2EJ8A

Crystal structure of appl1 ptb domain at 1.8a
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
139
structure length
133
Chain Sequence
ETEDSILHQLFIVRFLGSMEVKSDDHPDVVYETMRQILAARAIHNIFRMTESHLLVTCDCLKLIDPQTQVTRLTFPLPCVVLYATHQENKRLFGFVLRTSSLSSVCYIFESNNEGEKICDSVGLAKQIALHAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DCC-interacting protein 13 alpha
publication title Crystal structure of APPL1 PTB domain at 1.8A
rcsb
source organism Homo sapiens
molecule tags Structural genomics, unknown function
total genus 35
structure length 133
sequence length 139
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-03-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00640 PID Phosphotyrosine interaction domain (PTB/PID)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2ej8A00
2P0DA 3PG7A 4ZRIA 2ELAA 1BWNA 2YVCA 2DKQA 3SUZA 2OQBA 2I1JA 1Y5OA 4HAUB 3V5WA 4A6HA 1ISNA 1MAIA 4WSFA 1PMSA 4K2OA 1X1FA 3WYFB 5C16A 2ZPYA 1E5WA 2ROZB 1TQZA 5KCVA 5EFXA 5D3WA 2K00A 4HAYB 2D10A 5L81A 2RSGA 3FM8C 2Y8GA 1ZVRA 2Q13A 2UVMA 1W1HA 1FHXA 1EVHA 3QIJA 2GCLA 2VKIA 3ZDTA 3CXBB 1TXDA 2DHJA 3ML4A 4K81A 2DFKA 4Z2MB 1X86A 2DX5A 3IVFA 4B6HA 2R09A 2LG1A 2D4QA 1P6SA 4KHAA 4HB0B 1XR0B 4HDQA 1WGQA 1XKEA 2DHIA 4DXAB 2HE7A 4TKNA 4WVFB 2DYQA 3QWMA 1I2HA 3N7CA 4MT7A 1K5DB 5J3QA 1M7RA 5C5BB 1H10A 3PEGA 1U27A 1AQCA 5D3VA 1N3HA 1V88A 2AEHA 4NY0A 3P6AA 3TVVA 2ROVA 2UZSA 1MK9B 5DHFB 1P3RA 4Y94A 2G35A 3PSCA 4HAWB 5HE3A 2LYDA 5JLJB 4GPTB 1Y19B 2UZRA 1OY2A 1UNRA 2DTCA 2GJYA 2Y8FA 1Z87A 5C6RA 3ODXA 2AL6A 3D8DA 3F5RA 3BINA 1DBHA 3KRWA 1KI1B 1OMWA 1J0WA 4DX90 2X18A 5CLLB 1GC6A 4CHJA 5DH9B 2KGXB 4EKUA 2GS0A 1NTYA 1DROA 3M1IB 1BTKA 2CY5A 2Z0OA 3PVWA 2DLWA 1XX0A 1QQGA 1K5GB 5KQ1A 4HAXB 5DIFB 2P8VA 1DYNA 3LJUX 1LB1A 1UNPA 1FHWA 4H8SA 2GCJA 3PVLA 3SYXA 1FGZA 2CRFA 3T06A 2EJ8A 2D9ZA 4GN1A 3OANA 2R0DA 5DHAB 1I7AA 2H7DA 1RRPB 2CAYA 1MKEA 5C79A 3U7DA 1RJ2A 3AU5A 4F7HA 3GYPA 2YT1A 2RGNB 3TFMA 5HE2A 2J0MA 4DX8A 2I5CA 2IYBA 1UPQA 1EGXA 2MWNB 3ULCA 1J19A 1BAKA 4A6FB 1XD4A 4IAPA 3NSUA 2YRYA 3VIAA 4YL8A 4KVGB 1QC6A 3D8EA 4BBKA 2NMBA 4GXBA 4IOYX 3VOQA 1SHCA 1V5UA 5J3TA 4IFSA 1WG7A 2W2WA 3RCPA 4CYEA 1U5EA 2HTHB 1DDVA 4K2PA 4P7IA 2V76A 2K2UA 5JP4A 5JHHA 2VRWB 3SV1A 2FJLA 1MIZB 3A8QA 2LULA 1B55A 2D2QA 1GC7A 2KCJA 3X23A 3PP2A 2DX1A 2MFQA 2LOZA 5LONB 1EAZA 2D11A 2BCJA 2J59M 1H4RA 2EMTA 3ODOA 4L6EA 1KZ7A 2QKLA 5FI0A 2IFSA 2I5FA 3TW1A 3A98B 2QKMA 2L2IA 3CIKA 3ZVRA 3FSSA 3QBVB 3BJIA 5HE0A 5FI1A 2KUPA 1U2BA 2H7EA 3GYOA 5D3YA 2DHKA 5LOPB 4HB2B 3SO6A 1WJMA 3TCAA 2I1KA 3U8ZA 2DA0A 2Y7BA 1BTNA 1NU2A 3KSYA 1TJ6A 2D9WA 4HAVB 2YS1A 2DKPA 1MPHA 5J3YA 4CHMA 3KZ1A 3A8PA 4EJNA 2RVBB 2EC1A 4MY6A 4EMOA 2LOXA 2COCA 1ZSQA 1W1DA 4HDOA 4NSWA 4C0AA 5C5BA 2J0JA 2J0KA 1KZGA 3UZTA 4WJ7A 1W1GA 4MK0A 1ZC3B 2P0FA 1FOEA 5KQ4A 4XWXA 1PFJA 1V61A 1ZC4B 4HATB 1MK7B 3KRXA 1X05A 2P0HA 3O96A 4KHOA 3KY9A 2YF0A 3WA0A 2N0YA 2JP2A 1NI2A 1U5DA 1V89A 1FHOA 4D0NB 1X1GA 