2HTHB

Structural basis for ubiquitin recognition by the human eap45/escrt-ii glue domain
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
129
structure length
129
Chain Sequence
RFVWTSGLLEINETLVIQQRGVRIYDGEEKIKFDAGTLLLSTHRLIWRDQKNHECCMAILLSQIVFIEEQAAGIGKSAKIVVHLHPAPPNKEPGPFQSSKNSYIKLSFKEHGQIEFYRRLSEEMTQRRW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for ubiquitin recognition by the human ESCRT-II EAP45 GLUE domain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
molecule keywords Ubiquitin
total genus 23
structure length 129
sequence length 129
ec nomenclature
pdb deposition date 2006-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF11605 Vps36_ESCRT-II Vacuolar protein sorting protein 36 Vps36
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2hthB00
2DHKA 2EMTA 3D8DA 1IRSA 2KCJA 1BWNA 2Y7BA 2YVCA 2DTCA 1P5TA 2RSGA 3TVVA 1EAZA 5HE0A 2W2XC 1OY2A 2OTXA 4HAUB 4K81A 3HW2B 1V61A 1DDWA 4YL8A 2K00A 2DYQA 1NU2A 2ZPYA 1RJ2A 4K2OA 1GC6A 1DROA 3KY9A 4DX8A 4HAZB 3A8PA 4KHBB 2LULA 3CXBB 1MIXA 3KSYA 5HE1A 2CY5A 2J0MA 3KZ1A 1SGHA 2GCLA 2JP2A 2NZ8B 1MK7B 3D8EA 1AQCA 1V5PA 4YONA 2D11A 2HE7A 1NTYA 1MPHA 3ML4A 4GN1A 3NSUA 1DDMA 2RVBB 5GOWB 1M7EA 4Z2NA 1WG7A 4Z2MB 5D3VA 3G9WA 1XR0B 2DN6A 2V76A 1UPQA 4Y94A 1GG3A 4HAXB 2KUPA 1PLSA 1UNQA 2PZ1A 5EFXA 2YSZA 1U5FA 3U8ZA 4TKNA 2E2XA 3WA0A 1XD4A 3DXDA 2LOZA 1I2HA 3SUZA 1QQGA 1U2BA 2H7EA 2P0HA 4MK0A 2D9YA 1V5MA 2UZSA 1P6SA 5CLQB 2K2UA 5D3XA 4CYEA 2P0FA 4B6HA 2GJYA 3SYXA 2ROVA 1BAKA 1U29A 4MY6A 3FM8C 4HB4B 1J19A 2CY4A 1FOEA 2EMSA 3PZDA 4ZRJA 1DBHA 1ZC3B 3PVUA 5J3TA 3M1IB 4L6EA 2DA0A 3PVLA 5KQ1A 4H8SA 1H10A 4BBKA 3F5RA 2GCJA 4GMXB 2R0DA 1UPRA 2N23A 2YT1A 5KQ4A 2Y8GA 3WYFB 2LG1A 2P0DA 4NSWA 2AL6A 1EVHA 1FB8A 3ODXA 1AWEA 4IFSA 2RLOA 2XQNM 2Z0QA 4MT7A 2X18A 1V89A 3A98B 1MKEA 1W1HA 1FGZA 2Z0PA 1H4RA 1QC6A 3TFMA 2IYBA 2MKRA 4F7UP 2GS0A 2EJ8A 3SO6A 4C0AA 2NMBA 2DHJA 2D9XA 2J59M 1BTKA 3V5WA 3U7DA 3GYPA 3QWMA 2L1CA 4EMOA 2ELBA 1RRPB 1Z87A 4PQ0A 1P3RA 2L2IA 2AEHA 2N0YA 1W1GA 4KHAA 4WJ7A 2LYDA 1DDVA 4A6HA 4A6FA 5DHAB 1ZSQA 2D9WA 3TO1A 3IVFA 1B55A 2CRFA 4KAXB 3PVWA 4HATB 3TW1A 2BCJA 2RUKB 4K2PA 3ULBA 2UZRA 5JP4A 3P6AA 3SV1A 5DHFB 1MK9B 5D3WA 4D0NB 3PEGA 1U5DA 3FEHA 1Y19B 2D10A 1X1FA 1KI1B 3KRWA 3AU5A 3PP2A 2DYNA 1TQZA 1Y5OA 2QKMA 1WGUA 3P7ZA 3KRXA 5DI9B 2QKLA 3TCAA 2D2QA 1FHWA 1WGQA 1Q67A 1ZC4B 1V5UA 5J3YA 5JHHA 1FHXA 2COFA 5C5BB 2COCA 1X86A 1PFJA 2OQBA 2RGNB 2H7DA 2DKQA 5HE3A 2COAA 4HB0B 2K2JA 4TYZA 2DHIA 2DX5A 2VKIA 4KVGB 1W1DA 1MAIA 4WVFB 1X11A 1FAOA 1I7AA 2CODA 1PMSA 3LJUX 2UVMA 1X1GA 2ROZB 1KZGA 5J3QA 4IOYX 1X05A 3OANA 4HAWB 1LB1A 1J0WA 2M38A 5L81A 5DIFB 1SHCA 2IFSA 1OQNA 4A6FB 2LOXA 2HTHB 3ULCA 4ZRKA 5HE2A 2I5CA 5FI0A 1FGYA 4PNKA 1U5GA 3ODOA 5KCVA 1K5GB 3VOQA 2D9VA 3A8QA 4IAPA 5C6RA 3DXEA 1WI1A 2VRWB 2DX1A 1UNPA 2P8VA 4HHVA 2Z0OA 3MPXA 1U27A 1ZVRA 1WJMA 4GMVA 2I1KA 4DXAB 1E5WA 2CAYA 4GZUA 3VIAA 5LOPB 2Y8FA 2YS5A 2G35A 2I5FA 