2HTHB

Structural basis for ubiquitin recognition by the human eap45/escrt-ii glue domain
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
129
structure length
129
Chain Sequence
RFVWTSGLLEINETLVIQQRGVRIYDGEEKIKFDAGTLLLSTHRLIWRDQKNHECCMAILLSQIVFIEEQAAGIGKSAKIVVHLHPAPPNKEPGPFQSSKNSYIKLSFKEHGQIEFYRRLSEEMTQRRW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein transport
molecule keywords Ubiquitin
publication title Structural basis for ubiquitin recognition by the human ESCRT-II EAP45 GLUE domain.
pubmed doi rcsb
source organism Homo sapiens
total genus 23
structure length 129
sequence length 129
ec nomenclature
pdb deposition date 2006-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF11605 Vps36_ESCRT-II Vacuolar protein sorting protein 36 Vps36
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2hthB00
1PFJA 2J59M 3V5WA 2Q13A 3QWMA 1FHOA 5L81A 3DXEA 1BTNA 2H7EA 5DIFB 2EC1A 2FJLA 2CY5A 1N3HA 1Z87A 2MDXA 1QC6A 3D8FA 1I7AA 2K00A 1XX0A 4A6FA 1ZSQA 4CYEA 1FHWA 2RVBB 2KUPA 4H8SA 2QKLA 1KZ7A 4HB3B 4YONA 2K2JA 3SO6A 2YT0A 1X11A 5DHFB 5JHHA 5C79A 2DN6A 4KHBB 5C6RA 2CODA 3X23A 2W2XD 2K2UA 2Z0QA 3GYOA 2W2WA 2LYDA 4A6KA 3DXCA 1V89A 4HAYB 3OANA 1EAZA 1MKEA 1ZM0A 3IVFA 2M38A 2DHKA 1V61A 2RNRB 4K2OA 4KVGB 2YT1A 4PQ0A 3U7DA 4Z2NA 4B6HA 1XD4A 2DYQA 4HB4B 2I5CA 1BTKA 3D8DA 4PNKA 2I1KA 1LB1A 2YS3A 5DHAB 4A5KA 1WVHA 5HE0A 3M1IB 2DYNA 1K5GB 1K5DB 4KHAA 2J0JA 5C5BA 4HATB 1XKEA 2N0YA 3PEGA 1U5EA 3PVLA 4HAUB 3TO1A 3FEHA 2LOXA 4ZRIA 3WA0A 1U27A 4A6HA 1ZVRA 2P0DA 1FB8A 2W2XC 1U2BA 3T06A 4HHVA 2MKRA 1NU2A 1X05A 2RSGA 4DXAB 4EMOA 2YVCA 1MAIA 3PSCA 3HK0A 3WYFB 4WSFA 1GC6A 1X86A 2NMBA 3F0WA 1LW3A 5C16A 2DHIA 1B55A 5CLLB 2DX5A 2GCLA 2CY4A 5D27A 2CAYA 4HAZB 2NZ8B 1U5FA 2D9XA 3P7ZA 2COAA 3KY9A 4IFSA 1UNPA 1TQZA 3TFMA 2UZRA 5HE3A 2LG1A 3MPXA 1P3RA 1J19A 3ZVRA 5DH9B 4MY6A 1DBHA 1U5DA 2VSZA 2D2QA 1UPRA 3TW1A 1FAOA 3PVUA 2GCJA 1V88A 3A8PA 2ELBA 1SGHA 1W1DA 1FGZA 2KCJA 3LJUX 1WJMA 3KRXA 3A8QA 4F7UP 1MIZB 1QQGA 5D3WA 2Y8FA 3HQCA 3SV1A 1X1FA 3BINA 3KSYA 2YSZA 2IYBA 1BWNA 1W1GA 4HDOA 2D11A 2DKQA 4GPTB 1UNQA 3GYPA 5KQ4A 2CRFA 4HAWB 3SYXA 3N7CA 1RJ2A 1OMWA 2DLWA 4ZRKA 2G35A 3G9WA 5J3TA 2M14A 3FM8C 2L2IA 3ULCA 4K2PA 4DX8A 2OQBA 3SNHA 4GN1A 3UZTA 1V5PA 1XR0B 4GMVA 2I5FA 1IRSA 4HAXB 1MPHA 5JP4A 1SHCA 2EMTA 2KGXB 2COFA 2Z0PA 1MIXA 1U29A 4KAXB 1WGUA 2GS0A 2ROZB 1KZGA 2YRYA 3AU5A 3AU4A 2RLOA 2OTXA 3MDBC 2I1JA 2D9VA 4WVFB 1V5UA 4D0NB 1UEFA 2D9WA 2VRWB 3O96A 1I2HA 1DYNA 1DDWA 1MK9B 4GZUA 3A98B 4GXBA 2Z0OA 3VOQA 2DA0A 5JHGA 1XCGA 4Y94A 2RUKB 1W1HA 2BCJA 2ROVA 2D4QA 2LKOA 1XODA 2ADZA 5D3YA 4HDQA 2D9ZA 4DBBA 2LULA 2AEHA 1PLSA 3ML4A 1U5GA 1NI2A 1ZC3B 2JP2A 4GMXB 1BAKA 1DDVA 3SUZA 3QIJA 3PG7A 2GJYA 1AWEA 2R09A 2P0FA 2YF0A 2HTHB 3HW2B 4C0AA 4CHJA 3BJIA 4XWXA 4BBKA 3ULBA 2PZ1A 2QKMA 4EKUA 4K81A 1EF1A 4Z2MB 1OY2A 1E5WA 2HE7A 4IOYX 3ODOA 1WGQA 1WG7A 2IFSA 3TCAA 2EMSA 1Y5OA 2D10A 5EFXA 4NY0A 2Y7BA 5D3XA 5DI9B 2LOZA 