4KHAA 1P5TA 2E2XA 3QWMA 2LYDA 4HATB 2VRWB 4A6FA 2P0HA 5LOPB 1AQCA 2L1CA 2Y7BA 3DXEA 2GCJA 3T06A 3U7DA 1UEFA 4HAUB 2CRFA 3OANA 5C16A 2QKLA 1WGQA 1TQZA 4HHVA 5J3YA 2DYNA 5J3TA 3CXBB 1ZC4B 2G35A 2UZSA 3NSUA 2CAYA 2COAA 1Y19B 3BJIA 2M14A 1UNQA 1PMSA 1V89A 2X18A 4YONA 2NZ8B 4BBKA 2YRYA 5C79A 1NU2A 5C5BB 1UPQA 4GMXB 1I2HA 1XKEA 1Y5OA 2AL6A 1X1GA 3AJ4A 3GYOA 1XODA 2FJLA 4HAXB 4DX8A 3ODOA 2J0JA 1DDWA 1BTNA 3PEGA 2RSGA 1UPRA 2DTCA 1KZ7A 2D9VA 4ZRJA 2GJYA 1OMWA 1AWEA 3CIKA 1N3HA 5HE0A 4DBBA 4CHMA 1MPHA 3TCAA 1FGZA 1ZSQA 1X86A 1ZC3B 2DKPA 3RCPA 3GYPA 3ZVRA 1MIXA 1GC7A 4EKUA 3VIAA 4EJNA 5C6RA 5LONB 1XCGA 1U5FA 2RVBB 4ZRIA 1GG3A 1LB1A 4NY0A 2LKOA 1PFJA 2K2UA 2RLOA 1V5MA 1M7EA 3TW1A 4IOYX 5D3YA 1DDMA 1PLSA 2YT1A 4F7HA 2OTXA 4KHBB 3PVWA 2VKIA 4WSFA 4A6FB 1MIZB 3AU5A 2I5CA 2PZ1A 4GXBA 4HDOA 5D3WA 1FHWA 3M1IB 1EGXA 5HE1A 4HAVB 2IFSA 1FGYA 4C0AA 1NI2A 1V88A 4L6EA 5D3XA 1U5GA 1UNPA 3F5RA 1K5GB 2P0FA 2VSZA 3N7CA 2QKMA 3SO6A 1KZGA 2KCJA 2AEHA 1FAOA 2DHJA 1EVHA 3DXCA 2LOXA 3A8PA 4KAXB 3KZ1A 2I1JA 1DYNA 1Z87A 4K2OA 1NTVA 2H7EA 3A98B 1QC6A 1X11A 2YS1A 4GPTB 2DX1A 1IRSA 2D9XA 4TYZA 3FM8C 2UVMA 2BCJA 2Z0OA 4K17A 1FHOA 3KRXA 1E5WA 4GMVA 5JP4A 2I5FA 2RUKB 2LULA 2EJ8A 3HQCA 5DIFB 4CHJA 3MPXA 1RJ2A 2J0MA 5J3QA 2ROZB 3QIJA 1SHCA 2DLWA 4B6HA 1U5DA 3V5WA 2YSZA 1U29A 2Z0QA 3PZDA 1OY2A 4Y94A 1M7RA 2N0YA 3PG7A 3SNHA 2RGNB 5HE2A 2P8VA 2DYQA 1TJ6A 4PQ0A 2ADZA 3TO1A 1LW3A 2D10A 2HTHB 5JHHA 3ULCA 3P7ZA 5JLJB 2J59M 2JP2A 5L81A 2CY5A 1GC6A 4KVGB 4Z2MB 1P3RA 4HAZB 3FEHA 1DDVA 2DX5A 2MKRA 3PVUA 2COCA 5DHFB 2D9ZA 3KRWA 1MKEA 3VOQA 2KUPA 3P6AA 2RNRB 2W2XD 2D4QA 5KCVA 1WGUA 1TXDA 4Z2NA 1OQNA 3ULBA 5DH9B 2Y8GA 1P6SA 1V5UA 2DFKA 3FSSA 1Q67A 2YF0A 4HDQA 3LJUX 3G9WA 1B55A 3ODXA 2Z0PA 4ZRKA 4PNKA 1U2BA 2D11A 2L2IA 1FHXA 3IVFA 2GS0A 2MWNB 4IFSA 1WVHA 1W1HA 5CLLB 3ZDTA 2KGXB 1W1DA 4F7UP 3D8EA 2M38A 4DX90 2K2JA 5CLQB 3QBVB 4WVFB 3F0WA 1H4RA 3WA0A 2LOZA 1DROA 5FI0A 1BWNA 2CODA 3DXDA 2H7DA 1J0WA 4EMOA 4HB3B 4MK0A 5D27A 2EMSA 3SUZA 4KHOA 2R09A 3D8DA 4GN1A 1U27A 