2EJ8A

Crystal structure of appl1 ptb domain at 1.8a
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
139
structure length
133
Chain Sequence
ETEDSILHQLFIVRFLGSMEVKSDDHPDVVYETMRQILAARAIHNIFRMTESHLLVTCDCLKLIDPQTQVTRLTFPLPCVVLYATHQENKRLFGFVLRTSSLSSVCYIFESNNEGEKICDSVGLAKQIALHAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of APPL1 PTB domain at 1.8A
rcsb
source organism Homo sapiens
molecule tags Structural genomics, unknown function
molecule keywords DCC-interacting protein 13 alpha
total genus 35
structure length 133
sequence length 139
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-03-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00640 PID Phosphotyrosine interaction domain (PTB/PID)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2ej8A00
2DFKA 3AU4A 3TO1A 2BCJA 1X1FA 4A6FB 1DYNA 1X86A 1U5DA 2R0DA 2HE7A 1DDVA 3P6AA 1V61A 1RJ2A 1FGYA 4GN1A 1MAIA 2YVCA 2Y8FA 1ZC3B 2FJLA 3FM8C 4HDQA 3NSUA 5DHFB 4H8SA 1P6SA 2Z0PA 2YSZA 2D9XA 5EFXA 3FSSA 4YONA 1DDWA 1ZC4B 4Y94A 3SYXA 3TFMA 2Z0OA 3SO6A 2K2JA 2KCJA 1KI1B 2N0YA 4TYZA 1XODA 2D9YA 2YS3A 4YL8A 2CRFA 3LJUX 1XD4A 4DBBA 4ZRKA 2P0FA 1BTKA 2ADZA 3F0WA 2LULA 2L1CA 3U7DA 3PVWA 1W1GA 2D2QA 2RVBB 4DXAB 5JHGA 4MK0A 5D27A 4HB4B 1DROA 2ROZB 3HK0A 3P7ZA 3SV1A 1FOEA 1WVHA 2W2WA 3N7CA 4GXBA 2D9ZA 4HATB 4HAZB 1X1GA 2J59M 3D8FA 3PEGA 4K17A 2QKLA 1K5GB 4HHVA 4F7GA 4F7UP 2CODA 5D3YA 3ODWA 5DH9B 4K81A 5KCVA 4HB0B 3HW2B 3G9WA 4L6EA 5LONB 5JHHA 2EJ8A 5FI1A 1I2HA 2KGXB 3D8DA 2YT0A 2ELAA 4KHAA 2COCA 2RSGA 1WJMA 5C79A 3SUZA 1MK9B 1AQCA 1MIXA 2NMBA 1H10A 3KZ1A 3TVVA 1WG7A 2X18A 3WYFB 2UVMA 1UNQA 3V5WA 2EMSA 1MPHA 2DX1A 1UNRA 4ZRJA 4D0NB 3QWMA 2I1JA 1W1HA 4EMOA 3PZDA 4DX90 4CHJA 4EKUA 5DHAB 1V89A 3ZVRA 4KVGB 1FHOA 1MKEA 1GC7A 2DLWA 3PSCA 1TJ6A 2LG1A 1FAOA 1ZM0A 5HE1A 1FHWA 1KZGA 3ODXA 1ZVRA 3CXBB 2Y7BA 1IRSA 4HDOA 1UNPA 1LW3A 2VKIA 3TCAA 3X23A 2DX5A 2M14A 2YS1A 3GYOA 4GMXB 3MDBC 2MKRA 3KY9A 5LOPB 1DDMA 1P5TA 4PNKA 4C0AA 5JLJB 3PP2A 2D9WA 2CAYA 1Z87A 3KRXA 1I7AA 5D3WA 3UZTA 1UPRA 1SGHA 3KSYA 4PQ0A 2I5CA 2J0KA 1LB1A 1Q67A 5HE2A 3AU5A 2EMTA 2CY4A 4HB3B 5JP4A 1NTYA 2YRYA 3ODOA 1XKEA 2IFSA 4MY6A 3VIAA 1BWNA 5C5BB 2K2UA 2RUKB 2MWNB 1PFJA 2DKQA 1FHXA 2K00A 4K2PA 1N3HA 3O96A 1EF1A 4K2OA 3OANA 2AEHA 2LOXA 1PLSA 4XWXA 3KRWA 1WJ1A 3T06A 1AWEA 3PVUA 2GCJA 2J0JA 2DHIA 2D4QA 2MDXA 1MK7B 3U8ZA 4BBKA 1DBHA 5L81A 2L2IA 1UPQA 2KUPA 4A6HA 1P3RA 2N23A 2M38A 1ZSQA 1U5GA 3WA0A 4CYEA 2GJYA 2RGNB 2I1KA 4NY0A 4Z2MB 1J19A 4HAWB 3CIKA 1PMSA 3D8EA 2V76A 4DX8A 2OTXA 4Z2NA 5D3XA 1OY2A 1Y19B 1V5UA 2XQNM 4HAYB 2IYBA 1GG3A 1WGUA 2VRWB 2COFA 3F5RA 2JP2A 1X05A 1EAZA 2DKPA 3DXCA 5J3YA 4CHMA 4GZUA 1U29A 1V88A 2DHKA 3ML4A 5J3TA 4GMVA 1QQGA 4KAXB 1E5WA 4HAUB 2H7DA 1KZ7A 2LOZA 4WVFB 1SHCA 2D9VA 2OQBA 2DA0A 2HTHB 2J0MA 1BAKA 3VOQA 2ZPYA 1NTVA 3BJIA 3TW1A 1K5DB 1X11A 4IFSA 2LYDA 3AJ4A 2COAA 5C6RA 3QIJA 3FEHA 4A5KA 1UEFA 1GC6A 5KQ4A 3RCPA 2D10A 4HB2B 2QKMA 1U27A 