2V76A

Crystal structure of the human dok1 ptb domain
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
103
structure length
99
Chain Sequence
PLGSQFWVTVQRTEAAERCGLHGSYVLRVEAERLTLLTVGILEPLLSWPYTLLRRYGRDKVMFSFEAGRRCPSGPGTFTFQTAQGNDIFQAVETAIHRQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords DOCKING PROTEIN 1
publication title An Integrin Phosphorylation Switch: The Effect of {Beta}3 Integrin Tail Phosphorylation on Dok1 and Talin Binding.
pubmed doi rcsb
source organism Homo sapiens
total genus 25
structure length 99
sequence length 103
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2007-07-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2v76A00
1ZC4B 1J0WA 1PMSA 2DX5A 4TYZA 4HAXB 1I7AA 2IYBA 3AU5A 2X18A 2EC1A 4HB3B 4HAUB 2CAYA 4KHAA 1PLSA 5C6RA 5HE3A 4A6KA 1KZ7A 2YRYA 5LONB 4A6FB 2RVBB 1XR0B 5C16A 4HB0B 5HE0A 4KHBB 5J3QA 1QC6A 2RLOA 2VSZA 4P7IA 1KI1B 2YVCA 4DBBA 5JHHA 5J3TA 1IRSA 4HDOA 2Z0OA 5C5BA 3VIAA 2DYQA 2D2QA 3TCAA 5L81A 2ROZB 5D3WA 1M7EA 3V5WA 3U7DA 3CXBB 1NU2A 2H7DA 4DX90 1ZSQA 1GG3A 1ZM0A 4KVGB 3WA0A 3SV1A 1BWNA 3UZTA 5KQ4A 3TO1A 5C79A 1DYNA 2MKRA 4HAYB 2P0FA 3PSCA 2I5CA 3PEGA 1DDWA 2LKOA 2M14A 4HATB 4IOYX 2ELBA 2YSZA 4NSWA 2N23A 2R09A 4D0NB 2D9YA 1WJ1A 2L2IA 3PG7A 4BBKA 4TKNA 2GJYA 1B55A 2QKLA 2OTXA 4PNKA 1K5GB 2Y7BA 3NSUA 1GC6A 1FHOA 5EFXA 1LB1A 2DX1A 3O96A 1FAOA 3ODXA 1Y5OA 1ZVRA 2I5FA 1DDMA 5CLLB 2ELAA 1MPHA 4GN1A 2DA0A 3ULCA 2GCLA 2I1KA 1FHXA 1WVHA 3KY9A 4A5KA 1MKEA 1NTVA 1X11A 3AJ4A 1KZGA 5D27A 2LG1A 2NZ8B 2UZSA 4WJ7A 1U5DA 4HB4B 4EKUA 4HAWB 4EJNA 1MIZB 2W2XC 3RCPA 2DN6A 5KQ1A 1WJMA 5DHFB 1ISNA 1FGZA 3PVWA 4HDQA 3MPXA 1V88A 2CRFA 3SUZA 3F0WA 1DBHA 2D9VA 2GCJA 5GOWB 4IFSA 3PP2A 2DLWA 2J0MA 3KRWA 1FHWA 2FJLA 1BAKA 3MDBC 3WYFB 3VOQA 3TFMA 3SYXA 4CYEA 4HAVB 4F7HA 3DXEA 1SHCA 1EAZA 2VKIA 1U29A 2W2XD 2K00A 4MT7A 1AWEA 4F7UP 5FI0A 3HQCA 2MWNB 2Y8GA 1RRPB 2CY5A 3FM8C 4K17A 2L1CA 3PVUA 2P8VA 2XQNM 3D8FA 1N3HA 3KSYA 5JLJB 1WI1A 2Z0PA 3F5RA 1Y19B 2D4QA 4IAPA 4CHJA 3ZVRA 1H4RA 4L6EA 1WGQA 3A8QA 2DHJA 2LULA 4GPTB 1XX0A 3ML4A 4HB2B 1U5EA 1BTNA 2D10A 3M1IB 3IVFA 3KRXA 1RJ2A 3P7ZA 4ZRKA 1OMWA 3SO6A 1GC7A 2YT1A 1X86A 1MIXA 1NI2A 2HE7A 3A8PA 1WG7A 2EMSA 4ZRIA 4KAXB 2KUPA 5KCVA 2PZ1A 5CLQB 2J0KA 3TVVA 1XKEA 1W1DA 2UVMA 2CY4A 3T06A 5HE1A 1X05A 2COFA 2H7EA 1PFJA 3AU4A 4A6HA 2DTCA 4KHOA 3BJIA 1FOEA 1XCGA 2CODA 3G9WA 3GYOA 4MK0A 2I1JA 3DXDA 2LYDA 1P5TA 2D9ZA 4Z2NA 3FEHA 4A6FA 4PQ0A 1UEFA 5DHAB 2RSGA 3FSSA 2D9WA 1TXDA 5C5BB 2Z0QA 1U5GA 1V89A 2RGNB 4GMXB 1TQZA 2JP2A 2HTHB 4DX8A 1AQCA 1XD4A 2W2WA 2OQBA 3P6AA 2DKQA 4GXBA 4CHMA 1W1HA 3ODWA 4XWXA 4MY6A 2KGXB 3U8ZA 5JHGA 1XODA 2MFQA 1UNPA 5D3XA 1P6SA 2D9XA 3HK0A 2EMTA 1U27A 4DXAB 2DHKA 3A98B 2AL6A 2DKPA 5HE2A 4EMOA 1TJ6A 2DHIA 2UZRA 5FI1A 3ZDTA 2G35A 2DYNA 1QQGA 2N0YA 2M38A 1W1GA 1WGUA 1V5MA 1SGHA 2YS5A 4F7GA 1ZC3B 2AEHA 3BINA 4K81A 2LOZA 1U2BA 3PZDA 2YS3A 4HAZB 4YL8A 1NTYA 2RNRB 5JP4A 2P0DA 