2YT0A

Solution structure of the chimera of the c-terminal tail peptide of app and the c-terminal pid domain of fe65l
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
176
structure length
176
Chain Sequence
GSSGSSGDAAVTPEERHLSKMQQNGYENPTYKFFEQMQNSGSSGSSGSSGSSGPTPKTELVQKFRVQYLGMLPVDRPVGMDTLNSAIENLMTSSSKEDWPSVNMNVADATVTVISEKNEEEVLVECRVRFLSFMGVGKDVHTFAFIMDTGNQRFECHVFWCEPNAANVSEAVQAAC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords Amyloid beta A4 protein and Amyloid beta A4 precursor protei
publication title Structure of the C-terminal phosphotyrosine interaction domain of Fe65L1 complexed with the cytoplasmic tail of amyloid precursor protein reveals a novel peptide binding mode
pubmed doi rcsb
source organism Mus musculus
total genus 24
structure length 176
sequence length 176
ec nomenclature
pdb deposition date 2007-04-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2yt0A01
2P0DA 3A98B 4MT7A 2YS1A 1UPQA 4NSWA 3WA0A 5C5BB 3U7DA 3OANA 4DXAB 5JLJB 2GCLA 2GJYA 2K2JA 1AQCA 2D11A 4YL8A 2M38A 1MK9B 2R0DA 2Y7BA 4CHMA 1ZM0A 3DXDA 1QQGA 2R09A 2EC1A 4DBBA 1EAZA 1Y5OA 5D27A 1K5DB 1W1HA 1XKEA 2ROZB 1E5WA 1Q67A 3VOQA 4A6KA 5DIFB 4CYEA 2YSZA 4MK0A 4HAZB 2QKMA 3TW1A 3TO1A 1NTVA 4KHBB 1SHCA 4EMOA 4IOYX 1QC6A 3A8PA 3AU4A 1KZGA 2RLOA 3CXBB 2LG1A 2KCJA 3AU5A 3DXEA 1X86A 1FHWA 3QWMA 4KAXB 5D3XA 1U5FA 1SGHA 1U27A 5D3YA 2L1CA 3LJUX 3TCAA 1WVHA 2D9ZA 4YONA 3GYOA 3PVLA 1V5MA 5CLLB 2P8VA 5HE0A 1W1GA 2X18A 2CODA 1KI1B 2EJ8A 3KRWA 4NY0A 2RNRB 2K2UA 1ZC3B 3P6AA 3HQCA 4WSFA 1XD4A 2NMBA 2AL6A 2YF0A 2H7EA 3PG7A 3QBVB 3P7ZA 4EKUA 1DDMA 1BTNA 4KVGB 1U2BA 1UNQA 4K17A 2K00A 1J0WA 1TJ6A 1NTYA 2XQNM 3N7CA 3BINA 4BBKA 3ML4A 2LOZA 5D3WA 3SUZA 2I5CA 3MPXA 3CIKA 2DYNA 2RGNB 2LULA 4XWXA 5J3YA 3UZTA 3FSSA 2J0JA 1EF1A 1V5PA 2VKIA 3PZDA 5GOWB 4PQ0A 1J19A 1V89A 2CY5A 1K5GB 4K2OA 1U29A 3D8FA 1FOEA 1H4RA 2Y8GA 3PVWA 3ODOA 5J3TA 1P3RA 4HB3B 2OQBA 4HAUB 4KHAA 3D8EA 1XR0B 1X1FA 4HAXB 3ZVRA 3HK0A 4DX8A 4HAWB 4Z2NA 4C0AA 2OTXA 3D8DA 4A5KA 2ELAA 2D10A 3ULCA 5EFXA 4TYZA 2DHIA 5KQ4A 4DX90 4GXBA 4F7UP 1B55A 1PFJA 5FI0A 3TVVA 5J3QA 1TQZA 1WGUA 2MKRA 1OY2A 2RUKB 2DA0A 2EMSA 3NSUA 1U5DA 2EMTA 2N23A 1RJ2A 1FHXA 3SNHA 1KZ7A 3F0WA 2DKPA 3ODWA 2KUPA 1Z87A 1M7EA 3RCPA 2D2QA 4HATB 1U5GA 2W2WA 1AWEA 1WI1A 2Z0QA 2IFSA 2NZ8B 2P0HA 5KCVA 4EJNA 3ULBA 2LKOA 2DKQA 5C16A 4WVFB 1IRSA 4Z2MB 2D9VA 1OMWA 1FB8A 2ROVA 1XODA 1BWNA 1WG7A 4HDQA 2J59M 1UPRA 4P7IA 2G35A 4IAPA 1H10A 2MWNB 4CHJA 2UZRA 3BJIA 1WJ1A 3ZDTA 1V5UA 2J0KA 3PP2A 2ELBA 2YT1A 3IVFA 2Z0PA 3A8QA 1FGYA 3KZ1A 2ZPYA 2J0MA 4IFSA 4A6FA 2YRYA 5C6RA 1X05A 1PMSA 4B6HA 1BAKA 5FI1A 1DYNA 5KQ1A 1I2HA 1Y19B 5JP4A 1X11A 2VSZA 4F7HA 1ISNA 4HDOA 1W1DA 3X23A 5LOPB 1BTKA 2N0YA 2DHKA 2LOXA 5DH9B 1DROA 4HAVB 2HE7A 3QIJA 2I1KA 2I1JA 2VRWB 4GN1A 1MAIA 2D9WA 1P6SA 1ZC4B 2DFKA 3DXCA 1RRPB 2DN6A 2LYDA 3SO6A 3FEHA 1WGQA 5HE2A 3TFMA 2HTHB 2DX1A 3V5WA 3WYFB 2RSGA 1I7AA 1FAOA 2YT0A 1UNRA 4ZRJA 1OQNA 2CAYA 