2V76A

Crystal structure of the human dok1 ptb domain
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
103
structure length
99
Chain Sequence
PLGSQFWVTVQRTEAAERCGLHGSYVLRVEAERLTLLTVGILEPLLSWPYTLLRRYGRDKVMFSFEAGRRCPSGPGTFTFQTAQGNDIFQAVETAIHRQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title An Integrin Phosphorylation Switch: The Effect of {Beta}3 Integrin Tail Phosphorylation on Dok1 and Talin Binding.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
molecule keywords DOCKING PROTEIN 1
total genus 25
structure length 99
sequence length 103
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2007-07-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2v76A00
3IVFA 4HAXB 4HB3B 2QKMA 4KHBB 1MK9B 4YONA 2CY4A 1SHCA 5DHFB 1P3RA 2N0YA 2D9XA 3BJIA 3N7CA 1IRSA 1Z87A 3TVVA 2KUPA 2Y7BA 1KZ7A 1DDMA 4NY0A 1KZGA 4KVGB 4F7UP 3PP2A 4HAVB 3KSYA 3D8DA 4HB4B 2P0FA 3FEHA 4BBKA 4WVFB 3A98B 3M1IB 2YRYA 4WJ7A 1U2BA 3AU5A 3VIAA 4B6HA 5LONB 1WVHA 3SV1A 2EMTA 1H10A 2I5FA 3A8PA 5HE1A 1ZC4B 4F7HA 3KZ1A 4DBBA 2R09A 1BWNA 2CY5A 3P6AA 2UVMA 4ZRJA 2D9YA 4HAWB 4PQ0A 2M38A 1GC6A 5HE2A 2DHKA 5HE3A 1W1HA 4IFSA 3HW2B 3PVUA 1P5TA 4Z2MB 4Z2NA 2Z0QA 3LJUX 1XKEA 1MKEA 2DHIA 1ZC3B 2GS0A 2IYBA 1KI1B 1ZSQA 1BAKA 3PVLA 1WGQA 1DDWA 2DKQA 1MIXA 1TXDA 1FHWA 1XR0B 3TW1A 2L1CA 2RNRB 3MPXA 2YF0A 5KQ1A 1V5PA 2YSZA 1NI2A 2ROZB 2ELAA 3NSUA 2YS3A 1MK7B 4YL8A 3ODOA 1SGHA 2Z0PA 2DX1A 2E2XA 2J0MA 4A6FA 5GOWB 2HE7A 1WJ1A 4MY6A 2YT1A 2VSZA 4A6FB 1TQZA 2VKIA 5KQ4A 2P8VA 1M7RA 1QQGA 4TKNA 2PZ1A 1V88A 2K2UA 4GZUA 2COFA 2I1KA 2Z0OA 4ZRIA 5LOPB 1UNPA 4MT7A 5C5BA 2K2JA 1PLSA 4DXAB 1FGZA 5JP4A 1FGYA 2DX5A 3D8EA 1UNRA 1PFJA 2OTXA 3SYXA 2DYQA 4GPTB 3O96A 5DHAB 1M7EA 4HAUB 5DI9B 2RLOA 2VRWB 1LB1A 3A8QA 2V76A 2D9ZA 3PVWA 5D3XA 1AWEA 1FAOA 2GJYA 3CXBB 1X05A 1ZM0A 1OY2A 1J19A 1MPHA 3ML4A 1DDVA 2MFQA 1X1FA 5L81A 3KRXA 2W2XC 5J3YA 4C0AA 2COCA 2D4QA 3DXCA 4A6HA 4EJNA 1XD4A 1ISNA 4KAXB 1V5UA 3DXEA 2YT0A 3ODWA 4HB2B 1Y19B 1H4RA 4MK0A 5DIFB 5C79A 5CLQB 1U27A 3X23A 3SO6A 2DA0A 3AJ4A 4HAZB 4CHJA 2W2WA 2D9WA 4WSFA 1XCGA 2ELBA 3QWMA 3WA0A 1EAZA 1ZVRA 1FHOA 2DFKA 3KRWA 1LW3A 2G35A 5D3WA 2RUKB 5JHGA 1U5EA 3UZTA 1U5DA 1MIZB 3PEGA 3AU4A 3V5WA 2DN6A 1WGUA 4PNKA 4EKUA 2CAYA 2DKPA 5D3YA 3SUZA 4IAPA 5D3VA 2KCJA 1K5DB 2DLWA 4GXBA 2N23A 5J3TA 1V5MA 1DYNA 2I1JA 2NMBA 2YVCA 1OQNA 2D11A 4L6EA 2BCJA 1W1GA 3FM8C 2LULA 1FOEA 1EGXA 1FHXA 4HDOA 1P6SA 1WJMA 1GG3A 3GYPA 2W2XD 4GMXB 4HB0B 2YS1A 2LOXA 4K2PA 3ZVRA 2LG1A 3DXDA 3ULBA 1GC7A 1J0WA 2GCLA 5DH9B 1WI1A 2COAA 2K00A 3QIJA 4H8SA 1UPRA 5FI0A 2R0DA 2RGNB 2D9VA 1OMWA 4KHAA 1MAIA 1X86A 1U29A 4P7IA 1I7AA 1RJ2A 1UEFA 1RRPB 2IFSA 2Q13A 3PSCA 1B55A 5FI1A 2MWNB 2D10A 3HK0A 4XWXA 4GN1A 2H7EA 2HTHB 3RCPA 1FB8A 3MDBC 2Y8FA 3SNHA 1PMSA 3PZDA 2ROVA 3P7ZA 3D8FA 4HATB 5CLLB 1DROA 1K5GB 1WG7A 1I2HA 1XODA 1V61A 4K17A 1NU2A 1Q67A 2EC1A 3T06A 3G9WA 4DX8A 1AQCA 4A6KA 1E5WA 1UNQA 4HHVA 4Y94A 2LKOA 1XX0A 