5DIFB 5DI9B 3TW1A 1EGXA 2GS0A 1I2HA 1E5WA 3CIKA 1EF1A 3ULBA 1MK9B 1V61A 4ZRJA 4WVFB 3D8EA 4B6HA 1M7RA 2P0HA 1X1GA 2COAA 3QBVB 4GMVA 2ADZA 3LJUX 1V5UA 1DROA 1J19A 2QKMA 3D8DA 4K2OA 1BTKA 5LOPB 1P3RA 1MAIA 2LOXA 1V5PA 2RUKB 2D11A 3QIJA 2KCJA 3KZ1A 1UPQA 2IFSA 2BCJA 2R0DA 2YS1A 1X1FA 5D3VA 2VRWB 4Y94A 1U5FA 3QWMA 1EVHA 3PVLA 4HHVA 5J3YA 2YF0A 2V76A 1DDVA 2ROVA 1Q67A 1OY2A 2K2JA 2DFKA 3HW2B 2MDXA 4H8SA 1UPRA 2YT0A 1Z87A 3X23A 2K2UA 5DH9B 3SNHA 3GYPA 2J0JA 1UNRA 2E2XA 2J59M 2Q13A 4Z2MB 4K2PA 1FB8A 3N7CA 1K5DB 1LW3A 2EJ8A 1UNQA 4C0AA 4WSFA 3ODOA 5D3YA 1FGYA 1H10A 2Y8FA 4YONA 2NMBA 2COCA 3DXCA 2ZPYA 1MK7B 4GZUA 3OANA 1OQNA 4NY0A
chains in the Genus database with same CATH superfamily
1ZC4B 1J0WA 1PMSA 2DX5A 4TYZA 4HAXB 1I7AA 2IYBA 3AU5A 2X18A 2EC1A 4HB3B 4HAUB 2CAYA 4KHAA 1PLSA 5C6RA 5HE3A 4A6KA 1KZ7A 2YRYA 5LONB 4A6FB 2RVBB 1XR0B 5C16A 4DIXA 4HB0B 5HE0A 4KHBB 5J3QA 1QC6A 2R2YA 2RLOA 2VSZA 4P7IA 1KI1B 2YVCA 4DBBA 5JHHA 5I2SA 5J3TA 1IRSA 4HDOA 2Z0OA 5C5BA 3VIAA 2DYQA 2D2QA 3TCAA 5L81A 2ROZB 5D3WA 1M7EA 3V5WA 3U7DA 3CXBB 1NU2A 2H7DA 3HIEA 4DX90 1ZSQA 4OSNA 1GG3A 1ZM0A 4KVGB 3WA0A 3SV1A 1BWNA 3UZTA 5KQ4A 3TO1A 5C79A 1DYNA 2MKRA 4HAYB 2P0FA 3PSCA 2I5CA 3PEGA 1DDWA 2LKOA 2M14A 4HATB 4IOYX 2ELBA 2YSZA 4NSWA 2N23A 2R09A 4D0NB 3FVCA 2D9YA 1WJ1A 2L2IA 3PG7A 4BBKA 4TKNA 2GJYA 1B55A 2QKLA 2OTXA 4PNKA 1K5GB 2Y7BA 3NSUA 1GC6A 1FHOA 5EFXA 1LB1A 2DX1A 3O96A 1FAOA 3ODXA 1Y5OA 1ZVRA 2I5FA 1DDMA 5CLLB 2ELAA 1MPHA 4GN1A 2DA0A 3ULCA 2GCLA 2I1KA 1FHXA 1WVHA 3KY9A 4A5KA 1MKEA 4KHBA 1NTVA 1X11A 3AJ4A 1KZGA 5D27A 2LG1A 2NZ8B 2UZSA 2GUMA 4WJ7A 1U5DA 4HB4B 4EKUA 4HAWB 4EJNA 1MIZB 2W2XC 3RCPA 2YT2A 4QJ5B 2DN6A 5KQ1A 1WJMA 5DHFB 1ISNA 1FGZA 3PVWA 4HDQA 3MPXA 1V88A 2CRFA 3SUZA 3F0WA 1DBHA 2D9VA 2GCJA 1MI1A 5GOWB 4IFSA 4HSIA 3PP2A 3NWDA 2DLWA 2J0MA 3KRWA 1FHWA 2FJLA 1BAKA 3MDBC 3WYFB 3VOQA 3TFMA 2Z59A 3SYXA 4CYEA 4HAVB 2RRFA 4F7HA 3DXEA 1SHCA 1EAZA 4D6WA 2VKIA 1U29A 2W2XD 2K00A 4MT7A 1AWEA 4F7UP 5FI0A 3HQCA 2KUQA 2MWNB 1RRPB 2CY5A 2Y8GA 3FM8C 5IRSA 4K17A 2L1CA 3PVUA 2P8VA 2XQNM 3D8FA 1N3HA 3KSYA 5JLJB 1WI1A 2Z13A 2Z0PA 3F5RA 1Y19B 2D4QA 4IAPA 4CHJA 3ZVRA 1H4RA 4L6EA 1WGQA 3A8QA 2DHJA 2LULA 2FJUB 4GPTB 1XX0A 2KR0A 3ML4A 4HB2B 1U5EA 1BTNA 2D10A 3M1IB 3A58A 3IVFA 3KRXA 1RJ2A 3P7ZA 4ZRKA 1OMWA 3SO6A 1GC7A 2YT1A 1X86A 1MIXA 1NI2A 2HE7A 3A8PA 1WG7A 4QXAB 2EMSA 3HSAA 4ZRIA 4KAXB 2KUPA 5KCVA 2PZ1A 3U12A 5CLQB 2J0KA 3TVVA 1XKEA 1W1DA 2UVMA 2CY4A 3T06A 5HE1A 1X05A 2COFA 2H7EA 1PFJA 3AU4A 4A6HA 2DTCA 4KHOA 3BJIA 1FOEA 1XCGA 2CODA 3G9WA 3GYOA 4MK0A 2I1JA 1T77A 3DXDA 2LYDA 1P5TA 2D9ZA 4Z2NA 3FEHA 3OHMB 4A6FA 4PQ0A 1UEFA 5DHAB 2RSGA 3FSSA 2D9WA 1TXDA 4QJ4B 5C5BB 2Z0QA 1U5GA 1V89A 2RGNB 4GMXB 2KIEA 1TQZA 2JP2A 1ZYIA 2HTHB 4DX8A 1AQCA 1XD4A 2W2WA 2OQBA 3P6AA 2DKQA 4GXBA 4CHMA 1W1HA 3ODWA 4XWXA 4MY6A 2KGXB 3U8ZA 5JHGA 1XODA 2MFQA 1UNPA 5D3XA 1P6SA 2D9XA 3HK0A 2EMTA 1U27A 4DXAB 2DHKA 3A98B 2AL6A 2DKPA 5HE2A 