2EJ8A

Crystal structure of appl1 ptb domain at 1.8a
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
139
structure length
133
Chain Sequence
ETEDSILHQLFIVRFLGSMEVKSDDHPDVVYETMRQILAARAIHNIFRMTESHLLVTCDCLKLIDPQTQVTRLTFPLPCVVLYATHQENKRLFGFVLRTSSLSSVCYIFESNNEGEKICDSVGLAKQIALHAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords DCC-interacting protein 13 alpha
publication title Crystal structure of APPL1 PTB domain at 1.8A
rcsb
source organism Homo sapiens
total genus 35
structure length 133
sequence length 139
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-03-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00640 PID Phosphotyrosine interaction domain (PTB/PID)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2ej8A00
4K17A 1K5DB 2YSZA 2H7EA 1TJ6A 2EMTA 2YT0A 1EAZA 3PVUA 4F7UP 1MK9B 3X23A 4A6FB 4GMXB 3V5WA 1KI1B 3KSYA 2DA0A 5DIFB 3TCAA 1U29A 5J3QA 3RCPA 1E5WA 4HHVA 2DX1A 2YS1A 4KHAA 1V5PA 1ZC3B 2QKLA 2ELBA 1K5GB 5C5BB 1U5FA 2Z0PA 1J0WA 5HE1A 3PSCA 4Y94A 5DI9B 3P7ZA 5DH9B 5KQ1A 4A5KA 2X18A 1P3RA 2DHIA 1V89A 1MIXA 4HB3B 2DLWA 2LKOA 2RGNB 3HW2B 4DXAB 4HDOA 3ODXA 1BTNA 4WJ7A 3F5RA 1NTYA 2D4QA 2D9XA 2Z0OA 2IFSA 1FGYA 2M14A 4IFSA 2AL6A 1UNRA 1FAOA 1DBHA 1MKEA 1AWEA 2NZ8B 4K81A 2HTHB 2HE7A 2PZ1A 1BAKA 1QQGA 2V76A 2D9ZA 2Q13A 2VRWB 5GOWB 1NU2A 3OANA 1U5GA 3U7DA 1U5DA 2KCJA 1X1FA 2UZRA 3IVFA 3QIJA 2XQNM 1MK7B 5JHHA 1WGUA 2DX5A 2ELAA 2W2WA 4CHJA 1UPQA 4YL8A 2J0KA 1V5MA 1ZM0A 3AU5A 4HAYB 3BINA 1PMSA 4PQ0A 1EGXA 2K00A 2VSZA 3ODOA 1Q67A 5D3WA 5HE0A 2COAA 2MFQA 4IOYX 1W1HA 2EMSA 4A6HA 5LOPB 5FI1A 3O96A 2BCJA 4DX90 2MDXA 1H4RA 1XD4A 3D8DA 1XR0B 3SV1A 1QC6A 1WG7A 2I5CA 3SNHA 2I1KA 3M1IB 1ZSQA 5C5BA 1P6SA 3ULBA 3PVLA 3MDBC 2COFA 2DHKA 3KY9A 5C6RA 1W1GA 2P8VA 4DBBA 1PLSA 1XODA 3AU4A 2D9YA 2AEHA 2GCJA 1NI2A 2J0MA 1LB1A 1ZC4B 1KZGA 2M38A 3WA0A 2D2QA 3FEHA 5KCVA 2QKMA 4A6KA 3QWMA 2R0DA 2Y8FA 2COCA 4MY6A 4KHBB 1OMWA 2RVBB 5DHAB 3UZTA 1X05A 2DHJA 3PG7A 5JLJB 3DXDA 2RNRB 1X11A 5FI0A 5CLLB 3BJIA 2UVMA 1FHWA 2Y8GA 2D10A 4Z2MB 3KRWA 2W2XC 4GXBA 2NMBA 1UPRA 4GMVA 2J0JA 2P0HA 2J59M 2D11A 2H7DA 4IAPA 1RJ2A 5L81A 5DHFB 1I7AA 1NTVA 5CLQB 4DX8A 1X1GA 2CODA 5D3VA 1UNPA 2DYQA 1FHXA 2LULA 3MPXA 4F7HA 2P0DA 3KRXA 1RRPB 1EF1A 1DDMA 1IRSA 2Z0QA 2DKQA 2CRFA 3N7CA 4BBKA 2DTCA 2UZSA 3PP2A 4HB0B 2DFKA 2Y7BA 1WI1A 3SO6A 1TQZA 4KAXB 3KZ1A 1XKEA 2G35A 1XCGA 4GZUA 1WJMA 1V88A 2K2UA 4HATB 3HQCA 1DROA 4ZRJA 4A6FA 2N0YA 3DXEA 4GPTB 1TXDA 1M7RA 4H8SA 1B55A 4K2PA 2YVCA 2P0FA 2ROZB 3ZVRA 1Y5OA 3ODWA 1N3HA 1LW3A 2LOZA 4F7GA 1U27A 4KHOA 4HAXB 2K2JA 4B6HA 1MAIA 3TO1A 4HB4B 4CYEA 1WVHA 1Z87A 1KZ7A 5LONB 3LJUX 4L6EA 2EJ8A 3GYPA 4HAVB 4HAWB 1XX0A 1WGQA 1U2BA 2YF0A 3A98B 5HE3A 2KUPA 2R09A 4CHMA 5KQ4A 4EMOA 2VKIA 2OQBA 1GC6A 4MT7A 3P6AA 3FSSA 4WVFB 3WYFB 1UEFA 4D0NB 1FGZA 1MPHA 2RLOA 4HB2B 2CAYA 2YS3A 4HDQA 1WJ1A 3A8QA 3CIKA 4K2OA 5D3YA 1V5UA 4NSWA 2RUKB 1H10A 3QBVB 1GG3A 1SHCA 2MWNB 3AJ4A 1OY2A 2LOXA 