1SGHA 1V5MA 3ODWA 1LW3A 2Z0QA 1Q67A 2D9XA 5CLQB 2LKOA 1XCGA 2CY4A 3G9WA 4PQ0A 4HHVA 2CODA 2COFA 3SNHA 3TO1A 1AWEA 3PZDA 2RNRB 2N23A 2XQNM 5GOWB 2ELBA 2W2XD 2DN6A 1WJ1A 2D9VA 1OQNA 2L1CA 4HB3B 1P5TA 1ZM0A 1FB8A 1DDWA 2RUKB 2D9YA 2OTXA 3AJ4A 1U5GA 2K2JA 2MKRA 1U5FA 2Z0PA 2YS5A 1U29A 2YT0A 4ZRKA 1UPRA 2VSZA 2M38A 3HW2B 4GMXB 5JHGA 2RLOA 4K17A 2YSZA 2E2XA 1V5PA 3DXCA 4F7GA 1WGUA 2EMSA 3HQCA 3DXDA 4HAZB 2PZ1A 2W2XC 1EF1A 2MDXA 2COAA 3MPXA 3DXEA 4F7UP 4KAXB 3ULBA 5HE1A 2ADZA 2NZ8B 1PLSA 3HK0A 2YS3A 1M7EA 1X11A 1MIXA 3FEHA 3D8FA 3F0WA 1DDMA 1WVHA 4A6FA 4DBBA 4GZUA 4YONA 1UEFA 1IRSA 3AU4A 5DI9B 4GMVA 1FGYA 4TYZA 4HB4B 1FAOA 4PNKA 4A6KA 5D27A 3PVUA 1XODA 4A5KA 2M14A 2DYNA 1WI1A 4Z2NA 3MDBC 4ZRJA 1GG3A 5D3XA 3P7ZA 1NTVA 1UNQA 4KHBB
chains in the Genus database with same CATH superfamily
2P0DA 3PG7A 4ZRIA 2ELAA 1BWNA 2YVCA 2DKQA 3SUZA 2OQBA 2I1JA 1Y5OA 4HAUB 3V5WA 4A6HA 1ISNA 1MAIA 4WSFA 1PMSA 2KR0A 4K2OA 1X1FA 3WYFB 5C16A 2ZPYA 1E5WA 2ROZB 1TQZA 5KCVA 5EFXA 5D3WA 2K00A 4HAYB 2D10A 5L81A 2RSGA 3FM8C 2Y8GA 1ZVRA 2Q13A 2UVMA 1W1HA 4OSNA 1FHXA 1EVHA 3QIJA 2GCLA 5I2MA 2VKIA 3ZDTA 3CXBB 2Z59A 1TXDA 2DHJA 3ML4A 4K81A 2DFKA 4Z2MB 1X86A 2DX5A 3IVFA 4B6HA 2R09A 2LG1A 2D4QA 1P6SA 4KHAA 4HB0B 1XR0B 4HDQA 1WGQA 1XKEA 2RRFA 2DHIA 4DXAB 2HE7A 2FJUB 4QJ4B 4TKNA 4WVFB 2DYQA 3QWMA 2K8EA 1I2HA 3N7CA 3HSAA 4MT7A 1K5DB 5J3QA 1M7RA 5C5BB 1H10A 3PEGA 1U27A 1AQCA 5D3VA 1N3HA 1V88A 2AEHA 4NY0A 3P6AA 3TVVA 2ROVA 2UZSA 1MK9B 5DHFB 1P3RA 4Y94A 2G35A 3PSCA 4HAWB 5HE3A 2LYDA 5JLJB 4GPTB 1Y19B 2UZRA 2K49A 1OY2A 4L1RA 1UNRA 3DCXA 2DTCA 3FVCA 2GJYA 2Y8FA 1Z87A 2R2YA 5C6RA 3ODXA 2AL6A 3D8DA 3F5RA 3BINA 1DBHA 3KRWA 1KI1B 1OMWA 1J0WA 4DX90 2X18A 5CLLB 1GC6A 4CHJA 5DH9B 2KGXB 4EKUA 2GS0A 1NTYA 1DROA 3M1IB 1BTKA 2CY5A 2Z0OA 4GOUA 3PVWA 2DLWA 1XX0A 1QQGA 1K5GB 5KQ1A 4HAXB 5DIFB 2P8VA 1DYNA 3LJUX 1LB1A 4D6WA 1UNPA 3NWAA 1FHWA 4H8SA 2GCJA 3PVLA 3SYXA 1FGZA 2CRFA 3T06A 3A58A 2EJ8A 2D9ZA 4GN1A 3OANA 2R0DA 5DHAB 4HSIA 1I7AA 2H7DA 3B77A 4QJ5B 1RRPB 2CAYA 1MKEA 5C79A 3U7DA 1RJ2A 3AU5A 4F7HA 3GYPA 2YT1A 2RGNB 3TFMA 5HE2A 1MI1A 4GNKB 2J0MA 4DX8A 2I5CA 2IYBA 1UPQA 1EGXA 2MWNB 3ULCA 1J19A 1BAKA 4A6FB 1XD4A 4IAPA 3HIEA 3NSUA 2YRYA 3VIAA 4KHBA 4YL8A 4KVGB 1QC6A 2Z4DA 3D8EA 4BBKA 2NMBA 4GXBA 3U12A 4IOYX 3VOQA 1SHCA 1V5UA 5J3TA 4IFSA 1WG7A 2W2WA 3RCPA 5I2SA 4CYEA 1U5EA 2HTHB 1DDVA 4K2PA 4P7IA 2V76A 2K2UA 5JP4A 5JHHA 2VRWB 3SV1A 2FJLA 1MIZB 3A8QA 2LULA 1B55A 2D2QA 1GC7A 2KCJA 3X23A 3PP2A 2DX1A 2MFQA 2LOZA 5LONB 1EAZA 2D11A 2BCJA 1ZYIA 2J59M 1H4RA 2EMTA 3ODOA 4L6EA 1KZ7A 2QKLA 5FI0A 2Z13A 2IFSA 2I5FA 3TW1A 3A98B 2QKMA 2L2IA 3CIKA 3ZVRA 3FSSA 3QBVB 3BJIA 5HE0A 5FI1A 2KUPA 1U2BA 2H7EA 3GYOA 5D3YA 2DHKA 4DIXA 5LOPB 4HB2B 3SO6A 1WJMA 3TCAA 2I1KA 3U8ZA 2DA0A 2Y7BA 1BTNA 1NU2A 3KSYA 1TJ6A 2D9WA 4HAVB 2YS1A 2DKPA 1MPHA 5J3YA 4CHMA 3KZ1A 3A8PA 4EJNA 2RVBB 2EC1A 4MY6A 4EMOA 2LOXA 2COCA 1ZSQA 1W1DA 4HDOA 4NSWA 4C0AA 5C5BA 2J0JA 2J0KA 1KZGA 