5FI0A 1M7EA 4HAVB 1MK7B 1DDMA 3ODWA 2P0HA 5JLJB 1FOEA 4L6EA 1FGYA 1X1GA 1OQNA 2Y8GA 2UZSA 4HB0B 5HE2A 2UVMA 5CLQB 1H4RA 1NTVA 4K17A 3TVVA 3PZDA 4IAPA 2ELAA 4DX90 2H7DA 4CHMA 2ZPYA 4WJ7A 3D8EA 1GC7A 5J3QA 4MT7A 2DKPA 5LONB 2AL6A 4A6FB 3NSUA 3P6AA 4YL8A 3QBVB 1ISNA 3FSSA 3KRWA 2DX1A 5FI1A 4KHOA 3KZ1A 1UNRA 1H10A 1WI1A 4ZRJA 2DTCA 2YS1A 1DROA 4NSWA 1RRPB 1WJ1A 1TXDA 5LOPB 2J0MA 5GOWB 3ODXA 5D3VA 2E2XA 1KI1B 1AQCA 1M7RA 1UPQA 4F7GA 1J0WA 1EGXA 3CXBB 2J0KA 2X18A 2RGNB 1Q67A 2D9YA 4MK0A 3RCPA 2N23A 1V5MA 2VKIA 1GG3A 1P5TA 3PP2A 2DHJA 2R0DA 3F5RA 1NTYA 3DXDA 3ZDTA 2YS5A 1ZC4B 3AJ4A 5C5BB 1TJ6A 5KCVA 2V76A 4EJNA 3U8ZA 1FHXA 1PMSA 2COCA 4TKNA 3CIKA 2P8VA 3PVWA 5HE1A 1EVHA 2XQNM 3VIAA 4P7IA 5J3YA 4F7HA 2EJ8A 4TYZA 2MFQA 1Y19B 5KQ1A 2DFKA 2L1CA 1P6SA 2MWNB 4HB2B
chains in the Genus database with same CATH superfamily
1PFJA 2J59M 3V5WA 2Q13A 3QWMA 1FHOA 5L81A 3DXEA 1BTNA 2H7EA 5DIFB 5I2MA 4HSIA 3HSAA 2EC1A 2FJLA 2CY5A 3NWAA 1N3HA 1Z87A 2MDXA 1QC6A 3D8FA 1I7AA 2K00A 1XX0A 4A6FA 1ZSQA 4CYEA 1FHWA 2RVBB 2KUPA 4H8SA 2QKLA 1KZ7A 4HB3B 4YONA 2K2JA 3SO6A 2YT0A 3U12A 1X11A 5DHFB 5JHHA 5C79A 2DN6A 4KHBB 5C6RA 2CODA 3X23A 4QJ5B 2W2XD 2K2UA 2Z0QA 3GYOA 2W2WA 2LYDA 4A6KA 2FJUB 3DXCA 1V89A 4HAYB 4QJ4B 3OANA 1EAZA 2K8EA 1MKEA 4QXAB 1ZM0A 3IVFA 2M38A 2DHKA 1V61A 2NBVA 2RNRB 4K2OA 4KVGB 2YT1A 4PQ0A 3U7DA 4Z2NA 4B6HA 1XD4A 1ZYIA 2DYQA 2I5CA 4HB4B 1BTKA 3D8DA 4PNKA 2I1KA 1LB1A 2YS3A 5DHAB 4A5KA 1WVHA 5HE0A 3M1IB 2DYNA 1K5GB 1K5DB 3NWDA 4KHAA 2J0JA 5C5BA 4HATB 3NW8A 1XKEA 2N0YA 3PEGA 1U5EA 3PVLA 4HAUB 3TO1A 3FEHA 2LOXA 4ZRIA 3WA0A 1U27A 4A6HA 1ZVRA 2P0DA 1FB8A 2W2XC 1U2BA 3T06A 4HHVA 2MKRA 1NU2A 1X05A 2RSGA 4DXAB 4EMOA 2YVCA 1MAIA 3PSCA 3HK0A 3WYFB 4WSFA 1GC6A 3A58A 1X86A 2NMBA 5IRSA 3F0WA 1LW3A 5C16A 2DHIA 1B55A 5CLLB 2DX5A 2GCLA 2CY4A 5D27A 2CAYA 4HAZB 2NZ8B 1U5FA 2D9XA 3P7ZA 2COAA 3KY9A 4IFSA 1UNPA 1TQZA 3TFMA 2UZRA 2K49A 5HE3A 2LG1A 3MPXA 4KHBA 1P3RA 5LG4B 1J19A 3ZVRA 5DH9B 4MY6A 2KUQA 1DBHA 4QJ3B 1U5DA 2VSZA 2D2QA 1UPRA 3TW1A 1FAOA 2R2YA 3PVUA 2GCJA 1V88A 3A8PA 2ELBA 1SGHA 1W1DA 1FGZA 2KCJA 3LJUX 1WJMA 3KRXA 3A8QA 4F7UP 3B77A 1MIZB 1QQGA 2Z4DA 5D3WA 2Y8FA 4OT1A 3HQCA 3SV1A 1X1FA 3BINA 3KSYA 2YSZA 2IYBA 1BWNA 1W1GA 4HDOA 2D11A 2DKQA 4GPTB 1UNQA 3GYPA 5KQ4A 2CRFA 4HAWB 2GUMA 3SYXA 3N7CA 1RJ2A 1OMWA 2DLWA 4ZRKA 2G35A 3G9WA 5J3TA 2M14A 3FM8C 2L2IA 3ULCA 4K2PA 4DX8A 2OQBA 3SNHA 4GN1A 3UZTA 1V5PA 1XR0B 4GMVA 2Z14A 2I5FA 1IRSA 4HAXB 1MPHA 5JP4A 1SHCA 2EMTA 2KGXB 2COFA 2Z0PA 1MIXA 2YT2A 1U29A 4KAXB 1WGUA 2GS0A 2ROZB 1KZGA 2YRYA 3AU5A 3AU4A 2RLOA 2OTXA 3MDBC 2I1JA 2D9VA 4WVFB 1V5UA 4D0NB 1UEFA 2D9WA 2VRWB 3O96A 1I2HA 5M4YB 1DYNA 1DDWA 1MK9B 4GZUA 2KIEA 3A98B 4GXBA 2Z0OA 3VOQA 2DA0A 5JHGA 1XCGA 4Y94A 2RUKB 3HIEA 1W1HA 2BCJA 2ROVA 2D4QA 2LKOA 1XODA 2ADZA 5D3YA 4HDQA 2D9ZA 4DBBA 2LULA 2AEHA 1PLSA 3ML4A 1U5GA 2Z13A 1NI2A 1ZC3B 2JP2A 4GMXB 1BAKA 1DDVA 3SUZA 3QIJA 3PG7A 2GJYA 1AWEA 2R09A 4D6WA 2P0FA 2YF0A 2HTHB 