2HTHB

Structural basis for ubiquitin recognition by the human eap45/escrt-ii glue domain
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
129
structure length
129
Chain Sequence
RFVWTSGLLEINETLVIQQRGVRIYDGEEKIKFDAGTLLLSTHRLIWRDQKNHECCMAILLSQIVFIEEQAAGIGKSAKIVVHLHPAPPNKEPGPFQSSKNSYIKLSFKEHGQIEFYRRLSEEMTQRRW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for ubiquitin recognition by the human ESCRT-II EAP45 GLUE domain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
molecule keywords Ubiquitin
total genus 23
structure length 129
sequence length 129
ec nomenclature
pdb deposition date 2006-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF11605 Vps36_ESCRT-II Vacuolar protein sorting protein 36 Vps36
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2hthB00
3P6AA 2HE7A 2NZ8B 3SNHA 1WVHA 3X23A 5EFXA 2DHKA 4EMOA 5KQ1A 1E5WA 4Z2NA 2P0DA 2DYQA 4IAPA 1KI1B 3A8PA 1U29A 1FHXA 2IYBA 2DKPA 2H7DA 1LB1A 2X18A 1V5PA 1EVHA 2RNRB 3A98B 3O96A 2ELAA 4D0NB 1ZC4B 3SV1A 2YS1A 1MPHA 2J59M 2NMBA 4HDOA 1XCGA 4DX8A 5JHGA 1X11A 4A6FB 3FSSA 4HAWB 3HW2B 1WJMA 3DXDA 1DDWA 5D3YA 5JLJB 4HDQA 3ZVRA 1W1GA 1N3HA 2MDXA 1ZC3B 3LJUX 4A5KA 4PQ0A 5C16A 5D3WA 2R0DA 2CODA 1K5DB 1X1GA 2CRFA 3TO1A 1WJ1A 1NU2A 2RSGA 2COFA 1ZVRA 1FAOA 4CYEA 1P6SA 1DDVA 3ML4A 4ZRIA 4BBKA 1IRSA 2VRWB 4K81A 2YVCA 5GOWB 1PFJA 2DN6A 1NI2A 1TJ6A 5LOPB 3FEHA 4KHOA 3AJ4A 2D9ZA 4ZRKA 3IVFA 3TFMA 1UNPA 4B6HA 5J3QA 2P0HA 2YS5A 2VSZA 1DBHA 1FHWA 1MIXA 4H8SA 2RLOA 3PZDA 4HATB 3KZ1A 2BCJA 2D9XA 2COCA 1RJ2A 3PVLA 2RGNB 4Y94A 2RVBB 2DKQA 2D10A 2G35A 4WSFA 1DROA 1XR0B 1U5FA 1ZSQA 3ODXA 1KZ7A 4HAUB 3QBVB 1QQGA 1MKEA 1OQNA 1V61A 2ROVA 3M1IB 2D9YA 2Q13A 4EKUA 2CY4A 3KRWA 2W2WA 1V88A 2YRYA 2YSZA 3ULCA 1UNQA 1W1HA 3PSCA 3SO6A 1DYNA 4TKNA 5LONB 1B55A 3AU4A 2CY5A 2D2QA 5KCVA 3SUZA 2KGXB 5HE0A 2Z0PA 1EGXA 2DX1A 2LG1A 1EF1A 2M38A 2UVMA 4P7IA 1X05A 2LOXA 1MIZB 2UZSA 3KY9A 5C5BB 3WYFB 2ROZB 2I5CA 5DHFB 3D8EA 5KQ4A 3WA0A 2V76A 4HB0B 3PG7A 1FOEA 5C5BA 3KRXA 3A8QA 3OANA 4PNKA 1MAIA 1Z87A 1FGYA 5DIFB 2I5FA 2QKLA 2GS0A 4Z2MB 4IFSA 1LW3A 4NSWA 2D9WA 1FHOA 4K2OA 3QWMA 4HB3B 3TW1A 4C0AA 1I7AA 3GYOA 4HB2B 4CHJA 3V5WA 1KZGA 4GN1A 4HHVA 1U5GA 5J3TA 3PVWA 2KUPA 2PZ1A 1V5MA 3MPXA 2Y8GA 3DXEA 2UZRA 3CXBB 2DLWA 2ADZA 4HAVB 1WI1A 3U7DA 5D3XA 3U8ZA 2J0JA 1P3RA 1TQZA 2M14A 2Z0OA 5HE1A 4GMXB 2W2XD 3G9WA 1OY2A 3N7CA 2JP2A 2ELBA 1PMSA 2RUKB 1GG3A 1FB8A 3P7ZA 3PEGA 4GXBA 1W1DA 5CLLB 2K00A 2EC1A 2H7EA 2VKIA 2XQNM 3GYPA 4HAYB 3D8DA 1SGHA 4EJNA 1ISNA 4IOYX 5CLQB 1XX0A 4YONA 3ODWA 2DA0A 2E2XA 2I1KA 3ODOA 2D4QA 2N0YA 2QKMA 3NSUA 1X86A 2YF0A 1ZM0A 2YT1A 2L2IA 1UPQA 3T06A 1WGUA 2YS3A 2I1JA 1WG7A 1Y19B 3PP2A 4DBBA 1DDMA 2LYDA 5DH9B 1EAZA 3HQCA 2D11A 2R09A 2D9VA 4HB4B 2AL6A 2L1CA 1XD4A 5JP4A 4F7GA 3ZDTA 4HAZB 2HTHB 1BAKA 4L6EA 4MY6A 3QIJA 1BTNA 5DI9B 2IFSA 4DXAB 1I2HA 1QC6A 1UEFA 2MWNB 4KHAA 2DFKA 4A6KA 3KSYA 4DX90 3RCPA 5L81A 4GMVA 2Y7BA 2KCJA 3BINA 1XODA 4GPTB 