2V76A

Crystal structure of the human dok1 ptb domain
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
103
structure length
99
Chain Sequence
PLGSQFWVTVQRTEAAERCGLHGSYVLRVEAERLTLLTVGILEPLLSWPYTLLRRYGRDKVMFSFEAGRRCPSGPGTFTFQTAQGNDIFQAVETAIHRQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DOCKING PROTEIN 1
publication title An Integrin Phosphorylation Switch: The Effect of {Beta}3 Integrin Tail Phosphorylation on Dok1 and Talin Binding.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 25
structure length 99
sequence length 103
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2007-07-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2v76A00
5J3TA 2YVCA 1E5WA 2R09A 1V5UA 2LOZA 3GYPA 1QC6A 3HW2B 2DHIA 4HB3B 3NSUA 1ZVRA 4HB4B 4DX8A 2MKRA 2DKPA 2NZ8B 1RRPB 3ULCA 2DLWA 1V89A 3GYOA 1BTKA 2GCLA 3TW1A 3F5RA 4WSFA 3U8ZA 2H7EA 2VRWB 2W2XC 1MPHA 2K2UA 3AU4A 3FEHA 2KCJA 4F7UP 1UNPA 3CXBB 5C6RA 2EMSA 1DDVA 5HE1A 5D3YA 1XR0B 2ELAA 2GS0A 2D9YA 1IRSA 4XWXA 1WGUA 2MWNB 4B6HA 5LONB 2EMTA 4IFSA 4GMXB 5J3YA 1U29A 4EKUA 5JHHA 1XODA 2LKOA 1BAKA 3VIAA 3D8EA 2PZ1A 2MDXA 3TO1A 1V88A 1Y5OA 4HDOA 3WYFB 2OTXA 2GCJA 2COFA 1BWNA 4K81A 2M14A 5KCVA 2W2XD 2YRYA 3FSSA 1WVHA 2LOXA 3PVWA 3SUZA 1W1HA 2I1JA 2BCJA 3D8FA 4A6FB 2CY4A 4HAZB 2I5CA 3TVVA 4HB2B 4GN1A 1NTYA 4HAVB 2IFSA 3ML4A 1DDWA 3A98B 1MKEA 1MK7B 5J3QA 5KQ1A 2YF0A 3TFMA 5C5BA 1ZC3B 3KRWA 1ZC4B 4EJNA 2D9XA 3MDBC 1GC6A 2RVBB 1UPRA 2P0FA 4F7GA 4KAXB 5JLJB 5L81A 5DHAB 4DX90 1FHXA 4YL8A 1OQNA 2VSZA 3BINA 3P6AA 2EJ8A 2EC1A 1M7RA 1OY2A 1WI1A 2R0DA 4GXBA 5DH9B 5HE2A 4K2OA 1J0WA 2W2WA 1EF1A 3SYXA 1J19A 2CODA 2I5FA 4K2PA 4GMVA 1XKEA 5JHGA 3PP2A 2YS3A 5GOWB 4KHBB 1FGZA 3G9WA 1H4RA 3DXCA 1U5FA 1SHCA 5DIFB 1XX0A 5C79A 4MK0A 2CRFA 1TQZA 5C16A 2DN6A 4Z2NA 1EGXA 3ODOA 5D27A 1U5DA 1X86A 1MIZB 3LJUX 4MT7A 2RNRB 1P5TA 1DBHA 1LW3A 4WJ7A 1PMSA 2L1CA 3PEGA 1PLSA 1RJ2A 2CAYA 1I2HA 2COAA 4H8SA 1GG3A 1SGHA 3SNHA 1NU2A 2J0MA 1BTNA 3SO6A 2Z0QA 4CHJA 1I7AA 2ROZB 4HATB 3T06A 2Y8GA 2D4QA 1FB8A 2QKLA 4IAPA 2MFQA 4WVFB 1FHOA 1GC7A 3KZ1A 3QWMA 5C5BB 1ZSQA 4KHAA 4PQ0A 4HAXB 4EMOA 4K17A 2ADZA 3FM8C 3PSCA 2COCA 2D11A 2DYQA 3HQCA 4KVGB 1DROA 4PNKA 2GJYA 2DA0A 1DYNA 1ISNA 3TCAA 2ROVA 4KHOA 2V76A 2DTCA 2IYBA 1X1FA 1UPQA 1WG7A 2D9WA 1UNQA 1X11A 2DX5A 2DHJA 2UZSA 1Q67A 2YT1A 4BBKA 1MIXA 2L2IA 4ZRIA 2DX1A 4P7IA 3PVLA 4TYZA 3WA0A 4A6KA 3ZVRA 4HAWB 2LULA 4NY0A 5JP4A 3ODXA 4CYEA 4HHVA 1TJ6A 2RLOA 4TKNA 5LOPB 3D8DA 3A8PA 2Z0OA 3F0WA 2G35A 3PG7A 5D3VA 1FAOA 3KRXA 3M1IB 1QQGA 2DFKA 2NMBA 3MPXA 1UNRA 1H10A 2RUKB 4HDQA 5FI0A 2DKQA 1V5PA 2RSGA 2RGNB 1AQCA 2KGXB 3ODWA 2ZPYA 2ELBA 1KZGA 3QBVB 3ULBA 1B55A 3V5WA 3UZTA 3VOQA 1V5MA 1WGQA 3QIJA 2J0JA 2Y7BA 5D3XA 3IVFA 2VKIA 2OQBA 2P0DA 1WJ1A 2QKMA 1KZ7A 3PZDA 1EVHA 4A5KA 3AU5A 1P3RA 2K2JA 4YONA 2Y8FA 1X05A 1ZM0A 5KQ4A 4CHMA 3A8QA 2E2XA 2H7DA 4ZRKA 1M7EA 4IOYX 1FHWA 3O96A 1V61A 2YT0A 3AJ4A 1NI2A 5CLLB 2P8VA 2D9VA 