1ZYIA

Solution structure of icln, a multifunctional protein involved in regulatory mechanisms as different as cell volume regulation and rna splicing
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
116
structure length
116
Chain Sequence
QQQPETEAVLNGKGLGTGTLYIAESRLSWLDGSGLGFSLEYPTISLHAVSRDLNAYPREHLYVMVNAKFGEESKESVAEEEDSDDDVEPIAEFRFVPSDKSALEAMFTAMCECQAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methylosome subunit pICln
publication title ICln159 folds into a pleckstrin homology domain-like structure. Interaction with kinases and the splicing factor LSm4
pubmed doi rcsb
source organism Canis lupus familiaris
molecule tags Translation
total genus 14
structure length 116
sequence length 116
ec nomenclature
pdb deposition date 2005-06-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.60 Mainly Beta Roll PH-domain like PH-domain like 1zyiA00
1ZYIA
chains in the Genus database with same CATH superfamily
2W2WA 1MAIA 3X23A 3SO6A 3V5WA 5EFXA 2W2XC 5LOPB 4XWXA 2YS5A 5DI9B 2YT1A 1XR0B 1KI1B 2L2IA 2RVBB 3NWFA 2Z0PA 2ROZB 1GC6A 4GMXB 3TO1A 1J0WA 4QJ5B 1M7RA 3QIJA 1WJMA 2COAA 1WVHA 4HB0B 2IYBA 1UNQA 2M14A 4B6HA 1PFJA 2YRYA 2P0HA 2LKOA 1Z87A 1ZVRA 2DYNA 2DN6A 2Z0OA 4OSNA 3QWMA 2HTHB 2D2QA 2D9XA 1DDWA 4KAXB 2KIEA 2Z4DA 1K5GB 3RCPA 4KVGB 1X11A 2P0DA 4H8SA 4DIXA 1Y5OA 2I1KA 1V5UA 1UNPA 2MFQA 2UZRA 2JP2A 3NWDA 3U12A 1FHWA 1TJ6A 1X05A 1XCGA 2Y7BA 4IOYX 5J3QA 3ODXA 2XQNM 2IFSA 1U2BA 5KQ1A 3AU5A 3PVWA 3ULBA 5DHAB 2J59M 2MKRA 1SGHA 4Z2NA 1W1HA 2H7DA 4MT7A 3D8DA 5JHGA 2J0MA 2DX5A 1W1DA 1V61A 3T06A 1ZC3B 1NTVA 1P6SA 2D9YA 1UPQA 4CHMA 2DFKA 1QQGA 5HE2A 5DH9B 4Y94A 3B77A 1MPHA 1V5PA 4L6EA 1KZ7A 1XD4A 3NSUA 2YS3A 2V76A 2DYQA 2BCJA 1TQZA 5D3YA 3SNHA 4DX8A 3DXCA 4GNKB 3A8PA 2QKLA 2MWNB 1LW3A 3D8FA 3QBVB 1BTNA 3KSYA 2KCJA 5M4YB 4HHVA 2NMBA 2J0JA 1QC6A 5DIFB 4BBKA 1GC7A 4EKUA 4QJ4B 3DXDA 2N0YA 5HE0A 2LOZA 2LYDA 5IRSA 2D11A 3BJIA 1FAOA 3U8ZA 5JP4A 4HAZB 3GYPA 1RJ2A 4WSFA 1ZSQA 3PVUA 1DYNA 1U5FA 3NWAA 3MDBC 4CYEA 1J19A 4PNKA 2CY4A 1MK9B 