5C16A 3RCPA 5C79A 1V88A 2M14A 5C5BA 4NY0A 2YT0A 1UEFA 5CLLB 4CHJA 2YF0A 5DH9B 4HDQA 1BTNA 1WVHA 1OMWA 4XWXA 4EJNA 1KZ7A 2Q13A 1TJ6A 4GPTB 1XX0A 4A6KA 3ODWA 2J0JA 3PG7A 4HB2B 1UNRA 3N7CA 2VSZA 3SNHA 3MDBC 1ZM0A 2DLWA 1NTVA 2ELAA 2YS1A 5D3YA 1ISNA 2EC1A 2LKOA 2MWNB 4GXBA 4F7HA 1N3HA 3DXCA 1XCGA 2D9ZA 1TXDA 4A5KA 5LONB 3AJ4A 1EGXA 1XODA 3QBVB 2FJLA 2YRYA 1FHOA 4DBBA 2DFKA 3BJIA 2ADZA 2KGXB 4K17A 4HDOA 3T06A 2J0KA 1EF1A 2D4QA 1WJ1A 3BINA 2W2WA 3F0WA 5JLJB 1K5DB 3X23A 4DX90 4EKUA 2RNRB 3QIJA 3HQCA 5D27A 4P7IA 2R09A 2DKPA 1GC7A 1LW3A 3PSCA 4CHMA 4HAVB 2MFQA 3FSSA 2MDXA 1U5EA 2W2XD 4HAYB 2I1JA 1DYNA 3HK0A 4HB3B 4F7GA 1XKEA 1NI2A 3ZDTA 1M7RA 2YS3A 4KHOA 3ZVRA 3O96A 3D8FA 3CIKA 3GYOA 5JHGA 5FI1A 4ZRIA 1MIZB 4WSFA 3AU4A 3UZTA
chains in the Genus database with same CATH superfamily
2DHKA 2EMTA 3D8DA 1IRSA 2KCJA 1BWNA 2Y7BA 2YVCA 2DTCA 1P5TA 2RSGA 3TVVA 1EAZA 5HE0A 2W2XC 1OY2A 2OTXA 4HAUB 4K81A 3HW2B 1V61A 2Z14A 1DDWA 4YL8A 2K00A 2Z4DA 2DYQA 1NU2A 2ZPYA 1RJ2A 4K2OA 1ZYIA 1GC6A 1DROA 3KY9A 4DX8A 4HAZB 3A8PA 4KHBB 2LULA 3CXBB 1MIXA 3KSYA 5HE1A 2CY5A 2J0MA 2YT2A 3KZ1A 1SGHA 2Z59A 2GCLA 2JP2A 2NZ8B 1MK7B 3D8EA 1AQCA 1V5PA 4YONA 2D11A 2HE7A 1NTYA 2KIGA 1MPHA 3ML4A 4GN1A 3NSUA 1DDMA 2RVBB 5GOWB 1M7EA 4Z2NA 1WG7A 4Z2MB 5D3VA 3G9WA 1XR0B 2DN6A 2V76A 1UPQA 4DIXA 4Y94A 1GG3A 2K8EA 4HAXB 2KUPA 1PLSA 1UNQA 2PZ1A 5EFXA 2YSZA 1U5FA 3FVCA 3U8ZA 4TKNA 2E2XA 3WA0A 1XD4A 3DXDA 2LOZA 1I2HA 3SUZA 3U12A 1QQGA 1U2BA 2H7EA 2P0HA 3OHMB 4MK0A 2D9YA 1V5MA 2UZSA 1P6SA 5CLQB 2K2UA 5D3XA 4CYEA 2P0FA 4B6HA 2GJYA 3SYXA 2ROVA 1BAKA 1U29A 4MY6A 3FM8C 4D6WA 3HSAA 4HB4B 1J19A 2CY4A 1FOEA 2EMSA 3NWAA 3PZDA 2FJUB 4ZRJA 1DBHA 1ZC3B 3PVUA 5J3TA 3M1IB 4L6EA 2DA0A 5I2MA 3PVLA 5IRSA 5KQ1A 4H8SA 1H10A 4BBKA 3F5RA 2GCJA 4GMXB 4KHBA 2R0DA 1UPRA 2N23A 2YT1A 5KQ4A 2Y8GA 3WYFB 2LG1A 2P0DA 4NSWA 2AL6A 1EVHA 1FB8A 3ODXA 1AWEA 4IFSA 2RLOA 2RRFA 2XQNM 4QXAB 2Z0QA 4MT7A 2X18A 1V89A 3A98B 1MKEA 1W1HA 1FGZA 4QJ5B 2Z0PA 2K49A 1H4RA 1QC6A 3TFMA 2Z13A 2IYBA 2MKRA 4F7UP 2KR0A 2GS0A 2EJ8A 3SO6A 4C0AA 2NMBA 2KUQA 2DHJA 2D9XA 2J59M 1BTKA 3V5WA 3U7DA 3GYPA 3QWMA 2L1CA 4EMOA 2ELBA 1RRPB 1Z87A 4PQ0A 1P3RA 2L2IA 2AEHA 2N0YA 1W1GA 4KHAA 4WJ7A 3A58A 2LYDA 1DDVA 4A6HA 4A6FA 5DHAB 1ZSQA 2D9WA 3HIEA 3TO1A 3IVFA 1B55A 2CRFA 2KIEA 3PVWA 4KAXB 4HATB 3TW1A 4CSQA 2BCJA 2RUKB 4K2PA 3ULBA 2UZRA 4GOUA 5JP4A 5I2SA 3P6AA 3SV1A 5DHFB 1MK9B 5D3WA 4D0NB 3PEGA 1U5DA 3FEHA 1Y19B 2D10A 1X1FA 1KI1B 3KRWA 3AU5A 3PP2A 2DYNA 1TQZA 1Y5OA 2QKMA 1WGUA 3P7ZA 3KRXA 5DI9B 2QKLA 3TCAA 2D2QA 1FHWA 3B77A 1WGQA 1Q67A 1ZC4B 1V5UA 5J3YA 5JHHA 1FHXA 2COFA 5C5BB 2COCA 1X86A 1PFJA 2OQBA 2RGNB 2H7DA 3DCXA 2DKQA 5HE3A 2COAA 4HB0B 2K2JA 4TYZA 2DHIA 2DX5A 2VKIA 5LG4B 4KVGB 1W1DA 1MAIA 4WVFB 1X11A 1FAOA 1I7AA 2CODA 1PMSA 3LJUX 2UVMA 1X1GA 2ROZB 1KZGA 5J3QA 4IOYX 1X05A 3OANA 4HAWB 1LB1A 1J0WA 2M38A 5L81A 5DIFB 4OT1A 1SHCA 2IFSA 4HSIA 1OQNA 2ZKMX 4A6FB 2LOXA 2HTHB 3ULCA 4ZRKA 5M4YB 5HE2A 