1WJMA 2ROVA 4K81A 1UNRA 2ELBA 2DHIA 3X23A 2J0KA 2W2XC 3PVLA 4K2PA 1WG7A 4WJ7A 3KSYA 1K5DB 1X05A 1ZM0A 1MAIA 2LG1A 2N23A 3KY9A 5KQ1A 2YS5A 3O96A 3D8FA 2EMTA 4MT7A 4YL8A 4TKNA 5D3VA 4A5KA 2ELAA 2GCLA 4NSWA 3SYXA 3UZTA 3BINA 4CYEA 2DHKA 1ISNA 2MFQA 4HB2B 3A8QA 1W1GA 3ODWA 4D0NB 2P0DA 4F7GA 1XX0A 1XD4A 1FOEA 5JHGA 2OQBA 5DI9B 2EC1A 2W2WA 2MDXA 2D9YA 1RRPB 2D9WA 2YVCA 4HB0B 3AU4A 4DXAB 3ML4A 3PSCA 1X1FA 3SV1A 4P7IA 2Q13A 5C5BA 4A6KA 2DN6A 2K00A 4MY6A 5DHAB 2V76A 5HE3A 3WYFB 1J19A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XWX A;  1V61 A;  1DBH A;  2HE7 A;  2I1K A;  4HB4 B;  3PP2 A;  4HAY B;  5GOW B;  2R0D A;  2YT0 A;  2UZR A;  1FB8 A;  2DKQ A;  4IAP A;  1BAK A;  1U5E A;  2NMB A;  4GZU A;  3U8Z A;  1NTY A;  1XR0 B;  2DA0 A;  1V5P A;  5FI1 A;  2ZPY A;  1H10 A;  1I7A A;  3HK0 A;  4H8S A;  5EFX A;  1MK9 B;  3HW2 B;  3MDB C;  1QQG A;  3TFM A;  1EF1 A;  1EAZ A;  1ZVR A;  1BTK A;  2CY4 A;  4HAW B;  1KI1 B;  5KQ4 A;  2Y8F A;  4A6H A;  1SGH A;  2D2Q A;  2XQN M;  1WI1 A;  3TVV A;  1MK7 B;  2COF A;  1WJ1 A;  2IYB A;  2YS3 A;  4KHA A;  1P5T A;  2E2X A;  3QWM A;  2LYD A;  4HAT B;  2VRW B;  4A6F A;  2P0H A;  5LOP B;  1AQC A;  2L1C A;  2Y7B A;  3DXE A;  2GCJ A;  3T06 A;  3U7D A;  1UEF A;  4HAU B;  2CRF A;  3OAN A;  5C16 A;  2QKL A;  1WGQ A;  1TQZ A;  4HHV A;  5J3Y A;  2DYN A;  5J3T A;  3CXB B;  1ZC4 B;  2G35 A;  2UZS A;  3NSU A;  2CAY A;  2COA A;  1Y19 B;  3BJI A;  2M14 A;  1UNQ A;  1PMS A;  1V89 A;  2X18 A;  4YON A;  2NZ8 B;  4BBK A;  2YRY A;  5C79 A;  1NU2 A;  5C5B B;  1UPQ A;  4GMX B;  1I2H A;  1XKE A;  1Y5O A;  2AL6 A;  1X1G A;  3AJ4 A;  3GYO A;  1XOD A;  2FJL A;  4HAX B;  4DX8 A;  3ODO A;  2J0J A;  1DDW A;  1BTN A;  3PEG A;  2RSG A;  1UPR A;  2DTC A;  1KZ7 A;  2D9V A;  4ZRJ A;  2GJY A;  1OMW A;  1AWE A;  3CIK A;  1N3H A;  5HE0 A;  4DBB A;  4CHM A;  1MPH A;  3TCA A;  1FGZ A;  1ZSQ A;  1X86 A;  1ZC3 B;  2DKP A;  3RCP A;  3GYP A;  3ZVR A;  1MIX A;  1GC7 A;  4EKU A;  3VIA A;  4EJN A;  5C6R A;  5LON B;  1XCG