1EGXA 3A98B 1U2BA 4NSWA 2DN6A 3M1IB 2UZRA 2VSZA 4EJNA 2DYNA 3GYPA 4A6FA 5D3VA 5CLLB 3HQCA 5HE0A 1Y5OA 4ZRIA 2H7EA 3PG7A 4IOYX 2DHJA 1W1DA 4TKNA 1M7EA 5C16A 4HAVB 3BINA 1WI1A 2EC1A 2Y8GA 4KHOA 2GS0A 2UZSA 4KHBB 2I5FA 1J0WA 4F7HA 1U5FA 2RNRB 1H4RA 1M7RA 1V5PA 2D11A 3DXDA 1NU2A 1OQNA 1FGZA 4GPTB 3IVFA 2P0DA 5GOWB 1ISNA 2DYQA 3SNHA 1FB8A 2YF0A 1EVHA 1V5MA 2P8VA 1WGQA 4A6KA 2NZ8B 1XCGA 1NI2A 2PZ1A 5C5BA 1U5EA 2YS5A 3DXEA 4WSFA 4IAPA 5FI0A 2Q13A 3A8QA 2E2XA 2AL6A 5DIFB 1OMWA 2G35A 1QC6A 4WJ7A 5CLQB 1B55A 5KQ1A 2R09A 2ROVA 1XR0B 3ULBA 2P0HA 2LKOA 4P7IA 1TXDA 3ZDTA 2W2XC 4B6HA 3A8PA 3QBVB 2W2XD 2MFQA 5J3QA 4MT7A 2CY5A 1RRPB 2GCLA 5DI9B 2Z0QA 1BTNA 3MPXA 4HAXB 1MIZB 2RLOA 1XX0A 5HE3A 1TQZA 2ELBA 3ULCA 3PVLA 2DTCA 2YT1A
chains in the Genus database with same CATH superfamily
2DFKA 3AU4A 3TO1A 2BCJA 1X1FA 4A6FB 1DYNA 1X86A 1U5DA 2R0DA 4KHBA 2HE7A 1DDVA 3P6AA 1V61A 1RJ2A 1FGYA 4GN1A 1MAIA 2YVCA 2Y8FA 1ZC3B 2FJLA 3FM8C 4HDQA 3NSUA 2KIGA 5DHFB 2YT2A 4H8SA 1T77A 1P6SA 2Z0PA 2YSZA 2D9XA 5EFXA 2KUQA 3FSSA 4YONA 1DDWA 1ZC4B 4Y94A 3SYXA 3TFMA 2Z0OA 3SO6A 2K2JA 2KCJA 1KI1B 2N0YA 4TYZA 1XODA 2D9YA 2YS3A 4YL8A 2CRFA 3LJUX 1XD4A 4DBBA 4ZRKA 2P0FA 1BTKA 2ADZA 3F0WA 2LULA 2L1CA 3U7DA 3PVWA 1W1GA 2D2QA 3HIEA 2RVBB 4DXAB 5JHGA 4MK0A 5D27A 4HB4B 1DROA 2ROZB 3NWAA 3HK0A 3P7ZA 3SV1A 1FOEA 1WVHA 4GOUA 2W2WA 3N7CA 4GXBA 2D9ZA 4HATB 2Z14A 4HAZB 1X1GA 2J59M 3D8FA 3PEGA 4K17A 2QKLA 1K5GB 4HHVA 4F7GA 4F7UP 2CODA 5D3YA 3ODWA 5DH9B 2Z13A 3A58A 4K81A 5KCVA 4HB0B 3HW2B 3G9WA 5IRSA 4L6EA 5LONB 5JHHA 2EJ8A 5FI1A 1I2HA 3NW8A 2KGXB 3D8DA 2YT0A 2ELAA 4KHAA 2COCA 2RSGA 1WJMA 5C79A 3SUZA 1MK9B 1AQCA 1MIXA 2NMBA 1H10A 3KZ1A 3TVVA 1WG7A 2X18A 3WYFB 2UVMA 4HSIA 1UNQA 3V5WA 2EMSA 4QJ5B 1MPHA 2DX1A 1UNRA 4ZRJA 4D0NB 3QWMA 2I1JA 1W1HA 4EMOA 3PZDA 4DX90 4CHJA 4EKUA 5DHAB 1V89A 3ZVRA 2ZKMX 4KVGB 1FHOA 1MKEA 1GC7A 2DLWA 3PSCA 1TJ6A 2LG1A 1FAOA 1ZM0A 5HE1A 1FHWA 1KZGA 3ODXA 1ZVRA 3CXBB 2Y7BA 1IRSA 4HDOA 1UNPA 1LW3A 2VKIA 3TCAA 3X23A 2NBVA 2DX5A 2M14A 2YS1A 3GYOA 4GMXB 3MDBC 2MKRA 3KY9A 4L1RA 5LOPB 1DDMA 1P5TA 4PNKA 4C0AA 5JLJB 3PP2A 2D9WA 2GUMA 2CAYA 1Z87A 3KRXA 1I7AA 5D3WA 3UZTA 1UPRA 4DIXA 1SGHA 3KSYA 4PQ0A 2I5CA 2J0KA 1LB1A 1Q67A 5HE2A 3AU5A 2EMTA 2CY4A 4HB3B 5JP4A 1NTYA 2YRYA 3ODOA 2KR0A 1XKEA 4QXAB 2IFSA 4MY6A 3VIAA 1BWNA 5C5BB 2K2UA 2RUKB 2MWNB 1PFJA 2DKQA 1FHXA 2K00A 3O96A 1N3HA 4K2PA 1EF1A 4K2OA 3OANA 2AEHA 2LOXA 1PLSA 3B77A 4XWXA 3KRWA 5M4YB 1WJ1A 2KIEA 3T06A 1AWEA 3PVUA 2GCJA 2J0JA 2DHIA 2D4QA 2MDXA 1MK7B 3U8ZA 4BBKA 4OT1A 1DBHA 5L81A 2L2IA 1UPQA 2KUPA 4A6HA 1P3RA 2N23A 2M38A 3NWDA 1ZSQA 1U5GA 3WA0A 4CYEA 2GJYA 2K49A 2RGNB 2I1KA 4NY0A 4Z2MB 1J19A 4HAWB 3CIKA 1PMSA 3D8EA 2V76A 4DX8A 2OTXA 4Z2NA 5D3XA 1OY2A 2Z59A 1Y19B 1V5UA 2XQNM 4HAYB 2IYBA 1GG3A 1WGUA 2VRWB 2COFA 3F5RA 2JP2A 1X05A 1EAZA 4CSQA 2DKPA 3DXCA 5J3YA 4CHMA 4GZUA 1U29A 5I2MA 1V88A 2DHKA 3ML4A 5J3TA 4GMVA 1QQGA 1E5WA 4HAUB 4KAXB 2H7DA 1KZ7A 2LOZA 4WVFB 