2DHJA

Solution structure of the ph domain of rho gtpase activating protein 21 from human
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
125
structure length
125
Chain Sequence
GSSGSSGDAAKEGWLHFRPLVTDKGKRVGGSIRPWKQMYVVLRGHSLYLYKDKREQTTPSEEEQPISVNACLIDISYSETKRKNVFRLTTSDCECLFQAEDRDDMLAWIKTIQESSNLNSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords Rho GTPase activating protein 21
publication title Solution structure of the PH domain of Rho GTPase activating protein 21 from human
rcsb
source organism Homo sapiens
total genus 16
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2006-03-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF15410 PH_9 Pleckstrin homology domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2dhjA00
1U2BA 2EMSA 3PEGA 2P0FA 2YT1A 1KZ7A 3SNHA 1XODA 2UZRA 2GJYA 2I1JA 2FJLA 1BTKA 2LOZA 2YRYA 1QC6A 2K00A 4BBKA 2RUKB 3TW1A 1UEFA 2LOXA 3X23A 5LONB 1U5FA 1FHOA 1K5GB 3LJUX 2YSZA 2MDXA 4DX8A 2YT0A 4GN1A 3KRXA 3ZDTA 1OQNA 4ZRKA 4A6HA 5DI9B 3TCAA 2D11A 2W2XD 3SUZA 3AJ4A 2D9VA 2YS3A 3IVFA 4KHOA 5C5BA 1NTYA 4TKNA 2M14A 4IOYX 1M7EA 2DYNA 4YL8A 2D9YA 2R0DA 5DIFB 1UPQA 2Q13A 2CY4A 4D0NB 1ZSQA 3HW2B 1M7RA 1MAIA 1H10A 2DHJA 2NZ8B 2XQNM 3KZ1A 3ODXA 2ZPYA 1P5TA 2COAA 3DXDA 2LG1A 1DROA 4F7GA 3HQCA 2RVBB 2MFQA 2QKMA 4WSFA 1K5DB 2AEHA 2QKLA 5JHGA 1UNQA 4HAUB 3SYXA 2DFKA 5HE1A 1NTVA 2HTHB 2N0YA 1QQGA 4Y94A 4IAPA 4C0AA 2P0HA 1SHCA 3QWMA 4A5KA 1OY2A 5DHFB 3PSCA 4DXAB 1WVHA 3O96A 5KQ4A 4Z2NA 2GCJA 3MDBC 1AQCA 4HAZB 2RLOA 1XD4A 4HAVB 1RJ2A 1MPHA 2Z0QA 1H4RA 3D8DA 2EJ8A 1MIZB 1DYNA 1Y19B 2EC1A 3ULCA 1EF1A 1WG7A 2DTCA 1J19A 2MKRA 2COFA 5HE2A 4MY6A 1X1FA 3GYPA 4GPTB 1FAOA 1DDVA 1MKEA 1BWNA 3ZVRA 1SGHA 5C5BB 2DA0A 3A98B 2ROVA 3KY9A 1DBHA 4HHVA 3ML4A 2D2QA 4HB3B 1P6SA 4MK0A 4CHMA 1WJMA 2ELAA 4KVGB 3ULBA 2ROZB 2I1KA 2D9XA 2UVMA 3V5WA 1MIXA 3HK0A 1IRSA 5J3TA 3PP2A 5DH9B 4F7UP 2YS5A 2IFSA 5EFXA 1PFJA 5LOPB 3UZTA 2IYBA 2D4QA 2W2XC 1BAKA 4NY0A 1MK9B 4K17A 1PMSA 2RNRB 3VOQA 4WJ7A 4HB4B 3BJIA 1W1HA 2VSZA 4HDOA 2DKQA 3ODWA 1ZVRA 2CODA 3PZDA 3KRWA 2BCJA 1FGYA 1XR0B 4YONA 4K2OA 2PZ1A 4EJNA 3D8EA 4PNKA 2KGXB 5JLJB 3AU4A 1V89A 2DYQA 3SV1A 4HB2B 2GS0A 2NMBA 3A8QA 1TXDA 3RCPA 2LYDA 4EKUA 4NSWA 1GC6A 4P7IA 1FOEA 1GG3A 4IFSA 4PQ0A 2DLWA 2D9ZA 1ZM0A 5D3YA 3M1IB 1Z87A 3G9WA 3GYOA 1FB8A 2D9WA 3ODOA 2Z0OA 2Y8GA 2YF0A 3U7DA 5C79A 1WJ1A 2DHIA 2DHKA 4HATB 2H7DA 2K2UA 4L6EA 2Z0PA 5D3VA 5CLLB 1KZGA 5DHAB 3F5RA 1W1GA 2CY5A 2LKOA 1N3HA 1B55A 3T06A 1EGXA 3A8PA 3WYFB 2KCJA 1Y5OA 2CRFA 2ELBA 5FI1A 4KHBB 2X18A 1ZC3B 1EAZA 1Q67A 2Y7BA 2P0DA 1FHXA 3TFMA 2VKIA 4KHAA 4H8SA 1MK7B 2DN6A 1WI1A 2J0JA 1E5WA 1X05A 2JP2A 2V76A 2N23A 1WGUA 2P8VA 4DBBA 3PVLA 1V5MA 4K2PA 1PLSA 4GXBA 1X1GA 2UZSA 3DXEA 4MT7A 1XX0A 4CHJA 3CIKA 3SO6A 1LW3A 2G35A 2MWNB 2L2IA 3U8ZA 2HE7A 4KAXB 5C16A 1FHWA 3OANA 5D27A 3NSUA 1ISNA 4EMOA 4HAXB 1P3RA 3N7CA 1KI1B 1UNPA 1U5DA 1U5EA 1DDMA 3DXCA 3TVVA 2DX5A 4TYZA 1EVHA 4A6FA 