5C6RA 4NY0A 5FI1A 2GCLA 2DX5A 2J0KA 2GCJA 1K5GB 2OQBA 4MK0A 3PVUA 3UZTA 2CAYA 3BJIA 3AU5A 1M7RA 1MK9B 1V5UA 4WVFB 1SHCA 2MKRA 2P8VA 4A6HA 2W2XC 1J0WA 1H10A 2DTCA 4ZRJA 4HAXB 1M7EA 1FGZA 3MDBC 4A6FA 1OMWA 2EMSA 1U2BA 2P0FA 4TYZA 3TVVA 4WJ7A 1H4RA 3F5RA 3SYXA 5JHHA 1MK7B 3HK0A 1PLSA 2N23A 1AQCA 2COAA 1Y5OA 2OTXA 1TXDA 1NTVA 1BWNA 3F0WA 1XKEA 1AWEA 5J3YA 1U5DA 4KHBB 1U5EA 1WGQA 1UPRA 1UNRA 3ULBA 5FI0A 1X1FA 3CIKA 2DHIA 2LOZA 2MFQA 4K17A 4MT7A 4CHMA 4K2PA 2AEHA 2Y8FA 2LKOA 1J19A 5HE3A 5C79A 2DYNA 1V89A 1GC7A 3D8FA 2FJLA 1Q67A 4F7UP 5D27A 2K2JA 2J0MA 4YL8A 4KAXB 2LULA 2K2UA 1U27A 1NTYA 4F7HA 3VOQA 4XWXA 3VIAA 1BTKA 4GZUA 2GJYA 5HE2A 1P5TA 1RRPB 2EJ8A 1GC6A 2Z0QA 5DHAB 2YT0A 2EMTA 3FM8C 5D3VA 2ZPYA 3DXCA 3TCAA 4KVGB 2DHJA
chains in the Genus database with same CATH superfamily
3P6AA 2HE7A 2NZ8B 3SNHA 1WVHA 3X23A 5EFXA 2DHKA 4EMOA 5KQ1A 1E5WA 4Z2NA 2P0DA 2DYQA 4IAPA 1KI1B 3A8PA 1U29A 1FHXA 2IYBA 2DKPA 2H7DA 1LB1A 2X18A 1V5PA 1EVHA 2RNRB 3A98B 3O96A 2ELAA 4D0NB 2Z4DA 1ZC4B 3SV1A 2YS1A 1MPHA 2J59M 2NMBA 4HDOA 1XCGA 1T77A 4D6WA 4DX8A 5JHGA 1X11A 4A6FB 3FSSA 4HAWB 3HW2B 1WJMA 3DXDA 1DDWA 5D3YA 4DIXA 5JLJB 4HDQA 3ZVRA 1W1GA 4QXAB 1N3HA 2MDXA 1ZC3B 3LJUX 4A5KA 4PQ0A 5C16A 4HSIA 5D3WA 2R0DA 2CODA 1K5DB 1X1GA 2CRFA 3TO1A 1WJ1A 1NU2A 2RSGA 2COFA 1ZVRA 1FAOA 4CYEA 1P6SA 1DDVA 3ML4A 3FVCA 4ZRIA 4BBKA 1IRSA 1MI1A 2VRWB 4K81A 4OT1A 2YVCA 5GOWB 1PFJA 2DN6A 1NI2A 1TJ6A 5LOPB 3FEHA 4KHOA 3AJ4A 2D9ZA 4ZRKA 3IVFA 3TFMA 1UNPA 4B6HA 5J3QA 2P0HA 2YS5A 2VSZA 1DBHA 1FHWA 1MIXA 2RRFA 4H8SA 2RLOA 3PZDA 4HATB 3KZ1A 2BCJA 2D9XA 2COCA 1RJ2A 3PVLA 4QJ3B 2RGNB 4Y94A 2RVBB 2DKQA 2D10A 2G35A 4WSFA 1DROA 1XR0B 1U5FA 4CSQA 3HSAA 1ZSQA 3ODXA 1KZ7A 4HAUB 3QBVB 1QQGA 1MKEA 2NBVA 1OQNA 1V61A 2ROVA 3M1IB 2R2YA 2D9YA 2Q13A 4EKUA 2CY4A 3KRWA 2W2WA 1V88A 2YRYA 2YSZA 3ULCA 1UNQA 1W1HA 3PSCA 2KIEA 3SO6A 1DYNA 4TKNA 5LONB 1B55A 3AU4A 2CY5A 3U12A 2D2QA 5KCVA 2K8EA 3SUZA 2KGXB 5HE0A 2Z0PA 1EGXA 2DX1A 2LG1A 1EF1A 2M38A 2UVMA 4P7IA 1X05A 2LOXA 1MIZB 2UZSA 3OHMB 3KY9A 5C5BB 3WYFB 2ROZB 2I5CA 4GNKB 2Z59A 5DHFB 3D8EA 5KQ4A 3WA0A 2V76A 3B77A 3PG7A 4HB0B 1FOEA 5C5BA 3KRXA 3A8QA 3OANA 4PNKA 1MAIA 1Z87A 1FGYA 5DIFB 2I5FA 2QKLA 2GS0A 4Z2MB 4IFSA 1LW3A 4NSWA 2D9WA 1FHOA 4K2OA 3QWMA 4HB3B 3TW1A 4C0AA 1I7AA 3GYOA 4HB2B 4CHJA 3V5WA 1KZGA 4GN1A 4HHVA 1U5GA 5J3TA 3PVWA 2KUPA 2PZ1A 1V5MA 3MPXA 2Y8GA 3DXEA 2UZRA 3CXBB 2DLWA 2ADZA 4HAVB 1WI1A 3U7DA 5D3XA 3U8ZA 2J0JA 1P3RA 1TQZA 2M14A 2Z0OA 5HE1A 4GMXB 2W2XD 3G9WA 1OY2A 3N7CA 2JP2A 2ELBA 1PMSA 2RUKB 1GG3A 1FB8A 3P7ZA 3PEGA 4GXBA 1W1DA 5CLLB 2K00A 2EC1A 2H7EA 2VKIA 3DCXA 2XQNM 3GYPA 4HAYB 3D8DA 1SGHA 3NWDA 4EJNA 1ISNA 4IOYX 3NWFA 5CLQB 1XX0A 4YONA 3ODWA 2DA0A 2E2XA 2I1KA 3ODOA 2D4QA 2N0YA 2QKMA 3NSUA 1X86A 2YF0A 1ZM0A 2YT1A 2L2IA 1UPQA 3T06A 1WGUA 2YS3A 2I1JA 3NWAA 1WG7A 1Y19B 3PP2A 5LG4B 4DBBA 1DDMA 2LYDA 5DH9B 1EAZA 3HQCA 2D11A 2R09A 2D9VA 4HB4B 2AL6A 2L1CA 1XD4A 5I2MA 5JP4A 4F7GA 3HIEA 