2V76A

Crystal structure of the human dok1 ptb domain
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
103
structure length
99
Chain Sequence
PLGSQFWVTVQRTEAAERCGLHGSYVLRVEAERLTLLTVGILEPLLSWPYTLLRRYGRDKVMFSFEAGRRCPSGPGTFTFQTAQGNDIFQAVETAIHRQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title An Integrin Phosphorylation Switch: The Effect of {Beta}3 Integrin Tail Phosphorylation on Dok1 and Talin Binding.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
molecule keywords DOCKING PROTEIN 1
total genus 25
structure length 99
sequence length 103
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2007-07-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2v76A00
1XCGA 4DX90 1MK7B 2NMBA 3ZDTA 1Y19B 2LULA 3FM8C 1GG3A 2P0FA 1EVHA 3QWMA 3PVUA 4YONA 4GMVA 3TW1A 3ZVRA 1V5MA 4WJ7A 1DDWA 3DXDA 1E5WA 2Y8FA 2H7DA 2K2UA 3BJIA 3VIAA 4DX8A 1U5EA 1WJ1A 3PEGA 5DHAB 4HATB 2RGNB 2DHJA 5C6RA 1P5TA 1J0WA 3O96A 1IRSA 4Z2MB 3AU4A 5L81A 2MDXA 3D8EA 5HE1A 4HB3B 4PNKA 2Z0QA 5DI9B 3MPXA 1J19A 2ELAA 1U5GA 2CRFA 5JLJB 2R09A 3T06A 4GXBA 3ULBA 3KRWA 4HHVA 2YVCA 1XD4A 2YT0A 1EF1A 1X05A 2RUKB 2VSZA 3BINA 1W1HA 2I5FA 5KCVA 1V89A 2YS3A 1U5DA 1OY2A 4A6FA 4NSWA 2ROZB 2LKOA 1NTVA 2N23A 3IVFA 2GJYA 4A6FB 4HAXB 2L2IA 4A5KA 4HDQA 2KUPA 4K17A 4DBBA 4DXAB 2IYBA 3N7CA 2ADZA 2CODA 1ZC3B 1QC6A 2LOZA 4H8SA 4MT7A 2DKQA 1NI2A 2RNRB 3V5WA 4K2PA 5LONB 5HE0A 2D9XA 3HK0A 3ULCA 2DHIA 3QIJA 1FHXA 3GYOA 4HB4B 3MDBC 5DHFB 5D3WA 4EJNA 2W2XC 1GC6A 1MIZB 2COCA 4IAPA 1XKEA 1ZVRA 5EFXA 1PMSA 3CXBB 1QQGA 1N3HA 1W1GA 3WYFB 3HQCA 3PVLA 2LG1A 1GC7A 2YSZA 2MFQA 3KRXA 1PFJA 1LW3A 1I2HA 3KY9A 4F7GA 1Q67A 2KCJA 2D4QA 4Y94A 3F5RA 2Z0PA 2OTXA 3A98B 1SHCA 1FB8A 4NY0A 2HE7A 3TVVA 1U29A 3D8FA 1W1DA 1UNQA 2HTHB 3M1IB 4F7HA 4IFSA 3ML4A 1X1FA 3F0WA 2JP2A 4HAZB 3ODXA 1B55A 5JHHA 4C0AA 2RLOA 1WJMA 2K2JA 2UZRA 4TYZA 3TCAA 2UZSA 1WG7A 1TQZA 2EJ8A 1UNRA 3GYPA 4KHBB 2VRWB 2IFSA 2E2XA 2I5CA 5J3QA 