2I5CA 5FI0A 1FGYA 4PNKA 1U5GA 3ODOA 5KCVA 1K5GB 3VOQA 2D9VA 3A8QA 1T77A 4IAPA 5C6RA 3DXEA 3NWFA 1WI1A 2VRWB 2DX1A 1UNPA 2P8VA 4HHVA 2Z0OA 3MPXA 1U27A 1ZVRA 1WJMA 1MI1A 4GMVA 2I1KA 4DXAB 1E5WA 2CAYA 4GZUA 3VIAA 5LOPB 2Y8FA 2YS5A 2G35A 2I5FA 5C16A 3RCPA 5C79A 1V88A 2M14A 5C5BA 4NY0A 2YT0A 1UEFA 5CLLB 4CHJA 2YF0A 5DH9B 4HDQA 1BTNA 1WVHA 1OMWA 4XWXA 4EJNA 1KZ7A 2Q13A 1TJ6A 4GPTB 4GNKB 1XX0A 4A6KA 3ODWA 2J0JA 3PG7A 4HB2B 1UNRA 3N7CA 2VSZA 3SNHA 3MDBC 1ZM0A 2DLWA 1NTVA 2ELAA 2YS1A 4L1RA 5D3YA 1ISNA 2EC1A 2LKOA 2MWNB 3NWDA 4GXBA 4F7HA 1N3HA 3DXCA 1XCGA 2D9ZA 1TXDA 4A5KA 5LONB 3AJ4A 2R2YA 2NBVA 1EGXA 1XODA 3QBVB 2FJLA 2YRYA 1FHOA 4DBBA 2DFKA 3BJIA 2ADZA 2KGXB 4K17A 4HDOA 3T06A 2J0KA 1EF1A 2D4QA 1WJ1A 3BINA 2W2WA 2GUMA 3F0WA 3NW8A 5JLJB 1K5DB 3X23A 4DX90 4EKUA 2RNRB 3QIJA 3HQCA 4QJ4B 5D27A 4P7IA 2R09A 2DKPA 1GC7A 1LW3A 3PSCA 4CHMA 4HAVB 2MFQA 3FSSA 2MDXA 1U5EA 2W2XD 4HAYB 2I1JA 1DYNA 3HK0A 4HB3B 4F7GA 1XKEA 4QJ3B 1NI2A 3ZDTA 1M7RA 2YS3A 4KHOA 3ZVRA 3O96A 3D8FA 3CIKA 4OSNA 3GYOA 5JHGA 5FI1A 4ZRIA 1MIZB 4WSFA 3AU4A 3UZTA
chains in the Genus database with same CATH topology
2DHKA 2EMTA 3D8DA 1IRSA 2KCJA 1BWNA 2Y7BA 2YVCA 2DTCA 1P5TA 2RSGA 3TVVA 1EAZA 5HE0A 2W2XC 1OY2A 2OTXA 4HAUB 4K81A 3HW2B 1V61A 1DDWA 4YL8A 2K00A 2DYQA 1NU2A 2ZPYA 1RJ2A 4K2OA 1GC6A 1DROA 3KY9A 4DX8A 4HAZB 3A8PA 4KHBB 2LULA 3CXBB 1MIXA 3KSYA 5HE1A 2CY5A 2J0MA 3KZ1A 1SGHA 2GCLA 2JP2A 2NZ8B 1MK7B 3D8EA 1AQCA 1V5PA 4YONA 2D11A 2HE7A 1NTYA 1MPHA 3ML4A 4GN1A 3NSUA 1DDMA 2RVBB 5GOWB 1M7EA 4Z2NA 1WG7A 4Z2MB 5D3VA 3G9WA 1XR0B 2DN6A 2V76A 1UPQA 4Y94A 1GG3A 4HAXB 2KUPA 1PLSA 1UNQA 2PZ1A 5EFXA 2YSZA 1U5FA 3U8ZA 4TKNA 2E2XA 3WA0A 1XD4A 3DXDA 2LOZA 1I2HA 3SUZA 1QQGA 1U2BA 2H7EA 2P0HA 4MK0A 2D9YA 1V5MA 2UZSA 1P6SA 5CLQB 2K2UA 5D3XA 4CYEA 2P0FA 4B6HA 2GJYA 3SYXA 2ROVA 1BAKA 1U29A 4MY6A 3FM8C 4HB4B 1J19A 2CY4A 1FOEA 2EMSA 3PZDA 4ZRJA 1DBHA 1ZC3B 3PVUA 5J3TA 3M1IB 4L6EA 2DA0A 3PVLA 5KQ1A 4H8SA 1H10A 4BBKA 3F5RA 2GCJA 4GMXB 2R0DA 1UPRA 2N23A 2YT1A 5KQ4A 2Y8GA 3WYFB 2LG1A 2P0DA 4NSWA 2AL6A 1EVHA 1FB8A 3ODXA 1AWEA 4IFSA 2RLOA 2XQNM 2Z0QA 4MT7A 2X18A 1V89A 3A98B 1MKEA 1W1HA 1FGZA 2Z0PA 1H4RA 1QC6A 3TFMA 2IYBA 2MKRA 4F7UP 2GS0A 2EJ8A 3SO6A 4C0AA 2NMBA 2DHJA 2D9XA 2J59M 1BTKA 3V5WA 3U7DA 3GYPA 3QWMA 2L1CA 4EMOA 2ELBA 1RRPB 1Z87A 4PQ0A 1P3RA 2L2IA 2AEHA 2N0YA 1W1GA 4KHAA 4WJ7A 2LYDA 1DDVA 4A6HA 4A6FA 5DHAB 1ZSQA 2D9WA 3TO1A 3IVFA 1B55A 2CRFA 4KAXB 3PVWA 4HATB 3TW1A 2BCJA 2RUKB 4K2PA 3ULBA 2UZRA 5JP4A 3P6AA 3SV1A 5DHFB 1MK9B 5D3WA 4D0NB 3PEGA 1U5DA 3FEHA 1Y19B 2D10A 1X1FA 1KI1B 3KRWA 3AU5A 3PP2A 2DYNA 1TQZA 1Y5OA 2QKMA 1WGUA 3P7ZA 3KRXA 5DI9B 2QKLA 3TCAA 2D2QA 1FHWA 1WGQA 1Q67A 1ZC4B 1V5UA 5J3YA 5JHHA 1FHXA 2COFA 5C5BB 2COCA 1X86A 1PFJA 2OQBA 2RGNB 2H7DA 2DKQA 5HE3A 2COAA 4HB0B 2K2JA 4TYZA 2DHIA 2DX5A 2VKIA 4KVGB 1W1DA 1MAIA 4WVFB 1X11A 1FAOA 1I7AA 2CODA 1PMSA 3LJUX 2UVMA 1X1GA 2ROZB 1KZGA 5J3QA 4IOYX 1X05A 3OANA 4HAWB 1LB1A 1J0WA 