3ZDTA 4HAZB 2HTHB 5IRSA 1BAKA 4L6EA 4GOUA 4MY6A 3QIJA 1BTNA 5DI9B 2IFSA 2K49A 4DXAB 1I2HA 1QC6A 1UEFA 2MWNB 4KHAA 2DFKA 4A6KA 3KSYA 4DX90 3RCPA 5L81A 4GMVA 2KR0A 2Y7BA 2KCJA 2ZKMX 3BINA 1XODA 4GPTB 5C6RA 4NY0A 5FI1A 2GCLA 2DX5A 5I2SA 3A58A 2J0KA 2GCJA 1K5GB 2OQBA 4MK0A 3PVUA 3UZTA 2CAYA 2KUQA 3BJIA 3AU5A 1M7RA 1MK9B 2Z14A 1V5UA 4WVFB 1SHCA 2MKRA 2P8VA 4A6HA 2W2XC 1J0WA 1H10A 2DTCA 4ZRJA 5M4YB 4HAXB 4OSNA 1M7EA 1FGZA 3MDBC 4A6FA 1OMWA 2EMSA 1U2BA 2P0FA 4TYZA 3TVVA 4WJ7A 3NW8A 1H4RA 3F5RA 3SYXA 2FJUB 5JHHA 1MK7B 3HK0A 1PLSA 2N23A 4KHBA 1AQCA 2COAA 2GUMA 1Y5OA 4QJ4B 2OTXA 1TXDA 1NTVA 1BWNA 3F0WA 1XKEA 1AWEA 5J3YA 1U5DA 4KHBB 1U5EA 1WGQA 1UPRA 1UNRA 3ULBA 4QJ5B 5FI0A 1X1FA 3CIKA 2DHIA 2LOZA 2MFQA 2Z13A 4K17A 4MT7A 4CHMA 4K2PA 2AEHA 1ZYIA 2Y8FA 2LKOA 1J19A 5HE3A 5C79A 2DYNA 1V89A 1GC7A 3D8FA 2FJLA 1Q67A 4F7UP 5D27A 2K2JA 2J0MA 4YL8A 4KAXB 2LULA 2K2UA 1U27A 1NTYA 4F7HA 3VOQA 4XWXA 3VIAA 1BTKA 4GZUA 2GJYA 5HE2A 1P5TA 1RRPB 2EJ8A 2KIGA 1GC6A 2Z0QA 5DHAB 2YT0A 2EMTA 3FM8C 4L1RA 5D3VA 2YT2A 2ZPYA 3DXCA 3TCAA 4KVGB 2DHJA
chains in the Genus database with same CATH topology
3P6AA 2HE7A 2NZ8B 3SNHA 1WVHA 3X23A 5EFXA 2DHKA 4EMOA 5KQ1A 1E5WA 4Z2NA 2P0DA 2DYQA 4IAPA 1KI1B 3A8PA 1U29A 1FHXA 2IYBA 2DKPA 2H7DA 1LB1A 2X18A 1V5PA 1EVHA 2RNRB 3A98B 3O96A 2ELAA 4D0NB 1ZC4B 3SV1A 2YS1A 1MPHA 2J59M 2NMBA 4HDOA 1XCGA 4DX8A 5JHGA 1X11A 4A6FB 3FSSA 4HAWB 3HW2B 1WJMA 3DXDA 1DDWA 5D3YA 5JLJB 4HDQA 3ZVRA 1W1GA 1N3HA 2MDXA 1ZC3B 3LJUX 4A5KA 4PQ0A 5C16A 5D3WA 2R0DA 2CODA 1K5DB 1X1GA 2CRFA 3TO1A 1WJ1A 1NU2A 2RSGA 2COFA 1ZVRA 1FAOA 4CYEA 1P6SA 1DDVA 3ML4A 4ZRIA 4BBKA 1IRSA 2VRWB 4K81A 2YVCA 5GOWB 1PFJA 2DN6A 1NI2A 1TJ6A 5LOPB 3FEHA 4KHOA 3AJ4A 2D9ZA 4ZRKA 3IVFA 3TFMA 1UNPA 4B6HA 5J3QA 2P0HA 2YS5A 2VSZA 1DBHA 1FHWA 1MIXA 4H8SA 2RLOA 3PZDA 4HATB 3KZ1A 2BCJA 2D9XA 2COCA 1RJ2A 3PVLA 2RGNB 4Y94A 2RVBB 2DKQA 2D10A 2G35A 4WSFA 1DROA 1XR0B 1U5FA 1ZSQA 3ODXA 1KZ7A 4HAUB 3QBVB 1QQGA 1MKEA 1OQNA 1V61A 2ROVA 3M1IB 2D9YA 2Q13A 4EKUA 2CY4A 3KRWA 2W2WA 1V88A 2YRYA 2YSZA 3ULCA 1UNQA 1W1HA 3PSCA 3SO6A 1DYNA 4TKNA 5LONB 1B55A 3AU4A 2CY5A 2D2QA 5KCVA 3SUZA 2KGXB 5HE0A 2Z0PA 1EGXA 2DX1A 2LG1A 1EF1A 2M38A 2UVMA 4P7IA 1X05A 2LOXA 1MIZB 2UZSA 3KY9A 5C5BB 3WYFB 2ROZB 2I5CA 5DHFB 3D8EA 5KQ4A 3WA0A 2V76A 4HB0B 3PG7A 1FOEA 5C5BA 3KRXA 3A8QA 3OANA 4PNKA 1MAIA 1Z87A 1FGYA 5DIFB 2I5FA 2QKLA 2GS0A 4Z2MB 4IFSA 1LW3A 4NSWA 2D9WA 1FHOA 4K2OA 3QWMA 4HB3B 3TW1A 4C0AA 1I7AA 3GYOA 4HB2B 4CHJA 3V5WA 1KZGA 4GN1A 4HHVA 1U5GA 5J3TA 3PVWA 2KUPA 2PZ1A 1V5MA 3MPXA 2Y8GA 3DXEA 2UZRA 3CXBB 2DLWA 2ADZA 4HAVB 1WI1A 3U7DA 5D3XA 3U8ZA 2J0JA 1P3RA 1TQZA 2M14A 2Z0OA 5HE1A 4GMXB 2W2XD 3G9WA 1OY2A 3N7CA 2JP2A 2ELBA 1PMSA 2RUKB 1GG3A 1FB8A 3P7ZA 3PEGA 4GXBA 1W1DA 5CLLB 2K00A 2EC1A 2H7EA 2VKIA 2XQNM 3GYPA 4HAYB 3D8DA 1SGHA 4EJNA 1ISNA 4IOYX 5CLQB 1XX0A 4YONA 3ODWA 2DA0A 2E2XA 2I1KA 3ODOA 2D4QA 2N0YA 2QKMA 3NSUA 1X86A 2YF0A 1ZM0A 2YT1A 2L2IA 1UPQA 3T06A 1WGUA 