4Z2MB 1U5GA 3BINA 3CXBB 5D3XA 4HAWB 1LB1A 2OQBA 4XWXA 5FI0A 2L1CA 5KCVA 1TJ6A 2OTXA 3PVUA 3TO1A 1I2HA 1V88A 5HE0A 2J0KA 2D10A 2DKPA 1DDWA 1XCGA 4B6HA 5C6RA 2RGNB 4K81A 2AL6A 1RRPB 2RSGA 5L81A 4ZRIA 1ZC4B 2GCLA 3AU5A 4ZRJA 1J0WA 2EMTA 2M38A 2YS1A 4WVFB 3KSYA 5HE3A 2H7EA 5GOWB 1BTNA 2LULA 1AWEA 4DX90 2DX1A 1NU2A 2E2XA 3F0WA 2J0MA 4HB0B 3VIAA 2K2JA 2YVCA 1W1DA 3MPXA 1V5UA 3QBVB 2J59M 4HAYB 3PG7A 5CLQB 4A6FB 4GMXB 1OMWA 1UPRA 5D3WA 2Y8FA 3FM8C 5JHHA 1WGQA 3FSSA 1XKEA 4GMVA 5KQ1A 3P6AA 1U27A 1TQZA 4HDQA 3WA0A 1I7AA 5J3YA 1NI2A 2W2WA 1FGZA 5J3QA 3P7ZA 2VRWB 3D8FA 4F7HA 1UNRA 1X11A 2COCA 5JP4A 3FEHA 1V5PA 2CAYA 3QIJA 1V61A 1GC7A 2I5FA 1X86A 4A6KA 1U29A 4CYEA 2R09A 4GZUA 3PVWA 2I5CA 2KUPA 2ADZA
chains in the Genus database with same CATH superfamily
1U2BA 2EMSA 5I2SA 2NBVA 3PEGA 2P0FA 2YT1A 1KZ7A 1T77A 3SNHA 1XODA 2UZRA 2GJYA 2I1JA 2FJLA 1BTKA 2LOZA 2YRYA 1QC6A 3FVCA 2K00A 4BBKA 2RUKB 3TW1A 1UEFA 2LOXA 3X23A 5LONB 1U5FA 1FHOA 1K5GB 3LJUX 2YSZA 2MDXA 4DX8A 3NWFA 2YT0A 4GN1A 3KRXA 3ZDTA 1OQNA 4ZRKA 3NWDA 4A6HA 5DI9B 3TCAA 3B77A 2D11A 2W2XD 3SUZA 3AJ4A 2D9VA 3HIEA 2YS3A 3IVFA 4KHOA 5C5BA 1NTYA 4TKNA 2M14A 4IOYX 1M7EA 2DYNA 1MI1A 4YL8A 2D9YA 2R0DA 5DIFB 1UPQA 2Q13A 2CY4A 2R2YA 4D0NB 1ZSQA 3HW2B 1M7RA 1MAIA 1H10A 2DHJA 2NZ8B 2XQNM 3KZ1A 3ODXA 2ZPYA 1P5TA 2COAA 3DXDA 2LG1A 1DROA 4F7GA 3HQCA 2RVBB 2MFQA 2QKMA 2Z13A 4WSFA 1K5DB 2AEHA 2QKLA 5JHGA 1UNQA 4HAUB 3SYXA 2DFKA 5HE1A 1NTVA 2HTHB 2N0YA 1QQGA 4Y94A 4IAPA 4C0AA 2P0HA 1SHCA 3QWMA 4A5KA 1OY2A 5DHFB 3PSCA 4DXAB 1WVHA 2Z4DA 3O96A 5KQ4A 4Z2NA 2GCJA 3MDBC 1AQCA 4HAZB 2RLOA 1XD4A 4HAVB 1RJ2A 1MPHA 2Z0QA 1H4RA 3D8DA 2EJ8A 1MIZB 2Z59A 4QXAB 1DYNA 1Y19B 2EC1A 3ULCA 1EF1A 3NW8A 1WG7A 2DTCA 1J19A 2MKRA 2COFA 5HE2A 4MY6A 1X1FA 3GYPA 4GPTB 1FAOA 1DDVA 1MKEA 1BWNA 3ZVRA 1SGHA 5C5BB 2DA0A 3A98B 2ROVA 3KY9A 1DBHA 4HHVA 3ML4A 2D2QA 4HB3B 1P6SA 4MK0A 4CHMA 1WJMA 2ELAA 4KVGB 3ULBA 2ROZB 2I1KA 2D9XA 2UVMA 3V5WA 1MIXA 3HK0A 3U12A 1IRSA 2ZKMX 3PP2A 5DH9B 4F7UP 5J3TA 2YS5A 2IFSA 5EFXA 1PFJA 5LOPB 2Z14A 3UZTA 2IYBA 2D4QA 2W2XC 2YT2A 5M4YB 1BAKA 4NY0A 1MK9B 4K17A 1PMSA 2RNRB 3VOQA 4WJ7A 4HB4B 3BJIA 1W1HA 2VSZA 4HDOA 2DKQA 3ODWA 1ZVRA 2CODA 3PZDA 3KRWA 2BCJA 1FGYA 1XR0B 4KHBA 4YONA 4K2OA 2PZ1A 4EJNA 3D8EA 4PNKA 2KGXB 5JLJB 3AU4A 2GUMA 1V89A 2DYQA 4OT1A 3SV1A 4OSNA 4HB2B 2GS0A 2NMBA 3A8QA 1TXDA 3RCPA 2LYDA 4EKUA 4NSWA 1GC6A 4P7IA 1FOEA 1GG3A 4IFSA 4PQ0A 2DLWA 2D9ZA 1ZM0A 5D3YA 3GYOA 1Z87A 3G9WA 3M1IB 5IRSA 1FB8A 2D9WA 3ODOA 2Z0OA 2Y8GA 2YF0A 3U7DA 5C79A 1WJ1A 2KUQA 2DHIA 2DHKA 4HATB 2H7DA 2K2UA 4L6EA 4D6WA 4CSQA 2Z0PA 3A58A 5D3VA 5CLLB 3HSAA 1KZGA 5DHAB 3F5RA 1W1GA 2CY5A 2LKOA 4GNKB 1N3HA 1B55A 3T06A 1EGXA 3A8PA 3WYFB 4GOUA 2KCJA 1Y5OA 2CRFA 2ELBA 5FI1A 4KHBB 2X18A 1ZC3B 1EAZA 1Q67A 2Y7BA 2P0DA 1FHXA 5LG4B 3TFMA 2VKIA 4KHAA 4H8SA 1MK7B 2DN6A 1WI1A 2J0JA 1E5WA 1X05A 2JP2A 4L1RA 2V76A 2N23A 1WGUA 2P8VA 4DBBA 3PVLA 1V5MA 4K2PA 1PLSA 4GXBA 1X1GA 2UZSA 