4TKNA 5JHHA 4GPTB 1LB1A 2PZ1A 1DDVA 1GG3A 2Q13A 5DHFB 1MIZB 5HE1A 2JP2A 5CLQB 1TXDA 5DHAB 2P0FA 4HHVA 4HB4B 2MFQA 3HW2B 2W2XD 3G9WA 1WJMA 2GCJA 4A6HA 5D3VA 2CRFA 2L2IA 3KSYA 4WJ7A 4A6FB 1MKEA 2D4QA 5L81A 1FHOA 3FM8C 2YS3A 2D9XA 4K2PA 4GMVA 2ADZA 5C5BA 2COCA 1M7RA 3SV1A 5LONB 1UNPA 1PLSA 1ZVRA 1UEFA 2BCJA 2UVMA 3AJ4A 4GZUA 1MIXA 5C79A 2AEHA 1GC7A 1NI2A 2W2XC 3VIAA 2COFA 2RVBB 2IYBA 2I5FA 2DTCA 3KY9A 1X1GA 5DI9B 1N3HA 2H7DA 2YVCA 4GMXB 2QKLA 3PVUA 4L6EA 1MPHA 3KRXA 2E2XA 2DLWA 2KGXB 3PEGA 2DHJA 2UZSA 1XCGA 3O96A 1DDWA 3M1IB 1V88A 3GYPA 1LW3A 4K81A 3PSCA 1U5EA 2MDXA 1MK7B 4F7GA 4KHOA 1ZSQA 4ZRKA 1V61A 4HB0B 2GS0A 1DBHA 4Y94A 3ODXA 3U8ZA 4D0NB 4H8SA 2M14A 2D9YA 2DX5A 3T06A 1P5TA 1EVHA 5HE3A 2FJLA 4ZRIA 1FGZA 4HAYB 1EGXA 1GC6A 2V76A 2YS5A 5JHGA 3SYXA 2Y8FA 1XX0A 2Z0OA 4MY6A 2DYQA 1NU2A 3MDBC 4PNKA 2COAA 2CY4A 4HB2B 3F5RA
chains in the Genus database with same CATH superfamily
2P0DA 3A98B 4MT7A 2YS1A 1UPQA 4NSWA 3WA0A 5C5BB 3U7DA 3OANA 4DXAB 5JLJB 2GCLA 2GJYA 2K2JA 1AQCA 2D11A 4YL8A 2M38A 1MK9B 2R0DA 2Y7BA 4CHMA 1ZM0A 3DXDA 1QQGA 2R09A 2EC1A 4DBBA 1EAZA 1Y5OA 5D27A 1K5DB 1W1HA 1XKEA 2ROZB 1E5WA 3U12A 1Q67A 3VOQA 4A6KA 5DIFB 4CYEA 2YSZA 4MK0A 2FJUB 4HAZB 2QKMA 3TW1A 3TO1A 1NTVA 4KHBB 4DIXA 1SHCA 4EMOA 4GOUA 4IOYX 1QC6A 3A8PA 3AU4A 1KZGA 2RLOA 3CXBB 2LG1A 2KCJA 3AU5A 3DXEA 1X86A 1FHWA 3QWMA 4KAXB 5D3XA 1U5FA 1SGHA 1U27A 5D3YA 2L1CA 3LJUX 3TCAA 1WVHA 2D9ZA 4YONA 3GYOA 3PVLA 3A58A 1V5MA 5CLLB 2P8VA 5HE0A 1W1GA 2X18A 2CODA 1KI1B 2EJ8A 3KRWA 4NY0A 2RNRB 2KIGA 2K2UA 1ZC3B 3HQCA 3P6AA 4WSFA 1XD4A 2NMBA 2AL6A 2YF0A 2H7EA 3PG7A 3QBVB 3P7ZA 4EKUA 1DDMA 1BTNA 3HIEA 4KVGB 1U2BA 1UNQA 4K17A 2K00A 5I2SA 1J0WA 1TJ6A 1NTYA 2XQNM 3N7CA 3BINA 4BBKA 3ML4A 4L1RA 2LOZA 5D3WA 3SUZA 2I5CA 4QJ5B 3MPXA 3CIKA 2DYNA 2RGNB 2LULA 4XWXA 5J3YA 3UZTA 2NBVA 4QJ3B 3FSSA 2J0JA 1EF1A 1V5PA 2VKIA 3PZDA 2Z14A 5GOWB 4PQ0A 3OHMB 1J19A 1V89A 2CY5A 1K5GB 2RRFA 3NWFA 4K2OA 1U29A 3D8FA 1FOEA 1H4RA 2Y8GA 3PVWA 3ODOA 5J3TA 1P3RA 4HB3B 2OQBA 4HAUB 4KHAA 3D8EA 5LG4B 1XR0B 1X1FA 4HAXB 3DCXA 3ZVRA 3HK0A 4DX8A 4HAWB 4Z2NA 4C0AA 2K49A 2OTXA 3D8DA 4A5KA 2ELAA 4CSQA 2D10A 3ULCA 5EFXA 4TYZA 2DHIA 2Z4DA 5KQ4A 4DX90 4GXBA 4F7UP 1B55A 1PFJA 5FI0A 3TVVA 5J3QA 1TQZA 1WGUA 2MKRA 1OY2A 2RUKB 4GNKB 2DA0A 2EMSA 3NSUA 1U5DA 2EMTA 3B77A 2N23A 1RJ2A 1FHXA 3SNHA 1KZ7A 3F0WA 2DKPA 3ODWA 2KUPA 1Z87A 1M7EA 3RCPA 2D2QA 4HATB 1U5GA 2W2WA 1AWEA 1WI1A 2Z0QA 2IFSA 2NZ8B 2P0HA 5KCVA 4EJNA 2ZKMX 3ULBA 2LKOA 2DKQA 5C16A 4WVFB 1IRSA 2R2YA 4Z2MB 2D9VA 1OMWA 1FB8A 2KIEA 2ROVA 1XODA 1BWNA 1WG7A 4HDQA 2J59M 1UPRA 4P7IA 2G35A 4IAPA 1H10A 2MWNB 4CHJA 2UZRA 3BJIA 1WJ1A 3ZDTA 1V5UA 2J0KA 4QXAB 3PP2A 2ELBA 2YT1A 3IVFA 2Z0PA 3A8QA 1FGYA 3KZ1A 2ZPYA 2J0MA 4IFSA 4A6FA 2YRYA 5C6RA 1X05A 1PMSA 4B6HA 1BAKA 5M4YB 5FI1A 1DYNA 5KQ1A 1I2HA 1Y19B 5JP4A 1X11A 2VSZA 4F7HA 1ISNA 4HDOA 1W1DA 4QJ4B 3X23A 5LOPB 1BTKA 2N0YA 2DHKA 2LOXA 5DH9B 1DROA 4HAVB 2HE7A 3QIJA 5IRSA 2KUQA 2I1KA 2I1JA 