A;  1U5F A;  2RVB B;  4ZRI A;  1GG3 A;  1LB1 A;  4NY0 A;  2LKO A;  1PFJ A;  2K2U A;  2RLO A;  1V5M A;  1M7E A;  3TW1 A;  4IOY X;  5D3Y A;  1DDM A;  1PLS A;  2YT1 A;  4F7H A;  2OTX A;  4KHB B;  3PVW A;  2VKI A;  4WSF A;  4A6F B;  1MIZ B;  3AU5 A;  2I5C A;  2PZ1 A;  4GXB A;  4HDO A;  5D3W A;  1FHW A;  3M1I B;  1EGX A;  5HE1 A;  4HAV B;  2IFS A;  1FGY A;  4C0A A;  1NI2 A;  1V88 A;  4L6E A;  5D3X A;  1U5G A;  1UNP A;  3F5R A;  1K5G B;  2P0F A;  2VSZ A;  3N7C A;  2QKM A;  3SO6 A;  1KZG A;  2KCJ A;  2AEH A;  1FAO A;  2DHJ A;  1EVH A;  3DXC A;  2LOX A;  3A8P A;  4KAX B;  3KZ1 A;  2I1J A;  1DYN A;  1Z87 A;  4K2O A;  1NTV A;  2H7E A;  3A98 B;  1QC6 A;  1X11 A;  2YS1 A;  4GPT B;  2DX1 A;  1IRS A;  2D9X A;  4TYZ A;  3FM8 C;  2UVM A;  2BCJ A;  2Z0O A;  4K17 A;  1FHO A;  3KRX A;  1E5W A;  4GMV A;  5JP4 A;  2I5F A;  2RUK B;  2LUL A;  2EJ8 A;  3HQC A;  5DIF B;  4CHJ A;  3MPX A;  1RJ2 A;  2J0M A;  5J3Q A;  2ROZ B;  3QIJ A;  1SHC A;  2DLW A;  4B6H A;  1U5D A;  3V5W A;  2YSZ A;  1U29 A;  2Z0Q A;  3PZD A;  1OY2 A;  4Y94 A;  1M7R A;  2N0Y A;  3PG7 A;  3SNH A;  2RGN B;  5HE2 A;  2P8V A;  2DYQ A;  1TJ6 A;  4PQ0 A;  2ADZ A;  3TO1 A;  1LW3 A;  2D10 A;  2HTH B;  5JHH A;  3ULC A;  3P7Z A;  5JLJ B;  2J59 M;  2JP2 A;  5L81 A;  2CY5 A;  1GC6 A;  4KVG B;  4Z2M B;  1P3R A;  4HAZ B;  3FEH A;  1DDV A;  2DX5 A;  2MKR A;  3PVU A;  2COC A;  5DHF B;  2D9Z A;  3KRW A;  1MKE A;  3VOQ A;  2KUP A;  3P6A A;  2RNR B;  2W2X D;  2D4Q A;  5KCV A;  1WGU A;  1TXD A;  4Z2N A;  1OQN A;  3ULB A;  5DH9 B;  2Y8G A;  1P6S A;  1V5U A;  2DFK A;  3FSS A;  1Q67 A;  2YF0 A;  4HDQ A;  3LJU X;  3G9W A;  1B55 A;  3ODX A;  2Z0P A;  4ZRK A;  4PNK A;  1U2B A;  2D11 A;  2L2I A;  1FHX A;  3IVF A;  2GS0 A;  2MWN B;  4IFS A;  1WVH A;  1W1H A;  5CLL B;  3ZDT A;  2KGX B;  1W1D A;  4F7U P;  3D8E A;  2M38 A;  4DX9 0;  2K2J A;  5CLQ B;  3QBV B;  4WVF B;  3F0W A;  1H4R A;  3WA0 A;  2LOZ A;  1DRO A;  5FI0 A;  1BWN A;  2COD A;  3DXD A;  2H7D A;  1J0W A;  4EMO A;  4HB3 B;  4MK0 A;  