3ODXA 4HAYB 2MDXA 4TYZA 1V89A 3TFMA 2DHJA 2ADZA 1N3HA 4KHOA 2ZPYA 2I5CA 2H7DA 2GCJA 3QBVB 2LYDA 2YS5A 3F5RA 1X11A 4CHMA 3ULCA 2L2IA 3F0WA 2LOZA 1QC6A 2CRFA 3BINA 4ZRKA 1EVHA 2D2QA 2M14A 3CIKA 4EMOA 5KCVA 2Y8GA 4CYEA 1BTKA 1NTVA 2XQNM 3OANA 4NSWA 4DX90 2P0DA 2QKLA 1UPQA 5JLJB 4K81A 3VOQA 3HQCA 2X18A 5JHHA 5C5BB 2UZRA 3TO1A 2EMSA 2EJ8A 3WYFB 1EF1A 3ZDTA 4HDQA 3FSSA 1Y5OA 1U5FA 2UZSA 2AEHA 2CODA 2FJLA 2P0HA 2J0JA 1TJ6A 2J0KA 3PG7A 2RVBB 1X1GA 2RSGA 3GYOA 2JP2A 2OQBA 5J3QA 4IOYX 4D0NB 5HE0A 3U7DA 1DBHA 1NTYA 2MKRA 2AL6A 5C16A 4K2OA 2DYNA 3TCAA 5D27A 3KY9A 1BTNA 5C6RA 3U8ZA 2KGXB 2NZ8B 4A5KA 4F7GA 2DTCA 4GMVA 5EFXA 1W1DA 2J59M 1U5GA
chains in the Genus database with same CATH superfamily
3IVFA 4HAXB 4HB3B 2QKMA 4KHBB 1MK9B 3NWAA 4YONA 2CY4A 1SHCA 5DHFB 1P3RA 2N0YA 2D9XA 3BJIA 3N7CA 1IRSA 1Z87A 3TVVA 2KUPA 3NWFA 2Y7BA 1KZ7A 1DDMA 4NY0A 1KZGA 4KVGB 4F7UP 3PP2A 4HAVB 3KSYA 3D8DA 4HB4B 2P0FA 3FEHA 4BBKA 4WVFB 3A98B 2ZKMX 3M1IB 2YRYA 4WJ7A 1U2BA 3AU5A 3VIAA 4B6HA 3B77A 5LONB 1WVHA 3SV1A 2EMTA 1H10A 2I5FA 3A8PA 5HE1A 1ZC4B 4F7HA 3KZ1A 4DBBA 2KIGA 2R09A 1BWNA 2CY5A 3P6AA 2UVMA 4ZRJA 2Z4DA 2D9YA 4HAWB 4PQ0A 2M38A 1GC6A 3FVCA 5HE2A 1T77A 2DHKA 5HE3A 1W1HA 4IFSA 3HW2B 3PVUA 1P5TA 4Z2MB 4Z2NA 2Z0QA 3LJUX 1XKEA 1MKEA 2DHIA 1ZC3B 2GS0A 2IYBA 1KI1B 1ZSQA 1BAKA 3PVLA 1WGQA 1DDWA 2DKQA 1MIXA 1TXDA 1FHWA 2K8EA 1XR0B 3TW1A 2L1CA 2RNRB 3MPXA 3OHMB 2YF0A 4HSIA 5KQ1A 1V5PA 2YSZA 1NI2A 2ROZB 2ELAA 3NSUA 4GOUA 2YS3A 1MK7B 4YL8A 3ODOA 1SGHA 2Z0PA 4L1RA 2DX1A 2E2XA 2J0MA 4A6FA 5GOWB 2HE7A 1WJ1A 4MY6A 2YT1A 2VSZA 4A6FB 1TQZA 2VKIA 5KQ4A 2P8VA 1M7RA 1QQGA 4TKNA 2PZ1A 2Z13A 2NBVA 1V88A 2K2UA 4GZUA 2COFA 2I1KA 2Z0OA 4ZRIA 5LOPB 1UNPA 4MT7A 2GUMA 1ZYIA 5C5BA 4QXAB 5IRSA 5I2SA 2K2JA 1PLSA 4DXAB 1FGZA 5JP4A 1FGYA 2DX5A 3D8EA 1UNRA 1PFJA 2OTXA 3SYXA 2DYQA 4GPTB 3O96A 5DHAB 1M7EA 4HAUB 5DI9B 2RLOA 2VRWB 1LB1A 3A8QA 2V76A 2D9ZA 3PVWA 2Z14A 5D3XA 1AWEA 1FAOA 2GJYA 3CXBB 2KR0A 1X05A 1ZM0A 1OY2A 1J19A 1MPHA 3ML4A 1DDVA 2MFQA 1X1FA 5L81A 3KRXA 2W2XC 5J3YA 4C0AA 2COCA 2D4QA 3DXCA 4A6HA 4EJNA 1XD4A 1ISNA 4KAXB 1V5UA 3DXEA 2YT0A 3ODWA 4HB2B 1Y19B 1H4RA 4MK0A 5DIFB 5C79A 5CLQB 1U27A 3X23A 3SO6A 2DA0A 3AJ4A 4HAZB 4CHJA 2W2WA 2D9WA 4D6WA 4WSFA 1XCGA 2ELBA 3QWMA 3WA0A 1EAZA 1ZVRA 1FHOA 2DFKA 3KRWA 3HSAA 1LW3A 1MI1A 2G35A 5D3WA 2RUKB 5JHGA 1U5EA 3UZTA 1U5DA 1MIZB 3PEGA 3AU4A 3V5WA 2DN6A 1WGUA 4KHBA 4PNKA 5M4YB 4EKUA 2CAYA 2DKPA 5D3YA 3SUZA 4IAPA 5D3VA 2KCJA 1K5DB 2DLWA 4GXBA 2N23A 5J3TA 2K49A 1V5MA 1DYNA 2I1JA 2NMBA 2YVCA 3A58A 1OQNA 2D11A 4L6EA 2BCJA 1W1GA 3FM8C 2LULA 1FOEA 1EGXA 1FHXA 4HDOA 1P6SA 1WJMA 1GG3A 3GYPA 2W2XD 4GMXB 4HB0B 2YS1A 2LOXA 4K2PA 3ZVRA 2LG1A 3DXDA 3ULBA 1GC7A 1J0WA 2GCLA 5DH9B 2R2YA 4OSNA 4GNKB 1WI1A 2COAA 2K00A 3QIJA 4H8SA 1UPRA 5FI0A 2R0DA 2RGNB 2D9VA 1OMWA 4KHAA 1MAIA 1X86A 1U29A 4P7IA 1I7AA 1RJ2A 1UEFA 2KIEA 1RRPB 3DCXA 2IFSA 2Q13A 3PSCA 1B55A 5FI1A 2RRFA 4CSQA 2MWNB 2D10A 2YT2A 