4GN1A 3PEGA 1X86A 1FOEA 2RSGA 2ADZA 1Y19B 2YS5A 3PZDA 2MKRA 2YRYA 4PNKA 4C0AA 3T06A 2DN6A 2GS0A 4HAZB 4EKUA 1DYNA 2FJLA 1M7EA 4HAUB 4NY0A 2N23A 1UNQA 2DKPA 3U8ZA 1BWNA 5J3YA 3FM8C 3ZDTA 5J3TA 3NSUA 1BTKA 1ZVRA 3A8PA 3ULCA 2ZPYA 3F0WA 3D8FA 3DXCA 3VOQA 1U5EA 2CY4A 2W2XD 5D27A 2I5FA 1ISNA 2E2XA 1GC7A 3HK0A 4XWXA 5C16A 2CY5A 4MK0A 2GCLA 2I1JA 4ZRKA 5C79A 1FHOA 3GYOA 2D9VA 3TW1A 1AQCA 1OQNA 3D8EA 2GJYA 2L1CA 3ML4A 3G9WA 5EFXA 2LG1A 1DDVA 2IYBA 1W1DA 3SUZA 2JP2A 2D9WA 2YT1A 1SGHA 4Z2NA 1I2HA 3TVVA 2DYNA 2L2IA 4ZRIA 3CXBB 2ROVA 4TKNA 3TFMA 1EVHA 2LYDA 5JP4A 3SYXA 3PVWA 4TYZA 5D3XA 1PFJA 3VIAA 4WSFA 4YONA 1V61A 2OTXA 1J19A 1FB8A 1P5TA 2KGXB 2EC1A 4KVGB 1DDWA 4EJNA 4P7IA 5HE2A 5JHGA 1MIZB
chains in the Genus database with same CATH superfamily
4K17A 1K5DB 2YSZA 2H7EA 1TJ6A 2EMTA 2YT0A 1EAZA 3PVUA 4F7UP 1MK9B 3X23A 4A6FB 4GMXB 3V5WA 1KI1B 3KSYA 2DA0A 2KIEA 5DIFB 3TCAA 1U29A 5J3QA 3RCPA 1E5WA 2NBVA 4HHVA 2DX1A 2YS1A 4KHAA 1V5PA 1ZC3B 4GNKB 3NWAA 2QKLA 2ELBA 1K5GB 5C5BB 1U5FA 2Z0PA 1J0WA 5HE1A 5LG4B 3PSCA 3FVCA 4Y94A 5DI9B 3P7ZA 5DH9B 5KQ1A 4A5KA 2X18A 1P3RA 2DHIA 1V89A 1MIXA 4HB3B 2DLWA 2LKOA 2RGNB 3HW2B 4DXAB 4HDOA 3ODXA 4QXAB 3DCXA 1BTNA 4WJ7A 3F5RA 1NTYA 2D4QA 2D9XA 2Z0OA 2IFSA 1FGYA 2M14A 4IFSA 2AL6A 2Z4DA 1UNRA 1FAOA 2YT2A 1DBHA 1MKEA 1AWEA 2NZ8B 4K81A 2HTHB 2HE7A 2PZ1A 1BAKA 1QQGA 2V76A 2D9ZA 2Q13A 2VRWB 5GOWB 1NU2A 3OANA 1U5GA 3U7DA 1U5DA 2KCJA 1X1FA 2UZRA 3IVFA 3QIJA 2XQNM 1MK7B 5JHHA 1WGUA 2DX5A 2ELAA 2W2WA 4CHJA 1UPQA 4YL8A 2J0KA 1V5MA 1ZM0A 3AU5A 4HAYB 3BINA 1PMSA 4PQ0A 1EGXA 2K00A 2VSZA 2Z13A 1Q67A 3ODOA 5D3WA 5HE0A 2COAA 2MFQA 4IOYX 1W1HA 2EMSA 4A6HA 5LOPB 5FI1A 4QJ5B 3O96A 2BCJA 4DX90 2MDXA 1H4RA 1XD4A 3D8DA 1XR0B 3SV1A 1QC6A 1WG7A 2I5CA 3SNHA 2I1KA 3M1IB 1ZSQA 5C5BA 1P6SA 3ULBA 3PVLA 3MDBC 4QJ4B 2COFA 2DHKA 3KY9A 5C6RA 2KUQA 1W1GA 2P8VA 4DBBA 1PLSA 1XODA 3AU4A 2D9YA 2AEHA 2GCJA 4HSIA 2ZKMX 1NI2A 2J0MA 1LB1A 1ZC4B 1KZGA 2M38A 3WA0A 2D2QA 3FEHA 5KCVA 2QKMA 4OT1A 4A6KA 3QWMA 3A58A 2R0DA 2Y8FA 2COCA 4MY6A 4KHBB 1OMWA 2RVBB 5DHAB 3UZTA 1X05A 2DHJA 3PG7A 5JLJB 3DXDA 2RNRB 1X11A 5FI0A 5CLLB 3BJIA 2UVMA 1FHWA 2Y8GA 2D10A 4Z2MB 3KRWA 2W2XC 4GXBA 2NMBA 1UPRA 4OSNA 4GMVA 2J0JA 2P0HA 2J59M 2D11A 2H7DA 4IAPA 1RJ2A 5L81A 5DHFB 1I7AA 2FJUB 5M4YB 1NTVA 5CLQB 4DX8A 1X1GA 2CODA 5D3VA 1UNPA 2DYQA 1FHXA 2LULA 3NWDA 3MPXA 4F7HA 2P0DA 3KRXA 1RRPB 1EF1A 1DDMA 1IRSA 2Z0QA 1ZYIA 2DKQA 1MI1A 2CRFA 3N7CA 4BBKA 4D6WA 2DTCA 2UZSA 3PP2A 4HB0B 3OHMB 2DFKA 2Y7BA 1WI1A 3SO6A 1TQZA 4KAXB 3KZ1A 1XKEA 2G35A 1XCGA 4GZUA 1WJMA 1V88A 2K2UA 4HATB 4DIXA 3HQCA 1DROA 4ZRJA 4A6FA 2N0YA 3DXEA 4GPTB 2RRFA 1TXDA 1M7RA 4H8SA 1B55A 4K2PA 2YVCA 2P0FA 2ROZB 3ZVRA 5IRSA 1Y5OA 3ODWA 1N3HA 1LW3A 2LOZA 4F7GA 1U27A 4KHOA 4HAXB 2K2JA 4B6HA 1MAIA 3TO1A 4KHBA 4HB4B 4CYEA 1WVHA 1Z87A 1KZ7A 5LONB 3LJUX 4L6EA 2EJ8A 3GYPA 4HAVB 4HAWB 1XX0A 2KR0A 1WGQA 1U2BA 2YF0A 4L1RA 3A98B 5HE3A 2KUPA 2R09A 4CHMA 5KQ4A 4EMOA 2R2YA 