2YS3A 2I1JA 1WG7A 1Y19B 3PP2A 4DBBA 1DDMA 2LYDA 5DH9B 1EAZA 3HQCA 2D11A 2R09A 2D9VA 4HB4B 2AL6A 2L1CA 1XD4A 5JP4A 4F7GA 3ZDTA 4HAZB 2HTHB 1BAKA 4L6EA 4MY6A 3QIJA 1BTNA 5DI9B 2IFSA 4DXAB 1I2HA 1QC6A 1UEFA 2MWNB 4KHAA 2DFKA 4A6KA 3KSYA 4DX90 3RCPA 5L81A 4GMVA 2Y7BA 2KCJA 3BINA 1XODA 4GPTB 5C6RA 4NY0A 5FI1A 2GCLA 2DX5A 2J0KA 2GCJA 1K5GB 2OQBA 4MK0A 3PVUA 3UZTA 2CAYA 3BJIA 3AU5A 1M7RA 1MK9B 1V5UA 4WVFB 1SHCA 2MKRA 2P8VA 4A6HA 2W2XC 1J0WA 1H10A 2DTCA 4ZRJA 4HAXB 1M7EA 1FGZA 3MDBC 4A6FA 1OMWA 2EMSA 1U2BA 2P0FA 4TYZA 3TVVA 4WJ7A 1H4RA 3F5RA 3SYXA 5JHHA 1MK7B 3HK0A 1PLSA 2N23A 1AQCA 2COAA 1Y5OA 2OTXA 1TXDA 1NTVA 1BWNA 3F0WA 1XKEA 1AWEA 5J3YA 1U5DA 4KHBB 1U5EA 1WGQA 1UPRA 1UNRA 3ULBA 5FI0A 1X1FA 3CIKA 2DHIA 2LOZA 2MFQA 4K17A 4MT7A 4CHMA 4K2PA 2AEHA 2Y8FA 2LKOA 1J19A 5HE3A 5C79A 2DYNA 1V89A 1GC7A 3D8FA 2FJLA 1Q67A 4F7UP 5D27A 2K2JA 2J0MA 4YL8A 4KAXB 2LULA 2K2UA 1U27A 1NTYA 4F7HA 3VOQA 4XWXA 3VIAA 1BTKA 4GZUA 2GJYA 5HE2A 1P5TA 1RRPB 2EJ8A 1GC6A 2Z0QA 5DHAB 2YT0A 2EMTA 3FM8C 5D3VA 2ZPYA 3DXCA 3TCAA 4KVGB 2DHJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3P6A A;  2HE7 A;  2NZ8 B;  3SNH A;  1WVH A;  3X23 A;  5EFX A;  2DHK A;  4EMO A;  5KQ1 A;  1E5W A;  4Z2N A;  2P0D A;  2DYQ A;  4IAP A;  1KI1 B;  3A8P A;  1U29 A;  1FHX A;  2IYB A;  2DKP A;  2H7D A;  1LB1 A;  2X18 A;  1V5P A;  1EVH A;  2RNR B;  3A98 B;  3O96 A;  2ELA A;  4D0N B;  1ZC4 B;  3SV1 A;  2YS1 A;  1MPH A;  2J59 M;  2NMB A;  4HDO A;  1XCG A;  4DX8 A;  5JHG A;  1X11 A;  4A6F B;  3FSS A;  4HAW B;  3HW2 B;  1WJM A;  3DXD A;  1DDW A;  5D3Y A;  5JLJ B;  4HDQ A;  3ZVR A;  1W1G A;  1N3H A;  2MDX A;  1ZC3 B;  3LJU X;  4A5K A;  4PQ0 A;  5C16 A;  5D3W A;  2R0D A;  2COD A;  1K5D B;  1X1G A;  2CRF A;  3TO1 A;  1WJ1 A;  1NU2 A;  2RSG A;  2COF A;  1ZVR A;  1FAO A;  4CYE A;  1P6S A;  1DDV A;  3ML4 A;  4ZRI A;  4BBK A;  1IRS A;  2VRW B;  4K81 A;  2YVC A;  5GOW B;  1PFJ A;  2DN6 A;  1NI2 A;  1TJ6 A;  5LOP B;  3FEH A;  4KHO A;  3AJ4 A;  2D9Z A;  4ZRK A;  3IVF A;  3TFM A;  1UNP A;  4B6H A;  5J3Q A;  2P0H A;  2YS5 A;  2VSZ A;  1DBH A;  1FHW A;  1MIX A;  4H8S A;  2RLO A;  3PZD A;  4HAT B;  3KZ1 A;  2BCJ A;  2D9X A;  2COC A;  1RJ2 A;  3PVL A;  2RGN B;  4Y94 A;  2RVB B;  2DKQ A;  2D10 A;  2G35 A;  4WSF A;  1DRO A;  1XR0 B;  1U5F A;  1ZSQ A;  3ODX A;  1KZ7 A;  4HAU B;  3QBV B;  1QQG A;  1MKE A;  1OQN A;  1V61 A;  2ROV A;  3M1I B;  2D9Y A;  2Q13 A;  4EKU A;  2CY4 A;  3KRW A;  2W2W A;  1V88 A;  2YRY A;  2YSZ A;  3ULC A;  1UNQ A;  1W1H A;  3PSC A;  3SO6 A;  1DYN A;  4TKN A;  5LON B;  1B55 A;  3AU4 A;  2CY5 A;  2D2Q A;  5KCV A;  3SUZ A;  2KGX B;  5HE0 A;  2Z0P A;  1EGX A;  2DX1 A;  2LG1 A;  1EF1 A;  2M38 A;  2UVM A;  4P7I A;  1X05 A;  2LOX A;  1MIZ B;  2UZS A;  3KY9 A;  5C5B B;  3WYF B;  2ROZ B;  2I5C A;  5DHF B;  3D8E A;  5KQ4 A;  3WA0 A;  2V76 A;  4HB0 B;  3PG7 A;  1FOE A;  5C5B A;  3KRX A;  3A8Q A;  3OAN A;  4PNK A;  1MAI A;  1Z87 A;  