2HTHB

Structural basis for ubiquitin recognition by the human eap45/escrt-ii glue domain
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
129
structure length
129
Chain Sequence
b'RFVWTSGLLEINETLVIQQRGVRIYDGEEKIKFDAGTLLLSTHRLIWRDQKNHECCMAILLSQIVFIEEQAAGIGKSAKIVVHLHPAPPNKEPGPFQSSKNSYIKLSFKEHGQIEFYRRLSEEMTQRRW'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquitin
publication title Structural basis for ubiquitin recognition by the human ESCRT-II EAP45 GLUE domain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
total genus 23
structure length 129
sequence length 129
ec nomenclature
pdb deposition date 2006-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF11605 Vps36_ESCRT-II Vacuolar protein sorting protein 36 Vps36
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2hthB00
1DBHA 4YONA 3VIAA 3HK0A 5KQ1A 2GJYA 2XQNM 2X18A 3PG7A 1K5DB 2Z0OA 3TO1A 2M14A 5DH9B 2LULA 2J59M 1ZVRA 3DXEA 2K2UA 1I2HA 2LG1A 1XKEA 4GMXB 1BTNA 3ODOA 1PLSA 2D2QA 2NZ8B 3D8EA 1WG7A 5JHGA 1WJ1A 1B55A 2EJ8A 2DHKA 1U5DA 4K81A 2JP2A 2CAYA 4HATB 1X1GA 1XX0A 1DDVA 5C5BB 2LYDA 1UNQA 3PVLA 4HB3B 2AEHA 2D9WA 4HHVA 3ULBA 2MFQA 2DHIA 5JLJB 4A6FB 2HTHB 1AWEA 5EFXA 2YS3A 2M38A 1XD4A 3UZTA 1QQGA 2AL6A 4HB2B 1XCGA 2H7DA 4IOYX 2G35A 2P8VA 3GYOA 4KHOA 1NI2A 3IVFA 2Z0PA 2ADZA 4KHBB 2RUKB 2D9YA 2GCLA 1X11A 1TQZA 1Q67A 1X1FA 1BTKA 3ZDTA 3O96A 2COCA 1V5PA 4D0NB 4XWXA 2E2XA 4GN1A 2D9ZA 3PEGA 5D3VA 2CRFA 3P7ZA 4ZRJA 2MKRA 4CYEA 4EMOA 3A98B 2MDXA 2N0YA 4DX8A 4EJNA 4B6HA 5DIFB 4K2PA 2LOXA 2VKIA 5HE1A 2EMTA 2COAA 4TKNA 1ZC4B 1OMWA 2DX5A 4HAZB 2YT1A 4HAYB 2UZSA 1P5TA 3P6AA 2LKOA 2VSZA 4K17A 1SGHA 1LW3A 1OQNA 2DA0A 4WJ7A 2IYBA 1BAKA 3PZDA 1ISNA 4DXAB 1X05A 2V76A 5JP4A 3CIKA 2DFKA 3HQCA 4HB4B 1GG3A 5GOWB 1OY2A 1FOEA 1FAOA 4C0AA 1MK7B 2KCJA 5KCVA 1H4RA 5KQ4A 3ODWA 4HAWB 4GZUA 1FHOA 2I1JA 2R09A 1J0WA 1FGYA 4A6KA 2EMSA 2Y8GA 2YS1A 3V5WA 4K2OA 1U5EA 1W1DA 2BCJA 5CLQB 2GCJA 2RGNB 5C79A 4F7UP 4BBKA 1N3HA 3FM8C 5FI0A 2P0HA 1J19A 2YT0A 4IAPA 1MIXA 5FI1A 2HE7A 1V89A 4NSWA 2L1CA 5LONB 2FJLA 2QKLA 4MT7A 1MKEA 2RLOA 3SNHA 3BJIA 4CHJA 2MWNB 1BWNA 2DLWA 2DTCA 2P0FA 3MPXA 3CXBB 4Z2NA 3DXDA 2DKQA 2CY5A 2DYNA 3WA0A 2YS5A 3PP2A 4EKUA 2D9XA 4F7HA 2D9VA 5D3YA 2IFSA 1IRSA 2DYQA 3ULCA 1V5UA 1EAZA 2R0DA 4TYZA 4DBBA 1WGQA 2W2WA 1SHCA 2J0MA 2J0KA 2EC1A 3KRWA 5D3XA 2I5FA 1NTYA 2K00A 1KZGA 3A8QA 2K2JA 4P7IA 4H8SA 3BINA 2J0JA 1E5WA 3RCPA 1V5MA 4MK0A 4F7GA 4KVGB 2CODA 1UPQA 3G9WA 1GC7A 1Y5OA 3PSCA 3SO6A 5J3TA 5J3YA 1WJMA 3F5RA 1M7EA 1U29A 3DXCA 3SUZA 3HW2B 5JHHA 2Y7BA 1W1GA 2DHJA 3PVUA 1MPHA 5LOPB 2OQBA 3AU4A 2H7EA 1V61A 3TW1A 1MIZB 2D10A 4KHAA 3N7CA 4GXBA 3SV1A 1Z87A 2P0DA 2ELBA 2DKPA 1UNRA 2I1KA 5C6RA 1GC6A 1NU2A 1ZC3B 3X23A 3KY9A 1AQCA 1EF1A 4NY0A 3F0WA 1P6SA 1TJ6A 5HE0A 2YF0A 2D4QA 2YVCA 3QWMA 4A5KA 5L81A 5DI9B 4HDQA 2DN6A 1NTVA 1ZSQA 2D11A 5HE2A 1K5GB 2I5CA 4HB0B 1H10A 2YRYA 4WVFB 3VOQA 1M7RA 3D8FA 1UPRA 4YL8A 3TVVA 2VRWB 3QIJA 2OTXA 