3PP2A 2FJUB 5C5BB 2CODA 3NW8A 4HB4B 4MK0A 1E5WA 2UVMA 4HDQA 3HSAA 1U27A 3PZDA 1X86A 2RLOA 4KHBA 4HB3B 4YL8A 2Q13A 2OQBA 1UPRA 4F7HA 3KRWA 3ZVRA 1FB8A 2YF0A 2W2XD 1AWEA 1BAKA 3GYOA 3KY9A 1EGXA 2I1JA 1H10A 1WGUA 2E2XA 1XODA 5FI1A 2ADZA 2COCA 1XX0A 1ISNA 1M7EA 3FEHA 1NI2A 2AEHA 2RNRB 1RRPB 1DBHA 3AU4A 2K49A 1GG3A 1WJ1A 1H4RA 2CRFA 1V5MA 3G9WA 4KHAA 1AQCA 1P3RA 2K2UA 2D9ZA 4NY0A 1U5DA 2EMTA 4Z2MB 2D10A 3WA0A 4ZRJA 1Q67A 4A6FA 2ELBA 4TKNA 1DDVA 3A8QA 1FOEA 5JHHA 5I2MA 1NTYA 3CXBB 5CLQB 2EJ8A 2YSZA 4A6KA 4ZRIA 2KR0A 4GN1A 2Y8GA 2YT0A 2DHJA 1SHCA 2Z14A 2H7EA 1UNRA 1V89A 1K5DB 4WVFB 2I5FA 1MKEA 4GOUA 3DXEA 1I2HA 3OHMB 3M1IB 2GCJA 4GPTB 4YONA 4GZUA 3TCAA 4QXAB 3UZTA 1B55A 4WJ7A 2D9VA 4CSQA 4C0AA 4IAPA 4HDOA 4HAXB 4F7GA 1DROA 2KGXB 2KUQA 1NU2A 3HK0A 3PSCA 4DX90 3MPXA 2GS0A 2ZKMX 4HATB 5LONB 2DHKA 2CAYA 1FGZA 2ROVA 3TFMA 4GXBA 1KZGA 4DXAB 1EAZA 1MIXA 2COFA 2K2JA 4HAVB 1BWNA 4A5KA 3PVLA 4IFSA 3VIAA 2RSGA 4PQ0A 2LG1A 2DTCA 5HE3A 1FHOA 3N7CA 3OANA 2PZ1A 1ZM0A 2K00A 5GOWB 5KCVA 5J3TA 4KHOA 2LULA 1OMWA 2R0DA 5C79A 3WYFB 5D3WA 3O96A 2DLWA 2KIGA 3F0WA 4QJ3B 1MI1A 1W1GA 2P0FA 2J0KA 2KUPA 1WGQA 1V88A 2D9WA 2VSZA 3U7DA 1OQNA 4HAUB 3AJ4A 4F7UP 4D6WA 2M38A 5C16A 2X18A 1U5GA 4HSIA 2G35A 2DX1A 4HAYB 4GMVA 4D0NB 3HQCA 1P5TA 2DA0A 1TXDA 2OTXA 2VKIA 2D4QA 1WI1A 2DKPA 3TVVA 1U5EA 2EMSA 2DKQA 4L1RA 5D3XA 4K81A 2R09A 4ZRKA 1XKEA 1ZYIA 4P7IA 5L81A 1U29A 1I7AA 5CLLB 4A6HA 1EF1A 4NSWA 3ULCA 4HB2B 1Y19B 2NZ8B 1LB1A 2I5CA 5JLJB 2FJLA 4KHBB 2GCLA 3PEGA 2NBVA 5KQ4A 4EJNA 2DHIA 2LOXA 4EMOA 2UZSA 2Z0QA 2GJYA 1OY2A 3PG7A 3KRXA 3IVFA 3TW1A 5D27A 4CHJA 2VRWB 4K2OA 4K2PA 3ODOA 2Y8FA 1IRSA 3P7ZA 3D8EA 5D3VA 2P8VA 1X1FA 2Z13A 2ELAA 2CY5A 1MK7B 2R2YA 3FM8C 3SUZA 3VOQA 2QKMA 2YVCA 2EC1A 3DCXA 1PLSA 2RGNB 1MIZB 2ZPYA 3F5RA 2GUMA 2Z59A 4TYZA 5HE1A 4A6FB 2N23A 3LJUX 1FGYA 2HE7A 5I2SA 5FI0A 3ML4A 5C5BA 1DDMA 3P6AA 3SYXA 1FHXA 3FVCA 3SV1A 1PMSA 1ZC4B 3FSSA 3BINA 3KZ1A 1T77A 3HIEA 2MDXA 5DHFB 4MY6A 1X1GA 5J3YA 2YS1A 5LG4B 1N3HA 3CIKA 1EVHA 1BTKA 2RUKB 1WG7A 2RRFA 4DBBA 3A58A 3ZDTA 3ODWA 2YT2A 2L1CA 5C6RA 3A98B 2AL6A 4OT1A 1UEFA 4K17A 3HW2B 4HAWB 2K8EA