3UZTA 4WJ7A 1W1GA 4MK0A 1ZC3B 2P0FA 1FOEA 5KQ4A 4QXAB 4XWXA 1PFJA 1V61A 1ZC4B 4HATB 1MK7B 3KRXA 1X05A 2P0HA 3O96A 4KHOA 3KY9A 2YF0A 3WA0A 5LG4B 2N0YA 2KIEA 2JP2A 1NI2A 1U5DA 1V89A 1FHOA 4D0NB 1X1GA 1SGHA 1V5MA 3ODWA 1LW3A 2Z0QA 1Q67A 2D9XA 5CLQB 2LKOA 1XCGA 2CY4A 3G9WA 4PQ0A 4HHVA 2CODA 2COFA 3SNHA 3TO1A 1AWEA 3PZDA 2RNRB 2N23A 2XQNM 5GOWB 2ELBA 2Z14A 2W2XD 2DN6A 1WJ1A 2D9VA 1OQNA 2L1CA 4HB3B 1P5TA 1ZM0A 1FB8A 3NWFA 1DDWA 2RUKB 2D9YA 2OTXA 3AJ4A 1U5GA 2K2JA 2MKRA 1U5FA 2Z0PA 2YS5A 1U29A 2YT0A 4ZRKA 1UPRA 2VSZA 2M38A 3HW2B 4GMXB 5JHGA 2RLOA 4K17A 2YSZA 1T77A 2E2XA 1V5PA 3DXCA 4F7GA 1WGUA 2EMSA 3HQCA 3DXDA 4HAZB 2PZ1A 2W2XC 1EF1A 2MDXA 2COAA 3MPXA 3DXEA 4F7UP 4KAXB 3ULBA 5HE1A 2ADZA 2NZ8B 1PLSA 3HK0A 2YS3A 1M7EA 1X11A 1MIXA 3FEHA 3D8FA 3F0WA 4QJ3B 1DDMA 1WVHA 4OT1A 4A6FA 4DBBA 4GZUA 2KIGA 3NWDA 3NW8A 4YONA 3OHMB 5M4YB 1UEFA 1IRSA 2YT2A 3AU4A 5DI9B 2ZKMX 4GMVA 1FGYA 4TYZA 4HB4B 1FAOA 4CSQA 4PNKA 4A6KA 5D27A 3PVUA 1XODA 4A5KA 2M14A 2DYNA 1WI1A 4Z2NA 2GUMA 3MDBC 4ZRJA 2NBVA 1GG3A 5D3XA 3P7ZA 1NTVA 5IRSA 1UNQA 2KUQA 4KHBB
chains in the Genus database with same CATH topology
2P0DA 3PG7A 4ZRIA 2ELAA 1BWNA 2YVCA 2DKQA 3SUZA 2OQBA 2I1JA 1Y5OA 4HAUB 3V5WA 4A6HA 1ISNA 1MAIA 4WSFA 1PMSA 4K2OA 1X1FA 3WYFB 5C16A 2ZPYA 1E5WA 2ROZB 1TQZA 5KCVA 5EFXA 5D3WA 2K00A 4HAYB 2D10A 5L81A 2RSGA 3FM8C 2Y8GA 1ZVRA 2Q13A 2UVMA 1W1HA 1FHXA 1EVHA 3QIJA 2GCLA 2VKIA 3ZDTA 3CXBB 1TXDA 2DHJA 3ML4A 4K81A 2DFKA 4Z2MB 1X86A 2DX5A 3IVFA 4B6HA 2R09A 2LG1A 2D4QA 1P6SA 4KHAA 4HB0B 1XR0B 4HDQA 1WGQA 1XKEA 2DHIA 4DXAB 2HE7A 4TKNA 4WVFB 2DYQA 3QWMA 1I2HA 3N7CA 4MT7A 1K5DB 5J3QA 1M7RA 5C5BB 1H10A 3PEGA 1U27A 1AQCA 5D3VA 1N3HA 1V88A 2AEHA 4NY0A 3P6AA 3TVVA 2ROVA 2UZSA 1MK9B 5DHFB 1P3RA 4Y94A 2G35A 3PSCA 4HAWB 5HE3A 2LYDA 5JLJB 4GPTB 1Y19B 2UZRA 1OY2A 1UNRA 2DTCA 2GJYA 2Y8FA 1Z87A 5C6RA 3ODXA 2AL6A 3D8DA 3F5RA 3BINA 1DBHA 3KRWA 1KI1B 1OMWA 1J0WA 4DX90 2X18A 5CLLB 1GC6A 4CHJA 5DH9B 2KGXB 4EKUA 2GS0A 1NTYA 1DROA 3M1IB 1BTKA 2CY5A 2Z0OA 3PVWA 2DLWA 1XX0A 1QQGA 1K5GB 5KQ1A 4HAXB 5DIFB 2P8VA 1DYNA 3LJUX 1LB1A 1UNPA 1FHWA 4H8SA 2GCJA 3PVLA 3SYXA 1FGZA 2CRFA 3T06A 2EJ8A 2D9ZA 4GN1A 3OANA 2R0DA 5DHAB 1I7AA 2H7DA 1RRPB 2CAYA 1MKEA 5C79A 3U7DA 1RJ2A 3AU5A 4F7HA 3GYPA 2YT1A 2RGNB 3TFMA 5HE2A 2J0MA 4DX8A 2I5CA 2IYBA 1UPQA 1EGXA 2MWNB 3ULCA 1J19A 1BAKA 4A6FB 1XD4A 4IAPA 3NSUA 2YRYA 3VIAA 4YL8A 4KVGB 1QC6A 3D8EA 4BBKA 2NMBA 4GXBA 4IOYX 3VOQA 1SHCA 1V5UA 5J3TA 4IFSA 1WG7A 2W2WA 3RCPA 4CYEA 1U5EA 2HTHB 1DDVA 4K2PA 4P7IA 2V76A 2K2UA 5JP4A 5JHHA 2VRWB 3SV1A 2FJLA 1MIZB 3A8QA 2LULA 1B55A 2D2QA 1GC7A 2KCJA 3X23A 3PP2A 2DX1A 2MFQA 2LOZA 5LONB 1EAZA 2D11A 2BCJA 2J59M 1H4RA 2EMTA 3ODOA 4L6EA 1KZ7A 2QKLA 5FI0A 2IFSA 2I5FA 3TW1A 3A98B 2QKMA 2L2IA 3CIKA 3ZVRA 3FSSA 3QBVB 3BJIA 5HE0A 5FI1A 2KUPA 1U2BA 2H7EA 3GYOA 5D3YA 2DHKA 5LOPB 4HB2B 3SO6A 1WJMA 3TCAA 2I1KA 3U8ZA 2DA0A 2Y7BA 1BTNA 1NU2A 3KSYA 1TJ6A 2D9WA 4HAVB 2YS1A 2DKPA 1MPHA 5J3YA 4CHMA 