3HK0A 4XWXA 4GN1A 2H7EA 2HTHB 3RCPA 1FB8A 3MDBC 2Y8FA 3SNHA 1PMSA 3PZDA 2ROVA 3P7ZA 3D8FA 4HATB 5CLLB 1DROA 5LG4B 1K5GB 1WG7A 3NW8A 1I2HA 1XODA 1V61A 4K17A 1NU2A 1Q67A 2EC1A 3T06A 3G9WA 4DX8A 1AQCA 4A6KA 1E5WA 4QJ4B 1UNQA 4HHVA 4Y94A 2LKOA 1XX0A 3ODXA 4HAYB 2MDXA 2Z59A 4TYZA 1V89A 3TFMA 3HIEA 2DHJA 2ADZA 1N3HA 2KUQA 4KHOA 2ZPYA 2I5CA 2H7DA 2GCJA 3QBVB 2LYDA 2YS5A 3F5RA 1X11A 4CHMA 3ULCA 2L2IA 3F0WA 4DIXA 2LOZA 1QC6A 2CRFA 3BINA 4ZRKA 1EVHA 2D2QA 2M14A 3CIKA 4OT1A 4QJ3B 4EMOA 5KCVA 2Y8GA 4CYEA 1BTKA 1NTVA 2XQNM 3OANA 4NSWA 4DX90 2P0DA 2QKLA 3NWDA 1UPQA 5JLJB 4K81A 3VOQA 3HQCA 2X18A 5JHHA 5C5BB 2UZRA 3TO1A 2EMSA 3U12A 2EJ8A 3WYFB 1EF1A 3ZDTA 4HDQA 3FSSA 1Y5OA 1U5FA 2UZSA 2AEHA 2CODA 2FJLA 4QJ5B 2P0HA 2J0JA 1TJ6A 2J0KA 3PG7A 2RVBB 1X1GA 2RSGA 3GYOA 2JP2A 2OQBA 5J3QA 4IOYX 4D0NB 5HE0A 3U7DA 1DBHA 1NTYA 2MKRA 2AL6A 5C16A 4K2OA 5I2MA 2FJUB 2DYNA 3TCAA 5D27A 3KY9A 1BTNA 5C6RA 3U8ZA 2KGXB 2NZ8B 4A5KA 4F7GA 2DTCA 4GMVA 5EFXA 1W1DA 2J59M 1U5GA
chains in the Genus database with same CATH topology
3IVFA 4HAXB 4HB3B 2QKMA 4KHBB 1MK9B 4YONA 2CY4A 1SHCA 5DHFB 1P3RA 2N0YA 2D9XA 3BJIA 3N7CA 1IRSA 1Z87A 3TVVA 2KUPA 2Y7BA 1KZ7A 1DDMA 4NY0A 1KZGA 4KVGB 4F7UP 3PP2A 4HAVB 3KSYA 3D8DA 4HB4B 2P0FA 3FEHA 4BBKA 4WVFB 3A98B 3M1IB 2YRYA 4WJ7A 1U2BA 3AU5A 3VIAA 4B6HA 5LONB 1WVHA 3SV1A 2EMTA 1H10A 2I5FA 3A8PA 5HE1A 1ZC4B 4F7HA 3KZ1A 4DBBA 2R09A 1BWNA 2CY5A 3P6AA 2UVMA 4ZRJA 2D9YA 4HAWB 4PQ0A 2M38A 1GC6A 5HE2A 2DHKA 5HE3A 1W1HA 4IFSA 3HW2B 3PVUA 1P5TA 4Z2MB 4Z2NA 2Z0QA 3LJUX 1XKEA 1MKEA 2DHIA 1ZC3B 2GS0A 2IYBA 1KI1B 1ZSQA 1BAKA 3PVLA 1WGQA 1DDWA 2DKQA 1MIXA 1TXDA 1FHWA 1XR0B 3TW1A 2L1CA 2RNRB 3MPXA 2YF0A 5KQ1A 1V5PA 2YSZA 1NI2A 2ROZB 2ELAA 3NSUA 2YS3A 1MK7B 4YL8A 3ODOA 1SGHA 2Z0PA 2DX1A 2E2XA 2J0MA 4A6FA 5GOWB 2HE7A 1WJ1A 4MY6A 2YT1A 2VSZA 4A6FB 1TQZA 2VKIA 5KQ4A 2P8VA 1M7RA 1QQGA 4TKNA 2PZ1A 1V88A 2K2UA 4GZUA 2COFA 2I1KA 2Z0OA 4ZRIA 5LOPB 1UNPA 4MT7A 5C5BA 2K2JA 1PLSA 4DXAB 1FGZA 5JP4A 1FGYA 2DX5A 3D8EA 1UNRA 1PFJA 2OTXA 3SYXA 2DYQA 4GPTB 3O96A 5DHAB 1M7EA 4HAUB 5DI9B 2RLOA 2VRWB 1LB1A 3A8QA 2V76A 2D9ZA 3PVWA 5D3XA 1AWEA 1FAOA 2GJYA 3CXBB 1X05A 1ZM0A 1OY2A 1J19A 1MPHA 3ML4A 1DDVA 2MFQA 1X1FA 5L81A 3KRXA 2W2XC 5J3YA 4C0AA 2COCA 2D4QA 3DXCA 4A6HA 4EJNA 1XD4A 1ISNA 4KAXB 1V5UA 3DXEA 2YT0A 3ODWA 4HB2B 1Y19B 1H4RA 4MK0A 5DIFB 5C79A 5CLQB 1U27A 3X23A 3SO6A 2DA0A 3AJ4A 4HAZB 4CHJA 2W2WA 2D9WA 4WSFA 1XCGA 2ELBA 3QWMA 3WA0A 1EAZA 1ZVRA 1FHOA 2DFKA 3KRWA 1LW3A 2G35A 5D3WA 2RUKB 5JHGA 1U5EA 3UZTA 1U5DA 1MIZB 3PEGA 3AU4A 3V5WA 2DN6A 1WGUA 4PNKA 4EKUA 2CAYA 2DKPA 5D3YA 3SUZA 4IAPA 5D3VA 2KCJA 1K5DB 2DLWA 4GXBA 2N23A 5J3TA 1V5MA 1DYNA 2I1JA 2NMBA 2YVCA 1OQNA 2D11A 4L6EA 2BCJA 1W1GA 3FM8C 2LULA 1FOEA 1EGXA 1FHXA 4HDOA 1P6SA 1WJMA 1GG3A 3GYPA 2W2XD 4GMXB 4HB0B 2YS1A 2LOXA 4K2PA 3ZVRA 2LG1A 3DXDA 3ULBA 1GC7A 1J0WA 2GCLA 5DH9B 1WI1A 2COAA 2K00A 3QIJA 4H8SA 1UPRA 5FI0A 2R0DA 2RGNB 2D9VA 1OMWA 4KHAA 1MAIA 1X86A 1U29A 4P7IA 1I7AA 1RJ2A 1UEFA 1RRPB 2IFSA 2Q13A 3PSCA 1B55A 5FI1A 2MWNB 2D10A 3HK0A 4XWXA 4GN1A 2H7EA 2HTHB 3RCPA 1FB8A 3MDBC 2Y8FA 3SNHA 1PMSA 3PZDA 2ROVA 3P7ZA 3D8FA 4HATB 5CLLB 1DROA 1K5GB 1WG7A 1I2HA 1XODA 1V61A 4K17A 1NU2A 1Q67A 2EC1A 3T06A 3G9WA 4DX8A 1AQCA 4A6KA 1E5WA 1UNQA 4HHVA 4Y94A 2LKOA 1XX0A 3ODXA 4HAYB 2MDXA 4TYZA 1V89A 3TFMA 2DHJA 2ADZA 1N3HA 4KHOA 2ZPYA 2I5CA 2H7DA 2GCJA 3QBVB 2LYDA 2YS5A 3F5RA 1X11A 4CHMA 3ULCA 2L2IA 3F0WA 2LOZA 1QC6A 2CRFA 3BINA 4ZRKA 1EVHA 2D2QA 2M14A 3CIKA 4EMOA 5KCVA 2Y8GA 4CYEA 1BTKA 1NTVA 2XQNM 3OANA 4NSWA 4DX90 2P0DA 2QKLA 1UPQA 5JLJB 4K81A 3VOQA 3HQCA 2X18A 5JHHA 5C5BB 2UZRA 3TO1A 2EMSA 2EJ8A 3WYFB 1EF1A 3ZDTA 4HDQA 3FSSA 1Y5OA 1U5FA 2UZSA 2AEHA 2CODA 2FJLA 2P0HA 2J0JA 1TJ6A 2J0KA 3PG7A 2RVBB 1X1GA 2RSGA 3GYOA 2JP2A 2OQBA 5J3QA 4IOYX 4D0NB 5HE0A 3U7DA 1DBHA 1NTYA 2MKRA 2AL6A 5C16A 4K2OA 2DYNA 3TCAA 5D27A 3KY9A 1BTNA 5C6RA 3U8ZA 2KGXB 2NZ8B 4A5KA 4F7GA 2DTCA 4GMVA 5EFXA 1W1DA 2J59M 1U5GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IVF A;  4HAX B;  4HB3 B;  2QKM A;  4KHB B;  1MK9 B;  4YON A;  2CY4 A;  1SHC A;  5DHF B;  1P3R A;  2N0Y A;  2D9X A;  3BJI A;  3N7C A;  1IRS A;  1Z87 A;  3TVV A;  2KUP A;  2Y7B A;  1KZ7 A;  1DDM A;  4NY0 A;  1KZG A;  4KVG B;  4F7U P;  3PP2 A;  4HAV B;  3KSY A;  3D8D A;  4HB4 B;  2P0F A;  3FEH A;  4BBK A;  4WVF B;  3A98 B;  3M1I B;  2YRY A;  4WJ7 A;  1U2B A;  3AU5 A;  3VIA A;  4B6H A;  5LON B;  1WVH A;  3SV1 A;  2EMT A;  1H10 A;  2I5F A;  3A8P A;  5HE1 A;  1ZC4 B;  4F7H A;  3KZ1 A;  4DBB A;  2R09 A;  1BWN A;  2CY5 A;  3P6A A;  2UVM A;  4ZRJ A;  2D9Y A;  4HAW B;  4PQ0 A;  2M38 A;  1GC6 A;  5HE2 A;  2DHK A;  5HE3 A;  1W1H A;  4IFS A;  3HW2 B;  3PVU A;  1P5T A;  4Z2M B;  4Z2N A;  2Z0Q A;  3LJU X;  1XKE A;  1MKE A;  2DHI A;  1ZC3 B;  2GS0 A;  2IYB A;  1KI1 B;  1ZSQ A;  1BAK A;  3PVL A;  1WGQ A;  1DDW A;  2DKQ A;  1MIX A;  1TXD A;  1FHW A;  1XR0 B;  3TW1 A;  2L1C A;  2RNR B;  3MPX A;  2YF0 A;  5KQ1 A;  1V5P A;  2YSZ A;  1NI2 A;  2ROZ B;  2ELA A;  3NSU A;  2YS3 A;  1MK7 B;  4YL8 A;  3ODO A;  1SGH A;  2Z0P A;  2DX1 A;  2E2X A;  2J0M A;  4A6F A;  5GOW B;  2HE7 A;  1WJ1 A;  4MY6 A;  2YT1 A;  2VSZ A;  4A6F B;  1TQZ A;  2VKI A;  5KQ4 A;  2P8V A;  1M7R A;  1QQG A;  4TKN A;  2PZ1 A;  1V88 A;  2K2U A;  4GZU A;  2COF A;  2I1K A;  2Z0O A;  4ZRI A;  5LOP B;  1UNP A;  4MT7 A;  5C5B A;  2K2J A;  1PLS A;  4DXA B;  1FGZ A;  5JP4 A;  1FGY A;  2DX5 A;  3D8E A;  1UNR A;  1PFJ A;  2OTX A;  3SYX A;  2DYQ A;  4GPT B;  3O96 A;  5DHA B;  1M7E A;  4HAU B;  5DI9 B;  2RLO A;  2VRW B;  1LB1 A;  3A8Q A;  2V76 A;  2D9Z A;  3PVW A;  5D3X A;  1AWE A;  1FAO A;  2GJY A;  3CXB B;  1X05 A;  1ZM0 A;  1OY2 A;  1J19 A;  1MPH A;  3ML4 A;  1DDV A;  2MFQ A;  1X1F A;  5L81 A;  3KRX A;  2W2X C;  5J3Y A;  4C0A A;  2COC A;  2D4Q A;  3DXC A;  4A6H A;  4EJN A;  1XD4 A;  1ISN A;  4KAX B;  1V5U A;  3DXE A;  2YT0 A;  3ODW A;  