3HW2B 4C0AA 4CHJA 3BJIA 4XWXA 4BBKA 3ULBA 2PZ1A 2QKMA 4EKUA 4K81A 2KR0A 1EF1A 4Z2MB 1OY2A 1E5WA 2HE7A 4IOYX 4GOUA 3ODOA 1WGQA 1WG7A 2IFSA 3TCAA 2EMSA 1Y5OA 2D10A 5EFXA 1MI1A 4NY0A 2Y7BA 5D3XA 5DI9B 2LOZA 5FI0A 1M7EA 4HAVB 1MK7B 1DDMA 3ODWA 2P0HA 5JLJB 1FOEA 4L6EA 2RRFA 3FVCA 1FGYA 1X1GA 3OHMB 1OQNA 2Y8GA 2UZSA 4HB0B 5HE2A 2UVMA 5CLQB 1H4RA 1NTVA 4DIXA 4K17A 3TVVA 3PZDA 4IAPA 2ELAA 4DX90 2H7DA 4CHMA 2ZPYA 4WJ7A 3D8EA 1GC7A 5J3QA 4MT7A 2DKPA 5LONB 2AL6A 5I2SA 4A6FB 3NSUA 3P6AA 4YL8A 3QBVB 1ISNA 3FSSA 3KRWA 2DX1A 5FI1A 4GNKB 4KHOA 3KZ1A 1UNRA 1H10A 4OSNA 1WI1A 4ZRJA 2DTCA 2YS1A 1DROA 2KIGA 4NSWA 1RRPB 1WJ1A 1TXDA 5LOPB 2J0MA 5GOWB 4L1RA 3ODXA 5D3VA 2E2XA 3NWFA 1KI1B 1AQCA 1M7RA 1UPQA 4F7GA 1J0WA 1EGXA 3CXBB 2J0KA 2X18A 2RGNB 1Q67A 3DCXA 2D9YA 4MK0A 3RCPA 2N23A 1V5MA 2VKIA 1GG3A 1P5TA 3PP2A 2ZKMX 2DHJA 2R0DA 4CSQA 3F5RA 1NTYA 3DXDA 3ZDTA 2YS5A 2Z59A 1ZC4B 3AJ4A 5C5BB 1TJ6A 5KCVA 2V76A 1T77A 4EJNA 3U8ZA 1FHXA 1PMSA 2COCA 4TKNA 3CIKA 2P8VA 3PVWA 5HE1A 1EVHA 2XQNM 3VIAA 4P7IA 5J3YA 4F7HA 2EJ8A 4TYZA 2MFQA 1Y19B 5KQ1A 2DFKA 2L1CA 1P6SA 2MWNB 4HB2B
chains in the Genus database with same CATH topology
1PFJA 2J59M 3V5WA 2Q13A 3QWMA 1FHOA 5L81A 3DXEA 1BTNA 2H7EA 5DIFB 2EC1A 2FJLA 2CY5A 1N3HA 1Z87A 2MDXA 1QC6A 3D8FA 1I7AA 2K00A 1XX0A 4A6FA 1ZSQA 4CYEA 1FHWA 2RVBB 2KUPA 4H8SA 2QKLA 1KZ7A 4HB3B 4YONA 2K2JA 3SO6A 2YT0A 1X11A 5DHFB 5JHHA 5C79A 2DN6A 4KHBB 5C6RA 2CODA 3X23A 2W2XD 2K2UA 2Z0QA 3GYOA 2W2WA 2LYDA 4A6KA 3DXCA 1V89A 4HAYB 3OANA 1EAZA 1MKEA 1ZM0A 3IVFA 2M38A 2DHKA 1V61A 2RNRB 4K2OA 4KVGB 2YT1A 4PQ0A 3U7DA 4Z2NA 4B6HA 1XD4A 2DYQA 4HB4B 2I5CA 1BTKA 3D8DA 4PNKA 2I1KA 1LB1A 2YS3A 5DHAB 4A5KA 1WVHA 5HE0A 3M1IB 2DYNA 1K5GB 1K5DB 4KHAA 2J0JA 5C5BA 4HATB 1XKEA 2N0YA 3PEGA 1U5EA 3PVLA 4HAUB 3TO1A 3FEHA 2LOXA 4ZRIA 3WA0A 1U27A 4A6HA 1ZVRA 2P0DA 1FB8A 2W2XC 1U2BA 3T06A 4HHVA 2MKRA 1NU2A 1X05A 2RSGA 4DXAB 4EMOA 2YVCA 1MAIA 3PSCA 3HK0A 3WYFB 4WSFA 1GC6A 1X86A 2NMBA 3F0WA 1LW3A 5C16A 2DHIA 1B55A 5CLLB 2DX5A 2GCLA 2CY4A 5D27A 2CAYA 4HAZB 2NZ8B 1U5FA 2D9XA 3P7ZA 2COAA 3KY9A 4IFSA 1UNPA 1TQZA 3TFMA 2UZRA 5HE3A 2LG1A 3MPXA 1P3RA 1J19A 3ZVRA 5DH9B 4MY6A 1DBHA 1U5DA 2VSZA 2D2QA 1UPRA 3TW1A 1FAOA 3PVUA 2GCJA 1V88A 3A8PA 2ELBA 1SGHA 1W1DA 1FGZA 2KCJA 3LJUX 1WJMA 3KRXA 3A8QA 4F7UP 1MIZB 1QQGA 5D3WA 2Y8FA 3HQCA 3SV1A 1X1FA 3BINA 3KSYA 2YSZA 2IYBA 1BWNA 1W1GA 4HDOA 2D11A 2DKQA 4GPTB 1UNQA 3GYPA 5KQ4A 2CRFA 4HAWB 3SYXA 3N7CA 1RJ2A 1OMWA 2DLWA 4ZRKA 2G35A 3G9WA 5J3TA 2M14A 3FM8C 2L2IA 3ULCA 4K2PA 4DX8A 2OQBA 3SNHA 4GN1A 3UZTA 1V5PA 1XR0B 4GMVA 2I5FA 1IRSA 4HAXB 1MPHA 5JP4A 1SHCA 2EMTA 2KGXB 2COFA 2Z0PA 1MIXA 1U29A 4KAXB 1WGUA 2GS0A 2ROZB 1KZGA 2YRYA 3AU5A 3AU4A 2RLOA 2OTXA 3MDBC 2I1JA 2D9VA 4WVFB 1V5UA 4D0NB 1UEFA 2D9WA 2VRWB 3O96A 1I2HA 1DYNA 1DDWA 1MK9B 4GZUA 3A98B 4GXBA 2Z0OA 3VOQA 2DA0A 5JHGA 1XCGA 4Y94A 2RUKB 1W1HA 2BCJA 2ROVA 2D4QA 2LKOA 1XODA 2ADZA 5D3YA 4HDQA 2D9ZA 4DBBA 2LULA 2AEHA 1PLSA 3ML4A 