2VRWB 4GN1A 1MAIA 2D9WA 1P6SA 1ZC4B 2DFKA 3DXCA 1RRPB 2DN6A 4OSNA 2LYDA 3SO6A 2KR0A 3FEHA 3FVCA 3NW8A 1WGQA 5HE2A 3TFMA 2HTHB 4HSIA 2DX1A 3V5WA 3WYFB 2RSGA 1I7AA 1FAOA 2YT0A 1MI1A 1UNRA 4ZRJA 1OQNA 2CAYA 4TKNA 5JHHA 4GPTB 1LB1A 2PZ1A 3NWAA 1DDVA 1GG3A 2Q13A 5DHFB 1MIZB 2Z59A 5HE1A 2JP2A 1T77A 5CLQB 1TXDA 5DHAB 2P0FA 4HHVA 4HB4B 2MFQA 3HW2B 2W2XD 3G9WA 1WJMA 2GCJA 4A6HA 2Z13A 5D3VA 2CRFA 2L2IA 3KSYA 4WJ7A 4A6FB 1MKEA 2D4QA 5L81A 1FHOA 3FM8C 2YS3A 2D9XA 4K2PA 4GMVA 2ADZA 5C5BA 1ZYIA 2COCA 1M7RA 3SV1A 5LONB 3NWDA 1UNPA 1PLSA 1ZVRA 1UEFA 2BCJA 2UVMA 3AJ4A 4GZUA 1MIXA 5C79A 2AEHA 1GC7A 1NI2A 2W2XC 3VIAA 2COFA 2RVBB 2IYBA 2I5FA 2DTCA 3KY9A 1X1GA 5DI9B 1N3HA 2H7DA 2YVCA 4GMXB 2QKLA 3PVUA 4L6EA 1MPHA 3KRXA 2E2XA 2DLWA 2KGXB 3PEGA 2DHJA 2K8EA 2UZSA 1XCGA 3O96A 1DDWA 3M1IB 1V88A 2GUMA 3GYPA 1LW3A 4K81A 3PSCA 1U5EA 4KHBA 2MDXA 1MK7B 4F7GA 4KHOA 1ZSQA 5I2MA 4ZRKA 1V61A 4HB0B 2GS0A 1DBHA 4Y94A 3ODXA 3U8ZA 3HSAA 4OT1A 4D0NB 4H8SA 2M14A 2D9YA 2DX5A 3T06A 1P5TA 1EVHA 5HE3A 2FJLA 2YT2A 4ZRIA 1FGZA 4HAYB 1EGXA 1GC6A 2V76A 2YS5A 5JHGA 3SYXA 2Y8FA 1XX0A 2Z0OA 4MY6A 2DYQA 1NU2A 3MDBC 4D6WA 4PNKA 2COAA 2CY4A 4HB2B 3F5RA
chains in the Genus database with same CATH topology
2P0DA 3A98B 4MT7A 2YS1A 1UPQA 4NSWA 3WA0A 5C5BB 3U7DA 3OANA 4DXAB 5JLJB 2GCLA 2GJYA 2K2JA 1AQCA 2D11A 4YL8A 2M38A 1MK9B 2R0DA 2Y7BA 4CHMA 1ZM0A 3DXDA 1QQGA 2R09A 2EC1A 4DBBA 1EAZA 1Y5OA 5D27A 1K5DB 1W1HA 1XKEA 2ROZB 1E5WA 1Q67A 3VOQA 4A6KA 5DIFB 4CYEA 2YSZA 4MK0A 4HAZB 2QKMA 3TW1A 3TO1A 1NTVA 4KHBB 1SHCA 4EMOA 4IOYX 1QC6A 3A8PA 3AU4A 1KZGA 2RLOA 3CXBB 2LG1A 2KCJA 3AU5A 3DXEA 1X86A 1FHWA 3QWMA 4KAXB 5D3XA 1U5FA 1SGHA 1U27A 5D3YA 2L1CA 3LJUX 3TCAA 1WVHA 2D9ZA 4YONA 3GYOA 3PVLA 1V5MA 5CLLB 2P8VA 5HE0A 1W1GA 2X18A 2CODA 1KI1B 2EJ8A 3KRWA 4NY0A 2RNRB 2K2UA 1ZC3B 3P6AA 3HQCA 4WSFA 1XD4A 2NMBA 2AL6A 2YF0A 2H7EA 3PG7A 3QBVB 3P7ZA 4EKUA 1DDMA 1BTNA 4KVGB 1U2BA 1UNQA 4K17A 2K00A 1J0WA 1TJ6A 1NTYA 2XQNM 3N7CA 3BINA 4BBKA 3ML4A 2LOZA 5D3WA 3SUZA 2I5CA 3MPXA 3CIKA 2DYNA 2RGNB 2LULA 4XWXA 5J3YA 3UZTA 3FSSA 2J0JA 1EF1A 1V5PA 2VKIA 3PZDA 5GOWB 4PQ0A 1J19A 1V89A 2CY5A 1K5GB 4K2OA 1U29A 3D8FA 1FOEA 1H4RA 2Y8GA 3PVWA 3ODOA 5J3TA 1P3RA 4HB3B 2OQBA 4HAUB 4KHAA 3D8EA 1XR0B 1X1FA 4HAXB 3ZVRA 3HK0A 4DX8A 4HAWB 4Z2NA 4C0AA 2OTXA 3D8DA 4A5KA 2ELAA 2D10A 3ULCA 5EFXA 4TYZA 2DHIA 5KQ4A 4DX90 4GXBA 4F7UP 1B55A 1PFJA 5FI0A 3TVVA 5J3QA 1TQZA 1WGUA 2MKRA 1OY2A 2RUKB 2DA0A 2EMSA 3NSUA 1U5DA 2EMTA 2N23A 1RJ2A 1FHXA 3SNHA 1KZ7A 3F0WA 2DKPA 3ODWA 2KUPA 1Z87A 1M7EA 3RCPA 2D2QA 4HATB 1U5GA 2W2WA 1AWEA 1WI1A 2Z0QA 2IFSA 2NZ8B 2P0HA 5KCVA 4EJNA 3ULBA 2LKOA 2DKQA 5C16A 4WVFB 1IRSA 4Z2MB 2D9VA 1OMWA 1FB8A 2ROVA 1XODA 1BWNA 1WG7A 4HDQA 2J59M 1UPRA 4P7IA 2G35A 4IAPA 1H10A 2MWNB 4CHJA 2UZRA 3BJIA 1WJ1A 3ZDTA 1V5UA 2J0KA 3PP2A 2ELBA 2YT1A 3IVFA 2Z0PA 3A8QA 1FGYA 3KZ1A 2ZPYA 2J0MA 4IFSA 4A6FA 2YRYA 5C6RA 1X05A 1PMSA 4B6HA 1BAKA 5FI1A 1DYNA 5KQ1A 1I2HA 1Y19B 5JP4A 1X11A 2VSZA 4F7HA 1ISNA 4HDOA 1W1DA 3X23A 5LOPB 1BTKA 2N0YA 2DHKA 2LOXA 5DH9B 1DROA 4HAVB 2HE7A 3QIJA 2I1KA 2I1JA 2VRWB 4GN1A 1MAIA 2D9WA 1P6SA 1ZC4B 2DFKA 3DXCA 1RRPB 2DN6A 2LYDA 3SO6A 3FEHA 1WGQA 5HE2A 3TFMA 2HTHB 2DX1A 3V5WA 3WYFB 2RSGA 1I7AA 1FAOA 2YT0A 1UNRA 4ZRJA 1OQNA 2CAYA 4TKNA 5JHHA 4GPTB 1LB1A 2PZ1A 1DDVA 1GG3A 2Q13A 5DHFB 1MIZB 5HE1A 2JP2A 5CLQB 1TXDA 5DHAB 2P0FA 4HHVA 4HB4B 2MFQA 3HW2B 2W2XD 3G9WA 1WJMA 2GCJA 4A6HA 5D3VA 2CRFA 2L2IA 3KSYA 4WJ7A 4A6FB 1MKEA 2D4QA 5L81A 1FHOA 3FM8C 2YS3A 2D9XA 4K2PA 4GMVA 2ADZA 5C5BA 2COCA 1M7RA 3SV1A 5LONB 1UNPA 1PLSA 1ZVRA 1UEFA 2BCJA 2UVMA 3AJ4A 4GZUA 1MIXA 5C79A 2AEHA 1GC7A 1NI2A 2W2XC 3VIAA 2COFA 2RVBB 2IYBA 2I5FA 2DTCA 3KY9A 1X1GA 5DI9B 1N3HA 2H7DA 2YVCA 4GMXB 2QKLA 3PVUA 4L6EA 1MPHA 3KRXA 2E2XA 2DLWA 2KGXB 3PEGA 2DHJA 2UZSA 1XCGA 3O96A 1DDWA 3M1IB 1V88A 3GYPA 1LW3A 4K81A 3PSCA 1U5EA 2MDXA 1MK7B 4F7GA 4KHOA 1ZSQA 4ZRKA 1V61A 4HB0B 2GS0A 1DBHA 4Y94A 3ODXA 3U8ZA 4D0NB 4H8SA 2M14A 2D9YA 2DX5A 3T06A 1P5TA 1EVHA 5HE3A 2FJLA 4ZRIA 1FGZA 4HAYB 1EGXA 1GC6A 2V76A 2YS5A 5JHGA 3SYXA 2Y8FA 1XX0A 2Z0OA 4MY6A 2DYQA 1NU2A 3MDBC 4PNKA 2COAA 2CY4A 4HB2B 3F5RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2P0D A;  3A98 B;  4MT7 A;  2YS1 A;  1UPQ A;  4NSW A;  3WA0 A;  5C5B B;  3U7D A;  3OAN A;  4DXA B;  5JLJ B;  2GCL A;  2GJY A;  2K2J A;  1AQC A;  2D11 A;  4YL8 A;  2M38 A;  1MK9 B;  2R0D A;  2Y7B A;  4CHM A;  1ZM0 A;  3DXD A;  1QQG A;  2R09 A;  2EC1 A;  4DBB A;  1EAZ A;  1Y5O A;  5D27 A;  1K5D B;  1W1H A;  1XKE A;  2ROZ B;  1E5W A;  1Q67 A;  3VOQ A;  4A6K A;  5DIF B;  4CYE A;  2YSZ A;  4MK0 A;  4HAZ B;  2QKM A;  3TW1 A;  3TO1 A;  1NTV A;  4KHB B;  1SHC A;  4EMO A;  4IOY X;  1QC6 A;  3A8P A;  3AU4 A;  1KZG A;  2RLO A;  3CXB B;  2LG1 A;  2KCJ A;  3AU5 A;  3DXE A;  1X86 A;  1FHW A;  3QWM A;  4KAX B;  5D3X A;  1U5F A;  1SGH A;  1U27 A;  5D3Y A;  2L1C A;  3LJU X;  3TCA A;  1WVH A;  2D9Z A;  4YON A;  3GYO A;  3PVL A;  1V5M A;  5CLL B;  2P8V A;  5HE0 A;  1W1G A;  2X18 A;  2COD A;  1KI1 B;  2EJ8 A;  3KRW A;  4NY0 A;  2RNR B;  2K2U A;  1ZC3 B;  3P6A A;  3HQC A;  4WSF A;  1XD4 A;  2NMB A;  2AL6 A;  2YF0 A;  2H7E A;  3PG7 A;  3QBV B;  3P7Z A;  4EKU A;  1DDM A;  1BTN A;  4KVG B;  1U2B A;  1UNQ A;  4K17 A;  2K00 A;  1J0W A;  1TJ6 A;  1NTY A;  2XQN M;  3N7C A;  3BIN A;  4BBK A;  3ML4 A;  2LOZ A;  5D3W A;  3SUZ A;  2I5C A;  3MPX A;  3CIK A;  2DYN A;  2RGN B;  2LUL A;  4XWX A;  5J3Y A;  3UZT A;  3FSS A;  2J0J A;  1EF1 A;  1V5P A;  2VKI A;  3PZD A;  5GOW B;  4PQ0 A;  1J19 A;  1V89 A;  2CY5 A;  1K5G B;  4K2O A;  1U29 A;  3D8F A;  1FOE A;  1H4R A;  2Y8G A;  3PVW A;  3ODO A;  5J3T A;  1P3R A;  4HB3 B;  2OQB A;  4HAU B;  4KHA A;  3D8E A;  1XR0 B;  1X1F A;  4HAX B;  3ZVR A;  3HK0 A;  4DX8 A;  4HAW B;  4Z2N A;  4C0A A;  2OTX A;  3D8D A;  4A5K A;  2ELA A;  2D10 A;  3ULC A;  5EFX A;  4TYZ A;  2DHI A;  5KQ4 A;  4DX9 0;  4GXB A;  4F7U P;  1B55 A;  1PFJ A;  5FI0 A;  3TVV A;  5J3Q A;  1TQZ A;  1WGU A;  2MKR A;  1OY2 A;  2RUK B;  2DA0 A;  2EMS A;  3NSU A;  1U5D A;  2EMT A;  2N23 A;  1RJ2 A;  1FHX A;  3SNH A;  1KZ7 A;  3F0W A;  2DKP A;  3ODW A;  2KUP A;  1Z87 A;  1M7E A;  3RCP A;  2D2Q A;  4HAT B;  1U5G A;  2W2W A;  1AWE A;  1WI1 A;  2Z0Q A;  2IFS A;  2NZ8 B;  2P0H A;  5KCV A;  4EJN A;  3ULB A;  2LKO A;  2DKQ A;  5C16 A;  4WVF B;  1IRS A;  4Z2M B;  2D9V A;  1OMW A;  1FB8 A;  2ROV A;  1XOD A;  1BWN A;  1WG7 A;  4HDQ A;  2J59 M;  1UPR A;  4P7I A;  2G35 A;  4IAP A;  1H10 A;  2MWN B;  4CHJ A;  2UZR A;  3BJI A;  1WJ1 A;  3ZDT A;  1V5U A;  2J0K A;  3PP2 A;  2ELB A;  2YT1 A;  3IVF A;  2Z0P A;  3A8Q A;  1FGY A;  3KZ1 A;  2ZPY A;  2J0M A;  4IFS A;  4A6F A;  2YRY A;  5C6R A;  1X05 A;  1PMS A;  4B6H A;  1BAK A;  5FI1 A;  1DYN A;  5KQ1 A;  1I2H A;  1Y19 B;  5JP4 A;  1X11 A;  2VSZ A;  4F7H A;  1ISN A;  4HDO A;  1W1D A;  3X23 A;  5LOP B;  1BTK A;  2N0Y A;  2DHK A;  2LOX A;  5DH9 B;  1DRO A;  4HAV B;  2HE7 A;  3QIJ A;  2I1K A;  2I1J A;  2VRW B;  4GN1 A;  1MAI A;  2D9W A;  1P6S A;  1ZC4 B;  2DFK A;  3DXC A;  1RRP B;  2DN6 A;  2LYD A;  3SO6 A;  3FEH A;  1WGQ A;  5HE2 A;  3TFM A;  2HTH B;  2DX1 A;  3V5W A;  3WYF B;  2RSG A;  1I7A A;  1FAO A;  2YT0 A;  1UNR A;  4ZRJ A;  1OQN A;  2CAY A;  4TKN A;  5JHH A;  4GPT B;  1LB1 A;  2PZ1 A;  1DDV A;  1GG3 A;  2Q13 A;  5DHF B;  1MIZ B;  5HE1 A;  2JP2 A;  5CLQ B;  1TXD A;  5DHA B;  2P0F A;  4HHV A;  4HB4 B;  2MFQ A;  3HW2 B;  2W2X D;  3G9W A;  1WJM A;  2GCJ A;  4A6H A;  5D3V A;  2CRF A;  2L2I A;  3KSY A;  4WJ7 A;  4A6F B;  1MKE A;  2D4Q A;  5L81 A;  1FHO A;  3FM8 C;  2YS3 A;  2D9X A;  4K2P A;  4GMV A;  2ADZ A;  5C5B A;  2COC A;  1M7R A;  3SV1 A;  5LON B;  1UNP A;  1PLS A;  1ZVR A;  1UEF A;  2BCJ A;  2UVM A;  3AJ4 A;  4GZU A;  1MIX A;  5C79 A;  2AEH A;  1GC7 A;  1NI2 A;  2W2X C;  3VIA A;  2COF A;  2RVB B;  2IYB A;  2I5F A;  2DTC A;  3KY9 A;  1X1G A;  5DI9 B;  1N3H A;  2H7D A;  2YVC A;  4GMX B;  2QKL A;  3PVU A;  4L6E A;  1MPH A;  3KRX A;  2E2X A;  2DLW A;  2KGX B;  3PEG A;  2DHJ A;  2UZS A;  1XCG A;  3O96 A;  1DDW A;  3M1I B;  1V88 A;  3GYP A;  1LW3 A;  4K81 A;  3PSC A;  1U5E A;  2MDX A;  1MK7 B;  4F7G A;  4KHO A;  1ZSQ A;  4ZRK A;  1V61 A;  4HB0 B;  2GS0 A;  1DBH A;  4Y94 A;  3ODX A;  3U8Z A;  4D0N B;  4H8S A;  2M14 A;  2D9Y A;  2DX5 A;  3T06 A;  1P5T A;  1EVH A;  5HE3 A;  2FJL A;  4ZRI A;  1FGZ A;  4HAY B;  1EGX A;  1GC6 A;  2V76 A;  2YS5 A;  5JHG A;  3SYX A;  2Y8F A;  1XX0 A;  2Z0O A;  4MY6 A;  2DYQ A;  1NU2 A;  3MDB C;  4PNK A;  2COA A;  2CY4 A;  4HB2 B;  3F5R A; 
#chains in the Genus database with same CATH topology