4HB2 B;  1Y19 B;  1H4R A;  4MK0 A;  5DIF B;  5C79 A;  5CLQ B;  1U27 A;  3X23 A;  3SO6 A;  2DA0 A;  3AJ4 A;  4HAZ B;  4CHJ A;  2W2W A;  2D9W A;  4WSF A;  1XCG A;  2ELB A;  3QWM A;  3WA0 A;  1EAZ A;  1ZVR A;  1FHO A;  2DFK A;  3KRW A;  1LW3 A;  2G35 A;  5D3W A;  2RUK B;  5JHG A;  1U5E A;  3UZT A;  1U5D A;  1MIZ B;  3PEG A;  3AU4 A;  3V5W A;  2DN6 A;  1WGU A;  4PNK A;  4EKU A;  2CAY A;  2DKP A;  5D3Y A;  3SUZ A;  4IAP A;  5D3V A;  2KCJ A;  1K5D B;  2DLW A;  4GXB A;  2N23 A;  5J3T A;  1V5M A;  1DYN A;  2I1J A;  2NMB A;  2YVC A;  1OQN A;  2D11 A;  4L6E A;  2BCJ A;  1W1G A;  3FM8 C;  2LUL A;  1FOE A;  1EGX A;  1FHX A;  4HDO A;  1P6S A;  1WJM A;  1GG3 A;  3GYP A;  2W2X D;  4GMX B;  4HB0 B;  2YS1 A;  2LOX A;  4K2P A;  3ZVR A;  2LG1 A;  3DXD A;  3ULB A;  1GC7 A;  1J0W A;  2GCL A;  5DH9 B;  1WI1 A;  2COA A;  2K00 A;  3QIJ A;  4H8S A;  1UPR A;  5FI0 A;  2R0D A;  2RGN B;  2D9V A;  1OMW A;  4KHA A;  1MAI A;  1X86 A;  1U29 A;  4P7I A;  1I7A A;  1RJ2 A;  1UEF A;  1RRP B;  2IFS A;  2Q13 A;  3PSC A;  1B55 A;  5FI1 A;  2MWN B;  2D10 A;  3HK0 A;  4XWX A;  4GN1 A;  2H7E A;  2HTH B;  3RCP A;  1FB8 A;  3MDB C;  2Y8F A;  3SNH A;  1PMS A;  3PZD A;  2ROV A;  3P7Z A;  3D8F A;  4HAT B;  5CLL B;  1DRO A;  1K5G B;  1WG7 A;  1I2H A;  1XOD A;  1V61 A;  4K17 A;  1NU2 A;  1Q67 A;  2EC1 A;  3T06 A;  3G9W A;  4DX8 A;  1AQC A;  4A6K A;  1E5W A;  1UNQ A;  4HHV A;  4Y94 A;  2LKO A;  1XX0 A;  3ODX A;  4HAY B;  2MDX A;  4TYZ A;  1V89 A;  3TFM A;  2DHJ A;  2ADZ A;  1N3H A;  4KHO A;  2ZPY A;  2I5C A;  2H7D A;  2GCJ A;  3QBV B;  2LYD A;  2YS5 A;  3F5R A;  1X11 A;  4CHM A;  3ULC A;  2L2I A;  3F0W A;  2LOZ A;  1QC6 A;  2CRF A;  3BIN A;  4ZRK A;  1EVH A;  2D2Q A;  2M14 A;  3CIK A;  4EMO A;  5KCV A;  2Y8G A;  4CYE A;  1BTK A;  1NTV A;  2XQN M;  3OAN A;  4NSW A;  4DX9 0;  2P0D A;  2QKL A;  1UPQ A;  5JLJ B;  4K81 A;  3VOQ A;  3HQC A;  2X18 A;  5JHH A;  5C5B B;  2UZR A;  3TO1 A;  2EMS A;  2EJ8 A;  3WYF B;  1EF1 A;  3ZDT A;  4HDQ A;  3FSS A;  1Y5O A;  1U5F A;  2UZS A;  2AEH A;  2COD A;  2FJL A;  2P0H A;  2J0J A;  1TJ6 A;  2J0K A;  3PG7 A;  2RVB B;  1X1G A;  2RSG A;  3GYO A;  2JP2 A;  2OQB A;  5J3Q A;  4IOY X;  4D0N B;  5HE0 A;  3U7D A;  1DBH A;  1NTY A;  2MKR A;  2AL6 A;  5C16 A;  4K2O A;  2DYN A;  3TCA A;  5D27 A;  3KY9 A;  1BTN A;  5C6R A;  3U8Z A;  2KGX B;  2NZ8 B;  4A5K A;  4F7G A;  2DTC A;  4GMV A;  5EFX A;  1W1D A;  2J59 M;  1U5G A; 
#chains in the Genus database with same CATH topology