2M38A 5L81A 5DIFB 1SHCA 2IFSA 1OQNA 4A6FB 2LOXA 2HTHB 3ULCA 4ZRKA 5HE2A 2I5CA 5FI0A 1FGYA 4PNKA 1U5GA 3ODOA 5KCVA 1K5GB 3VOQA 2D9VA 3A8QA 4IAPA 5C6RA 3DXEA 1WI1A 2VRWB 2DX1A 1UNPA 2P8VA 4HHVA 2Z0OA 3MPXA 1U27A 1ZVRA 1WJMA 4GMVA 2I1KA 4DXAB 1E5WA 2CAYA 4GZUA 3VIAA 5LOPB 2Y8FA 2YS5A 2G35A 2I5FA 5C16A 3RCPA 5C79A 1V88A 2M14A 5C5BA 4NY0A 2YT0A 1UEFA 5CLLB 4CHJA 2YF0A 5DH9B 4HDQA 1BTNA 1WVHA 1OMWA 4XWXA 4EJNA 1KZ7A 2Q13A 1TJ6A 4GPTB 1XX0A 4A6KA 3ODWA 2J0JA 3PG7A 4HB2B 1UNRA 3N7CA 2VSZA 3SNHA 3MDBC 1ZM0A 2DLWA 1NTVA 2ELAA 2YS1A 5D3YA 1ISNA 2EC1A 2LKOA 2MWNB 4GXBA 4F7HA 1N3HA 3DXCA 1XCGA 2D9ZA 1TXDA 4A5KA 5LONB 3AJ4A 1EGXA 1XODA 3QBVB 2FJLA 2YRYA 1FHOA 4DBBA 2DFKA 3BJIA 2ADZA 2KGXB 4K17A 4HDOA 3T06A 2J0KA 1EF1A 2D4QA 1WJ1A 3BINA 2W2WA 3F0WA 5JLJB 1K5DB 3X23A 4DX90 4EKUA 2RNRB 3QIJA 3HQCA 5D27A 4P7IA 2R09A 2DKPA 1GC7A 1LW3A 3PSCA 4CHMA 4HAVB 2MFQA 3FSSA 2MDXA 1U5EA 2W2XD 4HAYB 2I1JA 1DYNA 3HK0A 4HB3B 4F7GA 1XKEA 1NI2A 3ZDTA 1M7RA 2YS3A 4KHOA 3ZVRA 3O96A 3D8FA 3CIKA 3GYOA 5JHGA 5FI1A 4ZRIA 1MIZB 4WSFA 3AU4A 3UZTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DHK A;  2EMT A;  3D8D A;  1IRS A;  2KCJ A;  1BWN A;  2Y7B A;  2YVC A;  2DTC A;  1P5T A;  2RSG A;  3TVV A;  1EAZ A;  5HE0 A;  2W2X C;  1OY2 A;  2OTX A;  4HAU B;  4K81 A;  3HW2 B;  1V61 A;  1DDW A;  4YL8 A;  2K00 A;  2DYQ A;  1NU2 A;  2ZPY A;  1RJ2 A;  4K2O A;  1GC6 A;  1DRO A;  3KY9 A;  4DX8 A;  4HAZ B;  3A8P A;  4KHB B;  2LUL A;  3CXB B;  1MIX A;  3KSY A;  5HE1 A;  2CY5 A;  2J0M A;  3KZ1 A;  1SGH A;  2GCL A;  2JP2 A;  2NZ8 B;  1MK7 B;  3D8E A;  1AQC A;  1V5P A;  4YON A;  2D11 A;  2HE7 A;  1NTY A;  1MPH A;  3ML4 A;  4GN1 A;  3NSU A;  1DDM A;  2RVB B;  5GOW B;  1M7E A;  4Z2N A;  1WG7 A;  4Z2M B;  5D3V A;  3G9W A;  1XR0 B;  2DN6 A;  2V76 A;  1UPQ A;  4Y94 A;  1GG3 A;  4HAX B;  2KUP A;  1PLS A;  1UNQ A;  2PZ1 A;  5EFX A;  2YSZ A;  1U5F A;  3U8Z A;  4TKN A;  2E2X A;  3WA0 A;  1XD4 A;  3DXD A;  2LOZ A;  1I2H A;  3SUZ A;  1QQG A;  1U2B A;  2H7E A;  2P0H A;  4MK0 A;  2D9Y A;  1V5M A;  2UZS A;  1P6S A;  5CLQ B;  2K2U A;  5D3X A;  4CYE A;  2P0F A;  4B6H A;  2GJY A;  3SYX A;  2ROV A;  1BAK A;  1U29 A;  4MY6 A;  3FM8 C;  4HB4 B;  1J19 A;  2CY4 A;  1FOE A;  2EMS A;  3PZD A;  4ZRJ A;  1DBH A;  1ZC3 B;  3PVU A;  5J3T A;  3M1I B;  4L6E A;  2DA0 A;  3PVL A;  5KQ1 A;  4H8S A;  1H10 A;  4BBK A;  3F5R A;  2GCJ A;  4GMX B;  2R0D A;  1UPR A;  2N23 A;  2YT1 A;  5KQ4 A;  2Y8G A;  3WYF B;  2LG1 A;  2P0D A;  4NSW A;  2AL6 A;  1EVH A;  1FB8 A;  3ODX A;  1AWE A;  4IFS A;  2RLO A;  2XQN M;  2Z0Q A;  4MT7 A;  2X18 A;  1V89 A;  3A98 B;  1MKE A;  1W1H A;  1FGZ A;  2Z0P A;  1H4R A;  1QC6 A;  3TFM A;  2IYB A;  2MKR A;  4F7U P;  2GS0 A;  2EJ8 A;  3SO6 A;  4C0A A;  2NMB A;  2DHJ A;  2D9X A;  2J59 M;  1BTK A;  3V5W A;  3U7D A;  3GYP A;  3QWM A;  2L1C A;  4EMO A;  2ELB A;  1RRP B;  1Z87 A;  4PQ0 A;  1P3R A;  2L2I A;  2AEH A;  2N0Y A;  1W1G A;  4KHA A;  4WJ7 