chains in the Genus database with same CATH topology
4KHOA 2NBVA 5M4YB 2GUMA 2Z59A 4GOUA 3GYOA 3NWAA 4L1RA 4Z2MB 3OHMB 4OSNA 5LG4B 4D6WA 2KIEA 2GCJA 2Z4DA 3TW1A 2FJUB 5I2SA 1ZYIA 2KIGA 2RRFA 4QXAB 4HSIA 4Z2NA 3A58A 4IFSA 3NW8A 4QJ4B 3NWFA 4PQ0A 2YT2A 4QJ3B 5I2MA 4CSQA 3FVCA 5IRSA 4DIXA 3TO1A 2KUQA 4OT1A 2KR0A 2K49A 3FSSA 2Z13A 3NWDA 4QJ5B 3U12A 4GNKB 4KHBB 4KHBA 2ZKMX 4IOYX 3GYPA 2R2YA 2Z14A 3TVVA 2GCLA 3HIEA 2K8EA 4KHAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZYI A; 
#chains in the Genus database with same CATH topology
 2W2W A;  1MAI A;  3X23 A;  3SO6 A;  3V5W A;  5EFX A;  2W2X C;  5LOP B;  4XWX A;  2YS5 A;  5DI9 B;  2YT1 A;  1XR0 B;  1KI1 B;  2L2I A;  2RVB B;  3NWF A;  2Z0P A;  2ROZ B;  1GC6 A;  4GMX B;  3TO1 A;  1J0W A;  4QJ5 B;  1M7R A;  3QIJ A;  1WJM A;  2COA A;  1WVH A;  4HB0 B;  2IYB A;  1UNQ A;  2M14 A;  4B6H A;  1PFJ A;  2YRY A;  2P0H A;  2LKO A;  1Z87 A;  1ZVR A;  2DYN A;  2DN6 A;  2Z0O A;  4OSN A;  3QWM A;  2HTH B;  2D2Q A;  2D9X A;  1DDW A;  4KAX B;  2KIE A;  2Z4D A;  1K5G B;  3RCP A;  4KVG B;  1X11 A;  2P0D A;  4H8S A;  4DIX A;  1Y5O A;  2I1K A;  1V5U A;  1UNP A;  2MFQ A;  2UZR A;  2JP2 A;  3NWD A;  3U12 A;  1FHW A;  1TJ6 A;  1X05 A;  1XCG A;  2Y7B A;  4IOY X;  5J3Q A;  3ODX A;  2XQN M;  2IFS A;  1U2B A;  5KQ1 A;  3AU5 A;  3PVW A;  3ULB A;  5DHA B;  2J59 M;  2MKR A;  1SGH A;  4Z2N A;  1W1H A;  2H7D A;  4MT7 A;  3D8D A;  5JHG A;  2J0M A;  2DX5 A;  1W1D A;  1V61 A;  3T06 A;  1ZC3 B;  1NTV A;  1P6S A;  2D9Y A;  1UPQ A;  4CHM A;  2DFK A;  1QQG A;  5HE2 A;  5DH9 B;  4Y94 A;  3B77 A;  1MPH A;  1V5P A;  4L6E A;  1KZ7 A;  1XD4 A;  3NSU A;  2YS3 A;  2V76 A;  2DYQ A;  2BCJ A;  1TQZ A;  5D3Y A;  3SNH A;  4DX8 A;  3DXC A;  4GNK B;  3A8P A;  2QKL A;  2MWN B;  1LW3 A;  3D8F A;  3QBV B;  1BTN A;  3KSY A;  2KCJ A;  5M4Y B;  4HHV A;  2NMB A;  2J0J A;  1QC6 A;  5DIF B;  4BBK A;  1GC7 A;  4EKU A;  4QJ4 B;  3DXD A;  2N0Y A;  5HE0 A;  2LOZ A;  