4KAXB 3T06A 2ZPYA 2ROVA 5HE3A 1U2BA 2NMBA 4Y94A 1XODA 2RNRB 3SYXA 3GYPA 4HDOA 3QBVB 1W1HA 1UEFA 4ZRKA 2PZ1A 2LOZA 3U8ZA 3ZVRA 2UZRA 2KGXB 3KSYA 3TCAA 1Y19B 5CLLB 4IFSA 1DDMA 2L2IA 3TFMA 1FHWA 5DHFB 2UVMA 1KZ7A 3M1IB 1WGUA 2YSZA 5C5BA 2KUPA 3KRXA 2ROZB 4A6HA 1PMSA 1DDWA 3AU5A 4HAVB 2DX1A 4ZRIA 1U5GA 1MAIA 3FEHA 2Z0QA 2ELAA 1ZM0A 4HAUB 4Z2MB 3FSSA 3OANA 5DHAB 3KZ1A 2Y8FA 4A6FA 1DYNA 1RJ2A 4CHMA 3U7DA 1X86A 5D27A 2QKMA 3AJ4A 1V88A 2RSGA 2N23A 4GPTB 3LJUX 2COFA 5C16A 4DX90 3D8DA 4PQ0A 2GS0A 1WVHA 4GMVA 2RVBB 4MY6A 5J3QA 1FGZA 1P3RA 2W2XD 4WSFA 1U5FA 4L6EA 3A8PA 3WYFB 1QC6A 2CY4A 4HAXB 5D3WA 1UNPA 1I7AA 1FHXA 1U27A 3ODXA 1EVHA 1FB8A 1KI1B 1PFJA 4PNKA 2W2XC 1DROA 3MDBC 1MK9B 1RRPB 2Q13A 3ML4A 1EGXA 1XR0B 1LB1A 1TXDA 1WI1A 3NSUA 3PVWA
chains in the Genus database with same CATH superfamily
1DBHA 4YONA 3VIAA 3HK0A 5KQ1A 2GJYA 2XQNM 2X18A 3PG7A 1K5DB 2Z0OA 3FVCA 5I2SA 3TO1A 2M14A 5DH9B 2LULA 2J59M 1ZVRA 3DXEA 2K2UA 2Z13A 3NW8A 1I2HA 2LG1A 1XKEA 4GMXB 1BTNA 3ODOA 1PLSA 2D2QA 2NZ8B 3D8EA 2FJUB 1WG7A 5JHGA 1WJ1A 4L1RA 1B55A 2EJ8A 2DHKA 1U5DA 4K81A 4QJ4B 2JP2A 2CAYA 4HATB 1X1GA 1XX0A 1DDVA 5C5BB 2LYDA 1UNQA 3PVLA 4HB3B 2AEHA 2D9WA 4HHVA 3ULBA 2MFQA 2DHIA 5JLJB 4A6FB 2HTHB 1AWEA 5EFXA 2YS3A 2M38A 1XD4A 3UZTA 1QQGA 2AL6A 4HB2B 1XCGA 2H7DA 4IOYX 2G35A 2P8VA 3GYOA 4KHOA 1NI2A 2Z14A 3IVFA 2Z0PA 2ADZA 4KHBB 2RUKB 2D9YA 2GCLA 3NWAA 1X11A 1TQZA 1Q67A 1X1FA 1BTKA 3ZDTA 3O96A 2COCA 1V5PA 4D0NB 4XWXA 2E2XA 4GN1A 5IRSA 2D9ZA 3PEGA 5D3VA 2CRFA 3P7ZA 4ZRJA 2MKRA 5I2MA 4CYEA 4EMOA 3A98B 2MDXA 4DIXA 2N0YA 4D6WA 4DX8A 4EJNA 4B6HA 5DIFB 4K2PA 2LOXA 2VKIA 5HE1A 2EMTA 2KIEA 2COAA 4TKNA 1ZC4B 1OMWA 2DX5A 4HAZB 2YT1A 4HAYB 2UZSA 1P5TA 3P6AA 2LKOA 2VSZA 4K17A 1SGHA 1LW3A 1OQNA 2DA0A 4WJ7A 2IYBA 1BAKA 3PZDA 1ISNA 4DXAB 1X05A 2V76A 5JP4A 3CIKA 2DFKA 3HQCA 4HB4B 1GG3A 5GOWB 1OY2A 5LG4B 1FOEA 1FAOA 4C0AA 3PVWA 1MK7B 2KCJA 5KCVA 3HSAA 1H4RA 5KQ4A 4QJ5B 3ODWA 4HAWB 4GZUA 1FHOA 2I1JA 2R09A 1J0WA 1FGYA 4A6KA 2EMSA 2Y8GA 2YS1A 3V5WA 4K2OA 2YT2A 1U5EA 1W1DA 2BCJA 5CLQB 2GCJA 2RGNB 5C79A 4F7UP 2GUMA 4HSIA 4BBKA 2KUQA 1N3HA 3FM8C 5FI0A 2P0HA 1J19A 2YT0A 4IAPA 1MIXA 5FI1A 2HE7A 1V89A 4NSWA 2L1CA 1MI1A 5LONB 5M4YB 2FJLA 2QKLA 4MT7A 1MKEA 2RLOA 3SNHA 3BJIA 3OHMB 4CHJA 2MWNB 2K8EA 1BWNA 2DLWA 2DTCA 2P0FA 3MPXA 3CXBB 4Z2NA 3DXDA 2DKQA 2CY5A 2DYNA 3WA0A 2YS5A 3PP2A 4EKUA 2D9XA 4F7HA 2D9VA 5D3YA 2IFSA 1IRSA 2DYQA 3ULCA 1V5UA 1EAZA 1ZYIA 3DCXA 3U12A 2R0DA 4TYZA 4DBBA 1WGQA 3A58A 2W2WA 1SHCA 2J0MA 2J0KA 2EC1A 3KRWA 4OT1A 5D3XA 2I5FA 1NTYA 2K00A 1KZGA 3A8QA 2K2JA 4P7IA 4H8SA 3BINA 2J0JA 1E5WA 3RCPA 1V5MA 4MK0A 4F7GA 4KVGB 2CODA 1UPQA 3G9WA 1GC7A 1Y5OA 3PSCA 4GNKB 3SO6A 2K49A 5J3TA 5J3YA 1WJMA 3F5RA 1M7EA 1U29A 3DXCA 3SUZA 3HW2B 5JHHA 2Y7BA 1W1GA 3NWDA 2DHJA 3PVUA 1MPHA 5LOPB 2OQBA 3AU4A 2H7EA 2ZKMX 1V61A 3TW1A 1MIZB 2D10A 4KHAA 3N7CA 4GXBA 3SV1A 1Z87A 2P0DA 2ELBA 2DKPA 1UNRA 2I1KA 5C6RA 1GC6A 1NU2A 2NBVA 1ZC3B 3X23A 3KY9A 