5D27 A;  2EMS A;  3SUZ A;  4KHO A;  2R09 A;  3D8D A;  4GN1 A;  1U27 A;  1WJM A;  2ROV A;  4K81 A;  1UNR A;  2ELB A;  2DHI A;  3X23 A;  2J0K A;  2W2X C;  3PVL A;  4K2P A;  1WG7 A;  4WJ7 A;  3KSY A;  1K5D B;  1X05 A;  1ZM0 A;  1MAI A;  2LG1 A;  2N23 A;  3KY9 A;  5KQ1 A;  2YS5 A;  3O96 A;  3D8F A;  2EMT A;  4MT7 A;  4YL8 A;  4TKN A;  5D3V A;  4A5K A;  2ELA A;  2GCL A;  4NSW A;  3SYX A;  3UZT A;  3BIN A;  4CYE A;  2DHK A;  1ISN A;  2MFQ A;  4HB2 B;  3A8Q A;  1W1G A;  3ODW A;  4D0N B;  2P0D A;  4F7G A;  1XX0 A;  1XD4 A;  1FOE A;  5JHG A;  2OQB A;  5DI9 B;  2EC1 A;  2W2W A;  2MDX A;  2D9Y A;  1RRP B;  2D9W A;  2YVC A;  4HB0 B;  3AU4 A;  4DXA B;  3ML4 A;  3PSC A;  1X1F A;  3SV1 A;  4P7I A;  2Q13 A;  5C5B A;  4A6K A;  2DN6 A;  2K00 A;  4MY6 A;  5DHA B;  2V76 A;  5HE3 A;  3WYF B;  1J19 A; 
#chains in the Genus database with same CATH topology
 4QXA B;  1V61 A;  4XWX A;  1DBH A;  2HE7 A;  2I1K A;  4HB4 B;  3PP2 A;  4HAY B;  2Z13 A;  5GOW B;  2R0D A;  2YT0 A;  2UZR A;  1FB8 A;  2R2Y A;  2K8E A;  2DKQ A;  4IAP A;  1BAK A;  1U5E A;  2KIE A;  2NMB A;  4GZU A;  4D6W A;  3U8Z A;  1NTY A;  1XR0 B;  2DA0 A;  1V5P A;  5FI1 A;  2ZPY A;  1H10 A;  1I7A A;  3HK0 A;  4H8S A;  5EFX A;  1MK9 B;  3HW2 B;  3MDB C;  1QQG A;  3TFM A;  3FVC A;  1EF1 A;  3NWD A;  1EAZ A;  1ZVR A;  1BTK A;  2CY4 A;  3NWA A;  1KI1 B;  4HAW B;  5KQ4 A;  2Y8F A;  4A6H A;  1SGH A;  2D2Q A;  2XQN M;  1WI1 A;  3TVV A;  1MK7 B;  2COF A;  1WJ1 A;  2IYB A;  2YS3 A;  4KHA A;  1P5T A;  2E2X A;  3QWM A;  4KHB A;  2Z59 A;  2LYD A;  4HAT B;  2VRW B;  4A6F A;  2P0H A;  5LOP B;  1AQC A;  2L1C A;  2Y7B A;  3DXE A;  2GCJ A;  3T06 A;  3U7D A;  1UEF A;  4HAU B;  2CRF A;  3OAN A;  4QJ4 B;  5C16 A;  2QKL A;  1WGQ A;  1TQZ A;  4HHV A;  5J3Y A;  2ZKM X;  2DYN A;  5J3T A;  3CXB B;  1ZC4 B;  2G35 A;  2UZS A;  3NSU A;  2CAY A;  2COA A;  1Y19 B;  3NWF A;  3BJI A;  2M14 A;  1UNQ A;  3DCX A;  1PMS A;  1V89 A;  2X18 A;  4OT1 A;  4YON A;  2NZ8 B;  4BBK A;  2YRY A;  5C79 A;  1NU2 