2LYD A;  5IRS A;  2D11 A;  3BJI A;  1FAO A;  3U8Z A;  5JP4 A;  4HAZ B;  3GYP A;  1RJ2 A;  4WSF A;  1ZSQ A;  3PVU A;  1DYN A;  1U5F A;  3NWA A;  3MDB C;  4CYE A;  1J19 A;  4PNK A;  2CY4 A;  1MK9 B;  3PP2 A;  2FJU B;  5C5B B;  2COD A;  3NW8 A;  4HB4 B;  4MK0 A;  1E5W A;  2UVM A;  4HDQ A;  3HSA A;  1U27 A;  3PZD A;  1X86 A;  2RLO A;  4KHB A;  4HB3 B;  4YL8 A;  2Q13 A;  2OQB A;  1UPR A;  4F7H A;  3KRW A;  3ZVR A;  1FB8 A;  2YF0 A;  2W2X D;  1AWE A;  1BAK A;  3GYO A;  3KY9 A;  1EGX A;  2I1J A;  1H10 A;  1WGU A;  2E2X A;  1XOD A;  5FI1 A;  2ADZ A;  2COC A;  1XX0 A;  1ISN A;  1M7E A;  3FEH A;  1NI2 A;  2AEH A;  2RNR B;  1RRP B;  1DBH A;  3AU4 A;  2K49 A;  1GG3 A;  1WJ1 A;  1H4R A;  2CRF A;  1V5M A;  3G9W A;  4KHA A;  1AQC A;  1P3R A;  2K2U A;  2D9Z A;  4NY0 A;  1U5D A;  2EMT A;  4Z2M B;  2D10 A;  3WA0 A;  4ZRJ A;  1Q67 A;  4A6F A;  2ELB A;  4TKN A;  1DDV A;  3A8Q A;  1FOE A;  5JHH A;  5I2M A;  1NTY A;  3CXB B;  5CLQ B;  2EJ8 A;  2YSZ A;  4A6K A;  4ZRI A;  2KR0 A;  4GN1 A;  2Y8G A;  2YT0 A;  2DHJ A;  1SHC A;  2Z14 A;  2H7E A;  1UNR A;  1V89 A;  1K5D B;  4WVF B;  2I5F A;  1MKE A;  4GOU A;  3DXE A;  1I2H A;  3OHM B;  3M1I B;  2GCJ A;  4GPT B;  4YON A;  4GZU A;  3TCA A;  4QXA B;  3UZT A;  1B55 A;  4WJ7 A;  2D9V A;  4CSQ A;  4C0A A;  4IAP A;  4HDO A;  4HAX B;  4F7G A;  1DRO A;  2KGX B;  2KUQ A;  1NU2 A;  3HK0 A;  3PSC A;  4DX9 0;  3MPX A;  2GS0 A;  2ZKM X;  4HAT B;  5LON B;  2DHK A;  2CAY A;  1FGZ A;  2ROV A;  3TFM A;  4GXB A;  1KZG A;  4DXA B;  1EAZ A;  1MIX A;  2COF A;  2K2J A;  4HAV B;  1BWN A;  4A5K A;  3PVL A;  4IFS A;  3VIA A;  2RSG A;  4PQ0 A;  2LG1 A;  2DTC A;  5HE3 A;  1FHO A;  3N7C A;  3OAN A;  2PZ1 A;  1ZM0 A;  2K00 A;  5GOW B;  5KCV A;  5J3T A;  4KHO A;  2LUL A;  1OMW A;  2R0D A;  5C79 A;  3WYF B;  5D3W A;  3O96 A;  2DLW A;  2KIG A;  3F0W A;  4QJ3 B;  1MI1 A;  1W1G A;  2P0F A;  2J0K A;  2KUP A;  1WGQ A;  1V88 A;  2D9W A;  2VSZ A;  3U7D A;  1OQN A;  4HAU B;  3AJ4 A;  4F7U P;  4D6W A;  2M38 A;  5C16 A;  2X18 A;  1U5G A;  4HSI