4EMOA 5M4YB 1TJ6A 2DHIA 2UZRA 5FI1A 3ZDTA 2G35A 2DYNA 2NBVA 1QQGA 4GNKB 2N0YA 2M38A 1W1GA 1WGUA 3NWFA 1V5MA 1SGHA 2YS5A 4F7GA 1ZC3B 2AEHA 3BINA 4K81A 2LOZA 1U2BA 3PZDA 2YS3A 4HAZB 4OT1A 4YL8A 1NTYA 2RNRB 5JP4A 2P0DA 4L1RA 5DIFB 5DI9B 3TW1A 1EGXA 2GS0A 4QJ3B 1I2HA 1E5WA 3CIKA 2KIGA 2Z4DA 1EF1A 3ULBA 1MK9B 1V61A 4ZRJA 4WVFB 3D8EA 4B6HA 1M7RA 2P0HA 1X1GA 2COAA 3QBVB 4GMVA 2ADZA 3LJUX 1V5UA 1DROA 1J19A 2QKMA 3D8DA 4K2OA 3NW8A 1BTKA 5LOPB 1P3RA 2ZKMX 1MAIA 2LOXA 1V5PA 2RUKB 2D11A 3QIJA 2KCJA 3KZ1A 1UPQA 2IFSA 5I2MA 2BCJA 2R0DA 2YS1A 1X1FA 5D3VA 2VRWB 4Y94A 1U5FA 3QWMA 2K49A 3B77A 1EVHA 3PVLA 4HHVA 5LG4B 5J3YA 2YF0A 2V76A 1DDVA 2ROVA 1Q67A 1OY2A 2K2JA 2DFKA 3HW2B 2MDXA 3NWAA 1UPRA 2YT0A 4H8SA 1Z87A 3X23A 2K2UA 5DH9B 4GOUA 3SNHA 2K8EA 3GYPA 2J0JA 1UNRA 2E2XA 2J59M 2Q13A 4Z2MB 4K2PA 1FB8A 3N7CA 1K5DB 1LW3A 2EJ8A 1UNQA 4C0AA 4WSFA 3ODOA 5D3YA 1FGYA 1H10A 2Y8FA 3DCXA 4YONA 2NMBA 2COCA 3DXCA 2ZPYA 4CSQA 1MK7B 4GZUA 3OANA 1OQNA 2Z14A 4NY0A
chains in the Genus database with same CATH topology
1ZC4B 1J0WA 1PMSA 2DX5A 4TYZA 4HAXB 1I7AA 2IYBA 3AU5A 2X18A 2EC1A 4HB3B 4HAUB 2CAYA 4KHAA 1PLSA 5C6RA 5HE3A 4A6KA 1KZ7A 2YRYA 5LONB 4A6FB 2RVBB 1XR0B 5C16A 4HB0B 5HE0A 4KHBB 5J3QA 1QC6A 2RLOA 2VSZA 4P7IA 1KI1B 2YVCA 4DBBA 5JHHA 5J3TA 1IRSA 4HDOA 2Z0OA 5C5BA 3VIAA 2DYQA 2D2QA 3TCAA 5L81A 2ROZB 5D3WA 1M7EA 3V5WA 3U7DA 3CXBB 1NU2A 2H7DA 4DX90 1ZSQA 1GG3A 1ZM0A 4KVGB 3WA0A 3SV1A 1BWNA 3UZTA 5KQ4A 3TO1A 5C79A 1DYNA 2MKRA 4HAYB 2P0FA 3PSCA 2I5CA 3PEGA 1DDWA 2LKOA 2M14A 4HATB 4IOYX 2ELBA 2YSZA 4NSWA 2N23A 2R09A 4D0NB 2D9YA 1WJ1A 2L2IA 3PG7A 4BBKA 4TKNA 2GJYA 1B55A 2QKLA 2OTXA 4PNKA 1K5GB 2Y7BA 3NSUA 1GC6A 1FHOA 5EFXA 1LB1A 2DX1A 3O96A 1FAOA 3ODXA 1Y5OA 1ZVRA 2I5FA 1DDMA 5CLLB 2ELAA 1MPHA 4GN1A 2DA0A 3ULCA 2GCLA 2I1KA 1FHXA 1WVHA 3KY9A 4A5KA 1MKEA 1NTVA 1X11A 3AJ4A 1KZGA 5D27A 2LG1A 2NZ8B 2UZSA 4WJ7A 1U5DA 4HB4B 4EKUA 4HAWB 4EJNA 1MIZB 2W2XC 3RCPA 2DN6A 5KQ1A 1WJMA 5DHFB 1ISNA 1FGZA 3PVWA 4HDQA 3MPXA 1V88A 2CRFA 3SUZA 3F0WA 1DBHA 2D9VA 2GCJA 5GOWB 4IFSA 3PP2A 2DLWA 2J0MA 3KRWA 1FHWA 2FJLA 1BAKA 3MDBC 3WYFB 3VOQA 3TFMA 3SYXA 4CYEA 4HAVB 4F7HA 3DXEA 1SHCA 1EAZA 2VKIA 1U29A 2W2XD 2K00A 4MT7A 1AWEA 4F7UP 5FI0A 3HQCA 2MWNB 2Y8GA 1RRPB 2CY5A 3FM8C 4K17A 2L1CA 3PVUA 2P8VA 2XQNM 3D8FA 1N3HA 3KSYA 5JLJB 1WI1A 2Z0PA 3F5RA 1Y19B 2D4QA 4IAPA 4CHJA 3ZVRA 1H4RA 4L6EA 1WGQA 3A8QA 2DHJA 2LULA 4GPTB 1XX0A 3ML4A 4HB2B 1U5EA 1BTNA 2D10A 3M1IB 3IVFA 3KRXA 1RJ2A 3P7ZA 4ZRKA 1OMWA 3SO6A 1GC7A 2YT1A 1X86A 1MIXA 1NI2A 2HE7A 3A8PA 1WG7A 2EMSA 4ZRIA 4KAXB 2KUPA 5KCVA 2PZ1A 5CLQB 2J0KA 3TVVA 1XKEA 1W1DA 2UVMA 2CY4A 3T06A 5HE1A 1X05A 2COFA 2H7EA 1PFJA 3AU4A 4A6HA 2DTCA 4KHOA 3BJIA 1FOEA 1XCGA 2CODA 3G9WA 3GYOA 4MK0A 2I1JA 3DXDA 2LYDA 1P5TA 2D9ZA 4Z2NA 3FEHA 4A6FA 4PQ0A 1UEFA 5DHAB 2RSGA 3FSSA 2D9WA 1TXDA 5C5BB 2Z0QA 1U5GA 1V89A 2RGNB 4GMXB 1TQZA 2JP2A 2HTHB 4DX8A 1AQCA 1XD4A 2W2WA 2OQBA 3P6AA 2DKQA 4GXBA 4CHMA 