3DXEA 4MT7A 1XX0A 4CHJA 3CIKA 3SO6A 1LW3A 2G35A 2MWNB 2L2IA 3U8ZA 2HE7A 2KIGA 4KAXB 2K8EA 5C16A 1FHWA 3OANA 1ZYIA 5D27A 3NSUA 1ISNA 4EMOA 4HAXB 2FJUB 1P3RA 3N7CA 4QJ3B 1KI1B 1UNPA 1U5DA 1U5EA 1DDMA 3DXCA 3TVVA 2DX5A 4TYZA 1EVHA 4A6FA 3OHMB 4Z2MB 1U5GA 3BINA 3CXBB 5D3XA 4HAWB 1LB1A 2OQBA 4XWXA 5FI0A 2L1CA 5KCVA 1TJ6A 4QJ4B 2OTXA 3PVUA 3TO1A 1I2HA 2RRFA 1V88A 5HE0A 2J0KA 2D10A 2DKPA 1DDWA 1XCGA 4B6HA 5C6RA 3DCXA 2RGNB 4K81A 4HSIA 2AL6A 1RRPB 2RSGA 5L81A 4ZRIA 1ZC4B 2GCLA 3AU5A 4ZRJA 1J0WA 2EMTA 2M38A 2YS1A 4WVFB 3KSYA 5HE3A 2H7EA 5GOWB 1BTNA 2LULA 1AWEA 4DX90 2DX1A 1NU2A 2E2XA 3F0WA 2J0MA 4HB0B 3VIAA 2K2JA 2YVCA 1W1DA 3MPXA 1V5UA 3QBVB 2J59M 4HAYB 3PG7A 4QJ5B 5CLQB 4A6FB 4GMXB 1OMWA 1UPRA 3NWAA 5D3WA 2Y8FA 3FM8C 5JHHA 1WGQA 3FSSA 1XKEA 4GMVA 5KQ1A 3P6AA 1U27A 1TQZA 4HDQA 3WA0A 1I7AA 5J3YA 2KR0A 1NI2A 2W2WA 1FGZA 5J3QA 2KIEA 3P7ZA 2VRWB 3D8FA 4F7HA 1UNRA 1X11A 2COCA 5JP4A 3FEHA 1V5PA 2CAYA 3QIJA 5I2MA 1V61A 1GC7A 2I5FA 1X86A 4A6KA 4DIXA 1U29A 4CYEA 2R09A 2K49A 4GZUA 3PVWA 2I5CA 2KUPA 2ADZA
chains in the Genus database with same CATH topology
1U2BA 2EMSA 3PEGA 2P0FA 2YT1A 1KZ7A 3SNHA 1XODA 2UZRA 2GJYA 2I1JA 2FJLA 1BTKA 2LOZA 2YRYA 1QC6A 2K00A 4BBKA 2RUKB 3TW1A 1UEFA 2LOXA 3X23A 5LONB 1U5FA 1FHOA 1K5GB 3LJUX 2YSZA 2MDXA 4DX8A 2YT0A 4GN1A 3KRXA 3ZDTA 1OQNA 4ZRKA 4A6HA 5DI9B 3TCAA 2D11A 2W2XD 3SUZA 3AJ4A 2D9VA 2YS3A 3IVFA 4KHOA 5C5BA 1NTYA 4TKNA 2M14A 4IOYX 1M7EA 2DYNA 4YL8A 2D9YA 2R0DA 5DIFB 1UPQA 2Q13A 2CY4A 4D0NB 1ZSQA 3HW2B 1M7RA 1MAIA 1H10A 2DHJA 2NZ8B 2XQNM 3KZ1A 3ODXA 2ZPYA 1P5TA 2COAA 3DXDA 2LG1A 1DROA 4F7GA 3HQCA 2RVBB 2MFQA 2QKMA 4WSFA 1K5DB 2AEHA 2QKLA 5JHGA 1UNQA 4HAUB 3SYXA 2DFKA 5HE1A 1NTVA 2HTHB 2N0YA 1QQGA 4Y94A 4IAPA 4C0AA 2P0HA 1SHCA 3QWMA 4A5KA 1OY2A 5DHFB 3PSCA 4DXAB 1WVHA 3O96A 5KQ4A 4Z2NA 2GCJA 3MDBC 1AQCA 4HAZB 2RLOA 1XD4A 4HAVB 1RJ2A 1MPHA 2Z0QA 1H4RA 3D8DA 2EJ8A 1MIZB 1DYNA 1Y19B 2EC1A 3ULCA 1EF1A 1WG7A 2DTCA 1J19A 2MKRA 2COFA 5HE2A 4MY6A 1X1FA 3GYPA 4GPTB 1FAOA 1DDVA 1MKEA 1BWNA 3ZVRA 1SGHA 5C5BB 2DA0A 3A98B 2ROVA 3KY9A 1DBHA 4HHVA 3ML4A 2D2QA 4HB3B 1P6SA 4MK0A 4CHMA 1WJMA 2ELAA 4KVGB 3ULBA 2ROZB 2I1KA 2D9XA 2UVMA 3V5WA 1MIXA 3HK0A 1IRSA 5J3TA 3PP2A 5DH9B 4F7UP 2YS5A 2IFSA 5EFXA 1PFJA 5LOPB 3UZTA 2IYBA 2D4QA 2W2XC 1BAKA 4NY0A 1MK9B 4K17A 1PMSA 2RNRB 3VOQA 4WJ7A 4HB4B 3BJIA 1W1HA 2VSZA 4HDOA 2DKQA 3ODWA 1ZVRA 2CODA 3PZDA 3KRWA 2BCJA 1FGYA 1XR0B 4YONA 4K2OA 2PZ1A 4EJNA 3D8EA 4PNKA 2KGXB 5JLJB 3AU4A 1V89A 2DYQA 3SV1A 4HB2B 2GS0A 2NMBA 3A8QA 1TXDA 3RCPA 2LYDA 4EKUA 4NSWA 1GC6A 4P7IA 1FOEA 1GG3A 4IFSA 4PQ0A 2DLWA 2D9ZA 1ZM0A 5D3YA 3M1IB 1Z87A 3G9WA 3GYOA 1FB8A 2D9WA 3ODOA 2Z0OA 2Y8GA 2YF0A 3U7DA 5C79A 1WJ1A 2DHIA 2DHKA 4HATB 2H7DA 2K2UA 4L6EA 2Z0PA 5D3VA 5CLLB 1KZGA 5DHAB 3F5RA 1W1GA 2CY5A 2LKOA 1N3HA 1B55A 3T06A 1EGXA 3A8PA 3WYFB 2KCJA 1Y5OA 2CRFA 2ELBA 5FI1A 4KHBB 2X18A 1ZC3B 1EAZA 1Q67A 2Y7BA 2P0DA 1FHXA 3TFMA 2VKIA 4KHAA 4H8SA 1MK7B 2DN6A 1WI1A 