1SHCA 2D9VA 2OQBA 2DA0A 2HTHB 2J0MA 1BAKA 3VOQA 2ZPYA 1NTVA 3BJIA 3TW1A 1K5DB 1X11A 4IFSA 5LG4B 2LYDA 3AJ4A 2COAA 5C6RA 3QIJA 3U12A 3FEHA 4A5KA 1UEFA 3OHMB 4QJ3B 3DCXA 1GC6A 5KQ4A 3RCPA 2K8EA 2D10A 4HB2B 2QKMA 1U27A 1EGXA 3A98B 1U2BA 4NSWA 2DN6A 3M1IB 2UZRA 2VSZA 4EJNA 4QJ4B 2DYNA 3GYPA 4A6FA 5D3VA 5CLLB 3HQCA 5HE0A 3HSAA 1Y5OA 4GNKB 4ZRIA 2H7EA 3PG7A 3FVCA 4IOYX 2DHJA 1W1DA 4TKNA 1MI1A 1M7EA 5C16A 4HAVB 3BINA 1WI1A 2EC1A 2Y8GA 4KHOA 2GS0A 2UZSA 4KHBB 2I5FA 1J0WA 4F7HA 1U5FA 2RNRB 3NWFA 1H4RA 1M7RA 1V5PA 2D11A 2RRFA 3DXDA 1NU2A 1OQNA 1FGZA 4GPTB 3IVFA 2P0DA 2FJUB 5GOWB 1ISNA 2DYQA 3SNHA 1FB8A 4D6WA 2YF0A 1EVHA 5I2SA 1V5MA 2P8VA 1WGQA 4A6KA 2NZ8B 1XCGA 1NI2A 2PZ1A 2Z4DA 5C5BA 1U5EA 2YS5A 3DXEA 4WSFA 4IAPA 5FI0A 2Q13A 1ZYIA 3A8QA 2E2XA 2AL6A 5DIFB 1OMWA 2G35A 1QC6A 4WJ7A 5CLQB 1B55A 5KQ1A 2R09A 2ROVA 1XR0B 3ULBA 2P0HA 2LKOA 4P7IA 1TXDA 3ZDTA 2W2XC 4B6HA 4OSNA 3A8PA 3QBVB 2W2XD 2MFQA 5J3QA 4MT7A 2CY5A 1RRPB 2GCLA 5DI9B 2Z0QA 1BTNA 3MPXA 1MIZB 4HAXB 2RLOA 1XX0A 5HE3A 1TQZA 2ELBA 2R2YA 3ULCA 3PVLA 2DTCA 2YT1A
chains in the Genus database with same CATH topology
2DFKA 3AU4A 3TO1A 2BCJA 1X1FA 4A6FB 1DYNA 1X86A 1U5DA 2R0DA 2HE7A 1DDVA 3P6AA 1V61A 1RJ2A 1FGYA 4GN1A 1MAIA 2YVCA 2Y8FA 1ZC3B 2FJLA 3FM8C 4HDQA 3NSUA 5DHFB 4H8SA 1P6SA 2Z0PA 2YSZA 2D9XA 5EFXA 3FSSA 4YONA 1DDWA 1ZC4B 4Y94A 3SYXA 3TFMA 2Z0OA 3SO6A 2K2JA 2KCJA 1KI1B 2N0YA 4TYZA 1XODA 2D9YA 2YS3A 4YL8A 2CRFA 3LJUX 1XD4A 4DBBA 4ZRKA 2P0FA 1BTKA 2ADZA 3F0WA 2LULA 2L1CA 3U7DA 3PVWA 1W1GA 2D2QA 2RVBB 4DXAB 5JHGA 4MK0A 5D27A 4HB4B 1DROA 2ROZB 3HK0A 3P7ZA 3SV1A 1FOEA 1WVHA 2W2WA 3N7CA 4GXBA 2D9ZA 4HATB 4HAZB 1X1GA 2J59M 3D8FA 3PEGA 4K17A 2QKLA 1K5GB 4HHVA 4F7GA 4F7UP 2CODA 5D3YA 3ODWA 5DH9B 4K81A 5KCVA 4HB0B 3HW2B 3G9WA 4L6EA 5LONB 5JHHA 2EJ8A 5FI1A 1I2HA 2KGXB 3D8DA 2YT0A 2ELAA 4KHAA 2COCA 2RSGA 1WJMA 5C79A 3SUZA 1MK9B 1AQCA 1MIXA 2NMBA 1H10A 3KZ1A 3TVVA 1WG7A 2X18A 3WYFB 2UVMA 1UNQA 3V5WA 2EMSA 1MPHA 2DX1A 1UNRA 4ZRJA 4D0NB 3QWMA 2I1JA 1W1HA 4EMOA 3PZDA 4DX90 4CHJA 4EKUA 5DHAB 1V89A 3ZVRA 4KVGB 1FHOA 1MKEA 1GC7A 2DLWA 3PSCA 1TJ6A 2LG1A 1FAOA 1ZM0A 5HE1A 1FHWA 1KZGA 3ODXA 1ZVRA 3CXBB 2Y7BA 1IRSA 4HDOA 1UNPA 1LW3A 2VKIA 3TCAA 3X23A 2DX5A 2M14A 2YS1A 3GYOA 4GMXB 3MDBC 2MKRA 3KY9A 5LOPB 1DDMA 1P5TA 4PNKA 4C0AA 5JLJB 3PP2A 2D9WA 2CAYA 1Z87A 3KRXA 1I7AA 5D3WA 3UZTA 1UPRA 1SGHA 3KSYA 4PQ0A 2I5CA 2J0KA 1LB1A 1Q67A 5HE2A 3AU5A 2EMTA 2CY4A 4HB3B 5JP4A 1NTYA 2YRYA 3ODOA 1XKEA 2IFSA 4MY6A 3VIAA 1BWNA 5C5BB 2K2UA 2RUKB 2MWNB 1PFJA 2DKQA 1FHXA 2K00A 4K2PA 1N3HA 3O96A 1EF1A 4K2OA 3OANA 2AEHA 2LOXA 1PLSA 4XWXA 3KRWA 1WJ1A 3T06A 1AWEA 3PVUA 2GCJA 2J0JA 2DHIA 2D4QA 2MDXA 1MK7B 3U8ZA 4BBKA 1DBHA 5L81A 2L2IA 1UPQA 2KUPA 4A6HA 1P3RA 2N23A 2M38A 1ZSQA 1U5GA 3WA0A 4CYEA 2GJYA 2RGNB 2I1KA 4NY0A 4Z2MB 1J19A 4HAWB 3CIKA 1PMSA 3D8EA 2V76A 4DX8A 2OTXA 4Z2NA 5D3XA 1OY2A 1Y19B 1V5UA 2XQNM 4HAYB 2IYBA 1GG3A 1WGUA 2VRWB 2COFA 3F5RA 2JP2A 1X05A 1EAZA 2DKPA 