1FGY A;  5DIF B;  2I5F A;  2QKL A;  2GS0 A;  4Z2M B;  4IFS A;  1LW3 A;  4NSW A;  2D9W A;  1FHO A;  4K2O A;  3QWM A;  4HB3 B;  3TW1 A;  4C0A A;  1I7A A;  3GYO A;  4HB2 B;  4CHJ A;  3V5W A;  1KZG A;  4GN1 A;  4HHV A;  1U5G A;  5J3T A;  3PVW A;  2KUP A;  2PZ1 A;  1V5M A;  3MPX A;  2Y8G A;  3DXE A;  2UZR A;  3CXB B;  2DLW A;  2ADZ A;  4HAV B;  1WI1 A;  3U7D A;  5D3X A;  3U8Z A;  2J0J A;  1P3R A;  1TQZ A;  2M14 A;  2Z0O A;  5HE1 A;  4GMX B;  2W2X D;  3G9W A;  1OY2 A;  3N7C A;  2JP2 A;  2ELB A;  1PMS A;  2RUK B;  1GG3 A;  1FB8 A;  3P7Z A;  3PEG A;  4GXB A;  1W1D A;  5CLL B;  2K00 A;  2EC1 A;  2H7E A;  2VKI A;  2XQN M;  3GYP A;  4HAY B;  3D8D A;  1SGH A;  4EJN A;  1ISN A;  4IOY X;  5CLQ B;  1XX0 A;  4YON A;  3ODW A;  2DA0 A;  2E2X A;  2I1K A;  3ODO A;  2D4Q A;  2N0Y A;  2QKM A;  3NSU A;  1X86 A;  2YF0 A;  1ZM0 A;  2YT1 A;  2L2I A;  1UPQ A;  3T06 A;  1WGU A;  2YS3 A;  2I1J A;  1WG7 A;  1Y19 B;  3PP2 A;  4DBB A;  1DDM A;  2LYD A;  5DH9 B;  1EAZ A;  3HQC A;  2D11 A;  2R09 A;  2D9V A;  4HB4 B;  2AL6 A;  2L1C A;  1XD4 A;  5JP4 A;  4F7G A;  3ZDT A;  4HAZ B;  2HTH B;  1BAK A;  4L6E A;  4MY6 A;  3QIJ A;  1BTN A;  5DI9 B;  2IFS A;  4DXA B;  1I2H A;  1QC6 A;  1UEF A;  2MWN B;  4KHA A;  2DFK A;  4A6K A;  3KSY A;  4DX9 0;  3RCP A;  5L81 A;  4GMV A;  2Y7B A;  2KCJ A;  3BIN A;  1XOD A;  4GPT B;  5C6R A;  4NY0 A;  5FI1 A;  2GCL A;  2DX5 A;  2J0K A;  2GCJ A;  1K5G B;  2OQB A;  4MK0 A;  3PVU A;  3UZT A;  2CAY A;  3BJI A;  3AU5 A;  1M7R A;  1MK9 B;  1V5U A;  4WVF B;  1SHC A;  2MKR A;  2P8V A;  4A6H A;  2W2X C;  1J0W A;  1H10 A;  2DTC A;  4ZRJ A;  4HAX B;  1M7E A;  1FGZ A;  3MDB C;  4A6F A;  1OMW A;  2EMS A;  1U2B A;  2P0F A;  4TYZ A;  3TVV A;  4WJ7 A;  1H4R A;  3F5R A;  3SYX A;  5JHH A;  1MK7 B;  3HK0 A;  1PLS A;  2N23 A;  1AQC A;  2COA A;  1Y5O A;  2OTX A;  1TXD A;  1NTV A;  1BWN A;  3F0W A;  1XKE A;  1AWE A;  5J3Y A;  1U5D A;  4KHB B;  1U5E A;  1WGQ A;  1UPR A;  1UNR A;  3ULB A;  5FI0 A;  1X1F A;  3CIK A;  2DHI A;  2LOZ A;  2MFQ A;  4K17 A;  4MT7 A;  4CHM A;  4K2P A;  2AEH A;  2Y8F A;  2LKO A;  1J19 A;  5HE3 A;  5C79 A;  2DYN A;  1V89 A;  1GC7 A;  3D8F A;  2FJL A;  1Q67 A;  4F7U P;  5D27 A;  2K2J A;  2J0M A;  4YL8 A;  4KAX B;  2LUL A;  2K2U A;  1U27 A;  1NTY A;  4F7H A;  3VOQ A;  4XWX A;  3VIA A;  1BTK A;  4GZU A;  2GJY A;  5HE2 A;  1P5T A;  1RRP B;  2EJ8 A;  1GC6 A;  2Z0Q A;  5DHA B;  2YT0 A;  2EMT A;  3FM8 C;  5D3V A;  2ZPY A;  3DXC A;  3TCA A;  4KVG B;  2DHJ A; 
#chains in the Genus database with same CATH topology