 2P0D A;  3A98 B;  4MT7 A;  2YS1 A;  1UPQ A;  4NSW A;  3WA0 A;  5C5B B;  3U7D A;  3OAN A;  4DXA B;  5JLJ B;  2GCL A;  2GJY A;  2K2J A;  1AQC A;  2D11 A;  4YL8 A;  2M38 A;  1MK9 B;  2R0D A;  2Y7B A;  4CHM A;  1ZM0 A;  3DXD A;  1QQG A;  2R09 A;  2EC1 A;  4DBB A;  1EAZ A;  1Y5O A;  5D27 A;  1K5D B;  1W1H A;  1XKE A;  2ROZ B;  1E5W A;  3U12 A;  1Q67 A;  3VOQ A;  4A6K A;  5DIF B;  4CYE A;  2YSZ A;  4MK0 A;  2FJU B;  4HAZ B;  2QKM A;  3TW1 A;  3TO1 A;  1NTV A;  4KHB B;  4DIX A;  1SHC A;  4EMO A;  4GOU A;  4IOY X;  1QC6 A;  3A8P A;  3AU4 A;  1KZG A;  2RLO A;  3CXB B;  2LG1 A;  2KCJ A;  3AU5 A;  3DXE A;  1X86 A;  1FHW A;  3QWM A;  4KAX B;  5D3X A;  1U5F A;  1SGH A;  1U27 A;  5D3Y A;  2L1C A;  3LJU X;  3TCA A;  1WVH A;  2D9Z A;  4YON A;  3GYO A;  3PVL A;  3A58 A;  1V5M A;  5CLL B;  2P8V A;  5HE0 A;  1W1G A;  2X18 A;  2COD A;  1KI1 B;  2EJ8 A;  3KRW A;  4NY0 A;  2RNR B;  2KIG A;  2K2U A;  1ZC3 B;  3HQC A;  3P6A A;  4WSF A;  1XD4 A;  2NMB A;  2AL6 A;  2YF0 A;  2H7E A;  3PG7 A;  3QBV B;  3P7Z A;  4EKU A;  1DDM A;  1BTN A;  3HIE A;  4KVG B;  1U2B A;  1UNQ A;  4K17 A;  2K00 A;  5I2S A;  1J0W A;  1TJ6 A;  1NTY A;  2XQN M;  3N7C A;  3BIN A;  4BBK A;  3ML4 A;  4L1R A;  2LOZ A;  5D3W A;  3SUZ A;  2I5C A;  4QJ5 B;  3MPX A;  3CIK A;  2DYN A;  2RGN B;  2LUL A;  4XWX A;  5J3Y A;  3UZT A;  2NBV A;  4QJ3 B;  3FSS A;  2J0J A;  1EF1 A;  1V5P A;  2VKI A;  3PZD A;  2Z14 A;  5GOW B;  4PQ0 A;  3OHM B;  1J19 A;  1V89 A;  2CY5 A;  1K5G B;  2RRF A;  3NWF A;  4K2O A;  1U29 A;  3D8F A;  1FOE A;  1H4R A;  2Y8G A;  3PVW A;  3ODO A;  5J3T A;  1P3R A;  4HB3 B;  2OQB A;  4HAU B;  4KHA A;  3D8E A;  5LG4 B;  1XR0 B;  1X1F A;  4HAX B;  3DCX A;  3ZVR A;  3HK0 A;  4DX8 A;  4HAW B;  4Z2N A;  4C0A A;  2K49 A;  2OTX A;  3D8D A;  4A5K A;  2ELA A;  4CSQ A;  2D10 A;  3ULC A;  5EFX A;  4TYZ A;  2DHI A;  2Z4D A;  5KQ4 A;  4DX9 0;  4GXB A;  4F7U P;  1B55 A;  1PFJ A;  5FI0 A;  3TVV A;  5J3Q A;  1TQZ A;  1WGU A;  2MKR A;  1OY2 A;  2RUK B;  4GNK B;  2DA0 A;  2EMS A;  3NSU A;  1U5D A;  2EMT A;  3B77 A;  2N23 A;  1RJ2 A;  1FHX A;  3SNH A;  1KZ7 A;  3F0W A;  2DKP A;  3ODW A;  2KUP A;  1Z87 A;  1M7E A;  3RCP A;  2D2Q A;  4HAT B;  1U5G A;  2W2W A;  1AWE A;  1WI1 A;  2Z0Q A;  2IFS A;  2NZ8 B;  2P0H A;  5KCV A;  4EJN A;  2ZKM X;  3ULB A;  2LKO A;  2DKQ A;  5C16 A;  4WVF B;  1IRS A;  2R2Y A;  4Z2M B;  2D9V A;  1OMW A;  1FB8 A;  2KIE A;  2ROV A;  1XOD A;  1BWN A;  1WG7 A;  4HDQ A;  2J59 M;  1UPR A;  4P7I A;  2G35 A;  4IAP A;  1H10 A;  2MWN B;  4CHJ A;  2UZR A;  3BJI A;  1WJ1 A;  3ZDT A;  1V5U A;  2J0K A;  4QXA B;  3PP2 A;  2ELB A;  2YT1 A;  3IVF A;  2Z0P A;  3A8Q A;  1FGY A;  3KZ1 A;  2ZPY A;  2J0M A;  4IFS A;  4A6F A;  2YRY A;  5C6R A;  1X05 A;  1PMS A;  4B6H A;  1BAK A;  5M4Y B;  5FI1 A;  1DYN A;  5KQ1 A;  1I2H A;  1Y19 B;  5JP4 A;  1X11 A;  2VSZ A;  4F7H A;  1ISN A;  4HDO A;  1W1D A;  4QJ4 B;  3X23 A;  5LOP B;  1BTK A;  2N0Y A;  2DHK A;  2LOX A;  5DH9 B;  1DRO A;  4HAV B;  2HE7 A;  3QIJ A;  5IRS A;  2KUQ A;  2I1K A;  2I1J A;  2VRW B;  4GN1 A;  1MAI A;  2D9W A;  1P6S A;  1ZC4 B;  2DFK A;  3DXC A;  1RRP B;  2DN6 A;  4OSN A;  2LYD A;  3SO6 A;  2KR0 A;  3FEH A;  3FVC A;  3NW8 A;  1WGQ A;  5HE2 A;  3TFM A;  2HTH B;  4HSI A;  2DX1 A;  3V5W A;  3WYF B;  2RSG A;  1I7A A;  1FAO