1U5GA 1NI2A 1ZC3B 2JP2A 4GMXB 1BAKA 1DDVA 3SUZA 3QIJA 3PG7A 2GJYA 1AWEA 2R09A 2P0FA 2YF0A 2HTHB 3HW2B 4C0AA 4CHJA 3BJIA 4XWXA 4BBKA 3ULBA 2PZ1A 2QKMA 4EKUA 4K81A 1EF1A 4Z2MB 1OY2A 1E5WA 2HE7A 4IOYX 3ODOA 1WGQA 1WG7A 2IFSA 3TCAA 2EMSA 1Y5OA 2D10A 5EFXA 4NY0A 2Y7BA 5D3XA 5DI9B 2LOZA 5FI0A 1M7EA 4HAVB 1MK7B 1DDMA 3ODWA 2P0HA 5JLJB 1FOEA 4L6EA 1FGYA 1X1GA 1OQNA 2Y8GA 2UZSA 4HB0B 5HE2A 2UVMA 5CLQB 1H4RA 1NTVA 4K17A 3TVVA 3PZDA 4IAPA 2ELAA 4DX90 2H7DA 4CHMA 2ZPYA 4WJ7A 3D8EA 1GC7A 5J3QA 4MT7A 2DKPA 5LONB 2AL6A 4A6FB 3NSUA 3P6AA 4YL8A 3QBVB 1ISNA 3FSSA 3KRWA 2DX1A 5FI1A 4KHOA 3KZ1A 1UNRA 1H10A 1WI1A 4ZRJA 2DTCA 2YS1A 1DROA 4NSWA 1RRPB 1WJ1A 1TXDA 5LOPB 2J0MA 5GOWB 3ODXA 5D3VA 2E2XA 1KI1B 1AQCA 1M7RA 1UPQA 4F7GA 1J0WA 1EGXA 3CXBB 2J0KA 2X18A 2RGNB 1Q67A 2D9YA 4MK0A 3RCPA 2N23A 1V5MA 2VKIA 1GG3A 1P5TA 3PP2A 2DHJA 2R0DA 3F5RA 1NTYA 3DXDA 3ZDTA 2YS5A 1ZC4B 3AJ4A 5C5BB 1TJ6A 5KCVA 2V76A 4EJNA 3U8ZA 1FHXA 1PMSA 2COCA 4TKNA 3CIKA 2P8VA 3PVWA 5HE1A 1EVHA 2XQNM 3VIAA 4P7IA 5J3YA 4F7HA 2EJ8A 4TYZA 2MFQA 1Y19B 5KQ1A 2DFKA 2L1CA 1P6SA 2MWNB 4HB2B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PFJ A;  2J59 M;  3V5W A;  2Q13 A;  3QWM A;  1FHO A;  5L81 A;  3DXE A;  1BTN A;  2H7E A;  5DIF B;  2EC1 A;  2FJL A;  2CY5 A;  1N3H A;  1Z87 A;  2MDX A;  1QC6 A;  3D8F A;  1I7A A;  2K00 A;  1XX0 A;  4A6F A;  1ZSQ A;  4CYE A;  1FHW A;  2RVB B;  2KUP A;  4H8S A;  2QKL A;  1KZ7 A;  4HB3 B;  4YON A;  2K2J A;  3SO6 A;  2YT0 A;  1X11 A;  5DHF B;  5JHH A;  5C79 A;  2DN6 A;  4KHB B;  5C6R A;  2COD A;  3X23 A;  2W2X D;  2K2U A;  2Z0Q A;  3GYO A;  2W2W A;  2LYD A;  4A6K A;  3DXC A;  1V89 A;  4HAY B;  3OAN A;  1EAZ A;  1MKE A;  1ZM0 A;  3IVF A;  2M38 A;  2DHK A;  1V61 A;  2RNR B;  4K2O A;  4KVG B;  2YT1 A;  4PQ0 A;  3U7D A;  4Z2N A;  4B6H A;  1XD4 A;  2DYQ A;  4HB4 B;  2I5C A;  1BTK A;  3D8D A;  4PNK A;  2I1K A;  1LB1 A;  2YS3 A;  5DHA B;  4A5K A;  1WVH A;  5HE0 A;  3M1I B;  2DYN A;  1K5G B;  1K5D B;  4KHA A;  2J0J A;  5C5B A;  4HAT B;  1XKE A;  2N0Y A;  3PEG A;  1U5E A;  3PVL A;  4HAU B;  3TO1 A;  3FEH A;  2LOX A;  4ZRI A;  3WA0 A;  1U27 A;  4A6H A;  1ZVR A;  2P0D A;  1FB8 A;  2W2X C;  1U2B A;  3T06 A;  4HHV A;  2MKR A;  1NU2 A;  1X05 A;  2RSG A;  4DXA B;  4EMO A;  2YVC A;  1MAI A;  3PSC A;  3HK0 A;  3WYF B;  4WSF A;  1GC6 A;  1X86 A;  2NMB A;  3F0W A;  1LW3 A;  5C16 A;  2DHI A;  1B55 A;  5CLL B;  2DX5 A;  2GCL A;  2CY4 A;  5D27 A;  2CAY A;  4HAZ B;  2NZ8 B;  1U5F A;  2D9X A;  3P7Z A;  2COA A;  3KY9 A;  4IFS A;  1UNP A;  1TQZ A;  3TFM A;  2UZR A;  5HE3 A;  2LG1 A;  3MPX A;  1P3R A;  1J19 A;  3ZVR A;  5DH9 B;  4MY6 A;  1DBH A;  1U5D A;  2VSZ A;  2D2Q A;  1UPR A;  3TW1 A;  1FAO A;  3PVU A;  2GCJ A;  1V88 A;  3A8P A;  2ELB A;  1SGH A;  1W1D A;  1FGZ A;  2KCJ A;  3LJU X;  1WJM A;  3KRX A;  3A8Q A;  4F7U P;  1MIZ B;  1QQG A;  5D3W A;  2Y8F A;  3HQC A;  3SV1 A;  1X1F A;  3BIN A;  3KSY A;  2YSZ A;  2IYB A;  1BWN A;  