A;  2KR0 A;  5C5B B;  1UPQ A;  4GMX B;  1I2H A;  1XKE A;  1Y5O A;  2AL6 A;  1X1G A;  3AJ4 A;  3GYO A;  1XOD A;  2FJL A;  4HAX B;  5M4Y B;  4DX8 A;  3ODO A;  2J0J A;  1DDW A;  1BTN A;  3PEG A;  2RSG A;  1UPR A;  2DTC A;  1KZ7 A;  2D9V A;  4ZRJ A;  2GJY A;  1OMW A;  1AWE A;  3CIK A;  1N3H A;  5HE0 A;  4DBB A;  5LG4 B;  4CHM A;  1MPH A;  3TCA A;  1FGZ A;  1ZSQ A;  1X86 A;  1ZC3 B;  2DKP A;  3RCP A;  2Z4D A;  3GYP A;  3ZVR A;  1MIX A;  1GC7 A;  4EKU A;  3VIA A;  4EJN A;  5C6R A;  5LON B;  1XCG A;  1U5F A;  2RVB B;  4L1R A;  4ZRI A;  1GG3 A;  1LB1 A;  4NY0 A;  2LKO A;  1PFJ A;  2K2U A;  2RLO A;  1V5M A;  1M7E A;  3TW1 A;  4IOY X;  5D3Y A;  1DDM A;  1PLS A;  1T77 A;  2YT1 A;  4F7H A;  2OTX A;  4KHB B;  3PVW A;  2KUQ A;  2VKI A;  4WSF A;  4A6F B;  1MIZ B;  3AU5 A;  2I5C A;  2PZ1 A;  4GXB A;  4HDO A;  5D3W A;  1FHW A;  3M1I B;  1EGX A;  5HE1 A;  4HAV B;  2IFS A;  1FGY A;  4C0A A;  1NI2 A;  1V88 A;  2K49 A;  4L6E A;  4HSI A;  5D3X A;  1U5G A;  1UNP A;  3F5R A;  1K5G B;  2P0F A;  2VSZ A;  3N7C A;  2RRF A;  2QKM A;  3SO6 A;  1KZG A;  2KCJ A;  3B77 A;  2AEH A;  1FAO A;  2DHJ A;  1EVH A;  3DXC A;  2GUM A;  2LOX A;  3A8P A;  4KAX B;  3KZ1 A;  2I1J A;  1DYN A;  1Z87 A;  4K2O A;  1NTV A;  2H7E A;  3A98 B;  1QC6 A;  1X11 A;  2YS1 A;  4GPT B;  2DX1 A;  1IRS A;  2D9X A;  4TYZ A;  3FM8 C;  2UVM A;  2BCJ A;  2Z0O A;  4K17 A;  1FHO A;  3KRX A;  1E5W A;  4GMV A;  5JP4 A;  2I5F A;  2RUK B;  2LUL A;  2EJ8 A;  3HQC A;  5DIF B;  4CHJ A;  3MPX A;  1RJ2 A;  2J0M A;  4QJ3 B;  5J3Q A;  2ROZ B;  3QIJ A;  1SHC A;  2DLW A;  4B6H A;  1U5D A;  3V5W A;  2YSZ A;  1U29 A;  2Z0Q A;  3PZD A;  1OY2 A;  4Y94 A;  1M7R A;  2N0Y A;  3PG7 A;  4OSN A;  3SNH A;  2RGN B;  5HE2 A;  3U12 A;  2P8V A;  2DYQ A;  1TJ6 A;  4PQ0 A;  2ADZ A;  3TO1 A;  2NBV A;  1LW3 A;  2D10 A;  2FJU B;  1ZYI A;  2HTH B;  5JHH A;  3ULC A;  3P7Z A;  5JLJ B;  2J59 M;  2JP2 A;  5L81 A;  3A58 A;  2CY5 A;  1GC6 A;  4KVG B;  4CSQ A;  4Z2M B;  1P3R A;  4HAZ B;  3FEH A;  1DDV A;  2DX5 