A;  2G35 A;  2DX1 A;  4HAY B;  4GMV A;  4D0N B;  3HQC A;  1P5T A;  2DA0 A;  1TXD A;  2OTX A;  2VKI A;  2D4Q A;  1WI1 A;  2DKP A;  3TVV A;  1U5E A;  2EMS A;  2DKQ A;  4L1R A;  5D3X A;  4K81 A;  2R09 A;  4ZRK A;  1XKE A;  1ZYI A;  4P7I A;  5L81 A;  1U29 A;  1I7A A;  5CLL B;  4A6H A;  1EF1 A;  4NSW A;  3ULC A;  4HB2 B;  1Y19 B;  2NZ8 B;  1LB1 A;  2I5C A;  5JLJ B;  2FJL A;  4KHB B;  2GCL A;  3PEG A;  2NBV A;  5KQ4 A;  4EJN A;  2DHI A;  2LOX A;  4EMO A;  2UZS A;  2Z0Q A;  2GJY A;  1OY2 A;  3PG7 A;  3KRX A;  3IVF A;  3TW1 A;  5D27 A;  4CHJ A;  2VRW B;  4K2O A;  4K2P A;  3ODO A;  2Y8F A;  1IRS A;  3P7Z A;  3D8E A;  5D3V A;  2P8V A;  1X1F A;  2Z13 A;  2ELA A;  2CY5 A;  1MK7 B;  2R2Y A;  3FM8 C;  3SUZ A;  3VOQ A;  2QKM A;  2YVC A;  2EC1 A;  3DCX A;  1PLS A;  2RGN B;  1MIZ B;  2ZPY A;  3F5R A;  2GUM A;  2Z59 A;  4TYZ A;  5HE1 A;  4A6F B;  2N23 A;  3LJU X;  1FGY A;  2HE7 A;  5I2S A;  5FI0 A;  3ML4 A;  5C5B A;  1DDM A;  3P6A A;  3SYX A;  1FHX A;  3FVC A;  3SV1 A;  1PMS A;  1ZC4 B;  3FSS A;  3BIN A;  3KZ1 A;  1T77 A;  3HIE A;  2MDX A;  5DHF B;  4MY6 A;  1X1G A;  5J3Y A;  2YS1 A;  5LG4 B;  1N3H A;  3CIK A;  1EVH A;  1BTK A;  2RUK B;  1WG7 A;  2RRF A;  4DBB A;  3A58 A;  3ZDT A;  3ODW A;  2YT2 A;  2L1C A;  5C6R A;  3A98 B;  2AL6 A;  4OT1 A;  1UEF A;  4K17 A;  3HW2 B;  4HAW B;  2K8E A; 
#chains in the Genus database with same CATH homology
 4KHO A;  2NBV A;  5M4Y B;  2GUM A;  2Z59 A;  4GOU A;  3GYO A;  3NWA A;  4L1R A;  4Z2M B;  3OHM B;  4OSN A;  5LG4 B;  4D6W A;  2KIE A;  2GCJ A;  2Z4D A;  3TW1 A;  2FJU B;  5I2S A;  1ZYI A;  2KIG A;  2RRF A;  4QXA B;  4HSI A;  4Z2N A;  3A58 A;  4IFS A;  3NW8 A;  4QJ4 B;  3NWF A;  4PQ0 A;  2YT2 A;  4QJ3 B;  5I2M A;  4CSQ A;  3FVC A;  5IRS A;  4DIX A;  3TO1 A;  2KUQ A;  4OT1 A;  2KR0 A;  2K49 A;  3FSS A;  2Z13 A;  3NWD A;  4QJ5 B;  3U12 A;  4GNK B;  4KHB B;  4KHB A;  2ZKM X;  4IOY X;  3GYP A;  2R2Y A;  2Z14 A;  3TVV A;  2GCL A;  3HIE A;  2K8E A;  4KHA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...