1AQCA 1EF1A 2Z4DA 4NY0A 3F0WA 1P6SA 1TJ6A 4OSNA 5HE0A 2YF0A 2D4QA 2YVCA 4CSQA 3QWMA 4A5KA 5L81A 5DI9B 4HDQA 2DN6A 1NTVA 1ZSQA 2D11A 5HE2A 1K5GB 2I5CA 4HB0B 1H10A 2YRYA 3NWFA 4WVFB 3VOQA 1M7RA 3D8FA 1UPRA 4YL8A 3TVVA 2VRWB 3QIJA 2OTXA 4KAXB 3T06A 2ZPYA 2ROVA 5HE3A 1U2BA 2NMBA 4QXAB 4Y94A 1XODA 2RNRB 3SYXA 3GYPA 4HDOA 3QBVB 1W1HA 1UEFA 4ZRKA 2PZ1A 2LOZA 3U8ZA 3ZVRA 2UZRA 2KGXB 3KSYA 3TCAA 1Y19B 5CLLB 4IFSA 1DDMA 1T77A 2L2IA 3TFMA 1FHWA 5DHFB 2UVMA 1KZ7A 3M1IB 1WGUA 2YSZA 5C5BA 2KUPA 3KRXA 2ROZB 4A6HA 1PMSA 1DDWA 3AU5A 4HAVB 2DX1A 4GOUA 4ZRIA 1U5GA 1MAIA 3FEHA 2Z0QA 2ELAA 1ZM0A 4HAUB 4Z2MB 3FSSA 3OANA 5DHAB 3KZ1A 2Y8FA 4A6FA 1DYNA 1RJ2A 2Z59A 4CHMA 2R2YA 3U7DA 1X86A 5D27A 2QKMA 3AJ4A 3B77A 1V88A 4KHBA 2RSGA 4QJ3B 2N23A 4GPTB 3HIEA 3LJUX 2COFA 5C16A 4DX90 3D8DA 4PQ0A 2GS0A 1WVHA 4GMVA 2RVBB 4MY6A 5J3QA 1FGZA 1P3RA 2W2XD 4WSFA 1U5FA 4L6EA 3A8PA 3WYFB 1QC6A 2CY4A 4HAXB 5D3WA 1UNPA 1I7AA 1FHXA 1U27A 3ODXA 1EVHA 1FB8A 1KI1B 1PFJA 4PNKA 2W2XC 1DROA 2KIGA 3MDBC 1MK9B 1RRPB 2Q13A 3ML4A 1EGXA 1XR0B 1LB1A 2KR0A 1TXDA 1WI1A 3NSUA 2RRFA
chains in the Genus database with same CATH topology
1DBHA 4YONA 3VIAA 3HK0A 5KQ1A 2GJYA 2XQNM 2X18A 3PG7A 1K5DB 2Z0OA 3TO1A 2M14A 5DH9B 2LULA 2J59M 1ZVRA 3DXEA 2K2UA 1I2HA 2LG1A 1XKEA 4GMXB 1BTNA 3ODOA 1PLSA 2D2QA 2NZ8B 3D8EA 1WG7A 5JHGA 1WJ1A 1B55A 2EJ8A 2DHKA 1U5DA 4K81A 2JP2A 2CAYA 4HATB 1X1GA 1XX0A 1DDVA 5C5BB 2LYDA 1UNQA 3PVLA 4HB3B 2AEHA 2D9WA 4HHVA 3ULBA 2MFQA 2DHIA 5JLJB 4A6FB 2HTHB 1AWEA 5EFXA 2YS3A 2M38A 1XD4A 3UZTA 1QQGA 2AL6A 4HB2B 1XCGA 2H7DA 4IOYX 2G35A 2P8VA 3GYOA 4KHOA 1NI2A 3IVFA 2Z0PA 2ADZA 4KHBB 2RUKB 2D9YA 2GCLA 1X11A 1TQZA 1Q67A 1X1FA 1BTKA 3ZDTA 3O96A 2COCA 1V5PA 4D0NB 4XWXA 2E2XA 4GN1A 2D9ZA 3PEGA 5D3VA 2CRFA 3P7ZA 4ZRJA 2MKRA 4CYEA 4EMOA 3A98B 2MDXA 2N0YA 4DX8A 4EJNA 4B6HA 5DIFB 4K2PA 2LOXA 2VKIA 5HE1A 2EMTA 2COAA 4TKNA 1ZC4B 1OMWA 2DX5A 4HAZB 2YT1A 4HAYB 2UZSA 1P5TA 3P6AA 2LKOA 2VSZA 4K17A 1SGHA 1LW3A 1OQNA 2DA0A 4WJ7A 2IYBA 1BAKA 3PZDA 1ISNA 4DXAB 1X05A 2V76A 5JP4A 3CIKA 2DFKA 3HQCA 4HB4B 1GG3A 5GOWB 1OY2A 1FOEA 1FAOA 4C0AA 1MK7B 2KCJA 5KCVA 1H4RA 5KQ4A 3ODWA 4HAWB 4GZUA 1FHOA 2I1JA 2R09A 1J0WA 1FGYA 4A6KA 2EMSA 2Y8GA 2YS1A 3V5WA 4K2OA 1U5EA 1W1DA 2BCJA 5CLQB 2GCJA 2RGNB 5C79A 4F7UP 4BBKA 1N3HA 3FM8C 5FI0A 2P0HA 1J19A 2YT0A 4IAPA 1MIXA 5FI1A 2HE7A 1V89A 4NSWA 2L1CA 5LONB 2FJLA 2QKLA 4MT7A 1MKEA 2RLOA 3SNHA 3BJIA 4CHJA 2MWNB 1BWNA 2DLWA 2DTCA 2P0FA 3MPXA 3CXBB 4Z2NA 3DXDA 2DKQA 2CY5A 2DYNA 3WA0A 2YS5A 3PP2A 4EKUA 2D9XA 4F7HA 2D9VA 5D3YA 2IFSA 1IRSA 2DYQA 3ULCA 1V5UA 1EAZA 2R0DA 4TYZA 4DBBA 1WGQA 2W2WA 1SHCA 2J0MA 2J0KA 2EC1A 3KRWA 5D3XA 2I5FA 1NTYA 2K00A 1KZGA 3A8QA 2K2JA 4P7IA 4H8SA 3BINA 2J0JA 1E5WA 3RCPA 1V5MA 4MK0A 4F7GA 4KVGB 2CODA 1UPQA 3G9WA 1GC7A 1Y5OA 3PSCA 3SO6A 5J3TA 5J3YA 1WJMA 3F5RA 1M7EA 1U29A 3DXCA 3SUZA 3HW2B 5JHHA 2Y7BA 1W1GA 2DHJA 3PVUA 1MPHA 5LOPB 2OQBA 3AU4A 2H7EA 1V61A 3TW1A 1MIZB 2D10A 4KHAA 3N7CA 4GXBA 