1W1HA 3ODWA 4XWXA 4MY6A 2KGXB 3U8ZA 5JHGA 1XODA 2MFQA 1UNPA 5D3XA 1P6SA 2D9XA 3HK0A 2EMTA 1U27A 4DXAB 2DHKA 3A98B 2AL6A 2DKPA 5HE2A 4EMOA 1TJ6A 2DHIA 2UZRA 5FI1A 3ZDTA 2G35A 2DYNA 1QQGA 2N0YA 2M38A 1W1GA 1WGUA 1V5MA 1SGHA 2YS5A 4F7GA 1ZC3B 2AEHA 3BINA 4K81A 2LOZA 1U2BA 3PZDA 2YS3A 4HAZB 4YL8A 1NTYA 2RNRB 5JP4A 2P0DA 5DIFB 5DI9B 3TW1A 1EGXA 2GS0A 1I2HA 1E5WA 3CIKA 1EF1A 3ULBA 1MK9B 1V61A 4ZRJA 4WVFB 3D8EA 4B6HA 1M7RA 2P0HA 1X1GA 2COAA 3QBVB 4GMVA 2ADZA 3LJUX 1V5UA 1DROA 1J19A 2QKMA 3D8DA 4K2OA 1BTKA 5LOPB 1P3RA 1MAIA 2LOXA 1V5PA 2RUKB 2D11A 3QIJA 2KCJA 3KZ1A 1UPQA 2IFSA 2BCJA 2R0DA 2YS1A 1X1FA 5D3VA 2VRWB 4Y94A 1U5FA 3QWMA 1EVHA 3PVLA 4HHVA 5J3YA 2YF0A 2V76A 1DDVA 2ROVA 1Q67A 1OY2A 2K2JA 2DFKA 3HW2B 2MDXA 4H8SA 1UPRA 2YT0A 1Z87A 3X23A 2K2UA 5DH9B 3SNHA 3GYPA 2J0JA 1UNRA 2E2XA 2J59M 2Q13A 4Z2MB 4K2PA 1FB8A 3N7CA 1K5DB 1LW3A 2EJ8A 1UNQA 4C0AA 4WSFA 3ODOA 5D3YA 1FGYA 1H10A 2Y8FA 4YONA 2NMBA 2COCA 3DXCA 2ZPYA 1MK7B 4GZUA 3OANA 1OQNA 4NY0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZC4 B;  1J0W A;  1PMS A;  2DX5 A;  4TYZ A;  4HAX B;  1I7A A;  2IYB A;  3AU5 A;  2X18 A;  2EC1 A;  4HB3 B;  4HAU B;  2CAY A;  4KHA A;  1PLS A;  5C6R A;  5HE3 A;  4A6K A;  1KZ7 A;  2YRY A;  5LON B;  4A6F B;  2RVB B;  1XR0 B;  5C16 A;  4HB0 B;  5HE0 A;  4KHB B;  5J3Q A;  1QC6 A;  2RLO A;  2VSZ A;  4P7I A;  1KI1 B;  2YVC A;  4DBB A;  5JHH A;  5J3T A;  1IRS A;  4HDO A;  2Z0O A;  5C5B A;  3VIA A;  2DYQ A;  2D2Q A;  3TCA A;  5L81 A;  2ROZ B;  5D3W A;  1M7E A;  3V5W A;  3U7D A;  3CXB B;  1NU2 A;  2H7D A;  4DX9 0;  1ZSQ A;  1GG3 A;  1ZM0 A;  4KVG B;  3WA0 A;  3SV1 A;  1BWN A;  3UZT A;  5KQ4 A;  3TO1 A;  5C79 A;  1DYN A;  2MKR A;  4HAY B;  2P0F A;  3PSC A;  2I5C A;  3PEG A;  1DDW A;  2LKO A;  2M14 A;  4HAT B;  4IOY X;  2ELB A;  2YSZ A;  4NSW A;  2N23 A;  2R09 A;  4D0N B;  2D9Y A;  1WJ1 A;  2L2I A;  3PG7 A;  4BBK A;  4TKN A;  2GJY A;  1B55 A;  2QKL A;  2OTX A;  4PNK A;  1K5G B;  2Y7B A;  3NSU A;  1GC6 A;  1FHO A;  5EFX A;  1LB1 A;  2DX1 A;  3O96 A;  1FAO A;  3ODX A;  1Y5O A;  1ZVR A;  2I5F A;  1DDM A;  5CLL B;  2ELA A;  1MPH A;  4GN1 A;  2DA0 A;  3ULC A;  2GCL A;  2I1K A;  1FHX A;  1WVH A;  3KY9 A;  4A5K A;  1MKE A;  1NTV A;  1X11 A;  3AJ4 A;  1KZG A;  5D27 A;  2LG1 A;  2NZ8 B;  2UZS A;  4WJ7 A;  1U5D A;  4HB4 B;  4EKU A;  4HAW B;  4EJN A;  1MIZ B;  2W2X C;  3RCP A;  2DN6 A;  5KQ1 A;  1WJM A;  5DHF B;  1ISN A;  1FGZ A;  3PVW A;  4HDQ A;  3MPX A;  1V88 A;  2CRF A;  3SUZ A;  3F0W A;  1DBH A;  2D9V A;  2GCJ A;  5GOW B;  4IFS A;  3PP2 A;  2DLW A;  2J0M A;  3KRW A;  1FHW A;  2FJL A;  1BAK A;  3MDB C;  3WYF B;  3VOQ A;  3TFM A;  3SYX A;  4CYE A;  4HAV B;  4F7H A;  3DXE A;  1SHC A;  1EAZ A;  2VKI A;  1U29 A;  2W2X D;  2K00 A;  4MT7 A;  1AWE A;  4F7U P;  5FI0 A;  3HQC A;  2MWN B;  2Y8G A;  1RRP B;  2CY5 A;  3FM8 C;  4K17 A;  2L1C A;  3PVU A;  2P8V A;  2XQN M;  3D8F A;  1N3H A;  3KSY A;  5JLJ B;  1WI1 A;  2Z0P A;  3F5R A;  1Y19 B;  2D4Q A;  4IAP A;  4CHJ A;  3ZVR A;  1H4R A;  4L6E A;  1WGQ A;  3A8Q A;  2DHJ A;  2LUL A;  4GPT B;  1XX0 A;  3ML4 A;  4HB2 B;  1U5E A;  1BTN A;  2D10 A;  3M1I B;  3IVF A;  3KRX A;  1RJ2 A;  3P7Z A;  4ZRK A;  1OMW A;  3SO6 A;  1GC7 A;  2YT1 A;  1X86 A;  1MIX A;  1NI2 A;  2HE7 A;  3A8P A;  1WG7 A;  2EMS A;  4ZRI A;  4KAX B;  2KUP A;  5KCV A;  2PZ1 A;  5CLQ B;  2J0K A;  3TVV A;  1XKE A;  1W1D A;  2UVM A;  2CY4 A;  3T06 A;  5HE1 A;  1X05 A;  2COF A;  2H7E A;  1PFJ A;  3AU4 A;  4A6H A;  2DTC A;  4KHO A;  3BJI A;  1FOE A;  1XCG A;  2COD A;  3G9W A;  3GYO A;  4MK0 A;  2I1J A;  3DXD A;  2LYD A;  1P5T A;  2D9Z A;  4Z2N A;  3FEH A;  4A6F A;  4PQ0 A;  1UEF A;  5DHA B;  2RSG A;  3FSS A;  2D9W A;  1TXD A;  5C5B B;  2Z0Q A;  1U5G A;  1V89 A;  2RGN B;  4GMX B;  1TQZ A;  2JP2 A;  2HTH B;  4DX8 A;  1AQC A;  1XD4 A;  2W2W A;  2OQB A;  3P6A A;  2DKQ A;  4GXB A;  4CHM A;  1W1H A;  3ODW A;  4XWX A;  4MY6 A;  2KGX B;  3U8Z A;  5JHG A;  1XOD A;  2MFQ A;  1UNP A;  5D3X A;  1P6S A;  2D9X A;  3HK0 A;  2EMT A;  1U27 A;  4DXA B;  2DHK A;  3A98 B;  2AL6 A;  2DKP A;  5HE2 A;  4EMO A;  1TJ6 A;  2DHI A;  2UZR A;  5FI1 A;  3ZDT A;  2G35 A;  2DYN A;  1QQG A;  2N0Y A;  2M38 A;  1W1G A;  1WGU A;  1V5M A;  1SGH A;  2YS5 A;  4F7G A;  1ZC3 B;  2AEH A;  3BIN A;  4K81 A;  2LOZ A;  1U2B A;  3PZD A;  2YS3 A;  4HAZ B;  4YL8 A;  1NTY A;  2RNR B;  5JP4 A;  2P0D A;  5DIF B;  5DI9 B;  3TW1 A;  1EGX A;  2GS0 A;  1I2H A;  1E5W A;  3CIK A;  1EF1 A;  3ULB A;  1MK9 B;  1V61 A;  4ZRJ A;  4WVF B;  3D8E A;  4B6H A;  1M7R A;  2P0H A;  1X1G A;  2COA A;  3QBV B;  4GMV A;  2ADZ A;  3LJU X;  1V5U A;  1DRO A;  1J19 A;  2QKM A;  3D8D A;  4K2O A;  1BTK A;  5LOP B;  1P3R A;  1MAI A;  2LOX A;  1V5P A;  2RUK B;  2D11 A;  3QIJ A;  2KCJ A;  3KZ1 A;  1UPQ A;  2IFS A;  2BCJ A;  2R0D A;  2YS1 A;  1X1F A;  5D3V A;  2VRW B;  4Y94 A;  1U5F A;  3QWM A;  1EVH A;  3PVL A;  4HHV A;  5J3Y A;  2YF0 A;  2V76 A;  1DDV A;  2ROV A;  1Q67 A;  1OY2 A;  2K2J A;  2DFK A;  3HW2 B;  2MDX A;  4H8S A;  1UPR A;  2YT0 A;  1Z87 A;  3X23 A;  2K2U A;  5DH9 B;  3SNH A;  3GYP A;  2J0J A;  1UNR A;  2E2X A;  2J59 M;  2Q13 A;  4Z2M B;  4K2P A;  1FB8 A;  3N7C A;  1K5D B;  1LW3 A;  2EJ8 A;  1UNQ A;  4C0A A;  4WSF A;  3ODO A;  5D3Y A;  1FGY A;  1H10 A;  2Y8F A;  4YON A;  2NMB A;  2COC A;  3DXC A;  2ZPY A;  1MK7 B;  4GZU A;  3OAN A;  1OQN A;  4NY0 A; 
#chains in the Genus database with same CATH topology
 1ZC4 B;  1J0W A;  1PMS A;  2DX5 A;  4TYZ A;  4HAX B;  1I7A A;  2IYB A;  3AU5 A;  2X18 A;  2EC1 A;  4HB3 B;  4HAU B;  2CAY A;  4KHA A;  1PLS A;  5C6R A;  5HE3 A;  4A6K A;  1KZ7 A;  2YRY A;  5LON B;  4A6F B;  2RVB B;  1XR0 B;  5C16 A;  4DIX A;  4HB0 B;  5HE0 A;  4KHB B;  5J3Q A;  1QC6 A;  2R2Y A;  2RLO A;  2VSZ A;  4P7I A;  1KI1 B;  2YVC A;  4DBB A;  5JHH A;  5I2S A;  5J3T A;  1IRS A;  4HDO A;  2Z0O A;  5C5B A;  3VIA