1TXDA 3DXDA 1U5GA 3OANA 2M38A 3HK0A 4ZRJA 2AL6A 5DHFB 2D9ZA 4A6HA 2K00A 4C0AA 2FJLA 1WJMA 1KI1B 2UZRA 1X1GA 1FOEA 5CLQB 1W1GA 1FGYA 5FI1A 4MY6A 2YS1A 3CIKA 3KY9A 3X23A 4HB0B 1OMWA 2KUPA 2JP2A 1MAIA 1UEFA 2D10A 3N7CA 4Y94A 2Q13A 1Y19B 1P6SA 3P7ZA 2DHKA 1N3HA 1U5EA 4L6EA 4Z2MB 2YS5A 3BJIA 3U7DA 2XQNM 1XCGA 2I1KA 4GZUA 3DXEA 2HE7A 1K5DB 4F7HA 1K5GB 1EAZA 5HE0A 1DDMA 2AEHA 2X18A 1NTVA 2YSZA 2P0HA 1Z87A 1W1DA 2CY5A 4DBBA 2LG1A 2N0YA 1AWEA 2N23A 5D3WA 4HAYB 1U2BA 3PVUA 2Z0PA 5EFXA 1XD4A 2DYNA 5DI9B 4DXAB 4GPTB 3SV1A 4A6FA 1U27A 4NSWA 1LB1A 3ZDTA 2J0KA 2UVMA 5HE3A 4D0NB 2HTHB 3RCPA 2LYDA 4HAUB 1MK9B 3KSYA 2J59M 1PFJA 2D2QA
chains in the Genus database with same CATH superfamily
5J3TA 2YVCA 1E5WA 2R09A 1V5UA 2LOZA 3GYPA 1QC6A 3HW2B 2DHIA 4HB3B 3NSUA 3NW8A 1ZVRA 4HB4B 3NWDA 4DX8A 2Z13A 2MKRA 2DKPA 5IRSA 2K49A 2NZ8B 1RRPB 3DCXA 4OT1A 3ULCA 2DLWA 1V89A 3GYOA 1BTKA 2GCLA 3TW1A 3FVCA 3F5RA 4WSFA 3U8ZA 2H7EA 2VRWB 2W2XC 2Z14A 1MPHA 2K2UA 4L1RA 3AU4A 3FEHA 2KCJA 4F7UP 4KHBA 1UNPA 3CXBB 5C6RA 2EMSA 1DDVA 5HE1A 5D3YA 1XR0B 2ELAA 2GS0A 2D9YA 1IRSA 4XWXA 1WGUA 2MWNB 4B6HA 5LONB 2EMTA 4IFSA 4GMXB 5J3YA 3A58A 1U29A 4GOUA 4EKUA 5JHHA 1XODA 2LKOA 1BAKA 3VIAA 3D8EA 2PZ1A 2MDXA 3TO1A 1V88A 1Y5OA 4HDOA 3WYFB 2OTXA 2GCJA 2COFA 1BWNA 4K81A 2M14A 5KCVA 2W2XD 2YRYA 3FSSA 1WVHA 2LOXA 3PVWA 3SUZA 1W1HA 2I1JA 2BCJA 4DIXA 3D8FA 4A6FB 4GNKB 2CY4A 4HAZB 4QJ5B 2I5CA 3TVVA 4HB2B 4GN1A 1NTYA 4HAVB 2IFSA 3ML4A 1DDWA 2NBVA 3A98B 1MKEA 1MK7B 5J3QA 5KQ1A 2Z59A 2YF0A 3TFMA 2GUMA 1MI1A 5C5BA 1ZC3B 3KRWA 1ZC4B 4EJNA 2D9XA 3MDBC 1GC6A 2RVBB 1UPRA 2P0FA 4F7GA 4KAXB 5JLJB 5L81A 5DHAB 4DX90 1FHXA 4YL8A 1OQNA 2VSZA 3BINA 3P6AA 2EJ8A 2EC1A 1M7RA 4D6WA 1OY2A 1WI1A 2R0DA 4GXBA 5DH9B 5HE2A 4K2OA 1J0WA 2W2WA 5D3VA 1EF1A 3SYXA 1J19A 2CODA 2I5FA 4K2PA 4GMVA 1XKEA 5JHGA 3PP2A 2YS3A 5GOWB 4KHBB 1FGZA 3G9WA 3HIEA 1H4RA 3DXCA 1U5FA 1SHCA 5DIFB 1XX0A 5C79A 4MK0A 2CRFA 1TQZA 5C16A 2DN6A 4Z2NA 1EGXA 3ODOA 5D27A 3U12A 1U5DA 1X86A 1MIZB 3LJUX 4MT7A 2RNRB 1P5TA 1DBHA 1LW3A 4WJ7A 1PMSA 2L1CA 3PEGA 1PLSA 1RJ2A 2CAYA 1I2HA 2COAA 4H8SA 2KIGA 1GG3A 1SGHA 3SNHA 1NU2A 2J0MA 1BTNA 3SO6A 2Z0QA 4CHJA 1I7AA 2ROZB 4HATB 3T06A 2K8EA 2Y8GA 2D4QA 1FB8A 2QKLA 4IAPA 2MFQA 2ZKMX 4WVFB 1FHOA 1GC7A 3KZ1A 3QWMA 5C5BB 1ZSQA 4KHAA 4PQ0A 4HAXB 4EMOA 4K17A 2ADZA 3FM8C 3PSCA 2COCA 2D11A 2DYQA 2RRFA 3HQCA 4KVGB 1DROA 4PNKA 2GJYA 5LG4B 2DA0A 1DYNA 1ISNA 3TCAA 2ROVA 4KHOA 5I2MA 2V76A 2DTCA 2IYBA 1X1FA 1UPQA 1WG7A 2D9WA 1UNQA 1X11A 2DX5A 2DHJA 2UZSA 1Q67A 2YT1A 4BBKA 1MIXA 2L2IA 4ZRIA 2DX1A 4P7IA 3PVLA 4TYZA 3WA0A 4A6KA 3ZVRA 4HAWB 2LULA 4NY0A 5JP4A 3ODXA 4CYEA 4HHVA 1TJ6A 2RLOA 4TKNA 5LOPB 3B77A 3A8PA 1T77A 3F0WA 2G35A 2Z0OA 3D8DA 3PG7A 4QJ3B 1FAOA 3KRXA 3M1IB 1QQGA 2DFKA 2NMBA 3MPXA 1UNRA 1H10A 2RUKB 4HDQA 5FI0A 2DKQA 1V5PA 2RSGA 3NWAA 2RGNB 1AQCA 2KGXB 2ZPYA 3ODWA 2ELBA 1KZGA 3QBVB 3ULBA 1B55A 3V5WA 3UZTA 3VOQA 1V5MA 2FJUB 1WGQA 3QIJA 2J0JA 2Y7BA 