 3P6A A;  2HE7 A;  2NZ8 B;  3SNH A;  1WVH A;  3X23 A;  5EFX A;  2DHK A;  4EMO A;  5KQ1 A;  1E5W A;  4Z2N A;  2P0D A;  2DYQ A;  4IAP A;  1KI1 B;  3A8P A;  1U29 A;  1FHX A;  2IYB A;  2DKP A;  2H7D A;  1LB1 A;  2X18 A;  1V5P A;  1EVH A;  2RNR B;  3A98 B;  3O96 A;  2ELA A;  4D0N B;  2Z4D A;  1ZC4 B;  3SV1 A;  2YS1 A;  1MPH A;  2J59 M;  2NMB A;  4HDO A;  1XCG A;  1T77 A;  4D6W A;  4DX8 A;  5JHG A;  1X11 A;  4A6F B;  3FSS A;  4HAW B;  3HW2 B;  1WJM A;  3DXD A;  1DDW A;  5D3Y A;  4DIX A;  5JLJ B;  4HDQ A;  3ZVR A;  1W1G A;  4QXA B;  1N3H A;  2MDX A;  1ZC3 B;  3LJU X;  4A5K A;  4PQ0 A;  5C16 A;  4HSI A;  5D3W A;  2R0D A;  2COD A;  1K5D B;  1X1G A;  2CRF A;  3TO1 A;  1WJ1 A;  1NU2 A;  2RSG A;  2COF A;  1ZVR A;  1FAO A;  4CYE A;  1P6S A;  1DDV A;  3ML4 A;  3FVC A;  4ZRI A;  4BBK A;  1IRS A;  1MI1 A;  2VRW B;  4K81 A;  4OT1 A;  2YVC A;  5GOW B;  1PFJ A;  2DN6 A;  1NI2 A;  1TJ6 A;  5LOP B;  3FEH A;  4KHO A;  3AJ4 A;  2D9Z A;  4ZRK A;  3IVF A;  3TFM A;  1UNP A;  4B6H A;  5J3Q A;  2P0H A;  2YS5 A;  2VSZ A;  1DBH A;  1FHW A;  1MIX A;  2RRF A;  4H8S A;  2RLO A;  3PZD A;  4HAT B;  3KZ1 A;  2BCJ A;  2D9X A;  2COC A;  1RJ2 A;  3PVL A;  4QJ3 B;  2RGN B;  4Y94 A;  2RVB B;  2DKQ A;  2D10 A;  2G35 A;  4WSF A;  1DRO A;  1XR0 B;  1U5F A;  4CSQ A;  3HSA A;  1ZSQ A;  3ODX A;  1KZ7 A;  4HAU B;  3QBV B;  1QQG A;  1MKE A;  2NBV A;  1OQN A;  1V61 A;  2ROV A;  3M1I B;  2R2Y A;  2D9Y A;  2Q13 A;  4EKU A;  2CY4 A;  3KRW A;  2W2W A;  1V88 A;  2YRY A;  2YSZ A;  3ULC A;  1UNQ A;  1W1H A;  3PSC A;  2KIE A;  3SO6 A;  1DYN A;  4TKN A;  5LON B;  1B55 A;  3AU4 A;  2CY5 A;  3U12 A;  2D2Q A;  5KCV A;  2K8E A;  3SUZ A;  2KGX B;  5HE0 A;  2Z0P A;  1EGX A;  2DX1 A;  2LG1 A;  1EF1 A;  2M38 A;  2UVM A;  4P7I A;  1X05 A;  2LOX A;  1MIZ B;  2UZS A;  3OHM B;  3KY9 A;  5C5B B;  3WYF B;  2ROZ B;  2I5C A;  4GNK B;  2Z59 A;  5DHF B;  3D8E A;  5KQ4 A;  3WA0 A;  2V76 A;  3B77 A;  3PG7 A;  4HB0 B;  1FOE A;  5C5B A;  3KRX A;  3A8Q A;  3OAN A;  4PNK A;  1MAI A;  1Z87 A;  1FGY A;  5DIF B;  2I5F A;  2QKL A;  2GS0 A;  4Z2M B;  4IFS A;  1LW3 A;  4NSW A;  2D9W A;  1FHO A;  4K2O A;  3QWM A;  4HB3 B;  3TW1 A;  4C0A A;  1I7A A;  3GYO A;  4HB2 B;  4CHJ A;  3V5W A;  1KZG A;  4GN1 A;  4HHV A;  1U5G A;  5J3T A;  3PVW A;  2KUP A;  2PZ1 A;  1V5M A;  3MPX A;  2Y8G A;  3DXE A;  2UZR A;  3CXB B;  2DLW A;  2ADZ A;  4HAV B;  1WI1 A;  3U7D A;  5D3X A;  3U8Z A;  2J0J A;  1P3R A;  1TQZ A;  2M14 A;  2Z0O A;  5HE1 A;  4GMX B;  2W2X D;  3G9W A;  1OY2 A;  3N7C A;  2JP2 A;  2ELB A;  1PMS A;  2RUK B;  1GG3 A;  1FB8 A;  3P7Z A;  3PEG A;  4GXB A;  1W1D A;  5CLL B;  2K00 A;  2EC1 A;  2H7E A;  2VKI A;  3DCX A;  2XQN M;  3GYP A;  4HAY B;  3D8D A;  1SGH A;  3NWD A;  4EJN A;  1ISN A;  4IOY X;  3NWF A;  5CLQ B;  1XX0 A;  4YON A;  3ODW A;  2DA0 A;  2E2X A;  2I1K A;  3ODO A;  2D4Q A;  2N0Y A;  2QKM A;  3NSU A;  1X86 A;  2YF0 A;  1ZM0 A;  2YT1 A;  2L2I A;  1UPQ A;  3T06 A;  1WGU A;  2YS3 A;  2I1J A;  3NWA A;  1WG7 A;  1Y19 B;  3PP2 A;  5LG4 B;  4DBB A;  1DDM A;  2LYD A;  5DH9 B;  1EAZ A;  3HQC A;  2D11 A;  2R09 A;  2D9V A;  4HB4 B;  2AL6 A;  2L1C A;  1XD4 A;  5I2M A;  5JP4 A;  4F7G A;  3HIE A;  3ZDT A;  4HAZ B;  2HTH B;  5IRS A;  1BAK A;  4L6E A;  4GOU A;  4MY6 A;  3QIJ A;  1BTN A;  5DI9 B;  2IFS A;  2K49 A;  4DXA B;  1I2H A;  1QC6 A;  