3KZ1A 3A8PA 4EJNA 2RVBB 2EC1A 4MY6A 4EMOA 2LOXA 2COCA 1ZSQA 1W1DA 4HDOA 4NSWA 4C0AA 5C5BA 2J0JA 2J0KA 1KZGA 3UZTA 4WJ7A 1W1GA 4MK0A 1ZC3B 2P0FA 1FOEA 5KQ4A 4XWXA 1PFJA 1V61A 1ZC4B 4HATB 1MK7B 3KRXA 1X05A 2P0HA 3O96A 4KHOA 3KY9A 2YF0A 3WA0A 2N0YA 2JP2A 1NI2A 1U5DA 1V89A 1FHOA 4D0NB 1X1GA 1SGHA 1V5MA 3ODWA 1LW3A 2Z0QA 1Q67A 2D9XA 5CLQB 2LKOA 1XCGA 2CY4A 3G9WA 4PQ0A 4HHVA 2CODA 2COFA 3SNHA 3TO1A 1AWEA 3PZDA 2RNRB 2N23A 2XQNM 5GOWB 2ELBA 2W2XD 2DN6A 1WJ1A 2D9VA 1OQNA 2L1CA 4HB3B 1P5TA 1ZM0A 1FB8A 1DDWA 2RUKB 2D9YA 2OTXA 3AJ4A 1U5GA 2K2JA 2MKRA 1U5FA 2Z0PA 2YS5A 1U29A 2YT0A 4ZRKA 1UPRA 2VSZA 2M38A 3HW2B 4GMXB 5JHGA 2RLOA 4K17A 2YSZA 2E2XA 1V5PA 3DXCA 4F7GA 1WGUA 2EMSA 3HQCA 3DXDA 4HAZB 2PZ1A 2W2XC 1EF1A 2MDXA 2COAA 3MPXA 3DXEA 4F7UP 4KAXB 3ULBA 5HE1A 2ADZA 2NZ8B 1PLSA 3HK0A 2YS3A 1M7EA 1X11A 1MIXA 3FEHA 3D8FA 3F0WA 1DDMA 1WVHA 4A6FA 4DBBA 4GZUA 4YONA 1UEFA 1IRSA 3AU4A 5DI9B 4GMVA 1FGYA 4TYZA 4HB4B 1FAOA 4PNKA 4A6KA 5D27A 3PVUA 1XODA 4A5KA 2M14A 2DYNA 1WI1A 4Z2NA 3MDBC 4ZRJA 1GG3A 5D3XA 3P7ZA 1NTVA 1UNQA 4KHBB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2P0D A;  3PG7 A;  4ZRI A;  2ELA A;  1BWN A;  2YVC A;  2DKQ A;  3SUZ A;  2OQB A;  2I1J A;  1Y5O A;  4HAU B;  3V5W A;  4A6H A;  1ISN A;  1MAI A;  4WSF A;  1PMS A;  4K2O A;  1X1F A;  3WYF B;  5C16 A;  2ZPY A;  1E5W A;  2ROZ B;  1TQZ A;  5KCV A;  5EFX A;  5D3W A;  2K00 A;  4HAY B;  2D10 A;  5L81 A;  2RSG A;  3FM8 C;  2Y8G A;  1ZVR A;  2Q13 A;  2UVM A;  1W1H A;  1FHX A;  1EVH A;  3QIJ A;  2GCL A;  2VKI A;  3ZDT A;  3CXB B;  1TXD A;  2DHJ A;  3ML4 A;  4K81 A;  2DFK A;  4Z2M B;  1X86 A;  2DX5 A;  3IVF A;  4B6H A;  2R09 A;  2LG1 A;  2D4Q A;  1P6S A;  4KHA A;  4HB0 B;  1XR0 B;  4HDQ A;  1WGQ A;  1XKE A;  2DHI A;  4DXA B;  2HE7 A;  4TKN A;  4WVF B;  2DYQ A;  3QWM A;  1I2H A;  3N7C A;  4MT7 A;  1K5D B;  5J3Q A;  1M7R A;  5C5B B;  1H10 A;  3PEG A;  1U27 A;  1AQC A;  5D3V A;  1N3H A;  1V88 A;  2AEH A;  4NY0 A;  3P6A A;  3TVV A;  2ROV A;  2UZS A;  1MK9 B;  5DHF B;  1P3R A;  4Y94 A;  2G35 A;  3PSC A;  4HAW B;  5HE3 A;  2LYD A;  5JLJ B;  4GPT B;  1Y19 B;  2UZR A;  1OY2 A;  1UNR A;  2DTC A;  2GJY A;  2Y8F A;  1Z87 A;  5C6R A;  3ODX A;  2AL6 A;  3D8D A;  3F5R A;  3BIN A;  1DBH A;  3KRW A;  1KI1 B;  1OMW A;  1J0W A;  4DX9 0;  2X18 A;  5CLL B;  1GC6 A;  4CHJ A;  5DH9 B;  2KGX B;  4EKU A;  2GS0 A;  1NTY A;  1DRO A;  3M1I B;  1BTK A;  2CY5 A;  2Z0O A;  3PVW A;  2DLW A;  1XX0 A;  1QQG A;  1K5G B;  5KQ1 A;  4HAX B;  5DIF B;  2P8V A;  1DYN A;  3LJU X;  1LB1 A;  1UNP A;  1FHW A;  4H8S A;  2GCJ A;  3PVL A;  3SYX A;  1FGZ A;  2CRF A;  3T06 A;  2EJ8 A;  2D9Z A;  4GN1 A;  3OAN A;  2R0D A;  5DHA B;  1I7A A;  2H7D A;  1RRP B;  2CAY A;  1MKE A;  5C79 A;  3U7D A;  1RJ2 A;  3AU5 A;  4F7H A;  3GYP A;  2YT1 A;  2RGN B;  3TFM A;  5HE2 A;  2J0M A;  4DX8 A;  2I5C A;  2IYB A;  1UPQ A;  1EGX A;  2MWN B;  3ULC A;  1J19 A;  1BAK A;  4A6F B;  1XD4 A;  4IAP A;  