5D3XA 3IVFA 2R2YA 2VKIA 2OQBA 2P0DA 1WJ1A 2QKMA 1KZ7A 3PZDA 1EVHA 4A5KA 3AU5A 1P3RA 2K2JA 2KIEA 4YONA 2KR0A 2Y8FA 1X05A 1ZM0A 5KQ4A 4CHMA 3A8QA 2E2XA 2H7DA 4ZRKA 1M7EA 4IOYX 1FHWA 3O96A 1V61A 2YT0A 3AJ4A 1NI2A 5CLLB 2P8VA 5I2SA 2D9VA 1TXDA 3DXDA 1U5GA 5M4YB 3OANA 2M38A 3HK0A 4ZRJA 2AL6A 5DHFB 3OHMB 2D9ZA 4A6HA 2K00A 4C0AA 2FJLA 1WJMA 1KI1B 2UZRA 1X1GA 1FOEA 5CLQB 1W1GA 1FGYA 5FI1A 4MY6A 2YS1A 3CIKA 3KY9A 3X23A 4HB0B 1OMWA 2KUPA 4QXAB 2JP2A 1MAIA 1UEFA 2D10A 3N7CA 4Y94A 2Q13A 1Y19B 1P6SA 3P7ZA 2DHKA 1N3HA 1U5EA 3NWFA 4L6EA 4Z2MB 2YS5A 3BJIA 3U7DA 2XQNM 1XCGA 4OSNA 3HSAA 2I1KA 4GZUA 3DXEA 2HE7A 1K5DB 4F7HA 1K5GB 1EAZA 5HE0A 1DDMA 2Z4DA 2AEHA 2X18A 4CSQA 1NTVA 2YSZA 2P0HA 1Z87A 1W1DA 2CY5A 4DBBA 2LG1A 2KUQA 2N0YA 1AWEA 2N23A 5D3WA 4HAYB 1U2BA 3PVUA 2Z0PA 5EFXA 1ZYIA 1XD4A 2DYNA 5DI9B 4DXAB 2YT2A 4GPTB 4QJ4B 3SV1A 4A6FA 4HSIA 1U27A 4NSWA 1LB1A 3ZDTA 2J0KA 2UVMA 5HE3A 4D0NB 2HTHB 3RCPA 2LYDA 4HAUB 1MK9B 3KSYA 2J59M 1PFJA 2D2QA
chains in the Genus database with same CATH topology
5J3TA 2YVCA 1E5WA 2R09A 1V5UA 2LOZA 3GYPA 1QC6A 3HW2B 2DHIA 4HB3B 3NSUA 1ZVRA 4HB4B 4DX8A 2MKRA 2DKPA 2NZ8B 1RRPB 3ULCA 2DLWA 1V89A 3GYOA 1BTKA 2GCLA 3TW1A 3F5RA 4WSFA 3U8ZA 2H7EA 2VRWB 2W2XC 1MPHA 2K2UA 3AU4A 3FEHA 2KCJA 4F7UP 1UNPA 3CXBB 5C6RA 2EMSA 1DDVA 5HE1A 5D3YA 1XR0B 2ELAA 2GS0A 2D9YA 1IRSA 4XWXA 1WGUA 2MWNB 4B6HA 5LONB 2EMTA 4IFSA 4GMXB 5J3YA 1U29A 4EKUA 5JHHA 1XODA 2LKOA 1BAKA 3VIAA 3D8EA 2PZ1A 2MDXA 3TO1A 1V88A 1Y5OA 4HDOA 3WYFB 2OTXA 2GCJA 2COFA 1BWNA 4K81A 2M14A 5KCVA 2W2XD 2YRYA 3FSSA 1WVHA 2LOXA 3PVWA 3SUZA 1W1HA 2I1JA 2BCJA 3D8FA 4A6FB 2CY4A 4HAZB 2I5CA 3TVVA 4HB2B 4GN1A 1NTYA 4HAVB 2IFSA 3ML4A 1DDWA 3A98B 1MKEA 1MK7B 5J3QA 5KQ1A 2YF0A 3TFMA 5C5BA 1ZC3B 3KRWA 1ZC4B 4EJNA 2D9XA 3MDBC 1GC6A 2RVBB 1UPRA 2P0FA 4F7GA 4KAXB 5JLJB 5L81A 5DHAB 4DX90 1FHXA 4YL8A 1OQNA 2VSZA 3BINA 3P6AA 2EJ8A 2EC1A 1M7RA 1OY2A 1WI1A 2R0DA 4GXBA 5DH9B 5HE2A 4K2OA 1J0WA 2W2WA 1EF1A 3SYXA 1J19A 2CODA 2I5FA 4K2PA 4GMVA 1XKEA 5JHGA 3PP2A 2YS3A 5GOWB 4KHBB 1FGZA 3G9WA 1H4RA 3DXCA 1U5FA 1SHCA 5DIFB 1XX0A 5C79A 4MK0A 2CRFA 1TQZA 5C16A 2DN6A 4Z2NA 1EGXA 3ODOA 5D27A 1U5DA 1X86A 1MIZB 3LJUX 4MT7A 2RNRB 1P5TA 1DBHA 1LW3A 4WJ7A 1PMSA 2L1CA 3PEGA 1PLSA 1RJ2A 2CAYA 1I2HA 2COAA 4H8SA 1GG3A 1SGHA 3SNHA 1NU2A 2J0MA 1BTNA 3SO6A 2Z0QA 4CHJA 1I7AA 2ROZB 4HATB 3T06A 2Y8GA 2D4QA 1FB8A 2QKLA 4IAPA 2MFQA 4WVFB 1FHOA 1GC7A 3KZ1A 3QWMA 5C5BB 1ZSQA 4KHAA 4PQ0A 4HAXB 4EMOA 4K17A 2ADZA 3FM8C 3PSCA 2COCA 2D11A 2DYQA 3HQCA 4KVGB 1DROA 4PNKA 2GJYA 2DA0A 1DYNA 1ISNA 3TCAA 2ROVA 4KHOA 2V76A 2DTCA 2IYBA 1X1FA 1UPQA 1WG7A 2D9WA 1UNQA 1X11A 2DX5A 2DHJA 2UZSA 1Q67A 2YT1A 4BBKA 1MIXA 2L2IA 4ZRIA 2DX1A 4P7IA 3PVLA 4TYZA 3WA0A 4A6KA 3ZVRA 4HAWB 2LULA 4NY0A 5JP4A 3ODXA 4CYEA 4HHVA 1TJ6A 2RLOA 4TKNA 5LOPB 3D8DA 3A8PA 2Z0OA 3F0WA 2G35A 3PG7A 5D3VA 1FAOA 3KRXA 3M1IB 1QQGA 2DFKA 2NMBA 3MPXA 1UNRA 1H10A 2RUKB 4HDQA 5FI0A 2DKQA 1V5PA 2RSGA 