1UEF A;  2MWN B;  4KHA A;  2DFK A;  4A6K A;  3KSY A;  4DX9 0;  3RCP A;  5L81 A;  4GMV A;  2KR0 A;  2Y7B A;  2KCJ A;  2ZKM X;  3BIN A;  1XOD A;  4GPT B;  5C6R A;  4NY0 A;  5FI1 A;  2GCL A;  2DX5 A;  5I2S A;  3A58 A;  2J0K A;  2GCJ A;  1K5G B;  2OQB A;  4MK0 A;  3PVU A;  3UZT A;  2CAY A;  2KUQ A;  3BJI A;  3AU5 A;  1M7R A;  1MK9 B;  2Z14 A;  1V5U A;  4WVF B;  1SHC A;  2MKR A;  2P8V A;  4A6H A;  2W2X C;  1J0W A;  1H10 A;  2DTC A;  4ZRJ A;  5M4Y B;  4HAX B;  4OSN A;  1M7E A;  1FGZ A;  3MDB C;  4A6F A;  1OMW A;  2EMS A;  1U2B A;  2P0F A;  4TYZ A;  3TVV A;  4WJ7 A;  3NW8 A;  1H4R A;  3F5R A;  3SYX A;  2FJU B;  5JHH A;  1MK7 B;  3HK0 A;  1PLS A;  2N23 A;  4KHB A;  1AQC A;  2COA A;  2GUM A;  1Y5O A;  4QJ4 B;  2OTX A;  1TXD A;  1NTV A;  1BWN A;  3F0W A;  1XKE A;  1AWE A;  5J3Y A;  1U5D A;  4KHB B;  1U5E A;  1WGQ A;  1UPR A;  1UNR A;  3ULB A;  4QJ5 B;  5FI0 A;  1X1F A;  3CIK A;  2DHI A;  2LOZ A;  2MFQ A;  2Z13 A;  4K17 A;  4MT7 A;  4CHM A;  4K2P A;  2AEH A;  1ZYI A;  2Y8F A;  2LKO A;  1J19 A;  5HE3 A;  5C79 A;  2DYN A;  1V89 A;  1GC7 A;  3D8F A;  2FJL A;  1Q67 A;  4F7U P;  5D27 A;  2K2J A;  2J0M A;  4YL8 A;  4KAX B;  2LUL A;  2K2U A;  1U27 A;  1NTY A;  4F7H A;  3VOQ A;  4XWX A;  3VIA A;  1BTK A;  4GZU A;  2GJY A;  5HE2 A;  1P5T A;  1RRP B;  2EJ8 A;  2KIG A;  1GC6 A;  2Z0Q A;  5DHA B;  2YT0 A;  2EMT A;  3FM8 C;  4L1R A;  5D3V A;  2YT2 A;  2ZPY A;  3DXC A;  3TCA A;  4KVG B;  2DHJ A; 
#chains in the Genus database with same CATH homology
 3P6A A;  2HE7 A;  2NZ8 B;  3SNH A;  1WVH A;  3X23 A;  5EFX A;  2DHK A;  4EMO A;  5KQ1 A;  1E5W A;  4Z2N A;  2P0D A;  2DYQ A;  4IAP A;  1KI1 B;  3A8P A;  1U29 A;  1FHX A;  2IYB A;  2DKP A;  2H7D A;  1LB1 A;  2X18 A;  1V5P A;  1EVH A;  2RNR B;  3A98 B;  3O96 A;  2ELA A;  4D0N B;  1ZC4 B;  3SV1 A;  2YS1 A;  1MPH A;  2J59 M;  2NMB A;  4HDO A;  1XCG A;  4DX8 A;  5JHG A;  1X11 A;  4A6F B;  3FSS A;  4HAW B;  3HW2 B;  1WJM A;  3DXD A;  1DDW A;  5D3Y A;  5JLJ B;  4HDQ A;  3ZVR A;  1W1G A;  1N3H A;  2MDX A;  1ZC3 B;  3LJU X;  4A5K A;  4PQ0 A;  5C16 A;  5D3W A;  2R0D A;  2COD A;  1K5D B;  1X1G A;  2CRF A;  3TO1 A;  1WJ1 A;  1NU2 A;  2RSG A;  2COF A;  1ZVR A;  1FAO A;  4CYE A;  1P6S A;  1DDV A;  3ML4 A;  4ZRI A;  4BBK A;  1IRS A;  2VRW B;  4K81 A;  2YVC A;  5GOW B;  1PFJ A;  2DN6 A;  1NI2 A;  1TJ6 A;  5LOP B;  3FEH A;  4KHO A;  3AJ4 A;  2D9Z A;  4ZRK A;  3IVF A;  3TFM A;  1UNP A;  4B6H A;  5J3Q A;  2P0H A;  2YS5 A;  2VSZ A;  1DBH A;  1FHW A;  1MIX A;  4H8S A;  2RLO A;  3PZD A;  4HAT B;  3KZ1 A;  2BCJ A;  2D9X A;  2COC A;  1RJ2 A;  3PVL A;  2RGN B;  4Y94 A;  2RVB B;  2DKQ A;  2D10 A;  2G35 A;  4WSF A;  1DRO A;  1XR0 B;  1U5F A;  1ZSQ A;  3ODX A;  1KZ7 A;  4HAU B;  3QBV B;  1QQG A;  1MKE A;  1OQN A;  1V61 A;  2ROV A;  3M1I B;  2D9Y A;  2Q13 A;  4EKU A;  2CY4 A;  3KRW A;  2W2W A;  1V88 A;  2YRY A;  2YSZ A;  3ULC A;  1UNQ A;  1W1H A;  3PSC A;  3SO6 A;  1DYN