3NSU A;  2YRY A;  3VIA A;  4YL8 A;  4KVG B;  1QC6 A;  3D8E A;  4BBK A;  2NMB A;  4GXB A;  4IOY X;  3VOQ A;  1SHC A;  1V5U A;  5J3T A;  4IFS A;  1WG7 A;  2W2W A;  3RCP A;  4CYE A;  1U5E A;  2HTH B;  1DDV A;  4K2P A;  4P7I A;  2V76 A;  2K2U A;  5JP4 A;  5JHH A;  2VRW B;  3SV1 A;  2FJL A;  1MIZ B;  3A8Q A;  2LUL A;  1B55 A;  2D2Q A;  1GC7 A;  2KCJ A;  3X23 A;  3PP2 A;  2DX1 A;  2MFQ A;  2LOZ A;  5LON B;  1EAZ A;  2D11 A;  2BCJ A;  2J59 M;  1H4R A;  2EMT A;  3ODO A;  4L6E A;  1KZ7 A;  2QKL A;  5FI0 A;  2IFS A;  2I5F A;  3TW1 A;  3A98 B;  2QKM A;  2L2I A;  3CIK A;  3ZVR A;  3FSS A;  3QBV B;  3BJI A;  5HE0 A;  5FI1 A;  2KUP A;  1U2B A;  2H7E A;  3GYO A;  5D3Y A;  2DHK A;  5LOP B;  4HB2 B;  3SO6 A;  1WJM A;  3TCA A;  2I1K A;  3U8Z A;  2DA0 A;  2Y7B A;  1BTN A;  1NU2 A;  3KSY A;  1TJ6 A;  2D9W A;  4HAV B;  2YS1 A;  2DKP A;  1MPH A;  5J3Y A;  4CHM A;  3KZ1 A;  3A8P A;  4EJN A;  2RVB B;  2EC1 A;  4MY6 A;  4EMO A;  2LOX A;  2COC A;  1ZSQ A;  1W1D A;  4HDO A;  4NSW A;  4C0A A;  5C5B A;  2J0J A;  2J0K A;  1KZG A;  3UZT A;  4WJ7 A;  1W1G A;  4MK0 A;  1ZC3 B;  2P0F A;  1FOE A;  5KQ4 A;  4XWX A;  1PFJ A;  1V61 A;  1ZC4 B;  4HAT B;  1MK7 B;  3KRX A;  1X05 A;  2P0H A;  3O96 A;  4KHO A;  3KY9 A;  2YF0 A;  3WA0 A;  2N0Y A;  2JP2 A;  1NI2 A;  1U5D A;  1V89 A;  1FHO A;  4D0N B;  1X1G A;  1SGH A;  1V5M A;  3ODW A;  1LW3 A;  2Z0Q A;  1Q67 A;  2D9X A;  5CLQ B;  2LKO A;  1XCG A;  2CY4 A;  3G9W A;  4PQ0 A;  4HHV A;  2COD A;  2COF A;  3SNH A;  3TO1 A;  1AWE A;  3PZD A;  2RNR B;  2N23 A;  2XQN M;  5GOW B;  2ELB A;  2W2X D;  2DN6 A;  1WJ1 A;  2D9V A;  1OQN A;  2L1C A;  4HB3 B;  1P5T A;  1ZM0 A;  1FB8 A;  1DDW A;  2RUK B;  2D9Y A;  2OTX A;  3AJ4 A;  1U5G A;  2K2J A;  2MKR A;  1U5F A;  2Z0P A;  2YS5 A;  1U29 A;  2YT0 A;  4ZRK A;  1UPR A;  2VSZ A;  2M38 A;  3HW2 B;  4GMX B;  5JHG A;  2RLO A;  4K17 A;  2YSZ A;  2E2X A;  1V5P A;  3DXC A;  4F7G A;  1WGU A;  2EMS A;  3HQC A;  3DXD A;  4HAZ B;  2PZ1 A;  2W2X C;  1EF1 A;  2MDX A;  2COA A;  3MPX A;  3DXE A;  4F7U P;  4KAX B;  3ULB A;  5HE1 A;  2ADZ A;  2NZ8 B;  1PLS A;  3HK0 A;  2YS3 A;  1M7E A;  1X11 A;  1MIX A;  3FEH A;  3D8F A;  3F0W A;  1DDM A;  1WVH A;  4A6F A;  4DBB A;  4GZU A;  4YON A;  1UEF A;  1IRS A;  3AU4 A;  5DI9 B;  4GMV A;  1FGY A;  4TYZ A;  4HB4 B;  1FAO A;  4PNK A;  4A6K A;  5D27 A;  3PVU A;  1XOD A;  4A5K A;  2M14 A;  2DYN A;  1WI1 A;  4Z2N A;  3MDB C;  4ZRJ A;  1GG3 A;  5D3X A;  3P7Z A;  1NTV A;  1UNQ A;  4KHB B; 
#chains in the Genus database with same CATH topology