2RGNB 1AQCA 2KGXB 3ODWA 2ZPYA 2ELBA 1KZGA 3QBVB 3ULBA 1B55A 3V5WA 3UZTA 3VOQA 1V5MA 1WGQA 3QIJA 2J0JA 2Y7BA 5D3XA 3IVFA 2VKIA 2OQBA 2P0DA 1WJ1A 2QKMA 1KZ7A 3PZDA 1EVHA 4A5KA 3AU5A 1P3RA 2K2JA 4YONA 2Y8FA 1X05A 1ZM0A 5KQ4A 4CHMA 3A8QA 2E2XA 2H7DA 4ZRKA 1M7EA 4IOYX 1FHWA 3O96A 1V61A 2YT0A 3AJ4A 1NI2A 5CLLB 2P8VA 2D9VA 1TXDA 3DXDA 1U5GA 3OANA 2M38A 3HK0A 4ZRJA 2AL6A 5DHFB 2D9ZA 4A6HA 2K00A 4C0AA 2FJLA 1WJMA 1KI1B 2UZRA 1X1GA 1FOEA 5CLQB 1W1GA 1FGYA 5FI1A 4MY6A 2YS1A 3CIKA 3KY9A 3X23A 4HB0B 1OMWA 2KUPA 2JP2A 1MAIA 1UEFA 2D10A 3N7CA 4Y94A 2Q13A 1Y19B 1P6SA 3P7ZA 2DHKA 1N3HA 1U5EA 4L6EA 4Z2MB 2YS5A 3BJIA 3U7DA 2XQNM 1XCGA 2I1KA 4GZUA 3DXEA 2HE7A 1K5DB 4F7HA 1K5GB 1EAZA 5HE0A 1DDMA 2AEHA 2X18A 1NTVA 2YSZA 2P0HA 1Z87A 1W1DA 2CY5A 4DBBA 2LG1A 2N0YA 1AWEA 2N23A 5D3WA 4HAYB 1U2BA 3PVUA 2Z0PA 5EFXA 1XD4A 2DYNA 5DI9B 4DXAB 4GPTB 3SV1A 4A6FA 1U27A 4NSWA 1LB1A 3ZDTA 2J0KA 2UVMA 5HE3A 4D0NB 2HTHB 3RCPA 2LYDA 4HAUB 1MK9B 3KSYA 2J59M 1PFJA 2D2QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5J3T A;  2YVC A;  1E5W A;  2R09 A;  1V5U A;  2LOZ A;  3GYP A;  1QC6 A;  3HW2 B;  2DHI A;  4HB3 B;  3NSU A;  1ZVR A;  4HB4 B;  4DX8 A;  2MKR A;  2DKP A;  2NZ8 B;  1RRP B;  3ULC A;  2DLW A;  1V89 A;  3GYO A;  1BTK A;  2GCL A;  3TW1 A;  3F5R A;  4WSF A;  3U8Z A;  2H7E A;  2VRW B;  2W2X C;  1MPH A;  2K2U A;  3AU4 A;  3FEH A;  2KCJ A;  4F7U P;  1UNP A;  3CXB B;  5C6R A;  2EMS A;  1DDV A;  5HE1 A;  5D3Y A;  1XR0 B;  2ELA A;  2GS0 A;  2D9Y A;  1IRS A;  4XWX A;  1WGU A;  2MWN B;  4B6H A;  5LON B;  2EMT A;  4IFS A;  4GMX B;  5J3Y A;  1U29 A;  4EKU A;  5JHH A;  1XOD A;  2LKO A;  1BAK A;  3VIA A;  3D8E A;  2PZ1 A;  2MDX A;  3TO1 A;  1V88 A;  1Y5O A;  4HDO A;  3WYF B;  2OTX A;  2GCJ A;  2COF A;  1BWN A;  4K81 A;  2M14 A;  5KCV A;  2W2X D;  2YRY A;  3FSS A;  1WVH A;  2LOX A;  3PVW A;  3SUZ A;  1W1H A;  2I1J A;  2BCJ A;  3D8F A;  4A6F B;  2CY4 A;  4HAZ B;  2I5C A;  3TVV A;  4HB2 B;  4GN1 A;  1NTY A;  4HAV B;  2IFS A;  3ML4 A;  1DDW A;  3A98 B;  1MKE A;  1MK7 B;  5J3Q A;  5KQ1 A;  2YF0 A;  3TFM A;  5C5B A;  1ZC3 B;  3KRW A;  1ZC4 B;  4EJN A;  2D9X A;  3MDB C;  1GC6 A;  2RVB B;  1UPR A;  2P0F A;  4F7G A;  4KAX B;  5JLJ B;  5L81 A;  5DHA B;  4DX9 0;  1FHX A;  4YL8 A;  1OQN A;  2VSZ A;  3BIN A;  3P6A A;  2EJ8 A;  2EC1 A;  1M7R A;  1OY2 A;  1WI1 A;  2R0D A;  4GXB A;  5DH9 B;  5HE2 A;  4K2O A;  1J0W A;  2W2W A;  1EF1 A;  3SYX A;  1J19 A;  2COD A;  2I5F A;  4K2P A;  4GMV A;  1XKE A;  5JHG A;  3PP2 A;  2YS3 A;  5GOW B;  4KHB B;  1FGZ A;  3G9W A;  1H4R A;  3DXC A;  1U5F A;  1SHC A;  5DIF B;  1XX0 A;  5C79 A;  4MK0 A;  2CRF A;  1TQZ A;  5C16 A;  2DN6 A;  4Z2N A;  1EGX A;  3ODO A;  5D27 A;  1U5D A;  1X86 A;  1MIZ B;  3LJU X;  4MT7 A;  2RNR B;  1P5T A;  1DBH A;  1LW3 A;  4WJ7 A;  1PMS A;  2L1C A;  3PEG A;  1PLS A;  1RJ2 A;  2CAY A;  1I2H A;  2COA A;  4H8S A;  1GG3 A;  1SGH A;  3SNH A;  1NU2 A;  2J0M A;  