3DXCA 5J3YA 4CHMA 4GZUA 1U29A 1V88A 2DHKA 3ML4A 5J3TA 4GMVA 1QQGA 4KAXB 1E5WA 4HAUB 2H7DA 1KZ7A 2LOZA 4WVFB 1SHCA 2D9VA 2OQBA 2DA0A 2HTHB 2J0MA 1BAKA 3VOQA 2ZPYA 1NTVA 3BJIA 3TW1A 1K5DB 1X11A 4IFSA 2LYDA 3AJ4A 2COAA 5C6RA 3QIJA 3FEHA 4A5KA 1UEFA 1GC6A 5KQ4A 3RCPA 2D10A 4HB2B 2QKMA 1U27A 1EGXA 3A98B 1U2BA 4NSWA 2DN6A 3M1IB 2UZRA 2VSZA 4EJNA 2DYNA 3GYPA 4A6FA 5D3VA 5CLLB 3HQCA 5HE0A 1Y5OA 4ZRIA 2H7EA 3PG7A 4IOYX 2DHJA 1W1DA 4TKNA 1M7EA 5C16A 4HAVB 3BINA 1WI1A 2EC1A 2Y8GA 4KHOA 2GS0A 2UZSA 4KHBB 2I5FA 1J0WA 4F7HA 1U5FA 2RNRB 1H4RA 1M7RA 1V5PA 2D11A 3DXDA 1NU2A 1OQNA 1FGZA 4GPTB 3IVFA 2P0DA 5GOWB 1ISNA 2DYQA 3SNHA 1FB8A 2YF0A 1EVHA 1V5MA 2P8VA 1WGQA 4A6KA 2NZ8B 1XCGA 1NI2A 2PZ1A 5C5BA 1U5EA 2YS5A 3DXEA 4WSFA 4IAPA 5FI0A 2Q13A 3A8QA 2E2XA 2AL6A 5DIFB 1OMWA 2G35A 1QC6A 4WJ7A 5CLQB 1B55A 5KQ1A 2R09A 2ROVA 1XR0B 3ULBA 2P0HA 2LKOA 4P7IA 1TXDA 3ZDTA 2W2XC 4B6HA 3A8PA 3QBVB 2W2XD 2MFQA 5J3QA 4MT7A 2CY5A 1RRPB 2GCLA 5DI9B 2Z0QA 1BTNA 3MPXA 4HAXB 1MIZB 2RLOA 1XX0A 5HE3A 1TQZA 2ELBA 3ULCA 3PVLA 2DTCA 2YT1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DFK A;  3AU4 A;  3TO1 A;  2BCJ A;  1X1F A;  4A6F B;  1DYN A;  1X86 A;  1U5D A;  2R0D A;  2HE7 A;  1DDV A;  3P6A A;  1V61 A;  1RJ2 A;  1FGY A;  4GN1 A;  1MAI A;  2YVC A;  2Y8F A;  1ZC3 B;  2FJL A;  3FM8 C;  4HDQ A;  3NSU A;  5DHF B;  4H8S A;  1P6S A;  2Z0P A;  2YSZ A;  2D9X A;  5EFX A;  3FSS A;  4YON A;  1DDW A;  1ZC4 B;  4Y94 A;  3SYX A;  3TFM A;  2Z0O A;  3SO6 A;  2K2J A;  2KCJ A;  1KI1 B;  2N0Y A;  4TYZ A;  1XOD A;  2D9Y A;  2YS3 A;  4YL8 A;  2CRF A;  3LJU X;  1XD4 A;  4DBB A;  4ZRK A;  2P0F A;  1BTK A;  2ADZ A;  3F0W A;  2LUL A;  2L1C A;  3U7D A;  3PVW A;  1W1G A;  2D2Q A;  2RVB B;  4DXA B;  5JHG A;  4MK0 A;  5D27 A;  4HB4 B;  1DRO A;  2ROZ B;  3HK0 A;  3P7Z A;  3SV1 A;  1FOE A;  1WVH A;  2W2W A;  3N7C A;  4GXB A;  2D9Z A;  4HAT B;  4HAZ B;  1X1G A;  2J59 M;  3D8F A;  3PEG A;  4K17 A;  2QKL A;  1K5G B;  4HHV A;  4F7G A;  4F7U P;  2COD A;  5D3Y A;  3ODW A;  5DH9 B;  4K81 A;  5KCV A;  4HB0 B;  3HW2 B;  3G9W A;  4L6E A;  5LON B;  5JHH A;  2EJ8 A;  5FI1 A;  1I2H A;  2KGX B;  3D8D A;  2YT0 A;  2ELA A;  4KHA A;  2COC A;  2RSG A;  1WJM A;  5C79 A;  3SUZ A;  1MK9 B;  1AQC A;  1MIX A;  2NMB A;  1H10 A;  3KZ1 A;  3TVV A;  1WG7 A;  2X18 A;  3WYF B;  2UVM A;  1UNQ A;  3V5W A;  2EMS A;  1MPH A;  2DX1 A;  1UNR A;  4ZRJ A;  4D0N B;  3QWM A;  2I1J A;  1W1H A;  4EMO A;  3PZD A;  4DX9 0;  4CHJ A;  4EKU A;  5DHA B;  1V89 A;  3ZVR A;  4KVG B;  1FHO A;  1MKE A;  1GC7 A;  2DLW A;  3PSC A;  1TJ6 A;  2LG1 A;  1FAO A;  1ZM0 A;  5HE1 A;  1FHW A;  1KZG A;  3ODX A;  1ZVR A;  3CXB B;  2Y7B A;  1IRS A;  4HDO A;  1UNP A;  1LW3 A;  2VKI A;  3TCA A;  3X23 A;  2DX5 A;  2M14 A;  2YS1 A;  3GYO A;  4GMX B;  3MDB C;  2MKR A;  3KY9 A;  5LOP B;  1DDM A;  1P5T A;  4PNK A;  4C0A A;  5JLJ B;  3PP2 A;  2D9W A;  2CAY A;  1Z87 A;  3KRX A;  1I7A A;  5D3W A;  3UZT A;  