3NWFA 2VKIA 2OQBA 1GC6A 4MT7A 3P6AA 3FSSA 4WVFB 3WYFB 1UEFA 4D0NB 1FGZA 1MPHA 3B77A 2RLOA 4HB2B 2GUMA 2CAYA 2K8EA 2YS3A 4HDQA 2Z14A 1WJ1A 3A8QA 3CIKA 4K2OA 5D3YA 1V5UA 4NSWA 2RUKB 1H10A 3QBVB 1GG3A 1SHCA 2MWNB 3AJ4A 1OY2A 2LOXA 4QJ3B 4GN1A 3PEGA 1X86A 1FOEA 2RSGA 2ADZA 1Y19B 2YS5A 5JHGA 3PZDA 2MKRA 2YRYA 3NW8A 4PNKA 4C0AA 3T06A 2KIGA 2DN6A 2GS0A 4HAZB 4EKUA 1DYNA 2FJLA 1M7EA 4HAUB 4NY0A 2N23A 5I2SA 1UNQA 2DKPA 3U8ZA 1BWNA 5J3YA 3FM8C 3ZDTA 5J3TA 3NSUA 1BTKA 1ZVRA 3A8PA 3ULCA 2ZPYA 3F0WA 3D8FA 3DXCA 3VOQA 1U5EA 2CY4A 2W2XD 5D27A 2I5FA 1ISNA 2E2XA 1GC7A 3HK0A 4XWXA 5C16A 4GOUA 2CY5A 4CSQA 4MK0A 2GCLA 2I1JA 4ZRKA 3HIEA 5C79A 1FHOA 3GYOA 2D9VA 3U12A 3TW1A 1AQCA 1OQNA 3D8EA 2GJYA 2L1CA 3ML4A 3G9WA 5EFXA 2LG1A 1DDVA 1T77A 2IYBA 1W1DA 2Z59A 3SUZA 2JP2A 2D9WA 2YT1A 1SGHA 4Z2NA 1I2HA 3TVVA 2DYNA 2L2IA 4ZRIA 3CXBB 2ROVA 5I2MA 4TKNA 3TFMA 1EVHA 2LYDA 5JP4A 3SYXA 3PVWA 4TYZA 5D3XA 1PFJA 3VIAA 4WSFA 4YONA 1V61A 2OTXA 1J19A 1FB8A 1P5TA 2KGXB 2EC1A 4KVGB 1DDWA 4EJNA 4P7IA 5HE2A 3HSAA 2K49A 1MIZB
chains in the Genus database with same CATH topology
4K17A 1K5DB 2YSZA 2H7EA 1TJ6A 2EMTA 2YT0A 1EAZA 3PVUA 4F7UP 1MK9B 3X23A 4A6FB 4GMXB 3V5WA 1KI1B 3KSYA 2DA0A 5DIFB 3TCAA 1U29A 5J3QA 3RCPA 1E5WA 4HHVA 2DX1A 2YS1A 4KHAA 1V5PA 1ZC3B 2QKLA 2ELBA 1K5GB 5C5BB 1U5FA 2Z0PA 1J0WA 5HE1A 3PSCA 4Y94A 5DI9B 3P7ZA 5DH9B 5KQ1A 4A5KA 2X18A 1P3RA 2DHIA 1V89A 1MIXA 4HB3B 2DLWA 2LKOA 2RGNB 3HW2B 4DXAB 4HDOA 3ODXA 1BTNA 4WJ7A 3F5RA 1NTYA 2D4QA 2D9XA 2Z0OA 2IFSA 1FGYA 2M14A 4IFSA 2AL6A 1UNRA 1FAOA 1DBHA 1MKEA 1AWEA 2NZ8B 4K81A 2HTHB 2HE7A 2PZ1A 1BAKA 1QQGA 2V76A 2D9ZA 2Q13A 2VRWB 5GOWB 1NU2A 3OANA 1U5GA 3U7DA 1U5DA 2KCJA 1X1FA 2UZRA 3IVFA 3QIJA 2XQNM 1MK7B 5JHHA 1WGUA 2DX5A 2ELAA 2W2WA 4CHJA 1UPQA 4YL8A 2J0KA 1V5MA 1ZM0A 3AU5A 4HAYB 3BINA 1PMSA 4PQ0A 1EGXA 2K00A 2VSZA 3ODOA 1Q67A 5D3WA 5HE0A 2COAA 2MFQA 4IOYX 1W1HA 2EMSA 4A6HA 5LOPB 5FI1A 3O96A 2BCJA 4DX90 2MDXA 1H4RA 1XD4A 3D8DA 1XR0B 3SV1A 1QC6A 1WG7A 2I5CA 3SNHA 2I1KA 3M1IB 1ZSQA 5C5BA 1P6SA 3ULBA 3PVLA 3MDBC 2COFA 2DHKA 3KY9A 5C6RA 1W1GA 2P8VA 4DBBA 1PLSA 1XODA 3AU4A 2D9YA 2AEHA 2GCJA 1NI2A 2J0MA 1LB1A 1ZC4B 1KZGA 2M38A 3WA0A 2D2QA 3FEHA 5KCVA 2QKMA 4A6KA 3QWMA 2R0DA 2Y8FA 2COCA 4MY6A 4KHBB 1OMWA 2RVBB 5DHAB 3UZTA 1X05A 2DHJA 3PG7A 5JLJB 3DXDA 2RNRB 1X11A 5FI0A 5CLLB 3BJIA 2UVMA 1FHWA 2Y8GA 2D10A 4Z2MB 3KRWA 2W2XC 4GXBA 2NMBA 1UPRA 4GMVA 2J0JA 2P0HA 2J59M 2D11A 2H7DA 4IAPA 1RJ2A 5L81A 5DHFB 1I7AA 1NTVA 5CLQB 4DX8A 1X1GA 2CODA 5D3VA 1UNPA 2DYQA 1FHXA 2LULA 3MPXA 4F7HA 2P0DA 3KRXA 1RRPB 1EF1A 1DDMA 1IRSA 2Z0QA 2DKQA 2CRFA 3N7CA 4BBKA 2DTCA 2UZSA 3PP2A 4HB0B 2DFKA 2Y7BA 1WI1A 3SO6A 1TQZA 4KAXB 3KZ1A 1XKEA 2G35A 1XCGA 4GZUA 1WJMA 1V88A 2K2UA 4HATB 3HQCA 1DROA 4ZRJA 4A6FA 2N0YA 3DXEA 4GPTB 1TXDA 1M7RA 4H8SA 1B55A 4K2PA 2YVCA 2P0FA 2ROZB 3ZVRA 1Y5OA 3ODWA 1N3HA 1LW3A 2LOZA 4F7GA 1U27A 4KHOA 4HAXB 2K2JA 4B6HA 1MAIA 3TO1A 4HB4B 4CYEA 1WVHA 1Z87A 1KZ7A 5LONB 