2J0JA 1E5WA 1X05A 2JP2A 2V76A 2N23A 1WGUA 2P8VA 4DBBA 3PVLA 1V5MA 4K2PA 1PLSA 4GXBA 1X1GA 2UZSA 3DXEA 4MT7A 1XX0A 4CHJA 3CIKA 3SO6A 1LW3A 2G35A 2MWNB 2L2IA 3U8ZA 2HE7A 4KAXB 5C16A 1FHWA 3OANA 5D27A 3NSUA 1ISNA 4EMOA 4HAXB 1P3RA 3N7CA 1KI1B 1UNPA 1U5DA 1U5EA 1DDMA 3DXCA 3TVVA 2DX5A 4TYZA 1EVHA 4A6FA 4Z2MB 1U5GA 3BINA 3CXBB 5D3XA 4HAWB 1LB1A 2OQBA 4XWXA 5FI0A 2L1CA 5KCVA 1TJ6A 2OTXA 3PVUA 3TO1A 1I2HA 1V88A 5HE0A 2J0KA 2D10A 2DKPA 1DDWA 1XCGA 4B6HA 5C6RA 2RGNB 4K81A 2AL6A 1RRPB 2RSGA 5L81A 4ZRIA 1ZC4B 2GCLA 3AU5A 4ZRJA 1J0WA 2EMTA 2M38A 2YS1A 4WVFB 3KSYA 5HE3A 2H7EA 5GOWB 1BTNA 2LULA 1AWEA 4DX90 2DX1A 1NU2A 2E2XA 3F0WA 2J0MA 4HB0B 3VIAA 2K2JA 2YVCA 1W1DA 3MPXA 1V5UA 3QBVB 2J59M 4HAYB 3PG7A 5CLQB 4A6FB 4GMXB 1OMWA 1UPRA 5D3WA 2Y8FA 3FM8C 5JHHA 1WGQA 3FSSA 1XKEA 4GMVA 5KQ1A 3P6AA 1U27A 1TQZA 4HDQA 3WA0A 1I7AA 5J3YA 1NI2A 2W2WA 1FGZA 5J3QA 3P7ZA 2VRWB 3D8FA 4F7HA 1UNRA 1X11A 2COCA 5JP4A 3FEHA 1V5PA 2CAYA 3QIJA 1V61A 1GC7A 2I5FA 1X86A 4A6KA 1U29A 4CYEA 2R09A 4GZUA 3PVWA 2I5CA 2KUPA 2ADZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1U2B A;  2EMS A;  3PEG A;  2P0F A;  2YT1 A;  1KZ7 A;  3SNH A;  1XOD A;  2UZR A;  2GJY A;  2I1J A;  2FJL A;  1BTK A;  2LOZ A;  2YRY A;  1QC6 A;  2K00 A;  4BBK A;  2RUK B;  3TW1 A;  1UEF A;  2LOX A;  3X23 A;  5LON B;  1U5F A;  1FHO A;  1K5G B;  3LJU X;  2YSZ A;  2MDX A;  4DX8 A;  2YT0 A;  4GN1 A;  3KRX A;  3ZDT A;  1OQN A;  4ZRK A;  4A6H A;  5DI9 B;  3TCA A;  2D11 A;  2W2X D;  3SUZ A;  3AJ4 A;  2D9V A;  2YS3 A;  3IVF A;  4KHO A;  5C5B A;  1NTY A;  4TKN A;  2M14 A;  4IOY X;  1M7E A;  2DYN A;  4YL8 A;  2D9Y A;  2R0D A;  5DIF B;  1UPQ A;  2Q13 A;  2CY4 A;  4D0N B;  1ZSQ A;  3HW2 B;  1M7R A;  1MAI A;  1H10 A;  2DHJ A;  2NZ8 B;  2XQN M;  3KZ1 A;  3ODX A;  2ZPY A;  1P5T A;  2COA A;  3DXD A;  2LG1 A;  1DRO A;  4F7G A;  3HQC A;  2RVB B;  2MFQ A;  2QKM A;  4WSF A;  1K5D B;  2AEH A;  2QKL A;  5JHG A;  1UNQ A;  4HAU B;  3SYX A;  2DFK A;  5HE1 A;  1NTV A;  2HTH B;  2N0Y A;  1QQG A;  4Y94 A;  4IAP A;  4C0A A;  2P0H A;  1SHC A;  3QWM A;  4A5K A;  1OY2 A;  5DHF B;  3PSC A;  4DXA B;  1WVH A;  3O96 A;  5KQ4 A;  4Z2N A;  2GCJ A;  3MDB C;  1AQC A;  4HAZ B;  2RLO A;  1XD4 A;  4HAV B;  1RJ2 A;  1MPH A;  2Z0Q A;  1H4R A;  3D8D A;  2EJ8 A;  1MIZ B;  1DYN A;  1Y19 B;  2EC1 A;  3ULC A;  1EF1 A;  1WG7 A;  2DTC A;  1J19 A;  2MKR A;  2COF A;  5HE2 A;  4MY6 A;  1X1F A;  3GYP A;  4GPT B;  1FAO A;  1DDV A;  1MKE A;  1BWN A;  3ZVR A;  1SGH A;  5C5B B;  2DA0 A;  3A98 B;  2ROV A;  3KY9 A;  1DBH A;  4HHV A;  3ML4 A;  2D2Q A;  4HB3 B;  1P6S A;  4MK0 A;  4CHM A;  1WJM A;  2ELA A;  4KVG B;  3ULB A;  2ROZ B;  2I1K A;  2D9X A;  2UVM A;  3V5W A;  1MIX A;  3HK0 A;  1IRS A;  5J3T A;  3PP2 A;  5DH9 B;  4F7U P;  2YS5 A;  2IFS A;  5EFX A;  1PFJ A;  5LOP B;  3UZT A;  2IYB A;  2D4Q A;  2W2X C;  1BAK A;  4NY0 A;  1MK9 B;  4K17 A;  1PMS A;  2RNR B;  3VOQ A;  4WJ7 A;  4HB4 B;  3BJI A;  