A;  2LYD A;  1DDV A;  4A6H A;  4A6F A;  5DHA B;  1ZSQ A;  2D9W A;  3TO1 A;  3IVF A;  1B55 A;  2CRF A;  4KAX B;  3PVW A;  4HAT B;  3TW1 A;  2BCJ A;  2RUK B;  4K2P A;  3ULB A;  2UZR A;  5JP4 A;  3P6A A;  3SV1 A;  5DHF B;  1MK9 B;  5D3W A;  4D0N B;  3PEG A;  1U5D A;  3FEH A;  1Y19 B;  2D10 A;  1X1F A;  1KI1 B;  3KRW A;  3AU5 A;  3PP2 A;  2DYN A;  1TQZ A;  1Y5O A;  2QKM A;  1WGU A;  3P7Z A;  3KRX A;  5DI9 B;  2QKL A;  3TCA A;  2D2Q A;  1FHW A;  1WGQ A;  1Q67 A;  1ZC4 B;  1V5U A;  5J3Y A;  5JHH A;  1FHX A;  2COF A;  5C5B B;  2COC A;  1X86 A;  1PFJ A;  2OQB A;  2RGN B;  2H7D A;  2DKQ A;  5HE3 A;  2COA A;  4HB0 B;  2K2J A;  4TYZ A;  2DHI A;  2DX5 A;  2VKI A;  4KVG B;  1W1D A;  1MAI A;  4WVF B;  1X11 A;  1FAO A;  1I7A A;  2COD A;  1PMS A;  3LJU X;  2UVM A;  1X1G A;  2ROZ B;  1KZG A;  5J3Q A;  4IOY X;  1X05 A;  3OAN A;  4HAW B;  1LB1 A;  1J0W A;  2M38 A;  5L81 A;  5DIF B;  1SHC A;  2IFS A;  1OQN A;  4A6F B;  2LOX A;  2HTH B;  3ULC A;  4ZRK A;  5HE2 A;  2I5C A;  5FI0 A;  1FGY A;  4PNK A;  1U5G A;  3ODO A;  5KCV A;  1K5G B;  3VOQ A;  2D9V A;  3A8Q A;  4IAP A;  5C6R A;  3DXE A;  1WI1 A;  2VRW B;  2DX1 A;  1UNP A;  2P8V A;  4HHV A;  2Z0O A;  3MPX A;  1U27 A;  1ZVR A;  1WJM A;  4GMV A;  2I1K A;  4DXA B;  1E5W A;  2CAY A;  4GZU A;  3VIA A;  5LOP B;  2Y8F A;  2YS5 A;  2G35 A;  2I5F A;  5C16 A;  3RCP A;  5C79 A;  1V88 A;  2M14 A;  5C5B A;  4NY0 A;  2YT0 A;  1UEF A;  5CLL B;  4CHJ A;  2YF0 A;  5DH9 B;  4HDQ A;  1BTN A;  1WVH A;  1OMW A;  4XWX A;  4EJN A;  1KZ7 A;  2Q13 A;  1TJ6 A;  4GPT B;  1XX0 A;  4A6K A;  3ODW A;  2J0J A;  3PG7 A;  4HB2 B;  1UNR A;  3N7C A;  2VSZ A;  3SNH A;  3MDB C;  1ZM0 A;  2DLW A;  1NTV A;  2ELA A;  2YS1 A;  5D3Y A;  1ISN A;  2EC1 A;  2LKO A;  2MWN B;  4GXB A;  4F7H A;  1N3H A;  3DXC A;  1XCG A;  2D9Z A;  1TXD A;  4A5K A;  5LON B;  3AJ4 A;  1EGX A;  1XOD A;  3QBV B;  2FJL A;  2YRY A;  1FHO A;  4DBB A;  2DFK A;  3BJI A;  2ADZ A;  2KGX B;  4K17 A;  4HDO A;  3T06 A;  2J0K A;  1EF1 A;  2D4Q A;  1WJ1 A;  3BIN A;  2W2W A;  3F0W A;  5JLJ B;  1K5D B;  3X23 A;  4DX9 0;  4EKU A;  2RNR B;  3QIJ A;  3HQC A;  5D27 A;  4P7I A;  2R09 A;  2DKP A;  1GC7 A;  1LW3 A;  3PSC A;  4CHM A;  4HAV B;  2MFQ A;  3FSS A;  2MDX A;  1U5E A;  2W2X D;  4HAY B;  2I1J A;  1DYN A;  3HK0 A;  4HB3 B;  4F7G A;  1XKE A;  1NI2 A;  3ZDT A;  1M7R A;  2YS3 A;  4KHO A;  3ZVR A;  3O96 A;  3D8F A;  3CIK A;  3GYO A;  5JHG A;  5FI1 A;  4ZRI A;  1MIZ B;  4WSF A;  3AU4 A;  3UZT A; 
#chains in the Genus database with same CATH topology