3LJUX 4L6EA 2EJ8A 3GYPA 4HAVB 4HAWB 1XX0A 1WGQA 1U2BA 2YF0A 3A98B 5HE3A 2KUPA 2R09A 4CHMA 5KQ4A 4EMOA 2VKIA 2OQBA 1GC6A 4MT7A 3P6AA 3FSSA 4WVFB 3WYFB 1UEFA 4D0NB 1FGZA 1MPHA 2RLOA 4HB2B 2CAYA 2YS3A 4HDQA 1WJ1A 3A8QA 3CIKA 4K2OA 5D3YA 1V5UA 4NSWA 2RUKB 1H10A 3QBVB 1GG3A 1SHCA 2MWNB 3AJ4A 1OY2A 2LOXA 4GN1A 3PEGA 1X86A 1FOEA 2RSGA 2ADZA 1Y19B 2YS5A 3PZDA 2MKRA 2YRYA 4PNKA 4C0AA 3T06A 2DN6A 2GS0A 4HAZB 4EKUA 1DYNA 2FJLA 1M7EA 4HAUB 4NY0A 2N23A 1UNQA 2DKPA 3U8ZA 1BWNA 5J3YA 3FM8C 3ZDTA 5J3TA 3NSUA 1BTKA 1ZVRA 3A8PA 3ULCA 2ZPYA 3F0WA 3D8FA 3DXCA 3VOQA 1U5EA 2CY4A 2W2XD 5D27A 2I5FA 1ISNA 2E2XA 1GC7A 3HK0A 4XWXA 5C16A 2CY5A 4MK0A 2GCLA 2I1JA 4ZRKA 5C79A 1FHOA 3GYOA 2D9VA 3TW1A 1AQCA 1OQNA 3D8EA 2GJYA 2L1CA 3ML4A 3G9WA 5EFXA 2LG1A 1DDVA 2IYBA 1W1DA 3SUZA 2JP2A 2D9WA 2YT1A 1SGHA 4Z2NA 1I2HA 3TVVA 2DYNA 2L2IA 4ZRIA 3CXBB 2ROVA 4TKNA 3TFMA 1EVHA 2LYDA 5JP4A 3SYXA 3PVWA 4TYZA 5D3XA 1PFJA 3VIAA 4WSFA 4YONA 1V61A 2OTXA 1J19A 1FB8A 1P5TA 2KGXB 2EC1A 4KVGB 1DDWA 4EJNA 4P7IA 5HE2A 5JHGA 1MIZB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4K17 A;  1K5D B;  2YSZ A;  2H7E A;  1TJ6 A;  2EMT A;  2YT0 A;  1EAZ A;  3PVU A;  4F7U P;  1MK9 B;  3X23 A;  4A6F B;  4GMX B;  3V5W A;  1KI1 B;  3KSY A;  2DA0 A;  5DIF B;  3TCA A;  1U29 A;  5J3Q A;  3RCP A;  1E5W A;  4HHV A;  2DX1 A;  2YS1 A;  4KHA A;  1V5P A;  1ZC3 B;  2QKL A;  2ELB A;  1K5G B;  5C5B B;  1U5F A;  2Z0P A;  1J0W A;  5HE1 A;  3PSC A;  4Y94 A;  5DI9 B;  3P7Z A;  5DH9 B;  5KQ1 A;  4A5K A;  2X18 A;  1P3R A;  2DHI A;  1V89 A;  1MIX A;  4HB3 B;  2DLW A;  2LKO A;  2RGN B;  3HW2 B;  4DXA B;  4HDO A;  3ODX A;  1BTN A;  4WJ7 A;  3F5R A;  1NTY A;  2D4Q A;  2D9X A;  2Z0O A;  2IFS A;  1FGY A;  2M14 A;  4IFS A;  2AL6 A;  1UNR A;  1FAO A;  1DBH A;  1MKE A;  1AWE A;  2NZ8 B;  4K81 A;  2HTH B;  2HE7 A;  2PZ1 A;  1BAK A;  1QQG A;  2V76 A;  2D9Z A;  2Q13 A;  2VRW B;  5GOW B;  1NU2 A;  3OAN A;  1U5G A;  3U7D A;  1U5D A;  2KCJ A;  1X1F A;  2UZR A;  3IVF A;  3QIJ A;  2XQN M;  1MK7 B;  5JHH A;  1WGU A;  2DX5 A;  2ELA A;  2W2W A;  4CHJ A;  1UPQ A;  4YL8 A;  2J0K A;  1V5M A;  1ZM0 A;  3AU5 A;  4HAY B;  3BIN A;  1PMS A;  4PQ0 A;  1EGX A;  2K00 A;  2VSZ A;  3ODO A;  1Q67 A;  5D3W A;  5HE0 A;  2COA A;  2MFQ A;  4IOY X;  1W1H A;  2EMS A;  4A6H A;  5LOP B;  5FI1 A;  3O96 A;  2BCJ A;  4DX9 0;  2MDX A;  1H4R A;  1XD4 A;  3D8D A;  1XR0 B;  3SV1 A;  1QC6 A;  1WG7 A;  2I5C A;  3SNH A;  2I1K A;  3M1I B;  1ZSQ A;  5C5B A;  1P6S A;  3ULB A;  3PVL A;  3MDB C;  2COF A;  2DHK A;  3KY9 A;  5C6R A;  1W1G A;  2P8V A;  4DBB A;  1PLS A;  1XOD A;  3AU4 A;  2D9Y A;  2AEH A;  2GCJ A;  1NI2 A;  2J0M A;  1LB1 A;  1ZC4 B;  1KZG A;  2M38 A;  3WA0 A;  2D2Q A;  3FEH A;  5KCV A;  2QKM A;  4A6K A;  3QWM A;  2R0D A;  2Y8F A;  2COC A;  4MY6 A;  4KHB B;  1OMW A;  2RVB B;  5DHA B;  3UZT A;  1X05 A;  2DHJ A;  3PG7 A;  5JLJ B;  3DXD A;  2RNR B;  1X11 A;  5FI0 A;  5CLL B;  3BJI A;  2UVM