1W1H A;  2VSZ A;  4HDO A;  2DKQ A;  3ODW A;  1ZVR A;  2COD A;  3PZD A;  3KRW A;  2BCJ A;  1FGY A;  1XR0 B;  4YON A;  4K2O A;  2PZ1 A;  4EJN A;  3D8E A;  4PNK A;  2KGX B;  5JLJ B;  3AU4 A;  1V89 A;  2DYQ A;  3SV1 A;  4HB2 B;  2GS0 A;  2NMB A;  3A8Q A;  1TXD A;  3RCP A;  2LYD A;  4EKU A;  4NSW A;  1GC6 A;  4P7I A;  1FOE A;  1GG3 A;  4IFS A;  4PQ0 A;  2DLW A;  2D9Z A;  1ZM0 A;  5D3Y A;  3M1I B;  1Z87 A;  3G9W A;  3GYO A;  1FB8 A;  2D9W A;  3ODO A;  2Z0O A;  2Y8G A;  2YF0 A;  3U7D A;  5C79 A;  1WJ1 A;  2DHI A;  2DHK A;  4HAT B;  2H7D A;  2K2U A;  4L6E A;  2Z0P A;  5D3V A;  5CLL B;  1KZG A;  5DHA B;  3F5R A;  1W1G A;  2CY5 A;  2LKO A;  1N3H A;  1B55 A;  3T06 A;  1EGX A;  3A8P A;  3WYF B;  2KCJ A;  1Y5O A;  2CRF A;  2ELB A;  5FI1 A;  4KHB B;  2X18 A;  1ZC3 B;  1EAZ A;  1Q67 A;  2Y7B A;  2P0D A;  1FHX A;  3TFM A;  2VKI A;  4KHA A;  4H8S A;  1MK7 B;  2DN6 A;  1WI1 A;  2J0J A;  1E5W A;  1X05 A;  2JP2 A;  2V76 A;  2N23 A;  1WGU A;  2P8V A;  4DBB A;  3PVL A;  1V5M A;  4K2P A;  1PLS A;  4GXB A;  1X1G A;  2UZS A;  3DXE A;  4MT7 A;  1XX0 A;  4CHJ A;  3CIK A;  3SO6 A;  1LW3 A;  2G35 A;  2MWN B;  2L2I A;  3U8Z A;  2HE7 A;  4KAX B;  5C16 A;  1FHW A;  3OAN A;  5D27 A;  3NSU A;  1ISN A;  4EMO A;  4HAX B;  1P3R A;  3N7C A;  1KI1 B;  1UNP A;  1U5D A;  1U5E A;  1DDM A;  3DXC A;  3TVV A;  2DX5 A;  4TYZ A;  1EVH A;  4A6F A;  4Z2M B;  1U5G A;  3BIN A;  3CXB B;  5D3X A;  4HAW B;  1LB1 A;  2OQB A;  4XWX A;  5FI0 A;  2L1C A;  5KCV A;  1TJ6 A;  2OTX A;  3PVU A;  3TO1 A;  1I2H A;  1V88 A;  5HE0 A;  2J0K A;  2D10 A;  2DKP A;  1DDW A;  1XCG A;  4B6H A;  5C6R A;  2RGN B;  4K81 A;  2AL6 A;  1RRP B;  2RSG A;  5L81 A;  4ZRI A;  1ZC4 B;  2GCL A;  3AU5 A;  4ZRJ A;  1J0W A;  2EMT A;  2M38 A;  2YS1 A;  4WVF B;  3KSY A;  5HE3 A;  2H7E A;  5GOW B;  1BTN A;  2LUL A;  1AWE A;  4DX9 0;  2DX1 A;  1NU2 A;  2E2X A;  3F0W A;  2J0M A;  4HB0 B;  3VIA A;  2K2J A;  2YVC A;  1W1D A;  3MPX A;  1V5U A;  3QBV B;  2J59 M;  4HAY B;  3PG7 A;  5CLQ B;  4A6F B;  4GMX B;  1OMW A;  1UPR A;  5D3W A;  2Y8F A;  3FM8 C;  5JHH A;  1WGQ A;  3FSS A;  1XKE A;  4GMV A;  5KQ1 A;  3P6A A;  1U27 A;  1TQZ A;  4HDQ A;  3WA0 A;  1I7A A;  5J3Y A;  1NI2 A;  2W2W A;  1FGZ A;  5J3Q A;  3P7Z A;  2VRW B;  3D8F A;  4F7H A;  1UNR A;  1X11 A;  2COC A;  5JP4 A;  3FEH A;  1V5P A;  2CAY A;  3QIJ A;  1V61 A;  1GC7 A;  2I5F A;  1X86 A;  4A6K A;  1U29 A;  4CYE A;  2R09 A;  4GZU A;  3PVW A;  2I5C A;  2KUP A;  2ADZ A; 
#chains in the Genus database with same CATH topology