 3IVF A;  4HAX B;  4HB3 B;  2QKM A;  4KHB B;  1MK9 B;  3NWA A;  4YON A;  2CY4 A;  1SHC A;  5DHF B;  1P3R A;  2N0Y A;  2D9X A;  3BJI A;  3N7C A;  1IRS A;  1Z87 A;  3TVV A;  2KUP A;  3NWF A;  2Y7B A;  1KZ7 A;  1DDM A;  4NY0 A;  1KZG A;  4KVG B;  4F7U P;  3PP2 A;  4HAV B;  3KSY A;  3D8D A;  4HB4 B;  2P0F A;  3FEH A;  4BBK A;  4WVF B;  3A98 B;  2ZKM X;  3M1I B;  2YRY A;  4WJ7 A;  1U2B A;  3AU5 A;  3VIA A;  4B6H A;  3B77 A;  5LON B;  1WVH A;  3SV1 A;  2EMT A;  1H10 A;  2I5F A;  3A8P A;  5HE1 A;  1ZC4 B;  4F7H A;  3KZ1 A;  4DBB A;  2KIG A;  2R09 A;  1BWN A;  2CY5 A;  3P6A A;  2UVM A;  4ZRJ A;  2Z4D A;  2D9Y A;  4HAW B;  4PQ0 A;  2M38 A;  1GC6 A;  3FVC A;  5HE2 A;  1T77 A;  2DHK A;  5HE3 A;  1W1H A;  4IFS A;  3HW2 B;  3PVU A;  1P5T A;  4Z2M B;  4Z2N A;  2Z0Q A;  3LJU X;  1XKE A;  1MKE A;  2DHI A;  1ZC3 B;  2GS0 A;  2IYB A;  1KI1 B;  1ZSQ A;  1BAK A;  3PVL A;  1WGQ A;  1DDW A;  2DKQ A;  1MIX A;  1TXD A;  1FHW A;  2K8E A;  1XR0 B;  3TW1 A;  2L1C A;  2RNR B;  3MPX A;  3OHM B;  2YF0 A;  4HSI A;  5KQ1 A;  1V5P A;  2YSZ A;  1NI2 A;  2ROZ B;  2ELA A;  3NSU A;  4GOU A;  2YS3 A;  1MK7 B;  4YL8 A;  3ODO A;  1SGH A;  2Z0P A;  4L1R A;  2DX1 A;  2E2X A;  2J0M A;  4A6F A;  5GOW B;  2HE7 A;  1WJ1 A;  4MY6 A;  2YT1 A;  2VSZ A;  4A6F B;  1TQZ A;  2VKI A;  5KQ4 A;  2P8V A;  1M7R A;  1QQG A;  4TKN A;  2PZ1 A;  2Z13 A;  2NBV A;  1V88 A;  2K2U A;  4GZU A;  2COF A;  2I1K A;  2Z0O A;  4ZRI A;  5LOP B;  1UNP A;  4MT7 A;  2GUM A;  1ZYI A;  5C5B A;  4QXA B;  5IRS A;  5I2S A;  2K2J A;  1PLS A;  4DXA B;  1FGZ A;  5JP4 A;  1FGY A;  2DX5 A;  3D8E A;  1UNR A;  1PFJ A;  2OTX A;  3SYX A;  2DYQ A;  4GPT B;  3O96 A;  5DHA B;  1M7E A;  4HAU B;  5DI9 B;  2RLO A;  2VRW B;  1LB1 A;  3A8Q A;  2V76 A;  2D9Z A;  3PVW A;  2Z14 A;  5D3X A;  1AWE A;  1FAO A;  2GJY A;  3CXB B;  2KR0 A;  1X05 A;  1ZM0 A;  1OY2 A;  1J19 A;  1MPH A;  3ML4 A;  1DDV A;  2MFQ A;  1X1F A;  5L81 A;  3KRX A;  2W2X C;  5J3Y A;  4C0A A;  2COC A;  2D4Q A;  3DXC A;  4A6H A;  4EJN A;  1XD4 A;  1ISN A;  4KAX B;  1V5U A;  3DXE A;  2YT0 A;  3ODW A;  4HB2 B;  1Y19 B;  1H4R A;  4MK0 A;  5DIF B;  5C79 A;  5CLQ B;  1U27 A;  3X23 A;  3SO6 A;  2DA0 A;  3AJ4 A;  4HAZ B;  4CHJ A;  2W2W A;  2D9W A;  4D6W A;  4WSF A;  1XCG A;  2ELB A;  3QWM A;  3WA0 A;  1EAZ A;  1ZVR A;  1FHO A;  2DFK A;  3KRW A;  3HSA A;  1LW3 A;  1MI1 A;  2G35 A;  5D3W A;  2RUK B;  5JHG A;  1U5E A;  3UZT A;  1U5D A;  1MIZ B;  3PEG A;  3AU4 A;  3V5W A;  2DN6 A;  1WGU A;  4KHB A;  4PNK A;  5M4Y B;  4EKU A;  2CAY A;  2DKP A;  5D3Y A;  3SUZ A;  4IAP A;  5D3V A;  2KCJ A;  1K5D B;  2DLW A;  4GXB A;  2N23 A;  5J3T A;  2K49 A;  1V5M A;  1DYN A;  2I1J A;  2NMB A;  2YVC A;  3A58 A;  1OQN A;  2D11 A;  4L6E A;  2BCJ A;  1W1G A;  3FM8 C;  2LUL A;  1FOE A;  1EGX A;  1FHX A;  4HDO A;  1P6S A;  1WJM A;  1GG3 A;  3GYP A;  2W2X D;  4GMX B;  4HB0 B;  2YS1 A;  2LOX A;  4K2P A;  3ZVR A;  2LG1 A;  3DXD A;  3ULB A;  1GC7 A;  1J0W A;  2GCL A;  5DH9 B;  2R2Y A;  4OSN A;  4GNK B;  1WI1 A;  2COA A;  2K00 A;  3QIJ A;  4H8S A;  1UPR A;  5FI0 A;  2R0D A;  2RGN B;  2D9V A;  1OMW A;  4KHA A;  1MAI A;  1X86 A;  1U29 A;  4P7I A;  1I7A A;  1RJ2 A;  1UEF A;  2KIE A;  1RRP B;  3DCX A;  2IFS A;  2Q13 A;  3PSC A;  1B55 A;  5FI1 A;  2RRF A;  4CSQ A;  2MWN B;  2D10 A;  2YT2 A;  3HK0 A;  4XWX A;  4GN1 A;  2H7E A;  2HTH B;  3RCP A;  