1BTN A;  3SO6 A;  2Z0Q A;  4CHJ A;  1I7A A;  2ROZ B;  4HAT B;  3T06 A;  2Y8G A;  2D4Q A;  1FB8 A;  2QKL A;  4IAP A;  2MFQ A;  4WVF B;  1FHO A;  1GC7 A;  3KZ1 A;  3QWM A;  5C5B B;  1ZSQ A;  4KHA A;  4PQ0 A;  4HAX B;  4EMO A;  4K17 A;  2ADZ A;  3FM8 C;  3PSC A;  2COC A;  2D11 A;  2DYQ A;  3HQC A;  4KVG B;  1DRO A;  4PNK A;  2GJY A;  2DA0 A;  1DYN A;  1ISN A;  3TCA A;  2ROV A;  4KHO A;  2V76 A;  2DTC A;  2IYB A;  1X1F A;  1UPQ A;  1WG7 A;  2D9W A;  1UNQ A;  1X11 A;  2DX5 A;  2DHJ A;  2UZS A;  1Q67 A;  2YT1 A;  4BBK A;  1MIX A;  2L2I A;  4ZRI A;  2DX1 A;  4P7I A;  3PVL A;  4TYZ A;  3WA0 A;  4A6K A;  3ZVR A;  4HAW B;  2LUL A;  4NY0 A;  5JP4 A;  3ODX A;  4CYE A;  4HHV A;  1TJ6 A;  2RLO A;  4TKN A;  5LOP B;  3D8D A;  3A8P A;  2Z0O A;  3F0W A;  2G35 A;  3PG7 A;  5D3V A;  1FAO A;  3KRX A;  3M1I B;  1QQG A;  2DFK A;  2NMB A;  3MPX A;  1UNR A;  1H10 A;  2RUK B;  4HDQ A;  5FI0 A;  2DKQ A;  1V5P A;  2RSG A;  2RGN B;  1AQC A;  2KGX B;  3ODW A;  2ZPY A;  2ELB A;  1KZG A;  3QBV B;  3ULB A;  1B55 A;  3V5W A;  3UZT A;  3VOQ A;  1V5M A;  1WGQ A;  3QIJ A;  2J0J A;  2Y7B A;  5D3X A;  3IVF A;  2VKI A;  2OQB A;  2P0D A;  1WJ1 A;  2QKM A;  1KZ7 A;  3PZD A;  1EVH A;  4A5K A;  3AU5 A;  1P3R A;  2K2J A;  4YON A;  2Y8F A;  1X05 A;  1ZM0 A;  5KQ4 A;  4CHM A;  3A8Q A;  2E2X A;  2H7D A;  4ZRK A;  1M7E A;  4IOY X;  1FHW A;  3O96 A;  1V61 A;  2YT0 A;  3AJ4 A;  1NI2 A;  5CLL B;  2P8V A;  2D9V A;  1TXD A;  3DXD A;  1U5G A;  3OAN A;  2M38 A;  3HK0 A;  4ZRJ A;  2AL6 A;  5DHF B;  2D9Z A;  4A6H A;  2K00 A;  4C0A A;  2FJL A;  1WJM A;  1KI1 B;  2UZR A;  1X1G A;  1FOE A;  5CLQ B;  1W1G A;  1FGY A;  5FI1 A;  4MY6 A;  2YS1 A;  3CIK A;  3KY9 A;  3X23 A;  4HB0 B;  1OMW A;  2KUP A;  2JP2 A;  1MAI A;  1UEF A;  2D10 A;  3N7C A;  4Y94 A;  2Q13 A;  1Y19 B;  1P6S A;  3P7Z A;  2DHK A;  1N3H A;  1U5E A;  4L6E A;  4Z2M B;  2YS5 A;  3BJI A;  3U7D A;  2XQN M;  1XCG A;  2I1K A;  4GZU A;  3DXE A;  2HE7 A;  1K5D B;  4F7H A;  1K5G B;  1EAZ A;  5HE0 A;  1DDM A;  2AEH A;  2X18 A;  1NTV A;  2YSZ A;  2P0H A;  1Z87 A;  1W1D A;  2CY5 A;  4DBB A;  2LG1 A;  2N0Y A;  1AWE A;  2N23 A;  5D3W A;  4HAY B;  1U2B A;  3PVU A;  2Z0P A;  5EFX A;  1XD4 A;  2DYN A;  5DI9 B;  4DXA B;  4GPT B;  3SV1 A;  4A6F A;  1U27 A;  4NSW A;  1LB1 A;  3ZDT A;  2J0K A;  2UVM A;  5HE3 A;  4D0N B;  2HTH B;  3RCP A;  2LYD A;  4HAU B;  1MK9 B;  3KSY A;  2J59 M;  1PFJ A;  2D2Q A; 
#chains in the Genus database with same CATH topology
 5J3T A;  2YVC A;  1E5W A;  2R09 A;  1V5U A;  2LOZ A;  3GYP A;  1QC6 A;  3HW2 B;  2DHI A;  4HB3 B;  3NSU A;  3NW8 A;  1ZVR A;  4HB4 B;  3NWD A;  4DX8 A;  2Z13 A;  2MKR A;  2DKP A;  5IRS A;  2K49 A;  2NZ8 B;  1RRP B;  3DCX A;  4OT1 A;  3ULC A;  2DLW A;  1V89 A;  3GYO A;  1BTK A;  2GCL A;  3TW1 A;  3FVC A;  3F5R A;  4WSF A;  3U8Z A;  2H7E A;  2VRW B;  2W2X C;  2Z14 A;  1MPH A;  2K2U A;  4L1R A;  3AU4 A;  3FEH A;  2KCJ A;  