1W1G A;  4HDO A;  2D11 A;  2DKQ A;  4GPT B;  1UNQ A;  3GYP A;  5KQ4 A;  2CRF A;  4HAW B;  3SYX A;  3N7C A;  1RJ2 A;  1OMW A;  2DLW A;  4ZRK A;  2G35 A;  3G9W A;  5J3T A;  2M14 A;  3FM8 C;  2L2I A;  3ULC A;  4K2P A;  4DX8 A;  2OQB A;  3SNH A;  4GN1 A;  3UZT A;  1V5P A;  1XR0 B;  4GMV A;  2I5F A;  1IRS A;  4HAX B;  1MPH A;  5JP4 A;  1SHC A;  2EMT A;  2KGX B;  2COF A;  2Z0P A;  1MIX A;  1U29 A;  4KAX B;  1WGU A;  2GS0 A;  2ROZ B;  1KZG A;  2YRY A;  3AU5 A;  3AU4 A;  2RLO A;  2OTX A;  3MDB C;  2I1J A;  2D9V A;  4WVF B;  1V5U A;  4D0N B;  1UEF A;  2D9W A;  2VRW B;  3O96 A;  1I2H A;  1DYN A;  1DDW A;  1MK9 B;  4GZU A;  3A98 B;  4GXB A;  2Z0O A;  3VOQ A;  2DA0 A;  5JHG A;  1XCG A;  4Y94 A;  2RUK B;  1W1H A;  2BCJ A;  2ROV A;  2D4Q A;  2LKO A;  1XOD A;  2ADZ A;  5D3Y A;  4HDQ A;  2D9Z A;  4DBB A;  2LUL A;  2AEH A;  1PLS A;  3ML4 A;  1U5G A;  1NI2 A;  1ZC3 B;  2JP2 A;  4GMX B;  1BAK A;  1DDV A;  3SUZ A;  3QIJ A;  3PG7 A;  2GJY A;  1AWE A;  2R09 A;  2P0F A;  2YF0 A;  2HTH B;  3HW2 B;  4C0A A;  4CHJ A;  3BJI A;  4XWX A;  4BBK A;  3ULB A;  2PZ1 A;  2QKM A;  4EKU A;  4K81 A;  1EF1 A;  4Z2M B;  1OY2 A;  1E5W A;  2HE7 A;  4IOY X;  3ODO A;  1WGQ A;  1WG7 A;  2IFS A;  3TCA A;  2EMS A;  1Y5O A;  2D10 A;  5EFX A;  4NY0 A;  2Y7B A;  5D3X A;  5DI9 B;  2LOZ A;  5FI0 A;  1M7E A;  4HAV B;  1MK7 B;  1DDM A;  3ODW A;  2P0H A;  5JLJ B;  1FOE A;  4L6E A;  1FGY A;  1X1G A;  1OQN A;  2Y8G A;  2UZS A;  4HB0 B;  5HE2 A;  2UVM A;  5CLQ B;  1H4R A;  1NTV A;  4K17 A;  3TVV A;  3PZD A;  4IAP A;  2ELA A;  4DX9 0;  2H7D A;  4CHM A;  2ZPY A;  4WJ7 A;  3D8E A;  1GC7 A;  5J3Q A;  4MT7 A;  2DKP A;  5LON B;  2AL6 A;  4A6F B;  3NSU A;  3P6A A;  4YL8 A;  3QBV B;  1ISN A;  3FSS A;  3KRW A;  2DX1 A;  5FI1 A;  4KHO A;  3KZ1 A;  1UNR A;  1H10 A;  1WI1 A;  4ZRJ A;  2DTC A;  2YS1 A;  1DRO A;  4NSW A;  1RRP B;  1WJ1 A;  1TXD A;  5LOP B;  2J0M A;  5GOW B;  3ODX A;  5D3V A;  2E2X A;  1KI1 B;  1AQC A;  1M7R A;  1UPQ A;  4F7G A;  1J0W A;  1EGX A;  3CXB B;  2J0K A;  2X18 A;  2RGN B;  1Q67 A;  2D9Y A;  4MK0 A;  3RCP A;  2N23 A;  1V5M A;  2VKI A;  1GG3 A;  1P5T A;  3PP2 A;  2DHJ A;  2R0D A;  3F5R A;  1NTY A;  3DXD A;  3ZDT A;  2YS5 A;  1ZC4 B;  3AJ4 A;  5C5B B;  1TJ6 A;  5KCV A;  2V76 A;  4EJN A;  3U8Z A;  1FHX A;  1PMS A;  2COC A;  4TKN A;  3CIK A;  2P8V A;  3PVW A;  5HE1 A;  1EVH A;  2XQN M;  3VIA A;  4P7I A;  5J3Y A;  4F7H A;  2EJ8 A;  4TYZ A;  2MFQ A;  1Y19 B;  5KQ1 A;  2DFK A;  2L1C A;  1P6S A;  2MWN B;  4HB2 B; 
#chains in the Genus database with same CATH topology