 2DHK A;  2EMT A;  3D8D A;  1IRS A;  2KCJ A;  1BWN A;  2Y7B A;  2YVC A;  2DTC A;  1P5T A;  2RSG A;  3TVV A;  1EAZ A;  5HE0 A;  2W2X C;  1OY2 A;  2OTX A;  4HAU B;  4K81 A;  3HW2 B;  1V61 A;  2Z14 A;  1DDW A;  4YL8 A;  2K00 A;  2Z4D A;  2DYQ A;  1NU2 A;  2ZPY A;  1RJ2 A;  4K2O A;  1ZYI A;  1GC6 A;  1DRO A;  3KY9 A;  4DX8 A;  4HAZ B;  3A8P A;  4KHB B;  2LUL A;  3CXB B;  1MIX A;  3KSY A;  5HE1 A;  2CY5 A;  2J0M A;  2YT2 A;  3KZ1 A;  1SGH A;  2Z59 A;  2GCL A;  2JP2 A;  2NZ8 B;  1MK7 B;  3D8E A;  1AQC A;  1V5P A;  4YON A;  2D11 A;  2HE7 A;  1NTY A;  2KIG A;  1MPH A;  3ML4 A;  4GN1 A;  3NSU A;  1DDM A;  2RVB B;  5GOW B;  1M7E A;  4Z2N A;  1WG7 A;  4Z2M B;  5D3V A;  3G9W A;  1XR0 B;  2DN6 A;  2V76 A;  1UPQ A;  4DIX A;  4Y94 A;  1GG3 A;  2K8E A;  4HAX B;  2KUP A;  1PLS A;  1UNQ A;  2PZ1 A;  5EFX A;  2YSZ A;  1U5F A;  3FVC A;  3U8Z A;  4TKN A;  2E2X A;  3WA0 A;  1XD4 A;  3DXD A;  2LOZ A;  1I2H A;  3SUZ A;  3U12 A;  1QQG A;  1U2B A;  2H7E A;  2P0H A;  3OHM B;  4MK0 A;  2D9Y A;  1V5M A;  2UZS A;  1P6S A;  5CLQ B;  2K2U A;  5D3X A;  4CYE A;  2P0F A;  4B6H A;  2GJY A;  3SYX A;  2ROV A;  1BAK A;  1U29 A;  4MY6 A;  3FM8 C;  4D6W A;  3HSA A;  4HB4 B;  1J19 A;  2CY4 A;  1FOE A;  2EMS A;  3NWA A;  3PZD A;  2FJU B;  4ZRJ A;  1DBH A;  1ZC3 B;  3PVU A;  5J3T A;  3M1I B;  4L6E A;  2DA0 A;  5I2M A;  3PVL A;  5IRS A;  5KQ1 A;  4H8S A;  1H10 A;  4BBK A;  3F5R A;  2GCJ A;  4GMX B;  4KHB A;  2R0D A;  1UPR A;  2N23 A;  2YT1 A;  5KQ4 A;  2Y8G A;  3WYF B;  2LG1 A;  2P0D A;  4NSW A;  2AL6 A;  1EVH A;  1FB8 A;  3ODX A;  1AWE A;  4IFS A;  2RLO A;  2RRF A;  2XQN M;  4QXA B;  2Z0Q A;  4MT7 A;  2X18 A;  1V89 A;  3A98 B;  1MKE A;  1W1H A;  1FGZ A;  4QJ5 B;  2Z0P A;  2K49 A;  1H4R A;  1QC6 A;  3TFM A;  2Z13 A;  2IYB A;  2MKR A;  4F7U P;  2KR0 A;  2GS0 A;  2EJ8 A;  3SO6 A;  4C0A A;  2NMB A;  2KUQ A;  2DHJ A;  2D9X A;  2J59 M;  1BTK A;  3V5W A;  3U7D A;  3GYP A;  3QWM A;  2L1C A;  4EMO A;  2ELB A;  1RRP B;  1Z87 A;  4PQ0 A;  1P3R A;  2L2I A;  2AEH A;  2N0Y A;  1W1G A;  4KHA A;  4WJ7 A;  3A58 A;  2LYD A;  1DDV A;  4A6H A;  4A6F A;  5DHA B;  1ZSQ A;  2D9W A;  3HIE A;  3TO1 A;  3IVF A;  1B55 A;  2CRF A;  2KIE A;  3PVW A;  4KAX B;  4HAT B;  3TW1 A;  4CSQ A;  2BCJ A;  2RUK B;  4K2P A;  3ULB A;  2UZR A;  4GOU A;  5JP4 A;  5I2S A;  3P6A A;  3SV1 A;  5DHF B;  1MK9 B;  5D3W A;  4D0N B;  3PEG A;  1U5D A;  3FEH A;  1Y19 B;  2D10 A;  1X1F A;  1KI1 B;  3KRW A;  3AU5 A;  3PP2 A;  2DYN A;  1TQZ A;  1Y5O A;  2QKM A;  1WGU A;  3P7Z A;  3KRX A;  5DI9 B;  2QKL A;  3TCA A;  2D2Q A;  1FHW A;  3B77 A;  1WGQ A;  1Q67 A;  1ZC4 B;  1V5U A;  5J3Y A;  5JHH A;  1FHX A;  2COF A;  5C5B B;  2COC A;  1X86 A;  1PFJ A;  2OQB A;  2RGN B;  2H7D A;  3DCX A;  2DKQ A;  5HE3 A;  2COA A;  4HB0 B;  2K2J A;  4TYZ A;  2DHI A;  2DX5 A;  2VKI A;  5LG4 B;  4KVG B;  1W1D A;  1MAI A;  4WVF B;  1X11 A;  1FAO A;  1I7A A;  2COD A;  1PMS A;  3LJU X;  2UVM A;  1X1G A;  2ROZ B;  1KZG A;  5J3Q A;  4IOY X;  1X05 A;  3OAN A;  4HAW B;  1LB1 A;  1J0W A;  2M38 A;  5L81 A;  5DIF B;  4OT1 A;  1SHC A;  2IFS A;  4HSI A;  1OQN A;  2ZKM X;  4A6F B;  2LOX A;  2HTH B;  3ULC A;  4ZRK A;  5M4Y B;  5HE2 A;  2I5C A;  5FI0 A;  1FGY A;  4PNK A;  1U5G A;  3ODO A;  5KCV A;  1K5G B;  3VOQ A;  2D9V A;  3A8Q A;  1T77 A;  4IAP A;  5C6R A;  3DXE A;  3NWF A;  