3SV1A 1Z87A 2P0DA 2ELBA 2DKPA 1UNRA 2I1KA 5C6RA 1GC6A 1NU2A 1ZC3B 3X23A 3KY9A 1AQCA 1EF1A 4NY0A 3F0WA 1P6SA 1TJ6A 5HE0A 2YF0A 2D4QA 2YVCA 3QWMA 4A5KA 5L81A 5DI9B 4HDQA 2DN6A 1NTVA 1ZSQA 2D11A 5HE2A 1K5GB 2I5CA 4HB0B 1H10A 2YRYA 4WVFB 3VOQA 1M7RA 3D8FA 1UPRA 4YL8A 3TVVA 2VRWB 3QIJA 2OTXA 4KAXB 3T06A 2ZPYA 2ROVA 5HE3A 1U2BA 2NMBA 4Y94A 1XODA 2RNRB 3SYXA 3GYPA 4HDOA 3QBVB 1W1HA 1UEFA 4ZRKA 2PZ1A 2LOZA 3U8ZA 3ZVRA 2UZRA 2KGXB 3KSYA 3TCAA 1Y19B 5CLLB 4IFSA 1DDMA 2L2IA 3TFMA 1FHWA 5DHFB 2UVMA 1KZ7A 3M1IB 1WGUA 2YSZA 5C5BA 2KUPA 3KRXA 2ROZB 4A6HA 1PMSA 1DDWA 3AU5A 4HAVB 2DX1A 4ZRIA 1U5GA 1MAIA 3FEHA 2Z0QA 2ELAA 1ZM0A 4HAUB 4Z2MB 3FSSA 3OANA 5DHAB 3KZ1A 2Y8FA 4A6FA 1DYNA 1RJ2A 4CHMA 3U7DA 1X86A 5D27A 2QKMA 3AJ4A 1V88A 2RSGA 2N23A 4GPTB 3LJUX 2COFA 5C16A 4DX90 3D8DA 4PQ0A 2GS0A 1WVHA 4GMVA 2RVBB 4MY6A 5J3QA 1FGZA 1P3RA 2W2XD 4WSFA 1U5FA 4L6EA 3A8PA 3WYFB 1QC6A 2CY4A 4HAXB 5D3WA 1UNPA 1I7AA 1FHXA 1U27A 3ODXA 1EVHA 1FB8A 1KI1B 1PFJA 4PNKA 2W2XC 1DROA 3MDBC 1MK9B 1RRPB 2Q13A 3ML4A 1EGXA 1XR0B 1LB1A 1TXDA 1WI1A 3NSUA 3PVWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DBH A;  4YON A;  3VIA A;  3HK0 A;  5KQ1 A;  2GJY A;  2XQN M;  2X18 A;  3PG7 A;  1K5D B;  2Z0O A;  3TO1 A;  2M14 A;  5DH9 B;  2LUL A;  2J59 M;  1ZVR A;  3DXE A;  2K2U A;  1I2H A;  2LG1 A;  1XKE A;  4GMX B;  1BTN A;  3ODO A;  1PLS A;  2D2Q A;  2NZ8 B;  3D8E A;  1WG7 A;  5JHG A;  1WJ1 A;  1B55 A;  2EJ8 A;  2DHK A;  1U5D A;  4K81 A;  2JP2 A;  2CAY A;  4HAT B;  1X1G A;  1XX0 A;  1DDV A;  5C5B B;  2LYD A;  1UNQ A;  3PVL A;  4HB3 B;  2AEH A;  2D9W A;  4HHV A;  3ULB A;  2MFQ A;  2DHI A;  5JLJ B;  4A6F B;  2HTH B;  1AWE A;  5EFX A;  2YS3 A;  2M38 A;  1XD4 A;  3UZT A;  1QQG A;  2AL6 A;  4HB2 B;  1XCG A;  2H7D A;  4IOY X;  2G35 A;  2P8V A;  3GYO A;  4KHO A;  1NI2 A;  3IVF A;  2Z0P A;  2ADZ A;  4KHB B;  2RUK B;  2D9Y A;  2GCL A;  1X11 A;  1TQZ A;  1Q67 A;  1X1F A;  1BTK A;  3ZDT A;  3O96 A;  2COC A;  1V5P A;  4D0N B;  4XWX A;  2E2X A;  4GN1 A;  2D9Z A;  3PEG A;  5D3V A;  2CRF A;  3P7Z A;  4ZRJ A;  2MKR A;  4CYE A;  4EMO A;  3A98 B;  2MDX A;  2N0Y A;  4DX8 A;  4EJN A;  4B6H A;  5DIF B;  4K2P A;  2LOX A;  2VKI A;  5HE1 A;  2EMT A;  2COA A;  4TKN A;  1ZC4 B;  1OMW A;  2DX5 A;  4HAZ B;  2YT1 A;  4HAY B;  2UZS A;  1P5T A;  3P6A A;  2LKO A;  2VSZ A;  4K17 A;  1SGH A;  1LW3 A;  1OQN A;  2DA0 A;  4WJ7 A;  2IYB A;  1BAK A;  3PZD A;  1ISN A;  4DXA B;  1X05 A;  2V76 A;  5JP4 A;  3CIK A;  2DFK A;  3HQC A;  4HB4 B;  1GG3 A;  5GOW B;  1OY2 A;  1FOE A;  1FAO A;  4C0A A;  1MK7 B;  2KCJ A;  5KCV A;  1H4R A;  5KQ4 A;  3ODW A;  4HAW B;  4GZU A;  1FHO A;  2I1J A;  2R09 A;  1J0W A;  1FGY A;  4A6K A;  2EMS A;  2Y8G A;  2YS1 A;  3V5W A;  4K2O A;  1U5E A;  1W1D A;  2BCJ A;  5CLQ B;  2GCJ A;  2RGN B;  5C79 A;  4F7U P;  4BBK A;  1N3H A;  3FM8 C;  5FI0 A;  2P0H A;  1J19 A;  2YT0 A;  4IAP A;  1MIX A;  5FI1 A;  2HE7 A;  1V89 A;  4NSW A;  2L1C A;  5LON