A;  1FHW A;  2Y8G A;  2D10 A;  4Z2M B;  3KRW A;  2W2X C;  4GXB A;  2NMB A;  1UPR A;  4GMV A;  2J0J A;  2P0H A;  2J59 M;  2D11 A;  2H7D A;  4IAP A;  1RJ2 A;  5L81 A;  5DHF B;  1I7A A;  1NTV A;  5CLQ B;  4DX8 A;  1X1G A;  2COD A;  5D3V A;  1UNP A;  2DYQ A;  1FHX A;  2LUL A;  3MPX A;  4F7H A;  2P0D A;  3KRX A;  1RRP B;  1EF1 A;  1DDM A;  1IRS A;  2Z0Q A;  2DKQ A;  2CRF A;  3N7C A;  4BBK A;  2DTC A;  2UZS A;  3PP2 A;  4HB0 B;  2DFK A;  2Y7B A;  1WI1 A;  3SO6 A;  1TQZ A;  4KAX B;  3KZ1 A;  1XKE A;  2G35 A;  1XCG A;  4GZU A;  1WJM A;  1V88 A;  2K2U A;  4HAT B;  3HQC A;  1DRO A;  4ZRJ A;  4A6F A;  2N0Y A;  3DXE A;  4GPT B;  1TXD A;  1M7R A;  4H8S A;  1B55 A;  4K2P A;  2YVC A;  2P0F A;  2ROZ B;  3ZVR A;  1Y5O A;  3ODW A;  1N3H A;  1LW3 A;  2LOZ A;  4F7G A;  1U27 A;  4KHO A;  4HAX B;  2K2J A;  4B6H A;  1MAI A;  3TO1 A;  4HB4 B;  4CYE A;  1WVH A;  1Z87 A;  1KZ7 A;  5LON B;  3LJU X;  4L6E A;  2EJ8 A;  3GYP A;  4HAV B;  4HAW B;  1XX0 A;  1WGQ A;  1U2B A;  2YF0 A;  3A98 B;  5HE3 A;  2KUP A;  2R09 A;  4CHM A;  5KQ4 A;  4EMO A;  2VKI A;  2OQB A;  1GC6 A;  4MT7 A;  3P6A A;  3FSS A;  4WVF B;  3WYF B;  1UEF A;  4D0N B;  1FGZ A;  1MPH A;  2RLO A;  4HB2 B;  2CAY A;  2YS3 A;  4HDQ A;  1WJ1 A;  3A8Q A;  3CIK A;  4K2O A;  5D3Y A;  1V5U A;  4NSW A;  2RUK B;  1H10 A;  3QBV B;  1GG3 A;  1SHC A;  2MWN B;  3AJ4 A;  1OY2 A;  2LOX A;  4GN1 A;  3PEG A;  1X86 A;  1FOE A;  2RSG A;  2ADZ A;  1Y19 B;  2YS5 A;  3PZD A;  2MKR A;  2YRY A;  4PNK A;  4C0A A;  3T06 A;  2DN6 A;  2GS0 A;  4HAZ B;  4EKU A;  1DYN A;  2FJL A;  1M7E A;  4HAU B;  4NY0 A;  2N23 A;  1UNQ A;  2DKP A;  3U8Z A;  1BWN A;  5J3Y A;  3FM8 C;  3ZDT A;  5J3T A;  3NSU A;  1BTK A;  1ZVR A;  3A8P A;  3ULC A;  2ZPY A;  3F0W A;  3D8F A;  3DXC A;  3VOQ A;  1U5E A;  2CY4 A;  2W2X D;  5D27 A;  2I5F A;  1ISN A;  2E2X A;  1GC7 A;  3HK0 A;  4XWX A;  5C16 A;  2CY5 A;  4MK0 A;  2GCL A;  2I1J A;  4ZRK A;  5C79 A;  1FHO A;  3GYO A;  2D9V A;  3TW1 A;  1AQC A;  1OQN A;  3D8E A;  2GJY A;  2L1C A;  3ML4 A;  3G9W A;  5EFX A;  2LG1 A;  1DDV A;  2IYB A;  1W1D A;  3SUZ A;  2JP2 A;  2D9W A;  2YT1 A;  1SGH A;  4Z2N A;  1I2H A;  3TVV A;  2DYN A;  2L2I A;  4ZRI A;  3CXB B;  2ROV A;  4TKN A;  3TFM A;  1EVH A;  2LYD A;  5JP4 A;  3SYX A;  3PVW A;  4TYZ A;  5D3X A;  1PFJ A;  3VIA A;  4WSF A;  4YON A;  1V61 A;  2OTX A;  1J19 A;  1FB8 A;  1P5T A;  2KGX B;  2EC1 A;  4KVG B;  1DDW A;  4EJN A;  4P7I A;  5HE2 A;  5JHG A;  1MIZ B; 
#chains in the Genus database with same CATH topology