4F7U P;  4KHB A;  1UNP A;  3CXB B;  5C6R A;  2EMS A;  1DDV A;  5HE1 A;  5D3Y A;  1XR0 B;  2ELA A;  2GS0 A;  2D9Y A;  1IRS A;  4XWX A;  1WGU A;  2MWN B;  4B6H A;  5LON B;  2EMT A;  4IFS A;  4GMX B;  5J3Y A;  3A58 A;  1U29 A;  4GOU A;  4EKU A;  5JHH A;  1XOD A;  2LKO A;  1BAK A;  3VIA A;  3D8E A;  2PZ1 A;  2MDX A;  3TO1 A;  1V88 A;  1Y5O A;  4HDO A;  3WYF B;  2OTX A;  2GCJ A;  2COF A;  1BWN A;  4K81 A;  2M14 A;  5KCV A;  2W2X D;  2YRY A;  3FSS A;  1WVH A;  2LOX A;  3PVW A;  3SUZ A;  1W1H A;  2I1J A;  2BCJ A;  4DIX A;  3D8F A;  4A6F B;  4GNK B;  2CY4 A;  4HAZ B;  4QJ5 B;  2I5C A;  3TVV A;  4HB2 B;  4GN1 A;  1NTY A;  4HAV B;  2IFS A;  3ML4 A;  1DDW A;  2NBV A;  3A98 B;  1MKE A;  1MK7 B;  5J3Q A;  5KQ1 A;  2Z59 A;  2YF0 A;  3TFM A;  2GUM A;  1MI1 A;  5C5B A;  1ZC3 B;  3KRW A;  1ZC4 B;  4EJN A;  2D9X A;  3MDB C;  1GC6 A;  2RVB B;  1UPR A;  2P0F A;  4F7G A;  4KAX B;  5JLJ B;  5L81 A;  5DHA B;  4DX9 0;  1FHX A;  4YL8 A;  1OQN A;  2VSZ A;  3BIN A;  3P6A A;  2EJ8 A;  2EC1 A;  1M7R A;  4D6W A;  1OY2 A;  1WI1 A;  2R0D A;  4GXB A;  5DH9 B;  5HE2 A;  4K2O A;  1J0W A;  2W2W A;  5D3V A;  1EF1 A;  3SYX A;  1J19 A;  2COD A;  2I5F A;  4K2P A;  4GMV A;  1XKE A;  5JHG A;  3PP2 A;  2YS3 A;  5GOW B;  4KHB B;  1FGZ A;  3G9W A;  3HIE A;  1H4R A;  3DXC A;  1U5F A;  1SHC A;  5DIF B;  1XX0 A;  5C79 A;  4MK0 A;  2CRF A;  1TQZ A;  5C16 A;  2DN6 A;  4Z2N A;  1EGX A;  3ODO A;  5D27 A;  3U12 A;  1U5D A;  1X86 A;  1MIZ B;  3LJU X;  4MT7 A;  2RNR B;  1P5T A;  1DBH A;  1LW3 A;  4WJ7 A;  1PMS A;  2L1C A;  3PEG A;  1PLS A;  1RJ2 A;  2CAY A;  1I2H A;  2COA A;  4H8S A;  2KIG A;  1GG3 A;  1SGH A;  3SNH A;  1NU2 A;  2J0M A;  1BTN A;  3SO6 A;  2Z0Q A;  4CHJ A;  1I7A A;  2ROZ B;  4HAT B;  3T06 A;  2K8E A;  2Y8G A;  2D4Q A;  1FB8 A;  2QKL A;  4IAP A;  2MFQ A;  2ZKM X;  4WVF B;  1FHO A;  1GC7 A;  3KZ1 A;  3QWM A;  5C5B B;  1ZSQ A;  4KHA A;  4PQ0 A;  4HAX B;  4EMO A;  4K17 A;  2ADZ A;  3FM8 C;  3PSC A;  2COC A;  2D11 A;  2DYQ A;  2RRF A;  3HQC A;  4KVG B;  1DRO A;  4PNK A;  2GJY A;  5LG4 B;  2DA0 A;  1DYN A;  1ISN A;  3TCA A;  2ROV A;  4KHO A;  5I2M A;  2V76 A;  2DTC A;  2IYB A;  1X1F A;  1UPQ A;  1WG7 A;  2D9W A;  1UNQ A;  1X11 A;  2DX5 A;  2DHJ A;  2UZS A;  1Q67 A;  2YT1 A;  4BBK A;  1MIX A;  2L2I A;  4ZRI A;  2DX1 A;  4P7I A;  3PVL A;  4TYZ A;  3WA0 A;  4A6K A;  3ZVR A;  4HAW B;  2LUL A;  4NY0 A;  5JP4 A;  3ODX A;  4CYE A;  4HHV A;  1TJ6 A;  2RLO A;  4TKN A;  5LOP B;  3B77 A;  3A8P A;  1T77 A;  3F0W A;  2G35 A;  2Z0O A;  3D8D A;  3PG7 A;  4QJ3 B;  1FAO A;  3KRX A;  3M1I B;  1QQG A;  2DFK A;  2NMB A;  3MPX A;  1UNR A;  1H10 A;  2RUK B;  4HDQ A;  5FI0 A;  2DKQ A;  1V5P A;  2RSG A;  3NWA A;  2RGN B;  1AQC A;  2KGX B;  2ZPY A;  3ODW A;  2ELB A;  1KZG A;  3QBV B;  3ULB A;  1B55 A;  3V5W A;  3UZT A;  3VOQ A;  1V5M A;  2FJU B;  1WGQ A;  3QIJ A;  2J0J A;  2Y7B A;  5D3X A;  3IVF A;  2R2Y A;  2VKI A;  