B;  2FJL A;  2QKL A;  4MT7 A;  1MKE A;  2RLO A;  3SNH A;  3BJI A;  4CHJ A;  2MWN B;  1BWN A;  2DLW A;  2DTC A;  2P0F A;  3MPX A;  3CXB B;  4Z2N A;  3DXD A;  2DKQ A;  2CY5 A;  2DYN A;  3WA0 A;  2YS5 A;  3PP2 A;  4EKU A;  2D9X A;  4F7H A;  2D9V A;  5D3Y A;  2IFS A;  1IRS A;  2DYQ A;  3ULC A;  1V5U A;  1EAZ A;  2R0D A;  4TYZ A;  4DBB A;  1WGQ A;  2W2W A;  1SHC A;  2J0M A;  2J0K A;  2EC1 A;  3KRW A;  5D3X A;  2I5F A;  1NTY A;  2K00 A;  1KZG A;  3A8Q A;  2K2J A;  4P7I A;  4H8S A;  3BIN A;  2J0J A;  1E5W A;  3RCP A;  1V5M A;  4MK0 A;  4F7G A;  4KVG B;  2COD A;  1UPQ A;  3G9W A;  1GC7 A;  1Y5O A;  3PSC A;  3SO6 A;  5J3T A;  5J3Y A;  1WJM A;  3F5R A;  1M7E A;  1U29 A;  3DXC A;  3SUZ A;  3HW2 B;  5JHH A;  2Y7B A;  1W1G A;  2DHJ A;  3PVU A;  1MPH A;  5LOP B;  2OQB A;  3AU4 A;  2H7E A;  1V61 A;  3TW1 A;  1MIZ B;  2D10 A;  4KHA A;  3N7C A;  4GXB A;  3SV1 A;  1Z87 A;  2P0D A;  2ELB A;  2DKP A;  1UNR A;  2I1K A;  5C6R A;  1GC6 A;  1NU2 A;  1ZC3 B;  3X23 A;  3KY9 A;  1AQC A;  1EF1 A;  4NY0 A;  3F0W A;  1P6S A;  1TJ6 A;  5HE0 A;  2YF0 A;  2D4Q A;  2YVC A;  3QWM A;  4A5K A;  5L81 A;  5DI9 B;  4HDQ A;  2DN6 A;  1NTV A;  1ZSQ A;  2D11 A;  5HE2 A;  1K5G B;  2I5C A;  4HB0 B;  1H10 A;  2YRY A;  4WVF B;  3VOQ A;  1M7R A;  3D8F A;  1UPR A;  4YL8 A;  3TVV A;  2VRW B;  3QIJ A;  2OTX A;  4KAX B;  3T06 A;  2ZPY A;  2ROV A;  5HE3 A;  1U2B A;  2NMB A;  4Y94 A;  1XOD A;  2RNR B;  3SYX A;  3GYP A;  4HDO A;  3QBV B;  1W1H A;  1UEF A;  4ZRK A;  2PZ1 A;  2LOZ A;  3U8Z A;  3ZVR A;  2UZR A;  2KGX B;  3KSY A;  3TCA A;  1Y19 B;  5CLL B;  4IFS A;  1DDM A;  2L2I A;  3TFM A;  1FHW A;  5DHF B;  2UVM A;  1KZ7 A;  3M1I B;  1WGU A;  2YSZ A;  5C5B A;  2KUP A;  3KRX A;  2ROZ B;  4A6H A;  1PMS A;  1DDW A;  3AU5 A;  4HAV B;  2DX1 A;  4ZRI A;  1U5G A;  1MAI A;  3FEH A;  2Z0Q A;  2ELA A;  1ZM0 A;  4HAU B;  4Z2M B;  3FSS A;  3OAN A;  5DHA B;  3KZ1 A;  2Y8F A;  4A6F A;  1DYN A;  1RJ2 A;  4CHM A;  3U7D A;  1X86 A;  5D27 A;  2QKM A;  3AJ4 A;  1V88 A;  2RSG A;  2N23 A;  4GPT B;  3LJU X;  2COF A;  5C16 A;  4DX9 0;  3D8D A;  4PQ0 A;  2GS0 A;  1WVH A;  4GMV A;  2RVB B;  4MY6 A;  5J3Q A;  1FGZ A;  1P3R A;  2W2X D;  4WSF A;  1U5F A;  4L6E A;  3A8P A;  3WYF B;  1QC6 A;  2CY4 A;  4HAX B;  5D3W A;  1UNP A;  1I7A A;  1FHX A;  1U27 A;  3ODX A;  1EVH A;  1FB8 A;  1KI1 B;  1PFJ A;  4PNK A;  2W2X C;  1DRO A;  3MDB C;  1MK9 B;  1RRP B;  2Q13 A;  3ML4 A;  1EGX A;  1XR0 B;  1LB1 A;  1TXD A;  1WI1 A;  3NSU A;  3PVW A; 
#chains in the Genus database with same CATH topology