 4K17 A;  1K5D B;  2YSZ A;  2H7E A;  1TJ6 A;  2EMT A;  2YT0 A;  1EAZ A;  3PVU A;  4F7U P;  1MK9 B;  3X23 A;  4A6F B;  4GMX B;  3V5W A;  1KI1 B;  3KSY A;  2DA0 A;  2KIE A;  5DIF B;  3TCA A;  1U29 A;  5J3Q A;  3RCP A;  1E5W A;  2NBV A;  4HHV A;  2DX1 A;  2YS1 A;  4KHA A;  1V5P A;  1ZC3 B;  4GNK B;  3NWA A;  2QKL A;  2ELB A;  1K5G B;  5C5B B;  1U5F A;  2Z0P A;  1J0W A;  5HE1 A;  5LG4 B;  3PSC A;  3FVC A;  4Y94 A;  5DI9 B;  3P7Z A;  5DH9 B;  5KQ1 A;  4A5K A;  2X18 A;  1P3R A;  2DHI A;  1V89 A;  1MIX A;  4HB3 B;  2DLW A;  2LKO A;  2RGN B;  3HW2 B;  4DXA B;  4HDO A;  3ODX A;  4QXA B;  3DCX A;  1BTN A;  4WJ7 A;  3F5R A;  1NTY A;  2D4Q A;  2D9X A;  2Z0O A;  2IFS A;  1FGY A;  2M14 A;  4IFS A;  2AL6 A;  2Z4D A;  1UNR A;  1FAO A;  2YT2 A;  1DBH A;  1MKE A;  1AWE A;  2NZ8 B;  4K81 A;  2HTH B;  2HE7 A;  2PZ1 A;  1BAK A;  1QQG A;  2V76 A;  2D9Z A;  2Q13 A;  2VRW B;  5GOW B;  1NU2 A;  3OAN A;  1U5G A;  3U7D A;  1U5D A;  2KCJ A;  1X1F A;  2UZR A;  3IVF A;  3QIJ A;  2XQN M;  1MK7 B;  5JHH A;  1WGU A;  2DX5 A;  2ELA A;  2W2W A;  4CHJ A;  1UPQ A;  4YL8 A;  2J0K A;  1V5M A;  1ZM0 A;  3AU5 A;  4HAY B;  3BIN A;  1PMS A;  4PQ0 A;  1EGX A;  2K00 A;  2VSZ A;  2Z13 A;  1Q67 A;  3ODO A;  5D3W A;  5HE0 A;  2COA A;  2MFQ A;  4IOY X;  1W1H A;  2EMS A;  4A6H A;  5LOP B;  5FI1 A;  4QJ5 B;  3O96 A;  2BCJ A;  4DX9 0;  2MDX A;  1H4R A;  1XD4 A;  3D8D A;  1XR0 B;  3SV1 A;  1QC6 A;  1WG7 A;  2I5C A;  3SNH A;  2I1K A;  3M1I B;  1ZSQ A;  5C5B A;  1P6S A;  3ULB A;  3PVL A;  3MDB C;  4QJ4 B;  2COF A;  2DHK A;  3KY9 A;  5C6R A;  2KUQ A;  1W1G A;  2P8V A;  4DBB A;  1PLS A;  1XOD A;  3AU4 A;  2D9Y A;  2AEH A;  2GCJ A;  4HSI A;  2ZKM X;  1NI2 A;  2J0M A;  1LB1 A;  1ZC4 B;  1KZG A;  2M38 A;  3WA0 A;  2D2Q A;  3FEH A;  5KCV A;  2QKM A;  4OT1 A;  4A6K A;  3QWM A;  3A58 A;  2R0D A;  2Y8F A;  2COC A;  4MY6 A;  4KHB B;  1OMW A;  2RVB B;  5DHA B;  3UZT A;  1X05 A;  2DHJ A;  3PG7 A;  5JLJ B;  3DXD A;  2RNR B;  1X11 A;  5FI0 A;  5CLL B;  3BJI A;  2UVM A;  1FHW A;  2Y8G A;  2D10 A;  4Z2M B;  3KRW A;  2W2X C;  4GXB A;  2NMB A;  1UPR A;  4OSN A;  4GMV A;  2J0J A;  2P0H A;  2J59 M;  2D11 A;  2H7D A;  4IAP A;  1RJ2 A;  5L81 A;  5DHF B;  1I7A A;  2FJU B;  5M4Y B;  1NTV A;  5CLQ B;  4DX8 A;  1X1G A;  2COD A;  5D3V A;  1UNP A;  2DYQ A;  1FHX A;  2LUL A;  3NWD A;  3MPX A;  4F7H A;  2P0D A;  3KRX A;  1RRP B;  1EF1 A;  1DDM A;  1IRS A;  2Z0Q A;  1ZYI A;  2DKQ A;  1MI1 A;  2CRF A;  3N7C A;  4BBK A;  4D6W A;  2DTC A;  2UZS A;  3PP2 A;  4HB0 B;  3OHM B;  2DFK A;  2Y7B A;  1WI1 A;  3SO6 A;  1TQZ A;  4KAX B;  3KZ1 A;  1XKE A;  2G35 A;  1XCG A;  4GZU A;  1WJM A;  1V88 A;  2K2U A;  4HAT B;  4DIX A;  3HQC A;  1DRO A;  4ZRJ A;  4A6F A;  2N0Y A;  3DXE A;  4GPT B;  2RRF A;  1TXD A;  1M7R A;  4H8S A;  1B55 A;  4K2P A;  2YVC A;  2P0F A;  2ROZ B;  3ZVR A;  5IRS A;  1Y5O A;  3ODW A;  1N3H A;  1LW3 A;  2LOZ A;  4F7G A;  1U27 A;  4KHO A;  4HAX B;  2K2J A;  4B6H A;  1MAI A;  3TO1 A;  4KHB A;  4HB4 B;  4CYE A;  1WVH A;  1Z87 A;  1KZ7 A;  5LON B;  3LJU X;  4L6E A;  2EJ8 A;  3GYP A;  4HAV B;  4HAW B;  1XX0 A;  2KR0 A;  1WGQ A;  1U2B A;  2YF0 A;  4L1R A;  3A98 B;  5HE3 A;  2KUP A;  2R09 A;  4CHM A;  5KQ4 A;  4EMO A;  2R2Y A;  3NWF A;  2VKI A;  2OQB A;  1GC6 A;  4MT7 A;  3P6A A;  3FSS A;  4WVF B;  3WYF B;  1UEF A;  4D0N B;  1FGZ A;  1MPH A;  3B77 A;  2RLO A;  4HB2 B;  2GUM A;  2CAY A;  2K8E A;  2YS3 A;  4HDQ A;  2Z14 A;  1WJ1 A;  3A8Q A;  3CIK A;  4K2O A;  5D3Y A;  1V5U A;  4NSW A;  2RUK B;  1H10 A;  3QBV B;  1GG3 A;  1SHC A;  2MWN B;  3AJ4 A;  1OY2 A;  2LOX A;  4QJ3 B;  4GN1 A;  3PEG A;  1X86 A;  1FOE A;  2RSG A;  2ADZ A;  1Y19 B;  2YS5 A;  5JHG A;  3PZD A;  2MKR A;  2YRY A;  3NW8 A;  4PNK A;  4C0A A;  3T06 A;  2KIG A;  2DN6 A;  2GS0 A;  4HAZ B;  4EKU A;  1DYN A;  2FJL A;  1M7E A;  4HAU B;  4NY0 A;  2N23 A;  5I2S A;  1UNQ A;  2DKP A;  3U8Z A;  1BWN A;  5J3Y A;  3FM8 C;  3ZDT A;  5J3T A;  3NSU A;  1BTK A;  1ZVR A;  3A8P A;  3ULC A;  2ZPY A;  3F0W A;  3D8F A;  3DXC A;  3VOQ A;  1U5E A;  2CY4 A;  2W2X D;  5D27 A;  2I5F A;  1ISN A;  2E2X A;  1GC7 A;  3HK0 A;  4XWX A;  5C16 A;  4GOU A;  2CY5 A;  4CSQ A;  4MK0 A;  2GCL A;  2I1J A;  4ZRK A;  3HIE A;  5C79 A;  1FHO A;  3GYO A;  2D9V A;  3U12 A;  3TW1 A;  1AQC A;  1OQN A;  3D8E A;  2GJY A;  2L1C A;  3ML4 A;  3G9W A;  5EFX A;  2LG1 A;  1DDV A;  1T77 A;  2IYB A;  1W1D A;  2Z59 A;  3SUZ A;  2JP2 A;  2D9W A;  2YT1 A;  1SGH A;  4Z2N A;  1I2H A;  3TVV A;  2DYN A;  2L2I A;  4ZRI A;  3CXB B;  2ROV A;  5I2M A;  4TKN A;  3TFM A;  1EVH A;  2LYD A;  5JP4 A;  3SYX A;  3PVW A;  4TYZ A;  5D3X A;  1PFJ A;  3VIA A;  4WSF A;  4YON A;  1V61 A;  2OTX A;  1J19 A;  1FB8 A;  1P5T A;  2KGX B;  2EC1 A;  4KVG B;  1DDW A;  4EJN A;  4P7I A;  5HE2 A;  3HSA A;  2K49 A;  1MIZ B; 
#chains in the Genus database with same CATH homology
 4K17 A;  1K5D B;  2YSZ A;  2H7E A;  1TJ6 A;  2EMT A;  2YT0 A;  1EAZ A;  3PVU A;  4F7U P;  1MK9 B;  3X23 A;  4A6F B;  4GMX B;  3V5W A;  1KI1 B;  3KSY A;  2DA0 A;  5DIF B;  3TCA A;  1U29 A;  5J3Q A;  3RCP A;  1E5W A;  4HHV A;  2DX1 A;  2YS1 A;  4KHA A;  1V5P A;  1ZC3 B;  2QKL A;  2ELB A;  1K5G B;  5C5B B;  1U5F A;  2Z0P A;  1J0W A;  5HE1 A;  3PSC A;  4Y94 A;  5DI9 B;  3P7Z A;  5DH9 B;  5KQ1 A;  4A5K A;  2X18 A;  1P3R A;  2DHI A;  1V89 A;  1MIX A;  4HB3 B;  2DLW A;  2LKO A;  2RGN B;  3HW2 B;  4DXA B;  4HDO A;  3ODX A;  1BTN A;  4WJ7 A;  3F5R A;  1NTY A;  2D4Q A;  2D9X A;  2Z0O A;  2IFS A;  1FGY A;  2M14 A;  4IFS A;  2AL6 A;  1UNR A;  1FAO A;  1DBH A;  1MKE A;  1AWE A;  2NZ8 B;  4K81 A;  2HTH B;  2HE7 A;  2PZ1 A;  1BAK A;  1QQG A;  2V76 A;  2D9Z A;  2Q13 A;  2VRW B;  5GOW B;  1NU2 A;  3OAN A;  1U5G A;  3U7D A;  1U5D A;  2KCJ A;  1X1F A;  2UZR A;  3IVF A;  3QIJ A;  2XQN M;  1MK7 B;  5JHH A;  1WGU A;  2DX5 A;  2ELA A;  2W2W A;  4CHJ A;  1UPQ A;  4YL8 A;  2J0K A;  1V5M A;  1ZM0 A;  3AU5 A;  4HAY B;  3BIN A;  1PMS A;  4PQ0 A;  1EGX A;  2K00 A;  2VSZ A;  3ODO A;  1Q67 A;  5D3W A;  5HE0 A;  2COA A;  2MFQ A;  4IOY X;  1W1H A;  2EMS A;  4A6H A;  5LOP B;  5FI1 A;  3O96 A;  2BCJ A;  4DX9 0;  2MDX A;  1H4R A;  1XD4 A;  3D8D A;  1XR0 B;  3SV1 A;  1QC6 A;  1WG7 A;  2I5C A;  3SNH A;  2I1K A;  3M1I B;  1ZSQ A;  5C5B A;  1P6S A;  3ULB A;  3PVL A;  3MDB C;  2COF A;  2DHK