1UPR A;  1SGH A;  3KSY A;  4PQ0 A;  2I5C A;  2J0K A;  1LB1 A;  1Q67 A;  5HE2 A;  3AU5 A;  2EMT A;  2CY4 A;  4HB3 B;  5JP4 A;  1NTY A;  2YRY A;  3ODO A;  1XKE A;  2IFS A;  4MY6 A;  3VIA A;  1BWN A;  5C5B B;  2K2U A;  2RUK B;  2MWN B;  1PFJ A;  2DKQ A;  1FHX A;  2K00 A;  4K2P A;  1N3H A;  3O96 A;  1EF1 A;  4K2O A;  3OAN A;  2AEH A;  2LOX A;  1PLS A;  4XWX A;  3KRW A;  1WJ1 A;  3T06 A;  1AWE A;  3PVU A;  2GCJ A;  2J0J A;  2DHI A;  2D4Q A;  2MDX A;  1MK7 B;  3U8Z A;  4BBK A;  1DBH A;  5L81 A;  2L2I A;  1UPQ A;  2KUP A;  4A6H A;  1P3R A;  2N23 A;  2M38 A;  1ZSQ A;  1U5G A;  3WA0 A;  4CYE A;  2GJY A;  2RGN B;  2I1K A;  4NY0 A;  4Z2M B;  1J19 A;  4HAW B;  3CIK A;  1PMS A;  3D8E A;  2V76 A;  4DX8 A;  2OTX A;  4Z2N A;  5D3X A;  1OY2 A;  1Y19 B;  1V5U A;  2XQN M;  4HAY B;  2IYB A;  1GG3 A;  1WGU A;  2VRW B;  2COF A;  3F5R A;  2JP2 A;  1X05 A;  1EAZ A;  2DKP A;  3DXC A;  5J3Y A;  4CHM A;  4GZU A;  1U29 A;  1V88 A;  2DHK A;  3ML4 A;  5J3T A;  4GMV A;  1QQG A;  4KAX B;  1E5W A;  4HAU B;  2H7D A;  1KZ7 A;  2LOZ A;  4WVF B;  1SHC A;  2D9V A;  2OQB A;  2DA0 A;  2HTH B;  2J0M A;  1BAK A;  3VOQ A;  2ZPY A;  1NTV A;  3BJI A;  3TW1 A;  1K5D B;  1X11 A;  4IFS A;  2LYD A;  3AJ4 A;  2COA A;  5C6R A;  3QIJ A;  3FEH A;  4A5K A;  1UEF A;  1GC6 A;  5KQ4 A;  3RCP A;  2D10 A;  4HB2 B;  2QKM A;  1U27 A;  1EGX A;  3A98 B;  1U2B A;  4NSW A;  2DN6 A;  3M1I B;  2UZR A;  2VSZ A;  4EJN A;  2DYN A;  3GYP A;  4A6F A;  5D3V A;  5CLL B;  3HQC A;  5HE0 A;  1Y5O A;  4ZRI A;  2H7E A;  3PG7 A;  4IOY X;  2DHJ A;  1W1D A;  4TKN A;  1M7E A;  5C16 A;  4HAV B;  3BIN A;  1WI1 A;  2EC1 A;  2Y8G A;  4KHO A;  2GS0 A;  2UZS A;  4KHB B;  2I5F A;  1J0W A;  4F7H A;  1U5F A;  2RNR B;  1H4R A;  1M7R A;  1V5P A;  2D11 A;  3DXD A;  1NU2 A;  1OQN A;  1FGZ A;  4GPT B;  3IVF A;  2P0D A;  5GOW B;  1ISN A;  2DYQ A;  3SNH A;  1FB8 A;  2YF0 A;  1EVH A;  1V5M A;  2P8V A;  1WGQ A;  4A6K A;  2NZ8 B;  1XCG A;  1NI2 A;  2PZ1 A;  5C5B A;  1U5E A;  2YS5 A;  3DXE A;  4WSF A;  4IAP A;  5FI0 A;  2Q13 A;  3A8Q A;  2E2X A;  2AL6 A;  5DIF B;  1OMW A;  2G35 A;  1QC6 A;  4WJ7 A;  5CLQ B;  1B55 A;  5KQ1 A;  2R09 A;  2ROV A;  1XR0 B;  3ULB A;  2P0H A;  2LKO A;  4P7I A;  1TXD A;  3ZDT A;  2W2X C;  4B6H A;  3A8P A;  3QBV B;  2W2X D;  2MFQ A;  5J3Q A;  4MT7 A;  2CY5 A;  1RRP B;  2GCL A;  5DI9 B;  2Z0Q A;  1BTN A;  3MPX A;  4HAX B;  1MIZ B;  2RLO A;  1XX0 A;  5HE3 A;  1TQZ A;  2ELB A;  3ULC A;  3PVL A;  2DTC A;  2YT1 A; 
#chains in the Genus database with same CATH topology