 1PFJ A;  2J59 M;  3V5W A;  2Q13 A;  3QWM A;  1FHO A;  5L81 A;  3DXE A;  1BTN A;  2H7E A;  5DIF B;  5I2M A;  4HSI A;  3HSA A;  2EC1 A;  2FJL A;  2CY5 A;  3NWA A;  1N3H A;  1Z87 A;  2MDX A;  1QC6 A;  3D8F A;  1I7A A;  2K00 A;  1XX0 A;  4A6F A;  1ZSQ A;  4CYE A;  1FHW A;  2RVB B;  2KUP A;  4H8S A;  2QKL A;  1KZ7 A;  4HB3 B;  4YON A;  2K2J A;  3SO6 A;  2YT0 A;  3U12 A;  1X11 A;  5DHF B;  5JHH A;  5C79 A;  2DN6 A;  4KHB B;  5C6R A;  2COD A;  3X23 A;  4QJ5 B;  2W2X D;  2K2U A;  2Z0Q A;  3GYO A;  2W2W A;  2LYD A;  4A6K A;  2FJU B;  3DXC A;  1V89 A;  4HAY B;  4QJ4 B;  3OAN A;  1EAZ A;  2K8E A;  1MKE A;  4QXA B;  1ZM0 A;  3IVF A;  2M38 A;  2DHK A;  1V61 A;  2NBV A;  2RNR B;  4K2O A;  4KVG B;  2YT1 A;  4PQ0 A;  3U7D A;  4Z2N A;  4B6H A;  1XD4 A;  1ZYI A;  2DYQ A;  2I5C A;  4HB4 B;  1BTK A;  3D8D A;  4PNK A;  2I1K A;  1LB1 A;  2YS3 A;  5DHA B;  4A5K A;  1WVH A;  5HE0 A;  3M1I B;  2DYN A;  1K5G B;  1K5D B;  3NWD A;  4KHA A;  2J0J A;  5C5B A;  4HAT B;  3NW8 A;  1XKE A;  2N0Y A;  3PEG A;  1U5E A;  3PVL A;  4HAU B;  3TO1 A;  3FEH A;  2LOX A;  4ZRI A;  3WA0 A;  1U27 A;  4A6H A;  1ZVR A;  2P0D A;  1FB8 A;  2W2X C;  1U2B A;  3T06 A;  4HHV A;  2MKR A;  1NU2 A;  1X05 A;  2RSG A;  4DXA B;  4EMO A;  2YVC A;  1MAI A;  3PSC A;  3HK0 A;  3WYF B;  4WSF A;  1GC6 A;  3A58 A;  1X86 A;  2NMB A;  5IRS A;  3F0W A;  1LW3 A;  5C16 A;  2DHI A;  1B55 A;  5CLL B;  2DX5 A;  2GCL A;  2CY4 A;  5D27 A;  2CAY A;  4HAZ B;  2NZ8 B;  1U5F A;  2D9X A;  3P7Z A;  2COA A;  3KY9 A;  4IFS A;  1UNP A;  1TQZ A;  3TFM A;  2UZR A;  2K49 A;  5HE3 A;  2LG1 A;  3MPX A;  4KHB A;  1P3R A;  5LG4 B;  1J19 A;  3ZVR A;  5DH9 B;  4MY6 A;  2KUQ A;  1DBH A;  4QJ3 B;  1U5D A;  2VSZ A;  2D2Q A;  1UPR A;  3TW1 A;  1FAO A;  2R2Y A;  3PVU A;  2GCJ A;  1V88 A;  3A8P A;  2ELB A;  1SGH A;  1W1D A;  1FGZ A;  2KCJ A;  3LJU X;  1WJM A;  3KRX A;  3A8Q A;  4F7U P;  3B77 A;  1MIZ B;  1QQG A;  2Z4D A;  5D3W A;  2Y8F A;  4OT1 A;  3HQC A;  3SV1 A;  1X1F A;  3BIN A;  3KSY A;  2YSZ A;  2IYB A;  1BWN A;  1W1G A;  4HDO A;  2D11 A;  2DKQ A;  4GPT B;  1UNQ A;  3GYP A;  5KQ4 A;  2CRF A;  4HAW B;  2GUM A;  3SYX A;  3N7C A;  1RJ2 A;  1OMW A;  2DLW A;  4ZRK A;  2G35 A;  3G9W A;  5J3T A;  2M14 A;  3FM8 C;  2L2I A;  3ULC A;  4K2P A;  4DX8 A;  2OQB A;  3SNH A;  4GN1 A;  3UZT A;  1V5P A;  1XR0 B;  4GMV A;  2Z14 A;  2I5F A;  1IRS A;  4HAX B;  1MPH A;  5JP4 A;  1SHC A;  2EMT A;  2KGX B;  2COF A;  2Z0P A;  1MIX A;  2YT2 A;  1U29 A;  4KAX B;  1WGU A;  2GS0 A;  2ROZ B;  1KZG A;  2YRY A;  3AU5 A;  3AU4 A;  2RLO A;  2OTX A;  3MDB C;  2I1J A;  2D9V A;  4WVF B;  1V5U A;  4D0N B;  1UEF A;  2D9W A;  2VRW B;  3O96 A;  1I2H A;  5M4Y B;  1DYN A;  1DDW A;  1MK9 B;  4GZU A;  2KIE A;  3A98 B;  4GXB A;  2Z0O A;  3VOQ A;  2DA0 A;  5JHG A;  1XCG A;  4Y94 A;  2RUK B;  3HIE A;  1W1H A;  2BCJ A;  2ROV A;  2D4Q A;  2LKO A;  1XOD A;  2ADZ A;  5D3Y A;  4HDQ A;  2D9Z A;  4DBB A;  2LUL A;  2AEH A;  1PLS A;  3ML4 A;  1U5G A;  2Z13 A;  1NI2 A;  1ZC3 B;  2JP2 A;  4GMX B;  1BAK A;  1DDV A;  3SUZ A;  3QIJ A;  3PG7 A;  2GJY A;  1AWE A;  2R09 A;  4D6W A;  2P0F A;  2YF0 A;  2HTH B;  3HW2 B;  4C0A A;  4CHJ A;  3BJI A;  4XWX A;  4BBK A;  3ULB A;  2PZ1 A;  2QKM A;  4EKU A;  4K81 A;  2KR0 A;  1EF1 A;  4Z2M B;  1OY2 A;  1E5W A;  2HE7 A;  4IOY X;  4GOU A;  3ODO A;  