 1U2B A;  2EMS A;  5I2S A;  2NBV A;  3PEG A;  2P0F A;  2YT1 A;  1KZ7 A;  1T77 A;  3SNH A;  1XOD A;  2UZR A;  2GJY A;  2I1J A;  2FJL A;  1BTK A;  2LOZ A;  2YRY A;  1QC6 A;  3FVC A;  2K00 A;  4BBK A;  2RUK B;  3TW1 A;  1UEF A;  2LOX A;  3X23 A;  5LON B;  1U5F A;  1FHO A;  1K5G B;  3LJU X;  2YSZ A;  2MDX A;  4DX8 A;  3NWF A;  2YT0 A;  4GN1 A;  3KRX A;  3ZDT A;  1OQN A;  4ZRK A;  3NWD A;  4A6H A;  5DI9 B;  3TCA A;  3B77 A;  2D11 A;  2W2X D;  3SUZ A;  3AJ4 A;  2D9V A;  3HIE A;  2YS3 A;  3IVF A;  4KHO A;  5C5B A;  1NTY A;  4TKN A;  2M14 A;  4IOY X;  1M7E A;  2DYN A;  1MI1 A;  4YL8 A;  2D9Y A;  2R0D A;  5DIF B;  1UPQ A;  2Q13 A;  2CY4 A;  2R2Y A;  4D0N B;  1ZSQ A;  3HW2 B;  1M7R A;  1MAI A;  1H10 A;  2DHJ A;  2NZ8 B;  2XQN M;  3KZ1 A;  3ODX A;  2ZPY A;  1P5T A;  2COA A;  3DXD A;  2LG1 A;  1DRO A;  4F7G A;  3HQC A;  2RVB B;  2MFQ A;  2QKM A;  2Z13 A;  4WSF A;  1K5D B;  2AEH A;  2QKL A;  5JHG A;  1UNQ A;  4HAU B;  3SYX A;  2DFK A;  5HE1 A;  1NTV A;  2HTH B;  2N0Y A;  1QQG A;  4Y94 A;  4IAP A;  4C0A A;  2P0H A;  1SHC A;  3QWM A;  4A5K A;  1OY2 A;  5DHF B;  3PSC A;  4DXA B;  1WVH A;  2Z4D A;  3O96 A;  5KQ4 A;  4Z2N A;  2GCJ A;  3MDB C;  1AQC A;  4HAZ B;  2RLO A;  1XD4 A;  4HAV B;  1RJ2 A;  1MPH A;  2Z0Q A;  1H4R A;  3D8D A;  2EJ8 A;  1MIZ B;  2Z59 A;  4QXA B;  1DYN A;  1Y19 B;  2EC1 A;  3ULC A;  1EF1 A;  3NW8 A;  1WG7 A;  2DTC A;  1J19 A;  2MKR A;  2COF A;  5HE2 A;  4MY6 A;  1X1F A;  3GYP A;  4GPT B;  1FAO A;  1DDV A;  1MKE A;  1BWN A;  3ZVR A;  1SGH A;  5C5B B;  2DA0 A;  3A98 B;  2ROV A;  3KY9 A;  1DBH A;  4HHV A;  3ML4 A;  2D2Q A;  4HB3 B;  1P6S A;  4MK0 A;  4CHM A;  1WJM A;  2ELA A;  4KVG B;  3ULB A;  2ROZ B;  2I1K A;  2D9X A;  2UVM A;  3V5W A;  1MIX A;  3HK0 A;  3U12 A;  1IRS A;  2ZKM X;  3PP2 A;  5DH9 B;  4F7U P;  5J3T A;  2YS5 A;  2IFS A;  5EFX A;  1PFJ A;  5LOP B;  2Z14 A;  3UZT A;  2IYB A;  2D4Q A;  2W2X C;  2YT2 A;  5M4Y B;  1BAK A;  4NY0 A;  1MK9 B;  4K17 A;  1PMS A;  2RNR B;  3VOQ A;  4WJ7 A;  4HB4 B;  3BJI A;  1W1H A;  2VSZ A;  4HDO A;  2DKQ A;  3ODW A;  1ZVR A;  2COD A;  3PZD A;  3KRW A;  2BCJ A;  1FGY A;  1XR0 B;  4KHB A;  4YON A;  4K2O A;  2PZ1 A;  4EJN A;  3D8E A;  4PNK A;  2KGX B;  5JLJ B;  3AU4 A;  2GUM A;  1V89 A;  2DYQ A;  4OT1 A;  3SV1 A;  4OSN A;  4HB2 B;  2GS0 A;  2NMB A;  3A8Q A;  1TXD A;  3RCP A;  2LYD A;  4EKU A;  4NSW A;  1GC6 A;  4P7I A;  1FOE A;  1GG3 A;  4IFS A;  4PQ0 A;  2DLW A;  2D9Z A;  1ZM0 A;  5D3Y A;  3GYO A;  1Z87 A;  3G9W A;  3M1I B;  5IRS A;  1FB8 A;  2D9W A;  3ODO A;  2Z0O A;  2Y8G A;  2YF0 A;  3U7D A;  5C79 A;  1WJ1 A;  2KUQ A;  2DHI A;  2DHK A;  4HAT B;  2H7D A;  2K2U A;  4L6E A;  4D6W A;  4CSQ A;  2Z0P A;  3A58 A;  5D3V A;  5CLL B;  3HSA A;  1KZG A;  5DHA B;  3F5R A;  1W1G A;  2CY5 A;  2LKO A;  4GNK B;  1N3H A;  1B55 A;  3T06 A;  1EGX A;  3A8P A;  3WYF B;  4GOU A;  2KCJ A;  1Y5O A;  2CRF A;  2ELB A;  5FI1 A;  4KHB B;  2X18 A;  1ZC3 B;  1EAZ A;  1Q67 A;  2Y7B A;  2P0D A;  1FHX A;  5LG4 B;  3TFM A;  2VKI A;  4KHA A;  4H8S A;  1MK7 B;  2DN6 A;  1WI1 A;  2J0J A;  1E5W A;  1X05 A;  2JP2 A;  4L1R A;  2V76 A;  2N23 A;  1WGU A;  2P8V A;  4DBB A;  3PVL A;  1V5M A;  4K2P A;  1PLS A;  4GXB A;  1X1G A;  2UZS A;  3DXE A;  4MT7 A;  1XX0 A;  4CHJ A;  3CIK A;  3SO6 A;  1LW3 A;  2G35 A;  2MWN B;  2L2I A;  3U8Z A;  2HE7 A;  2KIG A;  