 1DBH A;  4YON A;  3VIA A;  3HK0 A;  5KQ1 A;  2GJY A;  2XQN M;  2X18 A;  3PG7 A;  1K5D B;  2Z0O A;  3FVC A;  5I2S A;  3TO1 A;  2M14 A;  5DH9 B;  2LUL A;  2J59 M;  1ZVR A;  3DXE A;  2K2U A;  2Z13 A;  3NW8 A;  1I2H A;  2LG1 A;  1XKE A;  4GMX B;  1BTN A;  3ODO A;  1PLS A;  2D2Q A;  2NZ8 B;  3D8E A;  2FJU B;  1WG7 A;  5JHG A;  1WJ1 A;  4L1R A;  1B55 A;  2EJ8 A;  2DHK A;  1U5D A;  4K81 A;  4QJ4 B;  2JP2 A;  2CAY A;  4HAT B;  1X1G A;  1XX0 A;  1DDV A;  5C5B B;  2LYD A;  1UNQ A;  3PVL A;  4HB3 B;  2AEH A;  2D9W A;  4HHV A;  3ULB A;  2MFQ A;  2DHI A;  5JLJ B;  4A6F B;  2HTH B;  1AWE A;  5EFX A;  2YS3 A;  2M38 A;  1XD4 A;  3UZT A;  1QQG A;  2AL6 A;  4HB2 B;  1XCG A;  2H7D A;  4IOY X;  2G35 A;  2P8V A;  3GYO A;  4KHO A;  1NI2 A;  2Z14 A;  3IVF A;  2Z0P A;  2ADZ A;  4KHB B;  2RUK B;  2D9Y A;  2GCL A;  3NWA A;  1X11 A;  1TQZ A;  1Q67 A;  1X1F A;  1BTK A;  3ZDT A;  3O96 A;  2COC A;  1V5P A;  4D0N B;  4XWX A;  2E2X A;  4GN1 A;  5IRS A;  2D9Z A;  3PEG A;  5D3V A;  2CRF A;  3P7Z A;  4ZRJ A;  2MKR A;  5I2M A;  4CYE A;  4EMO A;  3A98 B;  2MDX A;  4DIX A;  2N0Y A;  4D6W A;  4DX8 A;  4EJN A;  4B6H A;  5DIF B;  4K2P A;  2LOX A;  2VKI A;  5HE1 A;  2EMT A;  2KIE A;  2COA A;  4TKN A;  1ZC4 B;  1OMW A;  2DX5 A;  4HAZ B;  2YT1 A;  4HAY B;  2UZS A;  1P5T A;  3P6A A;  2LKO A;  2VSZ A;  4K17 A;  1SGH A;  1LW3 A;  1OQN A;  2DA0 A;  4WJ7 A;  2IYB A;  1BAK A;  3PZD A;  1ISN A;  4DXA B;  1X05 A;  2V76 A;  5JP4 A;  3CIK A;  2DFK A;  3HQC A;  4HB4 B;  1GG3 A;  5GOW B;  1OY2 A;  5LG4 B;  1FOE A;  1FAO A;  4C0A A;  3PVW A;  1MK7 B;  2KCJ A;  5KCV A;  3HSA A;  1H4R A;  5KQ4 A;  4QJ5 B;  3ODW A;  4HAW B;  4GZU A;  1FHO A;  2I1J A;  2R09 A;  1J0W A;  1FGY A;  4A6K A;  2EMS A;  2Y8G A;  2YS1 A;  3V5W A;  4K2O A;  2YT2 A;  1U5E A;  1W1D A;  2BCJ A;  5CLQ B;  2GCJ A;  2RGN B;  5C79 A;  4F7U P;  2GUM A;  4HSI A;  4BBK A;  2KUQ A;  1N3H A;  3FM8 C;  5FI0 A;  2P0H A;  1J19 A;  2YT0 A;  4IAP A;  1MIX A;  5FI1 A;  2HE7 A;  1V89 A;  4NSW A;  2L1C A;  1MI1 A;  5LON B;  5M4Y B;  2FJL A;  2QKL A;  4MT7 A;  1MKE A;  2RLO A;  3SNH A;  3BJI A;  3OHM B;  4CHJ A;  2MWN B;  2K8E A;  1BWN A;  2DLW A;  2DTC A;  2P0F A;  3MPX A;  3CXB B;  4Z2N A;  3DXD A;  2DKQ A;  2CY5 A;  2DYN A;  3WA0 A;  2YS5 A;  3PP2 A;  4EKU A;  2D9X A;  4F7H A;  2D9V A;  5D3Y A;  2IFS A;  1IRS A;  2DYQ A;  3ULC A;  1V5U A;  1EAZ A;  1ZYI A;  3DCX A;  3U12 A;  2R0D A;  4TYZ A;  4DBB A;  1WGQ A;  3A58 A;  2W2W A;  1SHC A;  2J0M A;  2J0K A;  2EC1 A;  3KRW A;  4OT1 A;  5D3X A;  2I5F A;  1NTY A;  2K00 A;  1KZG A;  3A8Q A;  2K2J A;  4P7I A;  4H8S A;  3BIN A;  2J0J A;  1E5W A;  3RCP A;  1V5M A;  4MK0 A;  4F7G A;  4KVG B;  2COD A;  1UPQ A;  3G9W A;  1GC7 A;  1Y5O A;  3PSC A;  4GNK B;  3SO6 A;  2K49 A;  5J3T A;  5J3Y A;  1WJM A;  3F5R A;  1M7E A;  1U29 A;  3DXC A;  3SUZ A;  3HW2 B;  5JHH A;  2Y7B A;  1W1G A;  3NWD A;  2DHJ A;  3PVU A;  1MPH A;  5LOP B;  2OQB A;  3AU4 A;  2H7E A;  2ZKM X;  1V61 A;  3TW1 A;  1MIZ B;  2D10 A;  4KHA A;  3N7C A;  4GXB A;  3SV1 A;  1Z87 A;  2P0D A;  2ELB A;  2DKP A;  1UNR A;  2I1K A;  5C6R A;  1GC6 A;  1NU2 A;  2NBV A;  1ZC3 B;  3X23 A;  3KY9 A;  1AQC A;  1EF1 A;  2Z4D A;  4NY0 A;  3F0W A;  1P6S A;  1TJ6 A;  4OSN A;  5HE0 A;  2YF0 A;  2D4Q A;  2YVC A;  4CSQ A;  3QWM A;  4A5K A;  5L81 A;  5DI9 B;  4HDQ A;  2DN6 A;  1NTV A;  1ZSQ A;  2D11 A;  5HE2 A;  1K5G B;  2I5C A;  4HB0 B;  1H10 A;  2YRY A;  3NWF A;  4WVF B;  3VOQ A;  1M7R A;  3D8F A;  1UPR A;  4YL8 A;  3TVV A;  2VRW B;  3QIJ A;  2OTX A;  4KAX B;  3T06 A;  2ZPY A;  2ROV A;  5HE3 A;  1U2B A;  2NMB A;  4QXA B;  4Y94 A;  1XOD A;  2RNR B;  3SYX A;  3GYP A;  4HDO A;  3QBV B;  1W1H A;  1UEF A;  4ZRK A;  2PZ1 A;  2LOZ A;  3U8Z A;  3ZVR A;  2UZR A;  2KGX B;  3KSY A;  3TCA A;  1Y19 B;  5CLL B;  4IFS A;  1DDM A;  1T77 A;  2L2I A;  3TFM A;  1FHW A;  5DHF B;  2UVM A;  1KZ7 A;  3M1I B;  1WGU A;  2YSZ A;  5C5B A;  2KUP A;  3KRX A;  2ROZ B;  4A6H A;  1PMS A;  1DDW A;  3AU5 A;  4HAV B;  2DX1 A;  4GOU A;  4ZRI A;  1U5G A;  1MAI A;  3FEH A;  2Z0Q A;  2ELA A;  1ZM0 A;  4HAU B;  4Z2M B;  3FSS A;  3OAN A;  5DHA B;  3KZ1 A;  2Y8F A;  4A6F A;  1DYN A;  1RJ2 A;  2Z59 A;  4CHM A;  2R2Y A;  3U7D A;  1X86 A;  5D27 A;  2QKM A;  3AJ4 A;  3B77 A;  1V88 A;  4KHB A;  2RSG A;  4QJ3 B;  2N23 A;  4GPT B;  3HIE A;  3LJU X;  2COF A;  5C16 A;  4DX9 0;  3D8D A;  4PQ0 A;  2GS0 A;  1WVH A;  4GMV A;  2RVB B;  4MY6 A;  5J3Q A;  1FGZ A;  1P3R A;  2W2X D;  4WSF A;  1U5F A;  4L6E A;  3A8P A;  3WYF B;  1QC6 A;  2CY4 A;  4HAX B;  5D3W A;  1UNP A;  1I7A A;  1FHX A;  1U27 A;  3ODX A;  1EVH A;  1FB8 A;  1KI1 B;  1PFJ A;  4PNK A;  2W2X C;  1DRO A;  2KIG A;  3MDB C;  1MK9 B;  1RRP B;  2Q13 A;  3ML4 A;  1EGX A;  1XR0 B;  1LB1 A;  2KR0 A;  1TXD A;  1WI1 A;  3NSU A;  2RRF A; 
#chains in the Genus database with same CATH homology
 1DBH A;  4YON A;  3VIA A;  3HK0 A;  5KQ1 A;  2GJY A;  2XQN M;  2X18 A;  3PG7 A;  1K5D B;  2Z0O A;  3TO1 A;  2M14 A;  5DH9 B;  2LUL A;  2J59 M;  1ZVR A;  3DXE A;  2K2U A;  1I2H A;  2LG1 A;  1XKE A;  4GMX B;  1BTN A;  3ODO A;  1PLS A;  2D2Q A;  2NZ8 B;  3D8E A;  1WG7 A;  5JHG A;  1WJ1 A;  1B55 A;  2EJ8 A;  2DHK A;  1U5D A;  4K81 A;  2JP2 A;  2CAY A;  4HAT B;  1X1G A;  1XX0 A;  1DDV A;  5C5B B;  2LYD A;  1UNQ A;  3PVL A;  4HB3 B;  2AEH A;  2D9W A;  4HHV A;  3ULB A;  2MFQ A;  2DHI A;  5JLJ B;  4A6F B;  2HTH B;  1AWE A;  5EFX A;  2YS3 A;  2M38 A;  1XD4 A;  3UZT A;  1QQG A;  2AL6 A;  4HB2 B;  1XCG A;  2H7D A;  4IOY X;  2G35 A;  2P8V A;  3GYO A;  4KHO A;  1NI2 A;  3IVF A;  2Z0P A;  2ADZ A;  4KHB B;  2RUK B;  2D9Y A;  2GCL A;  1X11 A;  1TQZ A;  1Q67 A;  1X1F A;  1BTK A;  3ZDT A;  3O96 A;  2COC A;  1V5P A;  4D0N B;  4XWX A;  2E2X A;  4GN1 A;  2D9Z A;  3PEG A;  5D3V A;  2CRF A;  3P7Z A;  4ZRJ A;  2MKR A;  4CYE A;  4EMO A;  3A98 B;  2MDX A;  2N0Y A;  4DX8 A;  4EJN A;  4B6H A;  5DIF B;  4K2P A;  2LOX A;  2VKI A;  5HE1 A;  2EMT A;  2COA A;  4TKN A;  1ZC4 B;  1OMW A;  2DX5 A;  4HAZ B;  2YT1 A;  4HAY B;  2UZS A;  1P5T A;  3P6A A;  2LKO A;  2VSZ A;  4K17 A;  1SGH A;  1LW3 A;  1OQN A;  2DA0 A;  4WJ7 A;  2IYB A;  1BAK A;  3PZD A;  1ISN A;  4DXA B;  1X05 A;  2V76 A;  5JP4 A;  3CIK A;  2DFK A;  3HQC A;  4HB4 B;  1GG3 A;  5GOW B;  1OY2 A;  1FOE A;  1FAO A;  4C0A