2OQB A;  2P0D A;  1WJ1 A;  2QKM A;  1KZ7 A;  3PZD A;  1EVH A;  4A5K A;  3AU5 A;  1P3R A;  2K2J A;  2KIE A;  4YON A;  2KR0 A;  2Y8F A;  1X05 A;  1ZM0 A;  5KQ4 A;  4CHM A;  3A8Q A;  2E2X A;  2H7D A;  4ZRK A;  1M7E A;  4IOY X;  1FHW A;  3O96 A;  1V61 A;  2YT0 A;  3AJ4 A;  1NI2 A;  5CLL B;  2P8V A;  5I2S A;  2D9V A;  1TXD A;  3DXD A;  1U5G A;  5M4Y B;  3OAN A;  2M38 A;  3HK0 A;  4ZRJ A;  2AL6 A;  5DHF B;  3OHM B;  2D9Z A;  4A6H A;  2K00 A;  4C0A A;  2FJL A;  1WJM A;  1KI1 B;  2UZR A;  1X1G A;  1FOE A;  5CLQ B;  1W1G A;  1FGY A;  5FI1 A;  4MY6 A;  2YS1 A;  3CIK A;  3KY9 A;  3X23 A;  4HB0 B;  1OMW A;  2KUP A;  4QXA B;  2JP2 A;  1MAI A;  1UEF A;  2D10 A;  3N7C A;  4Y94 A;  2Q13 A;  1Y19 B;  1P6S A;  3P7Z A;  2DHK A;  1N3H A;  1U5E A;  3NWF A;  4L6E A;  4Z2M B;  2YS5 A;  3BJI A;  3U7D A;  2XQN M;  1XCG A;  4OSN A;  3HSA A;  2I1K A;  4GZU A;  3DXE A;  2HE7 A;  1K5D B;  4F7H A;  1K5G B;  1EAZ A;  5HE0 A;  1DDM A;  2Z4D A;  2AEH A;  2X18 A;  4CSQ A;  1NTV A;  2YSZ A;  2P0H A;  1Z87 A;  1W1D A;  2CY5 A;  4DBB A;  2LG1 A;  2KUQ A;  2N0Y A;  1AWE A;  2N23 A;  5D3W A;  4HAY B;  1U2B A;  3PVU A;  2Z0P A;  5EFX A;  1ZYI A;  1XD4 A;  2DYN A;  5DI9 B;  4DXA B;  2YT2 A;  4GPT B;  4QJ4 B;  3SV1 A;  4A6F A;  4HSI A;  1U27 A;  4NSW A;  1LB1 A;  3ZDT A;  2J0K A;  2UVM A;  5HE3 A;  4D0N B;  2HTH B;  3RCP A;  2LYD A;  4HAU B;  1MK9 B;  3KSY A;  2J59 M;  1PFJ A;  2D2Q A; 
#chains in the Genus database with same CATH homology
 5J3T A;  2YVC A;  1E5W A;  2R09 A;  1V5U A;  2LOZ A;  3GYP A;  1QC6 A;  3HW2 B;  2DHI A;  4HB3 B;  3NSU A;  1ZVR A;  4HB4 B;  4DX8 A;  2MKR A;  2DKP A;  2NZ8 B;  1RRP B;  3ULC A;  2DLW A;  1V89 A;  3GYO A;  1BTK A;  2GCL A;  3TW1 A;  3F5R A;  4WSF A;  3U8Z A;  2H7E A;  2VRW B;  2W2X C;  1MPH A;  2K2U A;  3AU4 A;  3FEH A;  2KCJ A;  4F7U P;  1UNP A;  3CXB B;  5C6R A;  2EMS A;  1DDV A;  5HE1 A;  5D3Y A;  1XR0 B;  2ELA A;  2GS0 A;  2D9Y A;  1IRS A;  4XWX A;  1WGU A;  2MWN B;  4B6H A;  5LON B;  2EMT A;  4IFS A;  4GMX B;  5J3Y A;  1U29 A;  4EKU A;  5JHH A;  1XOD A;  2LKO A;  1BAK A;  3VIA A;  3D8E A;  2PZ1 A;  2MDX A;  3TO1 A;  1V88 A;  1Y5O A;  4HDO A;  3WYF B;  2OTX A;  2GCJ A;  2COF A;  1BWN A;  4K81 A;  2M14 A;  5KCV A;  2W2X D;  2YRY A;  3FSS A;  1WVH A;  2LOX A;  3PVW A;  3SUZ A;  1W1H A;  2I1J A;  2BCJ A;  3D8F A;  4A6F B;  2CY4 A;  4HAZ B;  2I5C A;  3TVV A;  4HB2 B;  4GN1 A;  1NTY A;  4HAV B;  2IFS A;  3ML4 A;  1DDW A;  3A98 B;  1MKE A;  1MK7 B;  5J3Q A;  5KQ1 A;  2YF0 A;  3TFM A;  5C5B A;  1ZC3 B;  3KRW A;  1ZC4 B;  4EJN A;  2D9X A;  3MDB C;  1GC6 A;  2RVB B;  1UPR A;  2P0F A;  4F7G A;  4KAX B;  5JLJ B;  5L81 A;  5DHA B;  4DX9 0;  1FHX A;  4YL8 A;  1OQN A;  2VSZ A;  3BIN A;  3P6A A;  2EJ8 A;  2EC1 A;  1M7R A;  1OY2 A;  1WI1 A;  2R0D A;  4GXB A;  5DH9 B;  5HE2 A;  4K2O A;  1J0W A;  2W2W A;  1EF1 A;  3SYX A;  1J19 A;  2COD A;  2I5F A;  4K2P A;  4GMV A;  1XKE