1WI1 A;  2VRW B;  2DX1 A;  1UNP A;  2P8V A;  4HHV A;  2Z0O A;  3MPX A;  1U27 A;  1ZVR A;  1WJM A;  1MI1 A;  4GMV A;  2I1K A;  4DXA B;  1E5W A;  2CAY A;  4GZU A;  3VIA A;  5LOP B;  2Y8F A;  2YS5 A;  2G35 A;  2I5F A;  5C16 A;  3RCP A;  5C79 A;  1V88 A;  2M14 A;  5C5B A;  4NY0 A;  2YT0 A;  1UEF A;  5CLL B;  4CHJ A;  2YF0 A;  5DH9 B;  4HDQ A;  1BTN A;  1WVH A;  1OMW A;  4XWX A;  4EJN A;  1KZ7 A;  2Q13 A;  1TJ6 A;  4GPT B;  4GNK B;  1XX0 A;  4A6K A;  3ODW A;  2J0J A;  3PG7 A;  4HB2 B;  1UNR A;  3N7C A;  2VSZ A;  3SNH A;  3MDB C;  1ZM0 A;  2DLW A;  1NTV A;  2ELA A;  2YS1 A;  4L1R A;  5D3Y A;  1ISN A;  2EC1 A;  2LKO A;  2MWN B;  3NWD A;  4GXB A;  4F7H A;  1N3H A;  3DXC A;  1XCG A;  2D9Z A;  1TXD A;  4A5K A;  5LON B;  3AJ4 A;  2R2Y A;  2NBV A;  1EGX A;  1XOD A;  3QBV B;  2FJL A;  2YRY A;  1FHO A;  4DBB A;  2DFK A;  3BJI A;  2ADZ A;  2KGX B;  4K17 A;  4HDO A;  3T06 A;  2J0K A;  1EF1 A;  2D4Q A;  1WJ1 A;  3BIN A;  2W2W A;  2GUM A;  3F0W A;  3NW8 A;  5JLJ B;  1K5D B;  3X23 A;  4DX9 0;  4EKU A;  2RNR B;  3QIJ A;  3HQC A;  4QJ4 B;  5D27 A;  4P7I A;  2R09 A;  2DKP A;  1GC7 A;  1LW3 A;  3PSC A;  4CHM A;  4HAV B;  2MFQ A;  3FSS A;  2MDX A;  1U5E A;  2W2X D;  4HAY B;  2I1J A;  1DYN A;  3HK0 A;  4HB3 B;  4F7G A;  1XKE A;  4QJ3 B;  1NI2 A;  3ZDT A;  1M7R A;  2YS3 A;  4KHO A;  3ZVR A;  3O96 A;  3D8F A;  3CIK A;  4OSN A;  3GYO A;  5JHG A;  5FI1 A;  4ZRI A;  1MIZ B;  4WSF A;  3AU4 A;  3UZT A; 
#chains in the Genus database with same CATH homology
 2DHK A;  2EMT A;  3D8D A;  1IRS A;  2KCJ A;  1BWN A;  2Y7B A;  2YVC A;  2DTC A;  1P5T A;  2RSG A;  3TVV A;  1EAZ A;  5HE0 A;  2W2X C;  1OY2 A;  2OTX A;  4HAU B;  4K81 A;  3HW2 B;  1V61 A;  1DDW A;  4YL8 A;  2K00 A;  2DYQ A;  1NU2 A;  2ZPY A;  1RJ2 A;  4K2O A;  1GC6 A;  1DRO A;  3KY9 A;  4DX8 A;  4HAZ B;  3A8P A;  4KHB B;  2LUL A;  3CXB B;  1MIX A;  3KSY A;  5HE1 A;  2CY5 A;  2J0M A;  3KZ1 A;  1SGH A;  2GCL A;  2JP2 A;  2NZ8 B;  1MK7 B;  3D8E A;  1AQC A;  1V5P A;  4YON A;  2D11 A;  2HE7 A;  1NTY A;  1MPH A;  3ML4 A;  4GN1 A;  3NSU A;  1DDM A;  2RVB B;  5GOW B;  1M7E A;  4Z2N A;  1WG7 A;  4Z2M B;  5D3V A;  3G9W A;  1XR0 B;  2DN6 A;  2V76 A;  1UPQ A;  4Y94 A;  1GG3 A;  4HAX B;  2KUP A;  1PLS A;  1UNQ A;  2PZ1 A;  5EFX A;  2YSZ A;  1U5F A;  3U8Z A;  4TKN A;  2E2X A;  3WA0 A;  1XD4 A;  3DXD A;  2LOZ A;  1I2H A;  3SUZ A;  1QQG A;  1U2B A;  2H7E A;  2P0H A;  4MK0 A;  2D9Y A;  1V5M A;  2UZS A;  1P6S A;  5CLQ B;  2K2U A;  5D3X A;  4CYE A;  2P0F A;  4B6H A;  2GJY A;  3SYX A;  2ROV A;  1BAK A;  1U29 A;  4MY6 A;  3FM8 C;  4HB4 B;  1J19 A;  2CY4 A;  1FOE A;  2EMS A;  3PZD A;  4ZRJ A;  1DBH A;  1ZC3 B;  3PVU A;  5J3T A;  3M1I B;  4L6E A;  2DA0 A;  3PVL A;  5KQ1 A;  4H8S A;  1H10 A;  4BBK A;  3F5R A;  2GCJ A;  4GMX B;  2R0D A;  1UPR A;  2N23 A;  2YT1 A;  5KQ4 A;  2Y8G A;  3WYF B;  2LG1 A;  2P0D A;  4NSW A;  2AL6 A;  1EVH A;  1FB8 A;  3ODX A;  1AWE A;  4IFS