1WGQ A;  1WG7 A;  2IFS A;  3TCA A;  2EMS A;  1Y5O A;  2D10 A;  5EFX A;  1MI1 A;  4NY0 A;  2Y7B A;  5D3X A;  5DI9 B;  2LOZ A;  5FI0 A;  1M7E A;  4HAV B;  1MK7 B;  1DDM A;  3ODW A;  2P0H A;  5JLJ B;  1FOE A;  4L6E A;  2RRF A;  3FVC A;  1FGY A;  1X1G A;  3OHM B;  1OQN A;  2Y8G A;  2UZS A;  4HB0 B;  5HE2 A;  2UVM A;  5CLQ B;  1H4R A;  1NTV A;  4DIX A;  4K17 A;  3TVV A;  3PZD A;  4IAP A;  2ELA A;  4DX9 0;  2H7D A;  4CHM A;  2ZPY A;  4WJ7 A;  3D8E A;  1GC7 A;  5J3Q A;  4MT7 A;  2DKP A;  5LON B;  2AL6 A;  5I2S A;  4A6F B;  3NSU A;  3P6A A;  4YL8 A;  3QBV B;  1ISN A;  3FSS A;  3KRW A;  2DX1 A;  5FI1 A;  4GNK B;  4KHO A;  3KZ1 A;  1UNR A;  1H10 A;  4OSN A;  1WI1 A;  4ZRJ A;  2DTC A;  2YS1 A;  1DRO A;  2KIG A;  4NSW A;  1RRP B;  1WJ1 A;  1TXD A;  5LOP B;  2J0M A;  5GOW B;  4L1R A;  3ODX A;  5D3V A;  2E2X A;  3NWF A;  1KI1 B;  1AQC A;  1M7R A;  1UPQ A;  4F7G A;  1J0W A;  1EGX A;  3CXB B;  2J0K A;  2X18 A;  2RGN B;  1Q67 A;  3DCX A;  2D9Y A;  4MK0 A;  3RCP A;  2N23 A;  1V5M A;  2VKI A;  1GG3 A;  1P5T A;  3PP2 A;  2ZKM X;  2DHJ A;  2R0D A;  4CSQ A;  3F5R A;  1NTY A;  3DXD A;  3ZDT A;  2YS5 A;  2Z59 A;  1ZC4 B;  3AJ4 A;  5C5B B;  1TJ6 A;  5KCV A;  2V76 A;  1T77 A;  4EJN A;  3U8Z A;  1FHX A;  1PMS A;  2COC A;  4TKN A;  3CIK A;  2P8V A;  3PVW A;  5HE1 A;  1EVH A;  2XQN M;  3VIA A;  4P7I A;  5J3Y A;  4F7H A;  2EJ8 A;  4TYZ A;  2MFQ A;  1Y19 B;  5KQ1 A;  2DFK A;  2L1C A;  1P6S A;  2MWN B;  4HB2 B; 
#chains in the Genus database with same CATH homology
 1PFJ A;  2J59 M;  3V5W A;  2Q13 A;  3QWM A;  1FHO A;  5L81 A;  3DXE A;  1BTN A;  2H7E A;  5DIF B;  2EC1 A;  2FJL A;  2CY5 A;  1N3H A;  1Z87 A;  2MDX A;  1QC6 A;  3D8F A;  1I7A A;  2K00 A;  1XX0 A;  4A6F A;  1ZSQ A;  4CYE A;  1FHW A;  2RVB B;  2KUP A;  4H8S A;  2QKL A;  1KZ7 A;  4HB3 B;  4YON A;  2K2J A;  3SO6 A;  2YT0 A;  1X11 A;  5DHF B;  5JHH A;  5C79 A;  2DN6 A;  4KHB B;  5C6R A;  2COD A;  3X23 A;  2W2X D;  2K2U A;  2Z0Q A;  3GYO A;  2W2W A;  2LYD A;  4A6K A;  3DXC A;  1V89 A;  4HAY B;  3OAN A;  1EAZ A;  1MKE A;  1ZM0 A;  3IVF A;  2M38 A;  2DHK A;  1V61 A;  2RNR B;  4K2O A;  4KVG B;  2YT1 A;  4PQ0 A;  3U7D A;  4Z2N A;  4B6H A;  1XD4 A;  2DYQ A;  4HB4 B;  2I5C A;  1BTK A;  3D8D A;  4PNK A;  2I1K A;  1LB1 A;  2YS3 A;  5DHA B;  4A5K A;  1WVH A;  5HE0 A;  3M1I B;  2DYN A;  1K5G B;  1K5D B;  4KHA A;  2J0J A;  5C5B A;  4HAT B;  1XKE A;  2N0Y A;  3PEG A;  1U5E A;  3PVL A;  4HAU B;  3TO1 A;  3FEH A;  2LOX A;  4ZRI A;  3WA0 A;  1U27 A;  4A6H A;  1ZVR A;  2P0D A;  1FB8 A;  2W2X C;  1U2B A;  3T06 A;  4HHV A;  2MKR A;  1NU2 A;  1X05 A;  2RSG A;  4DXA B;  4EMO A;  2YVC A;  1MAI A;  3PSC A;  3HK0 A;  3WYF B;  4WSF A;  1GC6 A;  1X86 A;  2NMB A;  3F0W A;  1LW3 A;  5C16 A;  2DHI A;  1B55 A;  5CLL B;  2DX5 A;  2GCL A;  2CY4 A;  5D27 A;  2CAY A;  4HAZ B;  2NZ8 B;  1U5F A;  2D9X A;  3P7Z A;  2COA A;  3KY9 A;  4IFS A;  1UNP A;  1TQZ A;  3TFM A;  2UZR A;  