4KAX B;  2K8E A;  5C16 A;  1FHW A;  3OAN A;  1ZYI A;  5D27 A;  3NSU A;  1ISN A;  4EMO A;  4HAX B;  2FJU B;  1P3R A;  3N7C A;  4QJ3 B;  1KI1 B;  1UNP A;  1U5D A;  1U5E A;  1DDM A;  3DXC A;  3TVV A;  2DX5 A;  4TYZ A;  1EVH A;  4A6F A;  3OHM B;  4Z2M B;  1U5G A;  3BIN A;  3CXB B;  5D3X A;  4HAW B;  1LB1 A;  2OQB A;  4XWX A;  5FI0 A;  2L1C A;  5KCV A;  1TJ6 A;  4QJ4 B;  2OTX A;  3PVU A;  3TO1 A;  1I2H A;  2RRF A;  1V88 A;  5HE0 A;  2J0K A;  2D10 A;  2DKP A;  1DDW A;  1XCG A;  4B6H A;  5C6R A;  3DCX A;  2RGN B;  4K81 A;  4HSI A;  2AL6 A;  1RRP B;  2RSG A;  5L81 A;  4ZRI A;  1ZC4 B;  2GCL A;  3AU5 A;  4ZRJ A;  1J0W A;  2EMT A;  2M38 A;  2YS1 A;  4WVF B;  3KSY A;  5HE3 A;  2H7E A;  5GOW B;  1BTN A;  2LUL A;  1AWE A;  4DX9 0;  2DX1 A;  1NU2 A;  2E2X A;  3F0W A;  2J0M A;  4HB0 B;  3VIA A;  2K2J A;  2YVC A;  1W1D A;  3MPX A;  1V5U A;  3QBV B;  2J59 M;  4HAY B;  3PG7 A;  4QJ5 B;  5CLQ B;  4A6F B;  4GMX B;  1OMW A;  1UPR A;  3NWA A;  5D3W A;  2Y8F A;  3FM8 C;  5JHH A;  1WGQ A;  3FSS A;  1XKE A;  4GMV A;  5KQ1 A;  3P6A A;  1U27 A;  1TQZ A;  4HDQ A;  3WA0 A;  1I7A A;  5J3Y A;  2KR0 A;  1NI2 A;  2W2W A;  1FGZ A;  5J3Q A;  2KIE A;  3P7Z A;  2VRW B;  3D8F A;  4F7H A;  1UNR A;  1X11 A;  2COC A;  5JP4 A;  3FEH A;  1V5P A;  2CAY A;  3QIJ A;  5I2M A;  1V61 A;  1GC7 A;  2I5F A;  1X86 A;  4A6K A;  4DIX A;  1U29 A;  4CYE A;  2R09 A;  2K49 A;  4GZU A;  3PVW A;  2I5C A;  2KUP A;  2ADZ A; 
#chains in the Genus database with same CATH homology
 1U2B A;  2EMS A;  3PEG A;  2P0F A;  2YT1 A;  1KZ7 A;  3SNH A;  1XOD A;  2UZR A;  2GJY A;  2I1J A;  2FJL A;  1BTK A;  2LOZ A;  2YRY A;  1QC6 A;  2K00 A;  4BBK A;  2RUK B;  3TW1 A;  1UEF A;  2LOX A;  3X23 A;  5LON B;  1U5F A;  1FHO A;  1K5G B;  3LJU X;  2YSZ A;  2MDX A;  4DX8 A;  2YT0 A;  4GN1 A;  3KRX A;  3ZDT A;  1OQN A;  4ZRK A;  4A6H A;  5DI9 B;  3TCA A;  2D11 A;  2W2X D;  3SUZ A;  3AJ4 A;  2D9V A;  2YS3 A;  3IVF A;  4KHO A;  5C5B A;  1NTY A;  4TKN A;  2M14 A;  4IOY X;  1M7E A;  2DYN A;  4YL8 A;  2D9Y A;  2R0D A;  5DIF B;  1UPQ A;  2Q13 A;  2CY4 A;  4D0N B;  1ZSQ A;  3HW2 B;  1M7R A;  1MAI A;  1H10 A;  2DHJ A;  2NZ8 B;  2XQN M;  3KZ1 A;  3ODX A;  2ZPY A;  1P5T A;  2COA A;  3DXD A;  2LG1 A;  1DRO A;  4F7G A;  3HQC A;  2RVB B;  2MFQ A;  2QKM A;  4WSF A;  1K5D B;  2AEH A;  2QKL A;  5JHG A;  1UNQ A;  4HAU B;  3SYX A;  2DFK A;  5HE1 A;  1NTV A;  2HTH B;  2N0Y A;  1QQG A;  4Y94 A;  4IAP A;  4C0A A;  2P0H A;  1SHC A;  3QWM A;  4A5K A;  1OY2 A;  5DHF B;  3PSC A;  4DXA B;  1WVH A;  3O96 A;  5KQ4 A;  4Z2N A;  2GCJ A;  3MDB C;  1AQC A;  4HAZ B;  2RLO A;  1XD4 A;  4HAV B;  1RJ2 A;  1MPH A;  2Z0Q A;  1H4R A;  3D8D A;  2EJ8 A;  1MIZ B;  1DYN A;  1Y19 B;  2EC1 A;  3ULC A;  1EF1 A;  1WG7 A;  2DTC A;  1J19 A;  2MKR A;  2COF A;  5HE2 A;  4MY6 A;  1X1F A;  3GYP A;  4GPT B;  1FAO A;  1DDV A;  1MKE A;  1BWN A;  3ZVR A;  1SGH A;  5C5B B;  2DA0 A;  3A98 B;  2ROV A;  