A;  4TKN A;  5LON B;  1B55 A;  3AU4 A;  2CY5 A;  2D2Q A;  5KCV A;  3SUZ A;  2KGX B;  5HE0 A;  2Z0P A;  1EGX A;  2DX1 A;  2LG1 A;  1EF1 A;  2M38 A;  2UVM A;  4P7I A;  1X05 A;  2LOX A;  1MIZ B;  2UZS A;  3KY9 A;  5C5B B;  3WYF B;  2ROZ B;  2I5C A;  5DHF B;  3D8E A;  5KQ4 A;  3WA0 A;  2V76 A;  4HB0 B;  3PG7 A;  1FOE A;  5C5B A;  3KRX A;  3A8Q A;  3OAN A;  4PNK A;  1MAI A;  1Z87 A;  1FGY A;  5DIF B;  2I5F A;  2QKL A;  2GS0 A;  4Z2M B;  4IFS A;  1LW3 A;  4NSW A;  2D9W A;  1FHO A;  4K2O A;  3QWM A;  4HB3 B;  3TW1 A;  4C0A A;  1I7A A;  3GYO A;  4HB2 B;  4CHJ A;  3V5W A;  1KZG A;  4GN1 A;  4HHV A;  1U5G A;  5J3T A;  3PVW A;  2KUP A;  2PZ1 A;  1V5M A;  3MPX A;  2Y8G A;  3DXE A;  2UZR A;  3CXB B;  2DLW A;  2ADZ A;  4HAV B;  1WI1 A;  3U7D A;  5D3X A;  3U8Z A;  2J0J A;  1P3R A;  1TQZ A;  2M14 A;  2Z0O A;  5HE1 A;  4GMX B;  2W2X D;  3G9W A;  1OY2 A;  3N7C A;  2JP2 A;  2ELB A;  1PMS A;  2RUK B;  1GG3 A;  1FB8 A;  3P7Z A;  3PEG A;  4GXB A;  1W1D A;  5CLL B;  2K00 A;  2EC1 A;  2H7E A;  2VKI A;  2XQN M;  3GYP A;  4HAY B;  3D8D A;  1SGH A;  4EJN A;  1ISN A;  4IOY X;  5CLQ B;  1XX0 A;  4YON A;  3ODW A;  2DA0 A;  2E2X A;  2I1K A;  3ODO A;  2D4Q A;  2N0Y A;  2QKM A;  3NSU A;  1X86 A;  2YF0 A;  1ZM0 A;  2YT1 A;  2L2I A;  1UPQ A;  3T06 A;  1WGU A;  2YS3 A;  2I1J A;  1WG7 A;  1Y19 B;  3PP2 A;  4DBB A;  1DDM A;  2LYD A;  5DH9 B;  1EAZ A;  3HQC A;  2D11 A;  2R09 A;  2D9V A;  4HB4 B;  2AL6 A;  2L1C A;  1XD4 A;  5JP4 A;  4F7G A;  3ZDT A;  4HAZ B;  2HTH B;  1BAK A;  4L6E A;  4MY6 A;  3QIJ A;  1BTN A;  5DI9 B;  2IFS A;  4DXA B;  1I2H A;  1QC6 A;  1UEF A;  2MWN B;  4KHA A;  2DFK A;  4A6K A;  3KSY A;  4DX9 0;  3RCP A;  5L81 A;  4GMV A;  2Y7B A;  2KCJ A;  3BIN A;  1XOD A;  4GPT B;  5C6R A;  4NY0 A;  5FI1 A;  2GCL A;  2DX5 A;  2J0K A;  2GCJ A;  1K5G B;  2OQB A;  4MK0 A;  3PVU A;  3UZT A;  2CAY A;  3BJI A;  3AU5 A;  1M7R A;  1MK9 B;  1V5U A;  4WVF B;  1SHC A;  2MKR A;  2P8V A;  4A6H A;  2W2X C;  1J0W A;  1H10 A;  2DTC A;  4ZRJ A;  4HAX B;  1M7E A;  1FGZ A;  3MDB C;  4A6F A;  1OMW A;  2EMS A;  1U2B A;  2P0F A;  4TYZ A;  3TVV A;  4WJ7 A;  1H4R A;  3F5R A;  3SYX A;  5JHH A;  1MK7 B;  3HK0 A;  1PLS A;  2N23 A;  1AQC A;  2COA A;  1Y5O A;  2OTX A;  1TXD A;  1NTV A;  1BWN A;  3F0W A;  1XKE A;  1AWE A;  5J3Y A;  1U5D A;  4KHB B;  1U5E A;  1WGQ A;  1UPR A;  1UNR A;  3ULB A;  5FI0 A;  1X1F A;  3CIK A;  2DHI A;  2LOZ A;  2MFQ A;  4K17 A;  4MT7 A;  4CHM A;  4K2P A;  2AEH A;  2Y8F A;  2LKO A;  1J19 A;  5HE3 A;  5C79 A;  2DYN A;  1V89 A;  1GC7 A;  3D8F A;  2FJL A;  1Q67 A;  4F7U P;  5D27 A;  2K2J A;  2J0M A;  4YL8 A;  4KAX B;  2LUL A;  2K2U A;  1U27 A;  1NTY A;  4F7H A;  3VOQ A;  4XWX A;  3VIA A;  1BTK A;  4GZU A;  2GJY A;  5HE2 A;  1P5T A;  1RRP B;  2EJ8 A;  1GC6 A;  2Z0Q A;  5DHA B;  2YT0 A;  2EMT A;  3FM8 C;  5D3V A;  2ZPY A;  3DXC A;  3TCA A;  4KVG B;  2DHJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...