1ZC4B 2Y8GA 4D0NB 1X1GA 3HW2B 1DROA 4GPTB 2DKPA 5C5BA 4A6KA 2J0KA 5CLLB 1MPHA 2D2QA 2DN6A 3SYXA 1X86A 3OANA 1TJ6A 2EMSA 2I1JA 2YF0A 3FSSA 4CHMA 2M14A 1WI1A 1RJ2A 3DXEA 1ZSQA 2GS0A 5C79A 3PSCA 1FGYA 2LYDA 1H10A 1Y5OA 1BAKA 5HE3A 2CY5A 5HE2A 2P0DA 2J59M 2H7EA 4F7UP 1KZGA 5CLQB 2OQBA 5DH9B 2D10A 2DLWA 4KVGB 1DDVA 5D27A 1WVHA 1WGUA 1XODA 4WVFB 2DX5A 1MKEA 3TFMA 5C16A 3KZ1A 2QKLA 4K81A 4P7IA 1Z87A 1MK9B 2W2XD 2J0MA 3AJ4A 2YS1A 1FHOA 2YT1A 4TKNA 4GN1A 4GMXB 2L1CA 4MY6A 4A6HA 3U7DA 2DYQA 3X23A 4HB0B 1ISNA 2ELBA 2J0JA 2EMTA 1V5UA 3VOQA 3CIKA 2P0HA 1V5PA 3QBVB 2MWNB 4ZRKA 2COFA 2VKIA 1LB1A 5D3YA 2DA0A 3U8ZA 2X18A 5JHGA 3P7ZA 4HB2B 2AL6A 5C5BB 2LOXA 2DX1A 3ODWA 1V88A 2KGXB 3SV1A 1AWEA 2D9WA 3WA0A 3A8PA 2EC1A 3PG7A 5LOPB 4B6HA 4CYEA 2CY4A 3PP2A 1UPRA 1DYNA 1BTKA 2FJLA 2K00A 1U27A 2CAYA 5D3VA 2Z0OA 1ZM0A 1I7AA 1UEFA 2AEHA 3SO6A 2XQNM 4PQ0A 2D9ZA 5J3YA 3P6AA 3A8QA 4Z2NA 3PVWA 4HAYB 4EKUA 1NU2A 2ZPYA 1FAOA 4KAXB 2COAA 4GZUA 1V61A 1OMWA 1BWNA 1WGQA 3ODOA 4L6EA 2D11A 2P8VA 1M7EA 4WSFA 4HDOA 1K5DB 5D3XA 2M38A 1P3RA 5KQ1A 1K5GB 1XR0B 4EMOA 1NTYA 2W2WA 1UPQA 2PZ1A 2Y7BA 2D9VA 1FOEA 2ROVA 4K2OA 4KHOA 2BCJA 1RRPB 1EGXA 1KI1B 2YS5A 2R0DA 1PLSA 1XX0A 3NSUA 2Q13A 1TXDA 4IOYX 4YL8A 5FI0A 1EAZA 1U2BA 2D9YA 2NZ8B 4ZRIA 1U5FA 2GCJA 3RCPA 2GCLA 1UNPA 4HAWB 2DYNA 5FI1A 5KQ4A 1DBHA 1OQNA 1X11A 1KZ7A 1MIXA 2DHKA 4XWXA 5GOWB 1BTNA 5JP4A 2QKMA 1H4RA 2UVMA 3TO1A 3FEHA 4KHAA 1FGZA 2MKRA 3DXCA 1SGHA 4HAVB 2YRYA 2G35A 1P6SA 3UZTA 1AQCA 4BBKA 2I1KA 3D8DA 4ZRJA 1DDMA 2RVBB 4HAUB 5J3TA 3KSYA 3PZDA 1M7RA 3G9WA 2N0YA 4MK0A 2DFKA 4CHJA 2RSGA 3SUZA 3SNHA 5DIFB 2DTCA 3AU5A 1MAIA 3LJUX 2V76A 1FHWA
chains in the Genus database with same CATH superfamily