A;  2DYQ A;  2D2Q A;  3TCA A;  5L81 A;  2ROZ B;  5D3W A;  1M7E A;  3V5W A;  3U7D A;  3CXB B;  1NU2 A;  2H7D A;  3HIE A;  4DX9 0;  1ZSQ A;  4OSN A;  1GG3 A;  1ZM0 A;  4KVG B;  3WA0 A;  3SV1 A;  1BWN A;  3UZT A;  5KQ4 A;  3TO1 A;  5C79 A;  1DYN A;  2MKR A;  4HAY B;  2P0F A;  3PSC A;  2I5C A;  3PEG A;  1DDW A;  2LKO A;  2M14 A;  4HAT B;  4IOY X;  2ELB A;  2YSZ A;  4NSW A;  2N23 A;  2R09 A;  4D0N B;  3FVC A;  2D9Y A;  1WJ1 A;  2L2I A;  3PG7 A;  4BBK A;  4TKN A;  2GJY A;  1B55 A;  2QKL A;  2OTX A;  4PNK A;  1K5G B;  2Y7B A;  3NSU A;  1GC6 A;  1FHO A;  5EFX A;  1LB1 A;  2DX1 A;  3O96 A;  1FAO A;  3ODX A;  1Y5O A;  1ZVR A;  2I5F A;  1DDM A;  5CLL B;  2ELA A;  1MPH A;  4GN1 A;  2DA0 A;  3ULC A;  2GCL A;  2I1K A;  1FHX A;  1WVH A;  3KY9 A;  4A5K A;  1MKE A;  4KHB A;  1NTV A;  1X11 A;  3AJ4 A;  1KZG A;  5D27 A;  2LG1 A;  2NZ8 B;  2UZS A;  2GUM A;  4WJ7 A;  1U5D A;  4HB4 B;  4EKU A;  4HAW B;  4EJN A;  1MIZ B;  2W2X C;  3RCP A;  2YT2 A;  4QJ5 B;  2DN6 A;  5KQ1 A;  1WJM A;  5DHF B;  1ISN A;  1FGZ A;  3PVW A;  4HDQ A;  3MPX A;  1V88 A;  2CRF A;  3SUZ A;  3F0W A;  1DBH A;  2D9V A;  2GCJ A;  1MI1 A;  5GOW B;  4IFS A;  4HSI A;  3PP2 A;  3NWD A;  2DLW A;  2J0M A;  3KRW A;  1FHW A;  2FJL A;  1BAK A;  3MDB C;  3WYF B;  3VOQ A;  3TFM A;  2Z59 A;  3SYX A;  4CYE A;  4HAV B;  2RRF A;  4F7H A;  3DXE A;  1SHC A;  1EAZ A;  4D6W A;  2VKI A;  1U29 A;  2W2X D;  2K00 A;  4MT7 A;  1AWE A;  4F7U P;  5FI0 A;  3HQC A;  2KUQ A;  2MWN B;  1RRP B;  2CY5 A;  2Y8G A;  3FM8 C;  5IRS A;  4K17 A;  2L1C A;  3PVU A;  2P8V A;  2XQN M;  3D8F A;  1N3H A;  3KSY A;  5JLJ B;  1WI1 A;  2Z13 A;  2Z0P A;  3F5R A;  1Y19 B;  2D4Q A;  4IAP A;  4CHJ A;  3ZVR A;  1H4R A;  4L6E A;  1WGQ A;  3A8Q A;  2DHJ A;  2LUL A;  2FJU B;  4GPT B;  1XX0 A;  2KR0 A;  3ML4 A;  4HB2 B;  1U5E A;  1BTN A;  2D10 A;  3M1I B;  3A58 A;  3IVF A;  3KRX A;  1RJ2 A;  3P7Z A;  4ZRK A;  1OMW A;  3SO6 A;  1GC7 A;  2YT1 A;  1X86 A;  1MIX A;  1NI2 A;  2HE7 A;  3A8P A;  1WG7 A;  4QXA B;  2EMS A;  3HSA A;  4ZRI A;  4KAX B;  2KUP A;  5KCV A;  2PZ1 A;  3U12 A;  5CLQ B;  2J0K A;  3TVV A;  1XKE A;  1W1D A;  2UVM A;  2CY4 A;  3T06 A;  5HE1 A;  1X05 A;  2COF A;  2H7E A;  1PFJ A;  3AU4 A;  4A6H A;  2DTC A;  4KHO A;  3BJI A;  1FOE A;  1XCG A;  2COD A;  3G9W A;  3GYO A;  4MK0 A;  2I1J A;  1T77 A;  3DXD A;  2LYD A;  1P5T A;  2D9Z A;  4Z2N A;  3FEH A;  3OHM B;  4A6F A;  4PQ0 A;  1UEF A;  5DHA B;  2RSG A;  3FSS A;  2D9W A;  1TXD A;  4QJ4 B;  5C5B B;  2Z0Q A;  1U5G A;  1V89 A;  2RGN B;  4GMX B;  2KIE A;  1TQZ A;  2JP2 A;  1ZYI A;  2HTH B;  4DX8 A;  1AQC A;  1XD4 A;  2W2W A;  2OQB A;  3P6A A;  2DKQ A;  4GXB A;  4CHM A;  1W1H A;  3ODW A;  4XWX A;  4MY6 A;  2KGX B;  3U8Z A;  5JHG A;  1XOD A;  2MFQ A;  1UNP A;  5D3X A;  1P6S A;  2D9X A;  3HK0 A;  2EMT A;  1U27 A;  4DXA B;  2DHK A;  3A98 B;  2AL6 A;  2DKP A;  5HE2 A;  4EMO A;  5M4Y B;  1TJ6 A;  2DHI A;  2UZR A;  