A;  5JHG A;  3PP2 A;  2YS3 A;  5GOW B;  4KHB B;  1FGZ A;  3G9W A;  1H4R A;  3DXC A;  1U5F A;  1SHC A;  5DIF B;  1XX0 A;  5C79 A;  4MK0 A;  2CRF A;  1TQZ A;  5C16 A;  2DN6 A;  4Z2N A;  1EGX A;  3ODO A;  5D27 A;  1U5D A;  1X86 A;  1MIZ B;  3LJU X;  4MT7 A;  2RNR B;  1P5T A;  1DBH A;  1LW3 A;  4WJ7 A;  1PMS A;  2L1C A;  3PEG A;  1PLS A;  1RJ2 A;  2CAY A;  1I2H A;  2COA A;  4H8S A;  1GG3 A;  1SGH A;  3SNH A;  1NU2 A;  2J0M A;  1BTN A;  3SO6 A;  2Z0Q A;  4CHJ A;  1I7A A;  2ROZ B;  4HAT B;  3T06 A;  2Y8G A;  2D4Q A;  1FB8 A;  2QKL A;  4IAP A;  2MFQ A;  4WVF B;  1FHO A;  1GC7 A;  3KZ1 A;  3QWM A;  5C5B B;  1ZSQ A;  4KHA A;  4PQ0 A;  4HAX B;  4EMO A;  4K17 A;  2ADZ A;  3FM8 C;  3PSC A;  2COC A;  2D11 A;  2DYQ A;  3HQC A;  4KVG B;  1DRO A;  4PNK A;  2GJY A;  2DA0 A;  1DYN A;  1ISN A;  3TCA A;  2ROV A;  4KHO A;  2V76 A;  2DTC A;  2IYB A;  1X1F A;  1UPQ A;  1WG7 A;  2D9W A;  1UNQ A;  1X11 A;  2DX5 A;  2DHJ A;  2UZS A;  1Q67 A;  2YT1 A;  4BBK A;  1MIX A;  2L2I A;  4ZRI A;  2DX1 A;  4P7I A;  3PVL A;  4TYZ A;  3WA0 A;  4A6K A;  3ZVR A;  4HAW B;  2LUL A;  4NY0 A;  5JP4 A;  3ODX A;  4CYE A;  4HHV A;  1TJ6 A;  2RLO A;  4TKN A;  5LOP B;  3D8D A;  3A8P A;  2Z0O A;  3F0W A;  2G35 A;  3PG7 A;  5D3V A;  1FAO A;  3KRX A;  3M1I B;  1QQG A;  2DFK A;  2NMB A;  3MPX A;  1UNR A;  1H10 A;  2RUK B;  4HDQ A;  5FI0 A;  2DKQ A;  1V5P A;  2RSG A;  2RGN B;  1AQC A;  2KGX B;  3ODW A;  2ZPY A;  2ELB A;  1KZG A;  3QBV B;  3ULB A;  1B55 A;  3V5W A;  3UZT A;  3VOQ A;  1V5M A;  1WGQ A;  3QIJ A;  2J0J A;  2Y7B A;  5D3X A;  3IVF A;  2VKI A;  2OQB A;  2P0D A;  1WJ1 A;  2QKM A;  1KZ7 A;  3PZD A;  1EVH A;  4A5K A;  3AU5 A;  1P3R A;  2K2J A;  4YON A;  2Y8F A;  1X05 A;  1ZM0 A;  5KQ4 A;  4CHM A;  3A8Q A;  2E2X A;  2H7D A;  4ZRK A;  1M7E A;  4IOY X;  1FHW A;  3O96 A;  1V61 A;  2YT0 A;  3AJ4 A;  1NI2 A;  5CLL B;  2P8V A;  2D9V A;  1TXD A;  3DXD A;  1U5G A;  3OAN A;  2M38 A;  3HK0 A;  4ZRJ A;  2AL6 A;  5DHF B;  2D9Z A;  4A6H A;  2K00 A;  4C0A A;  2FJL A;  1WJM A;  1KI1 B;  2UZR A;  1X1G A;  1FOE A;  5CLQ B;  1W1G A;  1FGY A;  5FI1 A;  4MY6 A;  2YS1 A;  3CIK A;  3KY9 A;  3X23 A;  4HB0 B;  1OMW A;  2KUP A;  2JP2 A;  1MAI A;  1UEF A;  2D10 A;  3N7C A;  4Y94 A;  2Q13 A;  1Y19 B;  1P6S A;  3P7Z A;  2DHK A;  1N3H A;  1U5E A;  4L6E A;  4Z2M B;  2YS5 A;  3BJI A;  3U7D A;  2XQN M;  1XCG A;  2I1K A;  4GZU A;  3DXE A;  2HE7 A;  1K5D B;  4F7H A;  1K5G B;  1EAZ A;  5HE0 A;  1DDM A;  2AEH A;  2X18 A;  1NTV A;  2YSZ A;  2P0H A;  1Z87 A;  1W1D A;  2CY5 A;  4DBB A;  2LG1 A;  2N0Y A;  1AWE A;  2N23 A;  5D3W A;  4HAY B;  1U2B A;  3PVU A;  2Z0P A;  5EFX A;  1XD4 A;  2DYN A;  5DI9 B;  4DXA B;  4GPT B;  3SV1 A;  4A6F A;  1U27 A;  4NSW A;  1LB1 A;  3ZDT A;  2J0K A;  2UVM A;  5HE3 A;  4D0N B;  2HTH B;  3RCP A;  2LYD A;  4HAU B;  1MK9 B;  3KSY A;  2J59 M;  1PFJ A;  2D2Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...