A;  2RLO A;  2XQN M;  2Z0Q A;  4MT7 A;  2X18 A;  1V89 A;  3A98 B;  1MKE A;  1W1H A;  1FGZ A;  2Z0P A;  1H4R A;  1QC6 A;  3TFM A;  2IYB A;  2MKR A;  4F7U P;  2GS0 A;  2EJ8 A;  3SO6 A;  4C0A A;  2NMB A;  2DHJ A;  2D9X A;  2J59 M;  1BTK A;  3V5W A;  3U7D A;  3GYP A;  3QWM A;  2L1C A;  4EMO A;  2ELB A;  1RRP B;  1Z87 A;  4PQ0 A;  1P3R A;  2L2I A;  2AEH A;  2N0Y A;  1W1G A;  4KHA A;  4WJ7 A;  2LYD A;  1DDV A;  4A6H A;  4A6F A;  5DHA B;  1ZSQ A;  2D9W A;  3TO1 A;  3IVF A;  1B55 A;  2CRF A;  4KAX B;  3PVW A;  4HAT B;  3TW1 A;  2BCJ A;  2RUK B;  4K2P A;  3ULB A;  2UZR A;  5JP4 A;  3P6A A;  3SV1 A;  5DHF B;  1MK9 B;  5D3W A;  4D0N B;  3PEG A;  1U5D A;  3FEH A;  1Y19 B;  2D10 A;  1X1F A;  1KI1 B;  3KRW A;  3AU5 A;  3PP2 A;  2DYN A;  1TQZ A;  1Y5O A;  2QKM A;  1WGU A;  3P7Z A;  3KRX A;  5DI9 B;  2QKL A;  3TCA A;  2D2Q A;  1FHW A;  1WGQ A;  1Q67 A;  1ZC4 B;  1V5U A;  5J3Y A;  5JHH A;  1FHX A;  2COF A;  5C5B B;  2COC A;  1X86 A;  1PFJ A;  2OQB A;  2RGN B;  2H7D A;  2DKQ A;  5HE3 A;  2COA A;  4HB0 B;  2K2J A;  4TYZ A;  2DHI A;  2DX5 A;  2VKI A;  4KVG B;  1W1D A;  1MAI A;  4WVF B;  1X11 A;  1FAO A;  1I7A A;  2COD A;  1PMS A;  3LJU X;  2UVM A;  1X1G A;  2ROZ B;  1KZG A;  5J3Q A;  4IOY X;  1X05 A;  3OAN A;  4HAW B;  1LB1 A;  1J0W A;  2M38 A;  5L81 A;  5DIF B;  1SHC A;  2IFS A;  1OQN A;  4A6F B;  2LOX A;  2HTH B;  3ULC A;  4ZRK A;  5HE2 A;  2I5C A;  5FI0 A;  1FGY A;  4PNK A;  1U5G A;  3ODO A;  5KCV A;  1K5G B;  3VOQ A;  2D9V A;  3A8Q A;  4IAP A;  5C6R A;  3DXE A;  1WI1 A;  2VRW B;  2DX1 A;  1UNP A;  2P8V A;  4HHV A;  2Z0O A;  3MPX A;  1U27 A;  1ZVR A;  1WJM A;  4GMV A;  2I1K A;  4DXA B;  1E5W A;  2CAY A;  4GZU A;  3VIA A;  5LOP B;  2Y8F A;  2YS5 A;  2G35 A;  2I5F A;  5C16 A;  3RCP A;  5C79 A;  1V88 A;  2M14 A;  5C5B A;  4NY0 A;  2YT0 A;  1UEF A;  5CLL B;  4CHJ A;  2YF0 A;  5DH9 B;  4HDQ A;  1BTN A;  1WVH A;  1OMW A;  4XWX A;  4EJN A;  1KZ7 A;  2Q13 A;  1TJ6 A;  4GPT B;  1XX0 A;  4A6K A;  3ODW A;  2J0J A;  3PG7 A;  4HB2 B;  1UNR A;  3N7C A;  2VSZ A;  3SNH A;  3MDB C;  1ZM0 A;  2DLW A;  1NTV A;  2ELA A;  2YS1 A;  5D3Y A;  1ISN A;  2EC1 A;  2LKO A;  2MWN B;  4GXB A;  4F7H A;  1N3H A;  3DXC A;  1XCG A;  2D9Z A;  1TXD A;  4A5K A;  5LON B;  3AJ4 A;  1EGX A;  1XOD A;  3QBV B;  2FJL A;  2YRY A;  1FHO A;  4DBB A;  2DFK A;  3BJI A;  2ADZ A;  2KGX B;  4K17 A;  4HDO A;  3T06 A;  2J0K A;  1EF1 A;  2D4Q A;  1WJ1 A;  3BIN A;  2W2W A;  3F0W A;  5JLJ B;  1K5D B;  3X23 A;  4DX9 0;  4EKU A;  2RNR B;  3QIJ A;  3HQC A;  5D27 A;  4P7I A;  2R09 A;  2DKP A;  1GC7 A;  1LW3 A;  3PSC A;  4CHM A;  4HAV B;  2MFQ A;  3FSS A;  2MDX A;  1U5E A;  2W2X D;  4HAY B;  2I1J A;  1DYN A;  3HK0 A;  4HB3 B;  4F7G A;  1XKE A;  1NI2 A;  3ZDT A;  1M7R A;  2YS3 A;  4KHO A;  3ZVR A;  3O96 A;  3D8F A;  3CIK A;  3GYO A;  5JHG A;  5FI1 A;  4ZRI A;  1MIZ B;  4WSF A;  3AU4 A;  3UZT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...