 2DFK A;  3AU4 A;  3TO1 A;  2BCJ A;  1X1F A;  4A6F B;  1DYN A;  1X86 A;  1U5D A;  2R0D A;  4KHB A;  2HE7 A;  1DDV A;  3P6A A;  1V61 A;  1RJ2 A;  1FGY A;  4GN1 A;  1MAI A;  2YVC A;  2Y8F A;  1ZC3 B;  2FJL A;  3FM8 C;  4HDQ A;  3NSU A;  2KIG A;  5DHF B;  2YT2 A;  4H8S A;  1T77 A;  1P6S A;  2Z0P A;  2YSZ A;  2D9X A;  5EFX A;  2KUQ A;  3FSS A;  4YON A;  1DDW A;  1ZC4 B;  4Y94 A;  3SYX A;  3TFM A;  2Z0O A;  3SO6 A;  2K2J A;  2KCJ A;  1KI1 B;  2N0Y A;  4TYZ A;  1XOD A;  2D9Y A;  2YS3 A;  4YL8 A;  2CRF A;  3LJU X;  1XD4 A;  4DBB A;  4ZRK A;  2P0F A;  1BTK A;  2ADZ A;  3F0W A;  2LUL A;  2L1C A;  3U7D A;  3PVW A;  1W1G A;  2D2Q A;  3HIE A;  2RVB B;  4DXA B;  5JHG A;  4MK0 A;  5D27 A;  4HB4 B;  1DRO A;  2ROZ B;  3NWA A;  3HK0 A;  3P7Z A;  3SV1 A;  1FOE A;  1WVH A;  4GOU A;  2W2W A;  3N7C A;  4GXB A;  2D9Z A;  4HAT B;  2Z14 A;  4HAZ B;  1X1G A;  2J59 M;  3D8F A;  3PEG A;  4K17 A;  2QKL A;  1K5G B;  4HHV A;  4F7G A;  4F7U P;  2COD A;  5D3Y A;  3ODW A;  5DH9 B;  2Z13 A;  3A58 A;  4K81 A;  5KCV A;  4HB0 B;  3HW2 B;  3G9W A;  5IRS A;  4L6E A;  5LON B;  5JHH A;  2EJ8 A;  5FI1 A;  1I2H A;  3NW8 A;  2KGX B;  3D8D A;  2YT0 A;  2ELA A;  4KHA A;  2COC A;  2RSG A;  1WJM A;  5C79 A;  3SUZ A;  1MK9 B;  1AQC A;  1MIX A;  2NMB A;  1H10 A;  3KZ1 A;  3TVV A;  1WG7 A;  2X18 A;  3WYF B;  2UVM A;  4HSI A;  1UNQ A;  3V5W A;  2EMS A;  4QJ5 B;  1MPH A;  2DX1 A;  1UNR A;  4ZRJ A;  4D0N B;  3QWM A;  2I1J A;  1W1H A;  4EMO A;  3PZD A;  4DX9 0;  4CHJ A;  4EKU A;  5DHA B;  1V89 A;  3ZVR A;  2ZKM X;  4KVG B;  1FHO A;  1MKE A;  1GC7 A;  2DLW A;  3PSC A;  1TJ6 A;  2LG1 A;  1FAO A;  1ZM0 A;  5HE1 A;  1FHW A;  1KZG A;  3ODX A;  1ZVR A;  3CXB B;  2Y7B A;  1IRS A;  4HDO A;  1UNP A;  1LW3 A;  2VKI A;  3TCA A;  3X23 A;  2NBV A;  2DX5 A;  2M14 A;  2YS1 A;  3GYO A;  4GMX B;  3MDB C;  2MKR A;  3KY9 A;  4L1R A;  5LOP B;  1DDM A;  1P5T A;  4PNK A;  4C0A A;  5JLJ B;  3PP2 A;  2D9W A;  2GUM A;  2CAY A;  1Z87 A;  3KRX A;  1I7A A;  5D3W A;  3UZT A;  1UPR A;  4DIX A;  1SGH A;  3KSY A;  4PQ0 A;  2I5C A;  2J0K A;  1LB1 A;  1Q67 A;  5HE2 A;  3AU5 A;  2EMT A;  2CY4 A;  4HB3 B;  5JP4 A;  1NTY A;  2YRY A;  3ODO A;  2KR0 A;  1XKE A;  4QXA B;  2IFS A;  4MY6 A;  3VIA A;  1BWN A;  5C5B B;  2K2U A;  2RUK B;  2MWN B;  1PFJ A;  2DKQ A;  1FHX A;  2K00 A;  3O96 A;  1N3H A;  4K2P A;  1EF1 A;  4K2O A;  3OAN A;  2AEH A;  2LOX A;  1PLS A;  3B77 A;  4XWX A;  3KRW A;  5M4Y B;  1WJ1 A;  2KIE A;  3T06 A;  1AWE A;  3PVU A;  2GCJ A;  2J0J A;  2DHI A;  2D4Q A;  2MDX A;  1MK7 B;  3U8Z A;  4BBK A;  4OT1 A;  1DBH A;  5L81 A;  2L2I A;  1UPQ A;  2KUP A;  4A6H A;  1P3R A;  2N23 A;  2M38 A;  3NWD A;  1ZSQ A;  1U5G A;  3WA0 A;  4CYE A;  2GJY A;  2K49 A;  2RGN B;  2I1K A;  4NY0 A;  4Z2M B;  1J19 A;  4HAW B;  3CIK A;  1PMS A;  3D8E A;  2V76 A;  4DX8 A;  2OTX A;  4Z2N A;  5D3X A;  1OY2 A;  2Z59 A;  1Y19 B;  1V5U A;  2XQN M;  4HAY B;  2IYB A;  1GG3 A;  1WGU A;  2VRW B;  2COF A;  3F5R A;  2JP2 A;  1X05 A;  1EAZ A;  4CSQ A;  2DKP A;  3DXC A;  5J3Y A;  4CHM A;  4GZU A;  1U29 A;  5I2M A;  1V88 A;  2DHK A;  3ML4 A;  5J3T A;  4GMV A;  1QQG A;  1E5W A;  4HAU B;  4KAX B;  2H7D A;  1KZ7 A;  2LOZ A;  4WVF B;  1SHC A;  2D9V A;  2OQB A;  2DA0 A;  2HTH B;  2J0M A;  1BAK A;  3VOQ A;  2ZPY A;  1NTV A;  3BJI A;  3TW1 A;  1K5D B;  1X11 A;  4IFS A;  