A;  2YT0 A;  1MI1 A;  1UNR A;  4ZRJ A;  1OQN A;  2CAY A;  4TKN A;  5JHH A;  4GPT B;  1LB1 A;  2PZ1 A;  3NWA A;  1DDV A;  1GG3 A;  2Q13 A;  5DHF B;  1MIZ B;  2Z59 A;  5HE1 A;  2JP2 A;  1T77 A;  5CLQ B;  1TXD A;  5DHA B;  2P0F A;  4HHV A;  4HB4 B;  2MFQ A;  3HW2 B;  2W2X D;  3G9W A;  1WJM A;  2GCJ A;  4A6H A;  2Z13 A;  5D3V A;  2CRF A;  2L2I A;  3KSY A;  4WJ7 A;  4A6F B;  1MKE A;  2D4Q A;  5L81 A;  1FHO A;  3FM8 C;  2YS3 A;  2D9X A;  4K2P A;  4GMV A;  2ADZ A;  5C5B A;  1ZYI A;  2COC A;  1M7R A;  3SV1 A;  5LON B;  3NWD A;  1UNP A;  1PLS A;  1ZVR A;  1UEF A;  2BCJ A;  2UVM A;  3AJ4 A;  4GZU A;  1MIX A;  5C79 A;  2AEH A;  1GC7 A;  1NI2 A;  2W2X C;  3VIA A;  2COF A;  2RVB B;  2IYB A;  2I5F A;  2DTC A;  3KY9 A;  1X1G A;  5DI9 B;  1N3H A;  2H7D A;  2YVC A;  4GMX B;  2QKL A;  3PVU A;  4L6E A;  1MPH A;  3KRX A;  2E2X A;  2DLW A;  2KGX B;  3PEG A;  2DHJ A;  2K8E A;  2UZS A;  1XCG A;  3O96 A;  1DDW A;  3M1I B;  1V88 A;  2GUM A;  3GYP A;  1LW3 A;  4K81 A;  3PSC A;  1U5E A;  4KHB A;  2MDX A;  1MK7 B;  4F7G A;  4KHO A;  1ZSQ A;  5I2M A;  4ZRK A;  1V61 A;  4HB0 B;  2GS0 A;  1DBH A;  4Y94 A;  3ODX A;  3U8Z A;  3HSA A;  4OT1 A;  4D0N B;  4H8S A;  2M14 A;  2D9Y A;  2DX5 A;  3T06 A;  1P5T A;  1EVH A;  5HE3 A;  2FJL A;  2YT2 A;  4ZRI A;  1FGZ A;  4HAY B;  1EGX A;  1GC6 A;  2V76 A;  2YS5 A;  5JHG A;  3SYX A;  2Y8F A;  1XX0 A;  2Z0O A;  4MY6 A;  2DYQ A;  1NU2 A;  3MDB C;  4D6W A;  4PNK A;  2COA A;  2CY4 A;  4HB2 B;  3F5R A; 
#chains in the Genus database with same CATH homology
 2P0D A;  3A98 B;  4MT7 A;  2YS1 A;  1UPQ A;  4NSW A;  3WA0 A;  5C5B B;  3U7D A;  3OAN A;  4DXA B;  5JLJ B;  2GCL A;  2GJY A;  2K2J A;  1AQC A;  2D11 A;  4YL8 A;  2M38 A;  1MK9 B;  2R0D A;  2Y7B A;  4CHM A;  1ZM0 A;  3DXD A;  1QQG A;  2R09 A;  2EC1 A;  4DBB A;  1EAZ A;  1Y5O A;  5D27 A;  1K5D B;  1W1H A;  1XKE A;  2ROZ B;  1E5W A;  1Q67 A;  3VOQ A;  4A6K A;  5DIF B;  4CYE A;  2YSZ A;  4MK0 A;  4HAZ B;  2QKM A;  3TW1 A;  3TO1 A;  1NTV A;  4KHB B;  1SHC A;  4EMO A;  4IOY X;  1QC6 A;  3A8P A;  3AU4 A;  1KZG A;  2RLO A;  3CXB B;  2LG1 A;  2KCJ A;  3AU5 A;  3DXE A;  1X86 A;  1FHW A;  3QWM A;  4KAX B;  5D3X A;  1U5F A;  1SGH A;  1U27 A;  5D3Y A;  2L1C A;  3LJU X;  3TCA A;  1WVH A;  2D9Z A;  4YON A;  3GYO A;  3PVL A;  1V5M A;  5CLL B;  2P8V A;  5HE0 A;  1W1G A;  2X18 A;  2COD A;  1KI1 B;  2EJ8 A;  3KRW A;  4NY0 A;  2RNR B;  2K2U A;  1ZC3 B;  3P6A A;  3HQC A;  4WSF A;  1XD4 A;  2NMB A;  2AL6 A;  2YF0 A;  2H7E A;  3PG7 A;  3QBV B;  3P7Z A;  4EKU A;  1DDM A;  1BTN A;  4KVG B;  1U2B A;  1UNQ A;  4K17 A;  2K00 A;  1J0W A;  1TJ6 A;  1NTY A;  2XQN M;  3N7C A;  3BIN A;  4BBK A;  3ML4 A;  2LOZ A;  5D3W A;  3SUZ A;  2I5C A;  3MPX A;  3CIK A;  2DYN A;  2RGN B;  2LUL A;  4XWX A;  5J3Y A;  3UZT A;  3FSS A;  2J0J A;  1EF1 A;  1V5P A;  2VKI A;  3PZD A;  5GOW B;  4PQ0 A;  1J19 A;  1V89 A;  2CY5 A;  1K5G B;  4K2O A;  1U29 A;  3D8F A;  1FOE A;  1H4R A;  