 2P0D A;  3PG7 A;  4ZRI A;  2ELA A;  1BWN A;  2YVC A;  2DKQ A;  3SUZ A;  2OQB A;  2I1J A;  1Y5O A;  4HAU B;  3V5W A;  4A6H A;  1ISN A;  1MAI A;  4WSF A;  1PMS A;  2KR0 A;  4K2O A;  1X1F A;  3WYF B;  5C16 A;  2ZPY A;  1E5W A;  2ROZ B;  1TQZ A;  5KCV A;  5EFX A;  5D3W A;  2K00 A;  4HAY B;  2D10 A;  5L81 A;  2RSG A;  3FM8 C;  2Y8G A;  1ZVR A;  2Q13 A;  2UVM A;  1W1H A;  4OSN A;  1FHX A;  1EVH A;  3QIJ A;  2GCL A;  5I2M A;  2VKI A;  3ZDT A;  3CXB B;  2Z59 A;  1TXD A;  2DHJ A;  3ML4 A;  4K81 A;  2DFK A;  4Z2M B;  1X86 A;  2DX5 A;  3IVF A;  4B6H A;  2R09 A;  2LG1 A;  2D4Q A;  1P6S A;  4KHA A;  4HB0 B;  1XR0 B;  4HDQ A;  1WGQ A;  1XKE A;  2RRF A;  2DHI A;  4DXA B;  2HE7 A;  2FJU B;  4QJ4 B;  4TKN A;  4WVF B;  2DYQ A;  3QWM A;  2K8E A;  1I2H A;  3N7C A;  3HSA A;  4MT7 A;  1K5D B;  5J3Q A;  1M7R A;  5C5B B;  1H10 A;  3PEG A;  1U27 A;  1AQC A;  5D3V A;  1N3H A;  1V88 A;  2AEH A;  4NY0 A;  3P6A A;  3TVV A;  2ROV A;  2UZS A;  1MK9 B;  5DHF B;  1P3R A;  4Y94 A;  2G35 A;  3PSC A;  4HAW B;  5HE3 A;  2LYD A;  5JLJ B;  4GPT B;  1Y19 B;  2UZR A;  2K49 A;  1OY2 A;  4L1R A;  1UNR A;  3DCX A;  2DTC A;  3FVC A;  2GJY A;  2Y8F A;  1Z87 A;  2R2Y A;  5C6R A;  3ODX A;  2AL6 A;  3D8D A;  3F5R A;  3BIN A;  1DBH A;  3KRW A;  1KI1 B;  1OMW A;  1J0W A;  4DX9 0;  2X18 A;  5CLL B;  1GC6 A;  4CHJ A;  5DH9 B;  2KGX B;  4EKU A;  2GS0 A;  1NTY A;  1DRO A;  3M1I B;  1BTK A;  2CY5 A;  2Z0O A;  4GOU A;  3PVW A;  2DLW A;  1XX0 A;  1QQG A;  1K5G B;  5KQ1 A;  4HAX B;  5DIF B;  2P8V A;  1DYN A;  3LJU X;  1LB1 A;  4D6W A;  1UNP A;  3NWA A;  1FHW A;  4H8S A;  2GCJ A;  3PVL A;  3SYX A;  1FGZ A;  2CRF A;  3T06 A;  3A58 A;  2EJ8 A;  2D9Z A;  4GN1 A;  3OAN A;  2R0D A;  5DHA B;  4HSI A;  1I7A A;  2H7D A;  3B77 A;  4QJ5 B;  1RRP B;  2CAY A;  1MKE A;  5C79 A;  3U7D A;  1RJ2 A;  3AU5 A;  4F7H A;  3GYP A;  2YT1 A;  2RGN B;  3TFM A;  5HE2 A;  1MI1 A;  4GNK B;  2J0M A;  4DX8 A;  2I5C A;  2IYB A;  1UPQ A;  1EGX A;  2MWN B;  3ULC A;  1J19 A;  1BAK A;  4A6F B;  1XD4 A;  4IAP A;  3HIE A;  3NSU A;  2YRY A;  3VIA A;  4KHB A;  4YL8 A;  4KVG B;  1QC6 A;  2Z4D A;  3D8E A;  4BBK A;  2NMB A;  4GXB A;  3U12 A;  4IOY X;  3VOQ A;  1SHC A;  1V5U A;  5J3T A;  4IFS A;  1WG7 A;  2W2W A;  3RCP A;  5I2S A;  4CYE A;  1U5E A;  2HTH B;  1DDV A;  4K2P A;  4P7I A;  2V76 A;  2K2U A;  5JP4 A;  5JHH A;  2VRW B;  3SV1 A;  2FJL A;  1MIZ B;  3A8Q A;  2LUL A;  1B55 A;  2D2Q A;  1GC7 A;  2KCJ A;  3X23 A;  3PP2 A;  2DX1 A;  2MFQ A;  2LOZ A;  5LON B;  1EAZ A;  2D11 A;  2BCJ A;  1ZYI A;  2J59 M;  1H4R A;  2EMT A;  3ODO A;  4L6E A;  1KZ7 A;  2QKL A;  5FI0 A;  2Z13 A;  2IFS A;  2I5F A;  3TW1 A;  3A98 B;  2QKM A;  2L2I A;  3CIK A;  3ZVR A;  3FSS A;  3QBV B;  3BJI A;  5HE0 A;  5FI1 A;  2KUP A;  1U2B A;  2H7E A;  3GYO A;  5D3Y A;  2DHK A;  4DIX A;  5LOP B;  4HB2 B;  3SO6 A;  1WJM A;  3TCA A;  2I1K A;  3U8Z A;  2DA0 A;  2Y7B A;  1BTN A;  1NU2 A;  3KSY A;  1TJ6 A;  2D9W A;  4HAV B;  2YS1 A;  2DKP A;  1MPH A;  5J3Y A;  4CHM A;  3KZ1 A;  3A8P A;  4EJN A;  2RVB B;  2EC1 A;  4MY6 A;  4EMO A;  2LOX A;  2COC A;  1ZSQ A;  1W1D A;  4HDO A;  4NSW A;  4C0A A;  5C5B A;  2J0J A;  2J0K A;  1KZG A;  3UZT A;  4WJ7 A;  1W1G A;  4MK0 A;  1ZC3 B;  2P0F A;  1FOE A;  5KQ4 A;  4QXA B;  4XWX A;  1PFJ A;  1V61 A;  1ZC4 B;  4HAT B;  1MK7 B;  3KRX A;  1X05 A;  