5LG4 B;  2LYD A;  3AJ4 A;  2COA A;  5C6R A;  3QIJ A;  3U12 A;  3FEH A;  4A5K A;  1UEF A;  3OHM B;  4QJ3 B;  3DCX A;  1GC6 A;  5KQ4 A;  3RCP A;  2K8E A;  2D10 A;  4HB2 B;  2QKM A;  1U27 A;  1EGX A;  3A98 B;  1U2B A;  4NSW A;  2DN6 A;  3M1I B;  2UZR A;  2VSZ A;  4EJN A;  4QJ4 B;  2DYN A;  3GYP A;  4A6F A;  5D3V A;  5CLL B;  3HQC A;  5HE0 A;  3HSA A;  1Y5O A;  4GNK B;  4ZRI A;  2H7E A;  3PG7 A;  3FVC A;  4IOY X;  2DHJ A;  1W1D A;  4TKN A;  1MI1 A;  1M7E A;  5C16 A;  4HAV B;  3BIN A;  1WI1 A;  2EC1 A;  2Y8G A;  4KHO A;  2GS0 A;  2UZS A;  4KHB B;  2I5F A;  1J0W A;  4F7H A;  1U5F A;  2RNR B;  3NWF A;  1H4R A;  1M7R A;  1V5P A;  2D11 A;  2RRF A;  3DXD A;  1NU2 A;  1OQN A;  1FGZ A;  4GPT B;  3IVF A;  2P0D A;  2FJU B;  5GOW B;  1ISN A;  2DYQ A;  3SNH A;  1FB8 A;  4D6W A;  2YF0 A;  1EVH A;  5I2S A;  1V5M A;  2P8V A;  1WGQ A;  4A6K A;  2NZ8 B;  1XCG A;  1NI2 A;  2PZ1 A;  2Z4D A;  5C5B A;  1U5E A;  2YS5 A;  3DXE A;  4WSF A;  4IAP A;  5FI0 A;  2Q13 A;  1ZYI A;  3A8Q A;  2E2X A;  2AL6 A;  5DIF B;  1OMW A;  2G35 A;  1QC6 A;  4WJ7 A;  5CLQ B;  1B55 A;  5KQ1 A;  2R09 A;  2ROV A;  1XR0 B;  3ULB A;  2P0H A;  2LKO A;  4P7I A;  1TXD A;  3ZDT A;  2W2X C;  4B6H A;  4OSN A;  3A8P A;  3QBV B;  2W2X D;  2MFQ A;  5J3Q A;  4MT7 A;  2CY5 A;  1RRP B;  2GCL A;  5DI9 B;  2Z0Q A;  1BTN A;  3MPX A;  1MIZ B;  4HAX B;  2RLO A;  1XX0 A;  5HE3 A;  1TQZ A;  2ELB A;  2R2Y A;  3ULC A;  3PVL A;  2DTC A;  2YT1 A; 
#chains in the Genus database with same CATH homology
 2DFK A;  3AU4 A;  3TO1 A;  2BCJ A;  1X1F A;  4A6F B;  1DYN A;  1X86 A;  1U5D A;  2R0D A;  2HE7 A;  1DDV A;  3P6A A;  1V61 A;  1RJ2 A;  1FGY A;  4GN1 A;  1MAI A;  2YVC A;  2Y8F A;  1ZC3 B;  2FJL A;  3FM8 C;  4HDQ A;  3NSU A;  5DHF B;  4H8S A;  1P6S A;  2Z0P A;  2YSZ A;  2D9X A;  5EFX A;  3FSS A;  4YON A;  1DDW A;  1ZC4 B;  4Y94 A;  3SYX A;  3TFM A;  2Z0O A;  3SO6 A;  2K2J A;  2KCJ A;  1KI1 B;  2N0Y A;  4TYZ A;  1XOD A;  2D9Y A;  2YS3 A;  4YL8 A;  2CRF A;  3LJU X;  1XD4 A;  4DBB A;  4ZRK A;  2P0F A;  1BTK A;  2ADZ A;  3F0W A;  2LUL A;  2L1C A;  3U7D A;  3PVW A;  1W1G A;  2D2Q A;  2RVB B;  4DXA B;  5JHG A;  4MK0 A;  5D27 A;  4HB4 B;  1DRO A;  2ROZ B;  3HK0 A;  3P7Z A;  3SV1 A;  1FOE A;  1WVH A;  2W2W A;  3N7C A;  4GXB A;  2D9Z A;  4HAT B;  4HAZ B;  1X1G A;  2J59 M;  3D8F A;  3PEG A;  4K17 A;  2QKL A;  1K5G B;  4HHV A;  4F7G A;  4F7U P;  2COD A;  5D3Y A;  3ODW A;  5DH9 B;  4K81 A;  5KCV A;  4HB0 B;  3HW2 B;  3G9W A;  4L6E A;  5LON B;  5JHH A;  2EJ8 A;  5FI1 A;  1I2H A;  2KGX B;  3D8D A;  2YT0 A;  2ELA A;  4KHA A;  2COC A;  2RSG A;  1WJM A;  5C79 A;  3SUZ A;  1MK9 B;  1AQC A;  1MIX A;  2NMB A;  1H10 A;  3KZ1 A;  3TVV A;  1WG7 A;  2X18 A;  3WYF B;  2UVM A;  1UNQ A;  3V5W A;  2EMS A;  1MPH A;  2DX1 A;  1UNR A;  4ZRJ A;  4D0N B;  3QWM A;  2I1J A;  1W1H A;  4EMO A;  3PZD A;  4DX9 0;  4CHJ A;  4EKU A;  5DHA B;  1V89 A;  3ZVR A;  4KVG B;  1FHO A;  1MKE A;  