5FI1 A;  3ZDT A;  2G35 A;  2DYN A;  2NBV A;  1QQG A;  4GNK B;  2N0Y A;  2M38 A;  1W1G A;  1WGU A;  3NWF A;  1V5M A;  1SGH A;  2YS5 A;  4F7G A;  1ZC3 B;  2AEH A;  3BIN A;  4K81 A;  2LOZ A;  1U2B A;  3PZD A;  2YS3 A;  4HAZ B;  4OT1 A;  4YL8 A;  1NTY A;  2RNR B;  5JP4 A;  2P0D A;  4L1R A;  5DIF B;  5DI9 B;  3TW1 A;  1EGX A;  2GS0 A;  4QJ3 B;  1I2H A;  1E5W A;  3CIK A;  2KIG A;  2Z4D A;  1EF1 A;  3ULB A;  1MK9 B;  1V61 A;  4ZRJ A;  4WVF B;  3D8E A;  4B6H A;  1M7R A;  2P0H A;  1X1G A;  2COA A;  3QBV B;  4GMV A;  2ADZ A;  3LJU X;  1V5U A;  1DRO A;  1J19 A;  2QKM A;  3D8D A;  4K2O A;  3NW8 A;  1BTK A;  5LOP B;  1P3R A;  2ZKM X;  1MAI A;  2LOX A;  1V5P A;  2RUK B;  2D11 A;  3QIJ A;  2KCJ A;  3KZ1 A;  1UPQ A;  2IFS A;  5I2M A;  2BCJ A;  2R0D A;  2YS1 A;  1X1F A;  5D3V A;  2VRW B;  4Y94 A;  1U5F A;  3QWM A;  2K49 A;  3B77 A;  1EVH A;  3PVL A;  4HHV A;  5LG4 B;  5J3Y A;  2YF0 A;  2V76 A;  1DDV A;  2ROV A;  1Q67 A;  1OY2 A;  2K2J A;  2DFK A;  3HW2 B;  2MDX A;  3NWA A;  1UPR A;  2YT0 A;  4H8S A;  1Z87 A;  3X23 A;  2K2U A;  5DH9 B;  4GOU A;  3SNH A;  2K8E A;  3GYP A;  2J0J A;  1UNR A;  2E2X A;  2J59 M;  2Q13 A;  4Z2M B;  4K2P A;  1FB8 A;  3N7C A;  1K5D B;  1LW3 A;  2EJ8 A;  1UNQ A;  4C0A A;  4WSF A;  3ODO A;  5D3Y A;  1FGY A;  1H10 A;  2Y8F A;  3DCX A;  4YON A;  2NMB A;  2COC A;  3DXC A;  2ZPY A;  4CSQ A;  1MK7 B;  4GZU A;  3OAN A;  1OQN A;  2Z14 A;  4NY0 A; 
#chains in the Genus database with same CATH homology
 1ZC4 B;  1J0W A;  1PMS A;  2DX5 A;  4TYZ A;  4HAX B;  1I7A A;  2IYB A;  3AU5 A;  2X18 A;  2EC1 A;  4HB3 B;  4HAU B;  2CAY A;  4KHA A;  1PLS A;  5C6R A;  5HE3 A;  4A6K A;  1KZ7 A;  2YRY A;  5LON B;  4A6F B;  2RVB B;  1XR0 B;  5C16 A;  4HB0 B;  5HE0 A;  4KHB B;  5J3Q A;  1QC6 A;  2RLO A;  2VSZ A;  4P7I A;  1KI1 B;  2YVC A;  4DBB A;  5JHH A;  5J3T A;  1IRS A;  4HDO A;  2Z0O A;  5C5B A;  3VIA A;  2DYQ A;  2D2Q A;  3TCA A;  5L81 A;  2ROZ B;  5D3W A;  1M7E A;  3V5W A;  3U7D A;  3CXB B;  1NU2 A;  2H7D A;  4DX9 0;  1ZSQ A;  1GG3 A;  1ZM0 A;  4KVG B;  3WA0 A;  3SV1 A;  1BWN A;  3UZT A;  5KQ4 A;  3TO1 A;  5C79 A;  1DYN A;  2MKR A;  4HAY B;  2P0F A;  3PSC A;  2I5C A;  3PEG A;  1DDW A;  2LKO A;  2M14 A;  4HAT B;  4IOY X;  2ELB A;  2YSZ A;  4NSW A;  2N23 A;  2R09 A;  4D0N B;  2D9Y A;  1WJ1 A;  2L2I A;  3PG7 A;  4BBK A;  4TKN A;  2GJY A;  1B55 A;  2QKL A;  2OTX A;  4PNK A;  1K5G B;  2Y7B A;  3NSU A;  1GC6 A;  1FHO A;  5EFX A;  1LB1 A;  2DX1 A;  3O96 A;  1FAO A;  3ODX A;  1Y5O A;  1ZVR A;  2I5F A;  1DDM A;  5CLL B;  2ELA A;  1MPH A;  4GN1 A;  2DA0 A;  3ULC A;  2GCL A;  2I1K A;  1FHX A;  1WVH A;  3KY9 A;  4A5K A;  1MKE A;  1NTV A;  1X11 A;  3AJ4 A;  1KZG A;  5D27 A;  2LG1 A;  2NZ8 B;  2UZS A;  4WJ7 A;  1U5D A;  4HB4 B;  4EKU A;  4HAW B;  4EJN A;  1MIZ B;  2W2X C;  3RCP A;  2DN6 A;  5KQ1 A;  1WJM A;  5DHF B;  1ISN A;  1FGZ A;  3PVW A;  4HDQ A;  3MPX A;  1V88 A;  2CRF A;  3SUZ A;  3F0W A;  1DBH A;  2D9V A;  2GCJ A;  5GOW B;  4IFS A;  3PP2 A;  2DLW A;  2J0M A;  3KRW A;  1FHW A;  2FJL A;  1BAK A;  3MDB C;  3WYF B;  3VOQ A;  3TFM A;  3SYX A;  4CYE A;  4HAV B;  4F7H A;  3DXE A;  1SHC A;  1EAZ A;  2VKI A;  1U29 A;  2W2X D;  2K00 A;  4MT7 A;  1AWE A;  4F7U P;  5FI0 A;  3HQC A;  2MWN B;  2Y8G A;  1RRP B;  2CY5 A;  3FM8 C;  4K17 A;  2L1C A;  3PVU A;  2P8V A;  2XQN M;  3D8F A;  1N3H A;  3KSY A;  5JLJ B;  1WI1 A;  2Z0P A;  3F5R A;  1Y19 B;  2D4Q A;  4IAP A;  4CHJ A;  3ZVR A;  1H4R A;  4L6E A;  1WGQ A;  3A8Q A;  2DHJ A;  2LUL A;  4GPT B;  1XX0 A;  3ML4 A;  4HB2 B;  1U5E A;  1BTN A;  2D10 A;  3M1I B;  3IVF A;  3KRX A;  1RJ2 A;  3P7Z A;  4ZRK A;  1OMW A;  3SO6 A;  1GC7 A;  2YT1 A;  1X86 A;  1MIX A;  1NI2 A;  2HE7 A;  3A8P A;  1WG7 A;  2EMS A;  4ZRI A;  4KAX B;  2KUP A;  5KCV A;  2PZ1 A;  5CLQ B;  2J0K A;  3TVV A;  1XKE A;  1W1D A;  2UVM A;  2CY4 A;  3T06 A;  5HE1 A;  1X05 A;  2COF A;  2H7E A;  1PFJ A;  3AU4 A;  4A6H A;  2DTC A;  4KHO A;  3BJI A;  1FOE A;  1XCG A;  2COD A;  3G9W A;  3GYO A;  4MK0 A;  2I1J A;  3DXD A;  2LYD A;  1P5T A;  2D9Z A;  4Z2N A;  3FEH A;  4A6F A;  4PQ0 A;  1UEF A;  5DHA B;  2RSG A;  3FSS A;  2D9W A;  1TXD A;  5C5B B;  2Z0Q A;  1U5G A;  1V89 A;  2RGN B;  4GMX B;  1TQZ A;  2JP2 A;  2HTH B;  4DX8 A;  1AQC A;  1XD4 A;  2W2W A;  2OQB A;  3P6A A;  2DKQ A;  4GXB A;  4CHM A;  1W1H A;  3ODW A;  4XWX A;  4MY6 A;  2KGX B;  3U8Z A;  5JHG A;  1XOD A;  2MFQ A;  1UNP A;  5D3X A;  1P6S A;  2D9X A;  3HK0 A;  2EMT A;  1U27 A;  4DXA B;  2DHK A;  3A98 B;  2AL6 A;  2DKP A;  5HE2 A;  4EMO A;  1TJ6 A;  2DHI A;  2UZR A;  5FI1 A;  3ZDT A;  2G35 A;  2DYN A;  1QQG A;  2N0Y A;  2M38 A;  1W1G A;  1WGU A;  1V5M A;  1SGH A;  2YS5 A;  4F7G A;  1ZC3 B;  2AEH A;  3BIN A;  4K81 A;  2LOZ A;  1U2B A;  3PZD A;  2YS3 A;  4HAZ B;  4YL8 A;  1NTY A;  2RNR B;  5JP4 A;  2P0D A;  5DIF B;  5DI9 B;  3TW1 A;  1EGX A;  2GS0 A;  1I2H A;  1E5W A;  3CIK A;  1EF1 A;  3ULB A;  1MK9 B;  1V61 A;  4ZRJ A;  4WVF B;  3D8E A;  4B6H A;  1M7R A;  2P0H A;  1X1G A;  2COA A;  3QBV B;  4GMV A;  2ADZ A;  3LJU X;  1V5U A;  1DRO A;  1J19 A;  2QKM A;  3D8D A;  4K2O A;  1BTK A;  5LOP B;  1P3R A;  1MAI A;  2LOX A;  1V5P A;  2RUK B;  2D11 A;  3QIJ A;  2KCJ A;  3KZ1 A;  1UPQ A;  2IFS A;  2BCJ A;  2R0D A;  2YS1 A;  1X1F A;  5D3V A;  2VRW B;  4Y94 A;  1U5F A;  3QWM A;  1EVH A;  3PVL A;  4HHV A;  5J3Y A;  2YF0 A;  2V76 A;  1DDV A;  2ROV A;  1Q67 A;  1OY2 A;  2K2J A;  2DFK A;  3HW2 B;  2MDX A;  4H8S A;  1UPR A;  2YT0 A;  1Z87 A;  3X23 A;  2K2U A;  5DH9 B;  3SNH A;  3GYP A;  2J0J A;  1UNR A;  2E2X A;  2J59 M;  2Q13 A;  4Z2M B;  4K2P A;  1FB8 A;  3N7C A;  1K5D B;  1LW3 A;  2EJ8 A;  1UNQ A;  4C0A A;  4WSF A;  3ODO A;  5D3Y A;  1FGY A;  1H10 A;  2Y8F A;  4YON A;  2NMB A;  2COC A;  3DXC A;  2ZPY A;  1MK7 B;  4GZU A;  3OAN A;  1OQN A;  4NY0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...