2P0H A;  3O96 A;  4KHO A;  3KY9 A;  2YF0 A;  3WA0 A;  5LG4 B;  2N0Y A;  2KIE A;  2JP2 A;  1NI2 A;  1U5D A;  1V89 A;  1FHO A;  4D0N B;  1X1G A;  1SGH A;  1V5M A;  3ODW A;  1LW3 A;  2Z0Q A;  1Q67 A;  2D9X A;  5CLQ B;  2LKO A;  1XCG A;  2CY4 A;  3G9W A;  4PQ0 A;  4HHV A;  2COD A;  2COF A;  3SNH A;  3TO1 A;  1AWE A;  3PZD A;  2RNR B;  2N23 A;  2XQN M;  5GOW B;  2ELB A;  2Z14 A;  2W2X D;  2DN6 A;  1WJ1 A;  2D9V A;  1OQN A;  2L1C A;  4HB3 B;  1P5T A;  1ZM0 A;  1FB8 A;  3NWF A;  1DDW A;  2RUK B;  2D9Y A;  2OTX A;  3AJ4 A;  1U5G A;  2K2J A;  2MKR A;  1U5F A;  2Z0P A;  2YS5 A;  1U29 A;  2YT0 A;  4ZRK A;  1UPR A;  2VSZ A;  2M38 A;  3HW2 B;  4GMX B;  5JHG A;  2RLO A;  4K17 A;  2YSZ A;  1T77 A;  2E2X A;  1V5P A;  3DXC A;  4F7G A;  1WGU A;  2EMS A;  3HQC A;  3DXD A;  4HAZ B;  2PZ1 A;  2W2X C;  1EF1 A;  2MDX A;  2COA A;  3MPX A;  3DXE A;  4F7U P;  4KAX B;  3ULB A;  5HE1 A;  2ADZ A;  2NZ8 B;  1PLS A;  3HK0 A;  2YS3 A;  1M7E A;  1X11 A;  1MIX A;  3FEH A;  3D8F A;  3F0W A;  4QJ3 B;  1DDM A;  1WVH A;  4OT1 A;  4A6F A;  4DBB A;  4GZU A;  2KIG A;  3NWD A;  3NW8 A;  4YON A;  3OHM B;  5M4Y B;  1UEF A;  1IRS A;  2YT2 A;  3AU4 A;  5DI9 B;  2ZKM X;  4GMV A;  1FGY A;  4TYZ A;  4HB4 B;  1FAO A;  4CSQ A;  4PNK A;  4A6K A;  5D27 A;  3PVU A;  1XOD A;  4A5K A;  2M14 A;  2DYN A;  1WI1 A;  4Z2N A;  2GUM A;  3MDB C;  4ZRJ A;  2NBV A;  1GG3 A;  5D3X A;  3P7Z A;  1NTV A;  5IRS A;  1UNQ A;  2KUQ A;  4KHB B; 
#chains in the Genus database with same CATH homology
 2P0D A;  3PG7 A;  4ZRI A;  2ELA A;  1BWN A;  2YVC A;  2DKQ A;  3SUZ A;  2OQB A;  2I1J A;  1Y5O A;  4HAU B;  3V5W A;  4A6H A;  1ISN A;  1MAI A;  4WSF A;  1PMS A;  4K2O A;  1X1F A;  3WYF B;  5C16 A;  2ZPY A;  1E5W A;  2ROZ B;  1TQZ A;  5KCV A;  5EFX A;  5D3W A;  2K00 A;  4HAY B;  2D10 A;  5L81 A;  2RSG A;  3FM8 C;  2Y8G A;  1ZVR A;  2Q13 A;  2UVM A;  1W1H A;  1FHX A;  1EVH A;  3QIJ A;  2GCL A;  2VKI A;  3ZDT A;  3CXB B;  1TXD A;  2DHJ A;  3ML4 A;  4K81 A;  2DFK A;  4Z2M B;  1X86 A;  2DX5 A;  3IVF A;  4B6H A;  2R09 A;  2LG1 A;  2D4Q A;  1P6S A;  4KHA A;  4HB0 B;  1XR0 B;  4HDQ A;  1WGQ A;  1XKE A;  2DHI A;  4DXA B;  2HE7 A;  4TKN A;  4WVF B;  2DYQ A;  3QWM A;  1I2H A;  3N7C A;  4MT7 A;  1K5D B;  5J3Q A;  1M7R A;  5C5B B;  1H10 A;  3PEG A;  1U27 A;  1AQC A;  5D3V A;  1N3H A;  1V88 A;  2AEH A;  4NY0 A;  3P6A A;  3TVV A;  2ROV A;  2UZS A;  1MK9 B;  5DHF B;  1P3R A;  4Y94 A;  2G35 A;  3PSC A;  4HAW B;  5HE3 A;  2LYD A;  5JLJ B;  4GPT B;  1Y19 B;  2UZR A;  1OY2 A;  1UNR A;  2DTC A;  2GJY A;  2Y8F A;  1Z87 A;  5C6R A;  3ODX A;  2AL6 A;  3D8D A;  3F5R A;  3BIN A;  1DBH A;  3KRW A;  1KI1 B;  1OMW A;  1J0W A;  4DX9 0;  2X18 A;  5CLL B;  1GC6 A;  4CHJ A;  5DH9 B;  2KGX B;  4EKU A;  2GS0 A;  1NTY A;  1DRO A;  3M1I B;  1BTK A;  2CY5 A;  2Z0O A;  3PVW A;  2DLW A;  1XX0 A;  1QQG A;  1K5G B;  5KQ1 A;  4HAX B;  5DIF B;  2P8V A;  1DYN A;  3LJU X;  1LB1 A;  1UNP A;  