A;  2MKR A;  3PVU A;  2COC A;  2Z14 A;  5DHF B;  2D9Z A;  3KRW A;  1MKE A;  3VOQ A;  2KUP A;  4GNK B;  3P6A A;  2RNR B;  2W2X D;  2D4Q A;  5KCV A;  1WGU A;  1TXD A;  4Z2N A;  1OQN A;  3ULB A;  1MI1 A;  5DH9 B;  2Y8G A;  1P6S A;  1V5U A;  2DFK A;  3FSS A;  1Q67 A;  2YF0 A;  4HDQ A;  3LJU X;  3G9W A;  1B55 A;  3ODX A;  2Z0P A;  4ZRK A;  4PNK A;  1U2B A;  2D11 A;  2L2I A;  1FHX A;  4DIX A;  3IVF A;  2GS0 A;  2MWN B;  4IFS A;  1WVH A;  1W1H A;  5CLL B;  3ZDT A;  2KGX B;  1W1D A;  4F7U P;  3D8E A;  2M38 A;  4DX9 0;  2K2J A;  5CLQ B;  3QBV B;  4WVF B;  3F0W A;  1H4R A;  3WA0 A;  2LOZ A;  1DRO A;  5FI0 A;  1BWN A;  2COD A;  3DXD A;  2H7D A;  1J0W A;  4EMO A;  4HB3 B;  4MK0 A;  5D27 A;  2EMS A;  3SUZ A;  4KHO A;  2R09 A;  3D8D A;  4GN1 A;  1U27 A;  1WJM A;  2ROV A;  4K81 A;  1UNR A;  2ELB A;  2DHI A;  3X23 A;  2J0K A;  2W2X C;  3PVL A;  4K2P A;  1WG7 A;  4WJ7 A;  3KSY A;  1K5D B;  1X05 A;  1ZM0 A;  1MAI A;  2LG1 A;  2N23 A;  3KY9 A;  5KQ1 A;  2YS5 A;  3O96 A;  3D8F A;  2EMT A;  4MT7 A;  4YL8 A;  2YT2 A;  4TKN A;  5D3V A;  4A5K A;  2KIG A;  2ELA A;  2GCL A;  4NSW A;  3OHM B;  3SYX A;  3UZT A;  5I2S A;  3BIN A;  4CYE A;  2DHK A;  1ISN A;  2MFQ A;  4HB2 B;  5I2M A;  3NW8 A;  3A8Q A;  1W1G A;  3ODW A;  4D0N B;  2P0D A;  4F7G A;  1XX0 A;  1XD4 A;  1FOE A;  5JHG A;  2OQB A;  5DI9 B;  2EC1 A;  5IRS A;  2W2W A;  4GOU A;  2MDX A;  2D9Y A;  1RRP B;  2D9W A;  2YVC A;  4HB0 B;  3AU4 A;  3HSA A;  4DXA B;  3ML4 A;  3PSC A;  1X1F A;  3SV1 A;  4P7I A;  2Q13 A;  5C5B A;  4A6K A;  3HIE A;  2DN6 A;  2K00 A;  4MY6 A;  5DHA B;  2V76 A;  4QJ5 B;  5HE3 A;  3WYF B;  1J19 A; 
#chains in the Genus database with same CATH homology
 4XWX A;  1V61 A;  1DBH A;  2HE7 A;  2I1K A;  4HB4 B;  3PP2 A;  4HAY B;  5GOW B;  2R0D A;  2YT0 A;  2UZR A;  1FB8 A;  2DKQ A;  4IAP A;  1BAK A;  1U5E A;  2NMB A;  4GZU A;  3U8Z A;  1NTY A;  1XR0 B;  2DA0 A;  1V5P A;  5FI1 A;  2ZPY A;  1H10 A;  1I7A A;  3HK0 A;  4H8S A;  5EFX A;  1MK9 B;  3HW2 B;  3MDB C;  1QQG