A;  3KY9 A;  5C6R A;  1W1G A;  2P8V A;  4DBB A;  1PLS A;  1XOD A;  3AU4 A;  2D9Y A;  2AEH A;  2GCJ A;  1NI2 A;  2J0M A;  1LB1 A;  1ZC4 B;  1KZG A;  2M38 A;  3WA0 A;  2D2Q A;  3FEH A;  5KCV A;  2QKM A;  4A6K A;  3QWM A;  2R0D A;  2Y8F A;  2COC A;  4MY6 A;  4KHB B;  1OMW A;  2RVB B;  5DHA B;  3UZT A;  1X05 A;  2DHJ A;  3PG7 A;  5JLJ B;  3DXD A;  2RNR B;  1X11 A;  5FI0 A;  5CLL B;  3BJI A;  2UVM A;  1FHW A;  2Y8G A;  2D10 A;  4Z2M B;  3KRW A;  2W2X C;  4GXB A;  2NMB A;  1UPR A;  4GMV A;  2J0J A;  2P0H A;  2J59 M;  2D11 A;  2H7D A;  4IAP A;  1RJ2 A;  5L81 A;  5DHF B;  1I7A A;  1NTV A;  5CLQ B;  4DX8 A;  1X1G A;  2COD A;  5D3V A;  1UNP A;  2DYQ A;  1FHX A;  2LUL A;  3MPX A;  4F7H A;  2P0D A;  3KRX A;  1RRP B;  1EF1 A;  1DDM A;  1IRS A;  2Z0Q A;  2DKQ A;  2CRF A;  3N7C A;  4BBK A;  2DTC A;  2UZS A;  3PP2 A;  4HB0 B;  2DFK A;  2Y7B A;  1WI1 A;  3SO6 A;  1TQZ A;  4KAX B;  3KZ1 A;  1XKE A;  2G35 A;  1XCG A;  4GZU A;  1WJM A;  1V88 A;  2K2U A;  4HAT B;  3HQC A;  1DRO A;  4ZRJ A;  4A6F A;  2N0Y A;  3DXE A;  4GPT B;  1TXD A;  1M7R A;  4H8S A;  1B55 A;  4K2P A;  2YVC A;  2P0F A;  2ROZ B;  3ZVR A;  1Y5O A;  3ODW A;  1N3H A;  1LW3 A;  2LOZ A;  4F7G A;  1U27 A;  4KHO A;  4HAX B;  2K2J A;  4B6H A;  1MAI A;  3TO1 A;  4HB4 B;  4CYE A;  1WVH A;  1Z87 A;  1KZ7 A;  5LON B;  3LJU X;  4L6E A;  2EJ8 A;  3GYP A;  4HAV B;  4HAW B;  1XX0 A;  1WGQ A;  1U2B A;  2YF0 A;  3A98 B;  5HE3 A;  2KUP A;  2R09 A;  4CHM A;  5KQ4 A;  4EMO A;  2VKI A;  2OQB A;  1GC6 A;  4MT7 A;  3P6A A;  3FSS A;  4WVF B;  3WYF B;  1UEF A;  4D0N B;  1FGZ A;  1MPH A;  2RLO A;  4HB2 B;  2CAY A;  2YS3 A;  4HDQ A;  1WJ1 A;  3A8Q A;  3CIK A;  4K2O A;  5D3Y A;  1V5U A;  4NSW A;  2RUK B;  1H10 A;  3QBV B;  1GG3 A;  1SHC A;  2MWN B;  3AJ4 A;  1OY2 A;  2LOX A;  4GN1 A;  3PEG A;  1X86 A;  1FOE A;  2RSG A;  2ADZ A;  1Y19 B;  2YS5 A;  3PZD A;  2MKR A;  2YRY A;  4PNK A;  4C0A A;  3T06 A;  2DN6 A;  2GS0 A;  4HAZ B;  4EKU A;  1DYN A;  2FJL A;  1M7E A;  4HAU B;  4NY0 A;  2N23 A;  1UNQ A;  2DKP A;  3U8Z A;  1BWN A;  5J3Y A;  3FM8 C;  3ZDT A;  5J3T A;  3NSU A;  1BTK A;  1ZVR A;  3A8P A;  3ULC A;  2ZPY A;  3F0W A;  3D8F A;  3DXC A;  3VOQ A;  1U5E A;  2CY4 A;  2W2X D;  5D27 A;  2I5F A;  1ISN A;  2E2X A;  1GC7 A;  3HK0 A;  4XWX A;  5C16 A;  2CY5 A;  4MK0 A;  2GCL A;  2I1J A;  4ZRK A;  5C79 A;  1FHO A;  3GYO A;  2D9V A;  3TW1 A;  1AQC A;  1OQN A;  3D8E A;  2GJY A;  2L1C A;  3ML4 A;  3G9W A;  5EFX A;  2LG1 A;  1DDV A;  2IYB A;  1W1D A;  3SUZ A;  2JP2 A;  2D9W A;  2YT1 A;  1SGH A;  4Z2N A;  1I2H A;  3TVV A;  2DYN A;  2L2I A;  4ZRI A;  3CXB B;  2ROV A;  4TKN A;  3TFM A;  1EVH A;  2LYD A;  5JP4 A;  3SYX A;  3PVW A;  4TYZ A;  5D3X A;  1PFJ A;  3VIA A;  4WSF A;  4YON A;  1V61 A;  2OTX A;  1J19 A;  1FB8 A;  1P5T A;  2KGX B;  2EC1 A;  4KVG B;  1DDW A;  4EJN A;  4P7I A;  5HE2 A;  5JHG A;  1MIZ B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...