1FB8 A;  3MDB C;  2Y8F A;  3SNH A;  1PMS A;  3PZD A;  2ROV A;  3P7Z A;  3D8F A;  4HAT B;  5CLL B;  1DRO A;  5LG4 B;  1K5G B;  1WG7 A;  3NW8 A;  1I2H A;  1XOD A;  1V61 A;  4K17 A;  1NU2 A;  1Q67 A;  2EC1 A;  3T06 A;  3G9W A;  4DX8 A;  1AQC A;  4A6K A;  1E5W A;  4QJ4 B;  1UNQ A;  4HHV A;  4Y94 A;  2LKO A;  1XX0 A;  3ODX A;  4HAY B;  2MDX A;  2Z59 A;  4TYZ A;  1V89 A;  3TFM A;  3HIE A;  2DHJ A;  2ADZ A;  1N3H A;  2KUQ A;  4KHO A;  2ZPY A;  2I5C A;  2H7D A;  2GCJ A;  3QBV B;  2LYD A;  2YS5 A;  3F5R A;  1X11 A;  4CHM A;  3ULC A;  2L2I A;  3F0W A;  4DIX A;  2LOZ A;  1QC6 A;  2CRF A;  3BIN A;  4ZRK A;  1EVH A;  2D2Q A;  2M14 A;  3CIK A;  4OT1 A;  4QJ3 B;  4EMO A;  5KCV A;  2Y8G A;  4CYE A;  1BTK A;  1NTV A;  2XQN M;  3OAN A;  4NSW A;  4DX9 0;  2P0D A;  2QKL A;  3NWD A;  1UPQ A;  5JLJ B;  4K81 A;  3VOQ A;  3HQC A;  2X18 A;  5JHH A;  5C5B B;  2UZR A;  3TO1 A;  2EMS A;  3U12 A;  2EJ8 A;  3WYF B;  1EF1 A;  3ZDT A;  4HDQ A;  3FSS A;  1Y5O A;  1U5F A;  2UZS A;  2AEH A;  2COD A;  2FJL A;  4QJ5 B;  2P0H A;  2J0J A;  1TJ6 A;  2J0K A;  3PG7 A;  2RVB B;  1X1G A;  2RSG A;  3GYO A;  2JP2 A;  2OQB A;  5J3Q A;  4IOY X;  4D0N B;  5HE0 A;  3U7D A;  1DBH A;  1NTY A;  2MKR A;  2AL6 A;  5C16 A;  4K2O A;  5I2M A;  2FJU B;  2DYN A;  3TCA A;  5D27 A;  3KY9 A;  1BTN A;  5C6R A;  3U8Z A;  2KGX B;  2NZ8 B;  4A5K A;  4F7G A;  2DTC A;  4GMV A;  5EFX A;  1W1D A;  2J59 M;  1U5G A; 
#chains in the Genus database with same CATH homology
 3IVF A;  4HAX B;  4HB3 B;  2QKM A;  4KHB B;  1MK9 B;  4YON A;  2CY4 A;  1SHC A;  5DHF B;  1P3R A;  2N0Y A;  2D9X A;  3BJI A;  3N7C A;  1IRS A;  1Z87 A;  3TVV A;  2KUP A;  2Y7B A;  1KZ7 A;  1DDM A;  4NY0 A;  1KZG A;  4KVG B;  4F7U P;  3PP2 A;  4HAV B;  3KSY A;  3D8D A;  4HB4 B;  2P0F A;  3FEH A;  4BBK A;  4WVF B;  3A98 B;  3M1I B;  2YRY A;  4WJ7 A;  1U2B A;  3AU5 A;  3VIA A;  4B6H A;  5LON B;  1WVH A;  3SV1 A;  2EMT A;  1H10 A;  2I5F A;  3A8P A;  5HE1 A;  1ZC4 B;  4F7H A;  3KZ1 A;  4DBB A;  2R09 A;  1BWN A;  2CY5 A;  3P6A A;  2UVM A;  4ZRJ A;  2D9Y A;  4HAW B;  4PQ0 A;  2M38 A;  1GC6 A;  5HE2 A;  2DHK A;  5HE3 A;  1W1H A;  4IFS A;  3HW2 B;  3PVU A;  1P5T A;  4Z2M B;  4Z2N A;  2Z0Q A;  3LJU X;  1XKE A;  1MKE A;  2DHI A;  1ZC3 B;  2GS0 A;  2IYB A;  1KI1 B;  1ZSQ A;  1BAK A;  3PVL A;  1WGQ A;  1DDW A;  2DKQ A;  1MIX A;  1TXD A;  1FHW A;  1XR0 B;  3TW1 A;  2L1C A;  2RNR B;  3MPX A;  2YF0 A;  5KQ1 A;  1V5P A;  2YSZ A;  1NI2 A;  2ROZ B;  2ELA A;  3NSU A;  2YS3 A;  1MK7 B;  4YL8 A;  3ODO A;  1SGH A;  2Z0P A;  2DX1 A;  2E2X A;  2J0M A;  4A6F A;  5GOW B;  2HE7 A;  1WJ1 A;  4MY6 A;  2YT1 A;  2VSZ A;  4A6F B;  1TQZ A;  2VKI A;  5KQ4 A;  2P8V A;  1M7R A;  1QQG A;  4TKN A;  2PZ1 A;  1V88 A;  2K2U A;  4GZU A;  2COF A;  2I1K A;  2Z0O A;  4ZRI A;  5LOP B;  1UNP A;  4MT7 A;  5C5B A;  2K2J A;  1PLS A;  4DXA B;  1FGZ A;  5JP4 A;  1FGY A;  2DX5 A;  3D8E A;  1UNR A;  1PFJ A;  2OTX A;  3SYX A;  2DYQ A;  4GPT B;  3O96 A;  5DHA B;  1M7E A;  4HAU B;  5DI9 B;  2RLO A;  2VRW B;  1LB1 A;  3A8Q A;  2V76 A;  2D9Z A;  3PVW A;  5D3X A;  1AWE A;  1FAO A;  2GJY A;  3CXB B;  1X05 A;  1ZM0 A;  1OY2 A;  1J19 A;  1MPH A;  3ML4 A;  1DDV A;  2MFQ A;  1X1F A;  5L81 A;  3KRX A;  2W2X C;  5J3Y A;  4C0A A;  2COC A;  2D4Q A;  3DXC A;  4A6H A;  4EJN A;  1XD4 A;  1ISN A;  4KAX B;  1V5U A;  3DXE A;  2YT0 A;  3ODW A;  4HB2 B;  1Y19 B;  1H4R A;  4MK0 A;  5DIF B;  5C79 A;  5CLQ B;  1U27 A;  3X23 A;  3SO6 A;  2DA0 A;  3AJ4 A;  4HAZ B;  4CHJ A;  2W2W A;  2D9W A;  4WSF A;  1XCG A;  2ELB A;  3QWM A;  3WA0 A;  1EAZ A;  1ZVR A;  1FHO A;  2DFK A;  3KRW A;  1LW3 A;  2G35 A;  5D3W A;  2RUK B;  5JHG A;  1U5E A;  3UZT A;  1U5D A;  1MIZ B;  3PEG A;  3AU4 A;  3V5W A;  2DN6 A;  1WGU A;  4PNK A;  4EKU A;  2CAY A;  2DKP A;  5D3Y A;  3SUZ A;  4IAP A;  5D3V A;  2KCJ A;  1K5D B;  2DLW A;  4GXB A;  2N23 A;  5J3T A;  1V5M A;  1DYN A;  2I1J A;  2NMB A;  2YVC A;  1OQN A;  2D11 A;  4L6E A;  2BCJ A;  1W1G A;  3FM8 C;  2LUL A;  1FOE A;  1EGX A;  1FHX A;  4HDO A;  1P6S A;  1WJM A;  1GG3 A;  3GYP A;  2W2X D;  4GMX B;  4HB0 B;  2YS1 A;  2LOX A;  4K2P A;  3ZVR A;  2LG1 A;  3DXD A;  3ULB A;  1GC7 A;  1J0W A;  2GCL A;  5DH9 B;  1WI1 A;  2COA A;  2K00 A;  3QIJ A;  4H8S A;  1UPR A;  5FI0 A;  2R0D A;  2RGN B;  2D9V A;  1OMW A;  4KHA A;  1MAI A;  1X86 A;  1U29 A;  4P7I A;  1I7A A;  1RJ2 A;  1UEF A;  1RRP B;  2IFS A;  2Q13 A;  3PSC A;  1B55 A;  5FI1 A;  2MWN B;  2D10 A;  3HK0 A;  4XWX A;  4GN1 A;  2H7E A;  2HTH B;  3RCP A;  1FB8 A;  3MDB C;  2Y8F A;  3SNH A;  1PMS A;  3PZD A;  2ROV A;  3P7Z A;  3D8F A;  4HAT B;  5CLL B;  1DRO A;  1K5G B;  1WG7 A;  1I2H A;  1XOD A;  1V61 A;  4K17 A;  1NU2 A;  1Q67 A;  2EC1 A;  3T06 A;  3G9W A;  4DX8 A;  1AQC A;  4A6K A;  1E5W A;  1UNQ A;  4HHV A;  4Y94 A;  2LKO A;  1XX0 A;  3ODX A;  4HAY B;  2MDX A;  4TYZ A;  1V89 A;  3TFM A;  2DHJ A;  2ADZ A;  1N3H A;  4KHO A;  2ZPY A;  2I5C A;  2H7D A;  2GCJ A;  3QBV B;  2LYD A;  2YS5 A;  3F5R A;  1X11 A;  4CHM A;  3ULC A;  2L2I A;  3F0W A;  2LOZ A;  1QC6 A;  2CRF A;  3BIN A;  4ZRK A;  1EVH A;  2D2Q A;  2M14 A;  3CIK A;  4EMO A;  5KCV A;  2Y8G A;  4CYE A;  1BTK A;  1NTV A;  2XQN M;  3OAN A;  4NSW A;  4DX9 0;  2P0D A;  2QKL A;  1UPQ A;  5JLJ B;  4K81 A;  3VOQ A;  3HQC A;  2X18 A;  5JHH A;  5C5B B;  2UZR A;  3TO1 A;  2EMS A;  2EJ8 A;  3WYF B;  1EF1 A;  3ZDT A;  4HDQ A;  3FSS A;  1Y5O A;  1U5F A;  2UZS A;  2AEH A;  2COD A;  2FJL A;  2P0H A;  2J0J A;  1TJ6 A;  2J0K A;  3PG7 A;  2RVB B;  1X1G A;  2RSG A;  3GYO A;  2JP2 A;  2OQB A;  5J3Q A;  4IOY X;  4D0N B;  5HE0 A;  3U7D A;  1DBH A;  1NTY A;  2MKR A;  2AL6 A;  5C16 A;  4K2O A;  2DYN A;  3TCA A;  5D27 A;  3KY9 A;  1BTN A;  5C6R A;  3U8Z A;  2KGX B;  2NZ8 B;  4A5K A;  4F7G A;  2DTC A;  4GMV A;  5EFX A;  1W1D A;  2J59 M;  1U5G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...