A;  3TFM A;  1EF1 A;  1EAZ A;  1ZVR A;  1BTK A;  2CY4 A;  4HAW B;  1KI1 B;  5KQ4 A;  2Y8F A;  4A6H A;  1SGH A;  2D2Q A;  2XQN M;  1WI1 A;  3TVV A;  1MK7 B;  2COF A;  1WJ1 A;  2IYB A;  2YS3 A;  4KHA A;  1P5T A;  2E2X A;  3QWM A;  2LYD A;  4HAT B;  2VRW B;  4A6F A;  2P0H A;  5LOP B;  1AQC A;  2L1C A;  2Y7B A;  3DXE A;  2GCJ A;  3T06 A;  3U7D A;  1UEF A;  4HAU B;  2CRF A;  3OAN A;  5C16 A;  2QKL A;  1WGQ A;  1TQZ A;  4HHV A;  5J3Y A;  2DYN A;  5J3T A;  3CXB B;  1ZC4 B;  2G35 A;  2UZS A;  3NSU A;  2CAY A;  2COA A;  1Y19 B;  3BJI A;  2M14 A;  1UNQ A;  1PMS A;  1V89 A;  2X18 A;  4YON A;  2NZ8 B;  4BBK A;  2YRY A;  5C79 A;  1NU2 A;  5C5B B;  1UPQ A;  4GMX B;  1I2H A;  1XKE A;  1Y5O A;  2AL6 A;  1X1G A;  3AJ4 A;  3GYO A;  1XOD A;  2FJL A;  4HAX B;  4DX8 A;  3ODO A;  2J0J A;  1DDW A;  1BTN A;  3PEG A;  2RSG A;  1UPR A;  2DTC A;  1KZ7 A;  2D9V A;  4ZRJ A;  2GJY A;  1OMW A;  1AWE A;  3CIK A;  1N3H A;  5HE0 A;  4DBB A;  4CHM A;  1MPH A;  3TCA A;  1FGZ A;  1ZSQ A;  1X86 A;  1ZC3 B;  2DKP A;  3RCP A;  3GYP A;  3ZVR A;  1MIX A;  1GC7 A;  4EKU A;  3VIA A;  4EJN A;  5C6R A;  5LON B;  1XCG A;  1U5F A;  2RVB B;  4ZRI A;  1GG3 A;  1LB1 A;  4NY0 A;  2LKO A;  1PFJ A;  2K2U A;  2RLO A;  1V5M A;  1M7E A;  3TW1 A;  4IOY X;  5D3Y A;  1DDM A;  1PLS A;  2YT1 A;  4F7H A;  2OTX A;  4KHB B;  3PVW A;  2VKI A;  4WSF A;  4A6F B;  1MIZ B;  3AU5 A;  2I5C A;  2PZ1 A;  4GXB A;  4HDO A;  5D3W A;  1FHW A;  3M1I B;  1EGX A;  5HE1 A;  4HAV B;  2IFS A;  1FGY A;  4C0A A;  1NI2 A;  1V88 A;  4L6E A;  5D3X A;  1U5G A;  1UNP A;  3F5R A;  1K5G B;  2P0F A;  2VSZ A;  3N7C A;  2QKM A;  3SO6 A;  1KZG A;  2KCJ A;  2AEH A;  1FAO A;  2DHJ A;  1EVH A;  3DXC A;  2LOX A;  3A8P A;  4KAX B;  3KZ1 A;  2I1J A;  1DYN A;  1Z87 A;  4K2O A;  1NTV A;  2H7E A;  3A98 B;  1QC6 A;  1X11 A;  2YS1 A;  4GPT B;  2DX1 A;  1IRS A;  2D9X A;  4TYZ A;  3FM8 C;  2UVM A;  2BCJ A;  2Z0O A;  4K17 A;  1FHO A;  3KRX A;  1E5W A;  4GMV A;  5JP4 A;  2I5F A;  2RUK B;  2LUL A;  2EJ8 A;  3HQC