2Y8G A;  3PVW A;  3ODO A;  5J3T A;  1P3R A;  4HB3 B;  2OQB A;  4HAU B;  4KHA A;  3D8E A;  1XR0 B;  1X1F A;  4HAX B;  3ZVR A;  3HK0 A;  4DX8 A;  4HAW B;  4Z2N A;  4C0A A;  2OTX A;  3D8D A;  4A5K A;  2ELA A;  2D10 A;  3ULC A;  5EFX A;  4TYZ A;  2DHI A;  5KQ4 A;  4DX9 0;  4GXB A;  4F7U P;  1B55 A;  1PFJ A;  5FI0 A;  3TVV A;  5J3Q A;  1TQZ A;  1WGU A;  2MKR A;  1OY2 A;  2RUK B;  2DA0 A;  2EMS A;  3NSU A;  1U5D A;  2EMT A;  2N23 A;  1RJ2 A;  1FHX A;  3SNH A;  1KZ7 A;  3F0W A;  2DKP A;  3ODW A;  2KUP A;  1Z87 A;  1M7E A;  3RCP A;  2D2Q A;  4HAT B;  1U5G A;  2W2W A;  1AWE A;  1WI1 A;  2Z0Q A;  2IFS A;  2NZ8 B;  2P0H A;  5KCV A;  4EJN A;  3ULB A;  2LKO A;  2DKQ A;  5C16 A;  4WVF B;  1IRS A;  4Z2M B;  2D9V A;  1OMW A;  1FB8 A;  2ROV A;  1XOD A;  1BWN A;  1WG7 A;  4HDQ A;  2J59 M;  1UPR A;  4P7I A;  2G35 A;  4IAP A;  1H10 A;  2MWN B;  4CHJ A;  2UZR A;  3BJI A;  1WJ1 A;  3ZDT A;  1V5U A;  2J0K A;  3PP2 A;  2ELB A;  2YT1 A;  3IVF A;  2Z0P A;  3A8Q A;  1FGY A;  3KZ1 A;  2ZPY A;  2J0M A;  4IFS A;  4A6F A;  2YRY A;  5C6R A;  1X05 A;  1PMS A;  4B6H A;  1BAK A;  5FI1 A;  1DYN A;  5KQ1 A;  1I2H A;  1Y19 B;  5JP4 A;  1X11 A;  2VSZ A;  4F7H A;  1ISN A;  4HDO A;  1W1D A;  3X23 A;  5LOP B;  1BTK A;  2N0Y A;  2DHK A;  2LOX A;  5DH9 B;  1DRO A;  4HAV B;  2HE7 A;  3QIJ A;  2I1K A;  2I1J A;  2VRW B;  4GN1 A;  1MAI A;  2D9W A;  1P6S A;  1ZC4 B;  2DFK A;  3DXC A;  1RRP B;  2DN6 A;  2LYD A;  3SO6 A;  3FEH A;  1WGQ A;  5HE2 A;  3TFM A;  2HTH B;  2DX1 A;  3V5W A;  3WYF B;  2RSG A;  1I7A A;  1FAO A;  2YT0 A;  1UNR A;  4ZRJ A;  1OQN A;  2CAY A;  4TKN A;  5JHH A;  4GPT B;  1LB1 A;  2PZ1 A;  1DDV A;  1GG3 A;  2Q13 A;  5DHF B;  1MIZ B;  5HE1 A;  2JP2 A;  5CLQ B;  1TXD A;  5DHA B;  2P0F A;  4HHV A;  4HB4 B;  2MFQ A;  3HW2 B;  2W2X D;  3G9W A;  1WJM A;  2GCJ A;  4A6H A;  5D3V A;  2CRF A;  2L2I A;  3KSY A;  4WJ7 A;  4A6F B;  1MKE A;  2D4Q A;  5L81 A;  1FHO A;  3FM8 C;  2YS3 A;  2D9X A;  4K2P A;  4GMV A;  2ADZ A;  5C5B A;  2COC A;  1M7R A;  3SV1 A;  5LON B;  1UNP A;  1PLS A;  1ZVR A;  1UEF A;  2BCJ A;  2UVM A;  3AJ4 A;  4GZU A;  1MIX A;  5C79 A;  2AEH A;  1GC7 A;  1NI2 A;  2W2X C;  3VIA A;  2COF A;  2RVB B;  2IYB A;  2I5F A;  2DTC A;  3KY9 A;  1X1G A;  5DI9 B;  1N3H A;  2H7D A;  2YVC A;  4GMX B;  2QKL A;  3PVU A;  4L6E A;  1MPH A;  3KRX A;  2E2X A;  2DLW A;  2KGX B;  3PEG A;  2DHJ A;  2UZS A;  1XCG A;  3O96 A;  1DDW A;  3M1I B;  1V88 A;  3GYP A;  1LW3 A;  4K81 A;  3PSC A;  1U5E A;  2MDX A;  1MK7 B;  4F7G A;  4KHO A;  1ZSQ A;  4ZRK A;  1V61 A;  4HB0 B;  2GS0 A;  1DBH A;  4Y94 A;  3ODX A;  3U8Z A;  4D0N B;  4H8S A;  2M14 A;  2D9Y A;  2DX5 A;  3T06 A;  1P5T A;  1EVH A;  5HE3 A;  2FJL A;  4ZRI A;  1FGZ A;  4HAY B;  1EGX A;  1GC6 A;  2V76 A;  2YS5 A;  5JHG A;  3SYX A;  2Y8F A;  1XX0 A;  2Z0O A;  4MY6 A;  2DYQ A;  1NU2 A;  3MDB C;  4PNK A;  2COA A;  2CY4 A;  4HB2 B;  3F5R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...