5HE3 A;  2LG1 A;  3MPX A;  1P3R A;  1J19 A;  3ZVR A;  5DH9 B;  4MY6 A;  1DBH A;  1U5D A;  2VSZ A;  2D2Q A;  1UPR A;  3TW1 A;  1FAO A;  3PVU A;  2GCJ A;  1V88 A;  3A8P A;  2ELB A;  1SGH A;  1W1D A;  1FGZ A;  2KCJ A;  3LJU X;  1WJM A;  3KRX A;  3A8Q A;  4F7U P;  1MIZ B;  1QQG A;  5D3W A;  2Y8F A;  3HQC A;  3SV1 A;  1X1F A;  3BIN A;  3KSY A;  2YSZ A;  2IYB A;  1BWN A;  1W1G A;  4HDO A;  2D11 A;  2DKQ A;  4GPT B;  1UNQ A;  3GYP A;  5KQ4 A;  2CRF A;  4HAW B;  3SYX A;  3N7C A;  1RJ2 A;  1OMW A;  2DLW A;  4ZRK A;  2G35 A;  3G9W A;  5J3T A;  2M14 A;  3FM8 C;  2L2I A;  3ULC A;  4K2P A;  4DX8 A;  2OQB A;  3SNH A;  4GN1 A;  3UZT A;  1V5P A;  1XR0 B;  4GMV A;  2I5F A;  1IRS A;  4HAX B;  1MPH A;  5JP4 A;  1SHC A;  2EMT A;  2KGX B;  2COF A;  2Z0P A;  1MIX A;  1U29 A;  4KAX B;  1WGU A;  2GS0 A;  2ROZ B;  1KZG A;  2YRY A;  3AU5 A;  3AU4 A;  2RLO A;  2OTX A;  3MDB C;  2I1J A;  2D9V A;  4WVF B;  1V5U A;  4D0N B;  1UEF A;  2D9W A;  2VRW B;  3O96 A;  1I2H A;  1DYN A;  1DDW A;  1MK9 B;  4GZU A;  3A98 B;  4GXB A;  2Z0O A;  3VOQ A;  2DA0 A;  5JHG A;  1XCG A;  4Y94 A;  2RUK B;  1W1H A;  2BCJ A;  2ROV A;  2D4Q A;  2LKO A;  1XOD A;  2ADZ A;  5D3Y A;  4HDQ A;  2D9Z A;  4DBB A;  2LUL A;  2AEH A;  1PLS A;  3ML4 A;  1U5G A;  1NI2 A;  1ZC3 B;  2JP2 A;  4GMX B;  1BAK A;  1DDV A;  3SUZ A;  3QIJ A;  3PG7 A;  2GJY A;  1AWE A;  2R09 A;  2P0F A;  2YF0 A;  2HTH B;  3HW2 B;  4C0A A;  4CHJ A;  3BJI A;  4XWX A;  4BBK A;  3ULB A;  2PZ1 A;  2QKM A;  4EKU A;  4K81 A;  1EF1 A;  4Z2M B;  1OY2 A;  1E5W A;  2HE7 A;  4IOY X;  3ODO A;  1WGQ A;  1WG7 A;  2IFS A;  3TCA A;  2EMS A;  1Y5O A;  2D10 A;  5EFX A;  4NY0 A;  2Y7B A;  5D3X A;  5DI9 B;  2LOZ A;  5FI0 A;  1M7E A;  4HAV B;  1MK7 B;  1DDM A;  3ODW A;  2P0H A;  5JLJ B;  1FOE A;  4L6E A;  1FGY A;  1X1G A;  1OQN A;  2Y8G A;  2UZS A;  4HB0 B;  5HE2 A;  2UVM A;  5CLQ B;  1H4R A;  1NTV A;  4K17 A;  3TVV A;  3PZD A;  4IAP A;  2ELA A;  4DX9 0;  2H7D A;  4CHM A;  2ZPY A;  4WJ7 A;  3D8E A;  1GC7 A;  5J3Q A;  4MT7 A;  2DKP A;  5LON B;  2AL6 A;  4A6F B;  3NSU A;  3P6A A;  4YL8 A;  3QBV B;  1ISN A;  3FSS A;  3KRW A;  2DX1 A;  5FI1 A;  4KHO A;  3KZ1 A;  1UNR A;  1H10 A;  1WI1 A;  4ZRJ A;  2DTC A;  2YS1 A;  1DRO A;  4NSW A;  1RRP B;  1WJ1 A;  1TXD A;  5LOP B;  2J0M A;  5GOW B;  3ODX A;  5D3V A;  2E2X A;  1KI1 B;  1AQC A;  1M7R A;  1UPQ A;  4F7G A;  1J0W A;  1EGX A;  3CXB B;  2J0K A;  2X18 A;  2RGN B;  1Q67 A;  2D9Y A;  4MK0 A;  3RCP A;  2N23 A;  1V5M A;  2VKI A;  1GG3 A;  1P5T A;  3PP2 A;  2DHJ A;  2R0D A;  3F5R A;  1NTY A;  3DXD A;  3ZDT A;  2YS5 A;  1ZC4 B;  3AJ4 A;  5C5B B;  1TJ6 A;  5KCV A;  2V76 A;  4EJN A;  3U8Z A;  1FHX A;  1PMS A;  2COC A;  4TKN A;  3CIK A;  2P8V A;  3PVW A;  5HE1 A;  1EVH A;  2XQN M;  3VIA A;  4P7I A;  5J3Y A;  4F7H A;  2EJ8 A;  4TYZ A;  2MFQ A;  1Y19 B;  5KQ1 A;  2DFK A;  2L1C A;  1P6S A;  2MWN B;  4HB2 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...