A;  1MK7 B;  2KCJ A;  5KCV A;  1H4R A;  5KQ4 A;  3ODW A;  4HAW B;  4GZU A;  1FHO A;  2I1J A;  2R09 A;  1J0W A;  1FGY A;  4A6K A;  2EMS A;  2Y8G A;  2YS1 A;  3V5W A;  4K2O A;  1U5E A;  1W1D A;  2BCJ A;  5CLQ B;  2GCJ A;  2RGN B;  5C79 A;  4F7U P;  4BBK A;  1N3H A;  3FM8 C;  5FI0 A;  2P0H A;  1J19 A;  2YT0 A;  4IAP A;  1MIX A;  5FI1 A;  2HE7 A;  1V89 A;  4NSW A;  2L1C A;  5LON B;  2FJL A;  2QKL A;  4MT7 A;  1MKE A;  2RLO A;  3SNH A;  3BJI A;  4CHJ A;  2MWN B;  1BWN A;  2DLW A;  2DTC A;  2P0F A;  3MPX A;  3CXB B;  4Z2N A;  3DXD A;  2DKQ A;  2CY5 A;  2DYN A;  3WA0 A;  2YS5 A;  3PP2 A;  4EKU A;  2D9X A;  4F7H A;  2D9V A;  5D3Y A;  2IFS A;  1IRS A;  2DYQ A;  3ULC A;  1V5U A;  1EAZ A;  2R0D A;  4TYZ A;  4DBB A;  1WGQ A;  2W2W A;  1SHC A;  2J0M A;  2J0K A;  2EC1 A;  3KRW A;  5D3X A;  2I5F A;  1NTY A;  2K00 A;  1KZG A;  3A8Q A;  2K2J A;  4P7I A;  4H8S A;  3BIN A;  2J0J A;  1E5W A;  3RCP A;  1V5M A;  4MK0 A;  4F7G A;  4KVG B;  2COD A;  1UPQ A;  3G9W A;  1GC7 A;  1Y5O A;  3PSC A;  3SO6 A;  5J3T A;  5J3Y A;  1WJM A;  3F5R A;  1M7E A;  1U29 A;  3DXC A;  3SUZ A;  3HW2 B;  5JHH A;  2Y7B A;  1W1G A;  2DHJ A;  3PVU A;  1MPH A;  5LOP B;  2OQB A;  3AU4 A;  2H7E A;  1V61 A;  3TW1 A;  1MIZ B;  2D10 A;  4KHA A;  3N7C A;  4GXB A;  3SV1 A;  1Z87 A;  2P0D A;  2ELB A;  2DKP A;  1UNR A;  2I1K A;  5C6R A;  1GC6 A;  1NU2 A;  1ZC3 B;  3X23 A;  3KY9 A;  1AQC A;  1EF1 A;  4NY0 A;  3F0W A;  1P6S A;  1TJ6 A;  5HE0 A;  2YF0 A;  2D4Q A;  2YVC A;  3QWM A;  4A5K A;  5L81 A;  5DI9 B;  4HDQ A;  2DN6 A;  1NTV A;  1ZSQ A;  2D11 A;  5HE2 A;  1K5G B;  2I5C A;  4HB0 B;  1H10 A;  2YRY A;  4WVF B;  3VOQ A;  1M7R A;  3D8F A;  1UPR A;  4YL8 A;  3TVV A;  2VRW B;  3QIJ A;  2OTX A;  4KAX B;  3T06 A;  2ZPY A;  2ROV A;  5HE3 A;  1U2B A;  2NMB A;  4Y94 A;  1XOD A;  2RNR B;  3SYX A;  3GYP A;  4HDO A;  3QBV B;  1W1H A;  1UEF A;  4ZRK A;  2PZ1 A;  2LOZ A;  3U8Z A;  3ZVR A;  2UZR A;  2KGX B;  3KSY A;  3TCA A;  1Y19 B;  5CLL B;  4IFS A;  1DDM A;  2L2I A;  3TFM A;  1FHW A;  5DHF B;  2UVM A;  1KZ7 A;  3M1I B;  1WGU A;  2YSZ A;  5C5B A;  2KUP A;  3KRX A;  2ROZ B;  4A6H A;  1PMS A;  1DDW A;  3AU5 A;  4HAV B;  2DX1 A;  4ZRI A;  1U5G A;  1MAI A;  3FEH A;  2Z0Q A;  2ELA A;  1ZM0 A;  4HAU B;  4Z2M B;  3FSS A;  3OAN A;  5DHA B;  3KZ1 A;  2Y8F A;  4A6F A;  1DYN A;  1RJ2 A;  4CHM A;  3U7D A;  1X86 A;  5D27 A;  2QKM A;  3AJ4 A;  1V88 A;  2RSG A;  2N23 A;  4GPT B;  3LJU X;  2COF A;  5C16 A;  4DX9 0;  3D8D A;  4PQ0 A;  2GS0 A;  1WVH A;  4GMV A;  2RVB B;  4MY6 A;  5J3Q A;  1FGZ A;  1P3R A;  2W2X D;  4WSF A;  1U5F A;  4L6E A;  3A8P A;  3WYF B;  1QC6 A;  2CY4 A;  4HAX B;  5D3W A;  1UNP A;  1I7A A;  1FHX A;  1U27 A;  3ODX A;  1EVH A;  1FB8 A;  1KI1 B;  1PFJ A;  4PNK A;  2W2X C;  1DRO A;  3MDB C;  1MK9 B;  1RRP B;  2Q13 A;  3ML4 A;  1EGX A;  1XR0 B;  1LB1 A;  1TXD A;  1WI1 A;  3NSU A;  3PVW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...