1FHW A;  4H8S A;  2GCJ A;  3PVL A;  3SYX A;  1FGZ A;  2CRF A;  3T06 A;  2EJ8 A;  2D9Z A;  4GN1 A;  3OAN A;  2R0D A;  5DHA B;  1I7A A;  2H7D A;  1RRP B;  2CAY A;  1MKE A;  5C79 A;  3U7D A;  1RJ2 A;  3AU5 A;  4F7H A;  3GYP A;  2YT1 A;  2RGN B;  3TFM A;  5HE2 A;  2J0M A;  4DX8 A;  2I5C A;  2IYB A;  1UPQ A;  1EGX A;  2MWN B;  3ULC A;  1J19 A;  1BAK A;  4A6F B;  1XD4 A;  4IAP A;  3NSU A;  2YRY A;  3VIA A;  4YL8 A;  4KVG B;  1QC6 A;  3D8E A;  4BBK A;  2NMB A;  4GXB A;  4IOY X;  3VOQ A;  1SHC A;  1V5U A;  5J3T A;  4IFS A;  1WG7 A;  2W2W A;  3RCP A;  4CYE A;  1U5E A;  2HTH B;  1DDV A;  4K2P A;  4P7I A;  2V76 A;  2K2U A;  5JP4 A;  5JHH A;  2VRW B;  3SV1 A;  2FJL A;  1MIZ B;  3A8Q A;  2LUL A;  1B55 A;  2D2Q A;  1GC7 A;  2KCJ A;  3X23 A;  3PP2 A;  2DX1 A;  2MFQ A;  2LOZ A;  5LON B;  1EAZ A;  2D11 A;  2BCJ A;  2J59 M;  1H4R A;  2EMT A;  3ODO A;  4L6E A;  1KZ7 A;  2QKL A;  5FI0 A;  2IFS A;  2I5F A;  3TW1 A;  3A98 B;  2QKM A;  2L2I A;  3CIK A;  3ZVR A;  3FSS A;  3QBV B;  3BJI A;  5HE0 A;  5FI1 A;  2KUP A;  1U2B A;  2H7E A;  3GYO A;  5D3Y A;  2DHK A;  5LOP B;  4HB2 B;  3SO6 A;  1WJM A;  3TCA A;  2I1K A;  3U8Z A;  2DA0 A;  2Y7B A;  1BTN A;  1NU2 A;  3KSY A;  1TJ6 A;  2D9W A;  4HAV B;  2YS1 A;  2DKP A;  1MPH A;  5J3Y A;  4CHM A;  3KZ1 A;  3A8P A;  4EJN A;  2RVB B;  2EC1 A;  4MY6 A;  4EMO A;  2LOX A;  2COC A;  1ZSQ A;  1W1D A;  4HDO A;  4NSW A;  4C0A A;  5C5B A;  2J0J A;  2J0K A;  1KZG A;  3UZT A;  4WJ7 A;  1W1G A;  4MK0 A;  1ZC3 B;  2P0F A;  1FOE A;  5KQ4 A;  4XWX A;  1PFJ A;  1V61 A;  1ZC4 B;  4HAT B;  1MK7 B;  3KRX A;  1X05 A;  2P0H A;  3O96 A;  4KHO A;  3KY9 A;  2YF0 A;  3WA0 A;  2N0Y A;  2JP2 A;  1NI2 A;  1U5D A;  1V89 A;  1FHO A;  4D0N B;  1X1G A;  1SGH A;  1V5M A;  3ODW A;  1LW3 A;  2Z0Q A;  1Q67 A;  2D9X A;  5CLQ B;  2LKO A;  1XCG A;  2CY4 A;  3G9W A;  4PQ0 A;  4HHV A;  2COD A;  2COF A;  3SNH A;  3TO1 A;  1AWE A;  3PZD A;  2RNR B;  2N23 A;  2XQN M;  5GOW B;  2ELB A;  2W2X D;  2DN6 A;  1WJ1 A;  2D9V A;  1OQN A;  2L1C A;  4HB3 B;  1P5T A;  1ZM0 A;  1FB8 A;  1DDW A;  2RUK B;  2D9Y A;  2OTX A;  3AJ4 A;  1U5G A;  2K2J A;  2MKR A;  1U5F A;  2Z0P A;  2YS5 A;  1U29 A;  2YT0 A;  4ZRK A;  1UPR A;  2VSZ A;  2M38 A;  3HW2 B;  4GMX B;  5JHG A;  2RLO A;  4K17 A;  2YSZ A;  2E2X A;  1V5P A;  3DXC A;  4F7G A;  1WGU A;  2EMS A;  3HQC A;  3DXD A;  4HAZ B;  2PZ1 A;  2W2X C;  1EF1 A;  2MDX A;  2COA A;  3MPX A;  3DXE A;  4F7U P;  4KAX B;  3ULB A;  5HE1 A;  2ADZ A;  2NZ8 B;  1PLS A;  3HK0 A;  2YS3 A;  1M7E A;  1X11 A;  1MIX A;  3FEH A;  3D8F A;  3F0W A;  1DDM A;  1WVH A;  4A6F A;  4DBB A;  4GZU A;  4YON A;  1UEF A;  1IRS A;  3AU4 A;  5DI9 B;  4GMV A;  1FGY A;  4TYZ A;  4HB4 B;  1FAO A;  4PNK A;  4A6K A;  5D27 A;  3PVU A;  1XOD A;  4A5K A;  2M14 A;  2DYN A;  1WI1 A;  4Z2N A;  3MDB C;  4ZRJ A;  1GG3 A;  5D3X A;  3P7Z A;  1NTV A;  1UNQ A;  4KHB B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...