A;  5DIF B;  4CHJ A;  3MPX A;  1RJ2 A;  2J0M A;  5J3Q A;  2ROZ B;  3QIJ A;  1SHC A;  2DLW A;  4B6H A;  1U5D A;  3V5W A;  2YSZ A;  1U29 A;  2Z0Q A;  3PZD A;  1OY2 A;  4Y94 A;  1M7R A;  2N0Y A;  3PG7 A;  3SNH A;  2RGN B;  5HE2 A;  2P8V A;  2DYQ A;  1TJ6 A;  4PQ0 A;  2ADZ A;  3TO1 A;  1LW3 A;  2D10 A;  2HTH B;  5JHH A;  3ULC A;  3P7Z A;  5JLJ B;  2J59 M;  2JP2 A;  5L81 A;  2CY5 A;  1GC6 A;  4KVG B;  4Z2M B;  1P3R A;  4HAZ B;  3FEH A;  1DDV A;  2DX5 A;  2MKR A;  3PVU A;  2COC A;  5DHF B;  2D9Z A;  3KRW A;  1MKE A;  3VOQ A;  2KUP A;  3P6A A;  2RNR B;  2W2X D;  2D4Q A;  5KCV A;  1WGU A;  1TXD A;  4Z2N A;  1OQN A;  3ULB A;  5DH9 B;  2Y8G A;  1P6S A;  1V5U A;  2DFK A;  3FSS A;  1Q67 A;  2YF0 A;  4HDQ A;  3LJU X;  3G9W A;  1B55 A;  3ODX A;  2Z0P A;  4ZRK A;  4PNK A;  1U2B A;  2D11 A;  2L2I A;  1FHX A;  3IVF A;  2GS0 A;  2MWN B;  4IFS A;  1WVH A;  1W1H A;  5CLL B;  3ZDT A;  2KGX B;  1W1D A;  4F7U P;  3D8E A;  2M38 A;  4DX9 0;  2K2J A;  5CLQ B;  3QBV B;  4WVF B;  3F0W A;  1H4R A;  3WA0 A;  2LOZ A;  1DRO A;  5FI0 A;  1BWN A;  2COD A;  3DXD A;  2H7D A;  1J0W A;  4EMO A;  4HB3 B;  4MK0 A;  5D27 A;  2EMS A;  3SUZ A;  4KHO A;  2R09 A;  3D8D A;  4GN1 A;  1U27 A;  1WJM A;  2ROV A;  4K81 A;  1UNR A;  2ELB A;  2DHI A;  3X23 A;  2J0K A;  2W2X C;  3PVL A;  4K2P A;  1WG7 A;  4WJ7 A;  3KSY A;  1K5D B;  1X05 A;  1ZM0 A;  1MAI A;  2LG1 A;  2N23 A;  3KY9 A;  5KQ1 A;  2YS5 A;  3O96 A;  3D8F A;  2EMT A;  4MT7 A;  4YL8 A;  4TKN A;  5D3V A;  4A5K A;  2ELA A;  2GCL A;  4NSW A;  3SYX A;  3UZT A;  3BIN A;  4CYE A;  2DHK A;  1ISN A;  2MFQ A;  4HB2 B;  3A8Q A;  1W1G A;  3ODW A;  4D0N B;  2P0D A;  4F7G A;  1XX0 A;  1XD4 A;  1FOE A;  5JHG A;  2OQB A;  5DI9 B;  2EC1 A;  2W2W A;  2MDX A;  2D9Y A;  1RRP B;  2D9W A;  2YVC A;  4HB0 B;  3AU4 A;  4DXA B;  3ML4 A;  3PSC A;  1X1F A;  3SV1 A;  4P7I A;  2Q13 A;  5C5B A;  4A6K A;  2DN6 A;  2K00 A;  4MY6 A;  5DHA B;  2V76 A;  5HE3 A;  3WYF B;  1J19 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...