3KY9 A;  1DBH A;  4HHV A;  3ML4 A;  2D2Q A;  4HB3 B;  1P6S A;  4MK0 A;  4CHM A;  1WJM A;  2ELA A;  4KVG B;  3ULB A;  2ROZ B;  2I1K A;  2D9X A;  2UVM A;  3V5W A;  1MIX A;  3HK0 A;  1IRS A;  5J3T A;  3PP2 A;  5DH9 B;  4F7U P;  2YS5 A;  2IFS A;  5EFX A;  1PFJ A;  5LOP B;  3UZT A;  2IYB A;  2D4Q A;  2W2X C;  1BAK A;  4NY0 A;  1MK9 B;  4K17 A;  1PMS A;  2RNR B;  3VOQ A;  4WJ7 A;  4HB4 B;  3BJI A;  1W1H A;  2VSZ A;  4HDO A;  2DKQ A;  3ODW A;  1ZVR A;  2COD A;  3PZD A;  3KRW A;  2BCJ A;  1FGY A;  1XR0 B;  4YON A;  4K2O A;  2PZ1 A;  4EJN A;  3D8E A;  4PNK A;  2KGX B;  5JLJ B;  3AU4 A;  1V89 A;  2DYQ A;  3SV1 A;  4HB2 B;  2GS0 A;  2NMB A;  3A8Q A;  1TXD A;  3RCP A;  2LYD A;  4EKU A;  4NSW A;  1GC6 A;  4P7I A;  1FOE A;  1GG3 A;  4IFS A;  4PQ0 A;  2DLW A;  2D9Z A;  1ZM0 A;  5D3Y A;  3M1I B;  1Z87 A;  3G9W A;  3GYO A;  1FB8 A;  2D9W A;  3ODO A;  2Z0O A;  2Y8G A;  2YF0 A;  3U7D A;  5C79 A;  1WJ1 A;  2DHI A;  2DHK A;  4HAT B;  2H7D A;  2K2U A;  4L6E A;  2Z0P A;  5D3V A;  5CLL B;  1KZG A;  5DHA B;  3F5R A;  1W1G A;  2CY5 A;  2LKO A;  1N3H A;  1B55 A;  3T06 A;  1EGX A;  3A8P A;  3WYF B;  2KCJ A;  1Y5O A;  2CRF A;  2ELB A;  5FI1 A;  4KHB B;  2X18 A;  1ZC3 B;  1EAZ A;  1Q67 A;  2Y7B A;  2P0D A;  1FHX A;  3TFM A;  2VKI A;  4KHA A;  4H8S A;  1MK7 B;  2DN6 A;  1WI1 A;  2J0J A;  1E5W A;  1X05 A;  2JP2 A;  2V76 A;  2N23 A;  1WGU A;  2P8V A;  4DBB A;  3PVL A;  1V5M A;  4K2P A;  1PLS A;  4GXB A;  1X1G A;  2UZS A;  3DXE A;  4MT7 A;  1XX0 A;  4CHJ A;  3CIK A;  3SO6 A;  1LW3 A;  2G35 A;  2MWN B;  2L2I A;  3U8Z A;  2HE7 A;  4KAX B;  5C16 A;  1FHW A;  3OAN A;  5D27 A;  3NSU A;  1ISN A;  4EMO A;  4HAX B;  1P3R A;  3N7C A;  1KI1 B;  1UNP A;  1U5D A;  1U5E A;  1DDM A;  3DXC A;  3TVV A;  2DX5 A;  4TYZ A;  1EVH A;  4A6F A;  4Z2M B;  1U5G A;  3BIN A;  3CXB B;  5D3X A;  4HAW B;  1LB1 A;  2OQB A;  4XWX A;  5FI0 A;  2L1C A;  5KCV A;  1TJ6 A;  2OTX A;  3PVU A;  3TO1 A;  1I2H A;  1V88 A;  5HE0 A;  2J0K A;  2D10 A;  2DKP A;  1DDW A;  1XCG A;  4B6H A;  5C6R A;  2RGN B;  4K81 A;  2AL6 A;  1RRP B;  2RSG A;  5L81 A;  4ZRI A;  1ZC4 B;  2GCL A;  3AU5 A;  4ZRJ A;  1J0W A;  2EMT A;  2M38 A;  2YS1 A;  4WVF B;  3KSY A;  5HE3 A;  2H7E A;  5GOW B;  1BTN A;  2LUL A;  1AWE A;  4DX9 0;  2DX1 A;  1NU2 A;  2E2X A;  3F0W A;  2J0M A;  4HB0 B;  3VIA A;  2K2J A;  2YVC A;  1W1D A;  3MPX A;  1V5U A;  3QBV B;  2J59 M;  4HAY B;  3PG7 A;  5CLQ B;  4A6F B;  4GMX B;  1OMW A;  1UPR A;  5D3W A;  2Y8F A;  3FM8 C;  5JHH A;  1WGQ A;  3FSS A;  1XKE A;  4GMV A;  5KQ1 A;  3P6A A;  1U27 A;  1TQZ A;  4HDQ A;  3WA0 A;  1I7A A;  5J3Y A;  1NI2 A;  2W2W A;  1FGZ A;  5J3Q A;  3P7Z A;  2VRW B;  3D8F A;  4F7H A;  1UNR A;  1X11 A;  2COC A;  5JP4 A;  3FEH A;  1V5P A;  2CAY A;  3QIJ A;  1V61 A;  1GC7 A;  2I5F A;  1X86 A;  4A6K A;  1U29 A;  4CYE A;  2R09 A;  4GZU A;  3PVW A;  2I5C A;  2KUP A;  2ADZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...