1GC7 A;  2DLW A;  3PSC A;  1TJ6 A;  2LG1 A;  1FAO A;  1ZM0 A;  5HE1 A;  1FHW A;  1KZG A;  3ODX A;  1ZVR A;  3CXB B;  2Y7B A;  1IRS A;  4HDO A;  1UNP A;  1LW3 A;  2VKI A;  3TCA A;  3X23 A;  2DX5 A;  2M14 A;  2YS1 A;  3GYO A;  4GMX B;  3MDB C;  2MKR A;  3KY9 A;  5LOP B;  1DDM A;  1P5T A;  4PNK A;  4C0A A;  5JLJ B;  3PP2 A;  2D9W A;  2CAY A;  1Z87 A;  3KRX A;  1I7A A;  5D3W A;  3UZT A;  1UPR A;  1SGH A;  3KSY A;  4PQ0 A;  2I5C A;  2J0K A;  1LB1 A;  1Q67 A;  5HE2 A;  3AU5 A;  2EMT A;  2CY4 A;  4HB3 B;  5JP4 A;  1NTY A;  2YRY A;  3ODO A;  1XKE A;  2IFS A;  4MY6 A;  3VIA A;  1BWN A;  5C5B B;  2K2U A;  2RUK B;  2MWN B;  1PFJ A;  2DKQ A;  1FHX A;  2K00 A;  4K2P A;  1N3H A;  3O96 A;  1EF1 A;  4K2O A;  3OAN A;  2AEH A;  2LOX A;  1PLS A;  4XWX A;  3KRW A;  1WJ1 A;  3T06 A;  1AWE A;  3PVU A;  2GCJ A;  2J0J A;  2DHI A;  2D4Q A;  2MDX A;  1MK7 B;  3U8Z A;  4BBK A;  1DBH A;  5L81 A;  2L2I A;  1UPQ A;  2KUP A;  4A6H A;  1P3R A;  2N23 A;  2M38 A;  1ZSQ A;  1U5G A;  3WA0 A;  4CYE A;  2GJY A;  2RGN B;  2I1K A;  4NY0 A;  4Z2M B;  1J19 A;  4HAW B;  3CIK A;  1PMS A;  3D8E A;  2V76 A;  4DX8 A;  2OTX A;  4Z2N A;  5D3X A;  1OY2 A;  1Y19 B;  1V5U A;  2XQN M;  4HAY B;  2IYB A;  1GG3 A;  1WGU A;  2VRW B;  2COF A;  3F5R A;  2JP2 A;  1X05 A;  1EAZ A;  2DKP A;  3DXC A;  5J3Y A;  4CHM A;  4GZU A;  1U29 A;  1V88 A;  2DHK A;  3ML4 A;  5J3T A;  4GMV A;  1QQG A;  4KAX B;  1E5W A;  4HAU B;  2H7D A;  1KZ7 A;  2LOZ A;  4WVF B;  1SHC A;  2D9V A;  2OQB A;  2DA0 A;  2HTH B;  2J0M A;  1BAK A;  3VOQ A;  2ZPY A;  1NTV A;  3BJI A;  3TW1 A;  1K5D B;  1X11 A;  4IFS A;  2LYD A;  3AJ4 A;  2COA A;  5C6R A;  3QIJ A;  3FEH A;  4A5K A;  1UEF A;  1GC6 A;  5KQ4 A;  3RCP A;  2D10 A;  4HB2 B;  2QKM A;  1U27 A;  1EGX A;  3A98 B;  1U2B A;  4NSW A;  2DN6 A;  3M1I B;  2UZR A;  2VSZ A;  4EJN A;  2DYN A;  3GYP A;  4A6F A;  5D3V A;  5CLL B;  3HQC A;  5HE0 A;  1Y5O A;  4ZRI A;  2H7E A;  3PG7 A;  4IOY X;  2DHJ A;  1W1D A;  4TKN A;  1M7E A;  5C16 A;  4HAV B;  3BIN A;  1WI1 A;  2EC1 A;  2Y8G A;  4KHO A;  2GS0 A;  2UZS A;  4KHB B;  2I5F A;  1J0W A;  4F7H A;  1U5F A;  2RNR B;  1H4R A;  1M7R A;  1V5P A;  2D11 A;  3DXD A;  1NU2 A;  1OQN A;  1FGZ A;  4GPT B;  3IVF A;  2P0D A;  5GOW B;  1ISN A;  2DYQ A;  3SNH A;  1FB8 A;  2YF0 A;  1EVH A;  1V5M A;  2P8V A;  1WGQ A;  4A6K A;  2NZ8 B;  1XCG A;  1NI2 A;  2PZ1 A;  5C5B A;  1U5E A;  2YS5 A;  3DXE A;  4WSF A;  4IAP A;  5FI0 A;  2Q13 A;  3A8Q A;  2E2X A;  2AL6 A;  5DIF B;  1OMW A;  2G35 A;  1QC6 A;  4WJ7 A;  5CLQ B;  1B55 A;  5KQ1 A;  2R09 A;  2ROV A;  1XR0 B;  3ULB A;  2P0H A;  2LKO A;  4P7I A;  1TXD A;  3ZDT A;  2W2X C;  4B6H A;  3A8P A;  3QBV B;  2W2X D;  2MFQ A;  5J3Q A;  4MT7 A;  2CY5 A;  1RRP B;  2GCL A;  5DI9 B;  2Z0Q A;  1BTN A;  3MPX A;  4HAX B;  1MIZ B;  2RLO A;  1XX0 A;  5HE3 A;  1TQZ A;  2ELB A;  3ULC A;  3PVL A;  2DTC A;  2YT1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...