1XCGA 4DX90 1MK7B 2NMBA 3HSAA 3ZDTA 1Y19B 2LULA 3FM8C 1GG3A 2P0FA 1EVHA 3QWMA 3PVUA 4YONA 4GMVA 3TW1A 3ZVRA 1V5MA 4WJ7A 1DDWA 3DXDA 1E5WA 2Y8FA 2H7DA 2K2UA 3BJIA 3VIAA 4DX8A 1U5EA 1WJ1A 3PEGA 5DHAB 4HATB 2RGNB 3NWFA 2DHJA 5C6RA 1P5TA 1J0WA 3O96A 1IRSA 4Z2MB 3AU4A 4L1RA 5L81A 2MDXA 3D8EA 5HE1A 4HB3B 4PNKA 2Z0QA 5DI9B 3MPXA 1J19A 5I2MA 2ELAA 1U5GA 2CRFA 5JLJB 2R09A 3T06A 4GXBA 3ULBA 3KRWA 4HHVA 2YT2A 2YVCA 1XD4A 2YT0A 1EF1A 1X05A 2RUKB 2VSZA 3BINA 1W1HA 2I5FA 5KCVA 1V89A 2YS3A 1U5DA 2FJUB 3B77A 1OY2A 4A6FA 4NSWA 2ROZB 2LKOA 1NTVA 2N23A 3IVFA 2GJYA 4A6FB 4D6WA 4HAXB 2KIEA 2L2IA 4A5KA 4HDQA 2KUPA 4K17A 4DBBA 4DXAB 2IYBA 3N7CA 2ADZA 2CODA 1ZC3B 1QC6A 2LOZA 4H8SA 4MT7A 2DKQA 1NI2A 2RNRB 3V5WA 4K2PA 5LONB 5HE0A 4DIXA 2D9XA 3HK0A 3ULCA 2K49A 2DHIA 3QIJA 1FHXA 3GYOA 4HB4B 3MDBC 5DHFB 5D3WA 4OSNA 4EJNA 2W2XC 1GC6A 3DCXA 1MIZB 2COCA 4IAPA 1XKEA 1ZVRA 5EFXA 1PMSA 3CXBB 1QQGA 1N3HA 1W1GA 3WYFB 3HQCA 3PVLA 2LG1A 1GC7A 2YSZA 2MFQA 3KRXA 1PFJA 1LW3A 1I2HA 3KY9A 4F7GA 1Q67A 2KCJA 2D4QA 4Y94A 3F5RA 2GUMA 3FVCA 2Z0PA 2OTXA 3NWAA 3A98B 1SHCA 1FB8A 4NY0A 2HE7A 3TVVA 1U29A 3D8FA 1W1DA 1UNQA 2HTHB 3M1IB 4F7HA 4IFSA 3ML4A 1X1FA 3F0WA 2JP2A 4HAZB 3ODXA 1B55A 5JHHA 4C0AA 2RLOA 1WJMA 2K2JA 2UZRA 4TYZA 1T77A 3TCAA 2UZSA 1WG7A 1TQZA 2EJ8A 1UNRA 3GYPA 4KHBB 2VRWB 2IFSA 2E2XA 2I5CA 5J3QA 1ZC4B 2Y8GA 4D0NB 1X1GA 5IRSA 3HW2B 1DROA 4GPTB 2DKPA 5C5BA 4A6KA 2J0KA 5CLLB 1MPHA 2D2QA 2DN6A 3SYXA 1X86A 3OANA 2KIGA 2RRFA 4QJ4B 1TJ6A 2EMSA 2I1JA 2YF0A 3FSSA 4CHMA 2M14A 1WI1A 3OHMB 1RJ2A 3DXEA 1ZSQA 2GS0A 5C79A 3PSCA 2R2YA 1FGYA 5I2SA 4GNKB 2LYDA 1H10A 1Y5OA 1BAKA 5HE3A 2CY5A 5HE2A 2P0DA 2J59M 2H7EA 4F7UP 1KZGA 5CLQB 2OQBA 2KR0A 5DH9B 2D10A 2DLWA 4KVGB 1DDVA 5D27A 1WVHA 1WGUA 2Z14A 1XODA 4WVFB 2DX5A 1MKEA 3NWDA 3TFMA 5C16A 3KZ1A 2QKLA 1MI1A 4K81A 4P7IA 4HSIA 1Z87A 1MK9B 2W2XD 2J0MA 3AJ4A 2YS1A 2K8EA 1FHOA 4GOUA 2YT1A 4TKNA 4GN1A 4GMXB 2L1CA 3HIEA 4MY6A 4A6HA 3U7DA 2DYQA 3X23A 4HB0B 1ISNA 2ELBA 2J0JA 2EMTA 1V5UA 3VOQA 3CIKA 2P0HA 1V5PA 3QBVB 2MWNB 4ZRKA 2COFA 2VKIA 1LB1A 5D3YA 2DA0A 3U8ZA 2X18A 5JHGA 4CSQA 3P7ZA 4HB2B 2AL6A 5C5BB 4OT1A 2LOXA 2DX1A 2KUQA 2Z13A 3ODWA 1V88A 2KGXB 3SV1A 1AWEA 2D9WA 3WA0A 3A8PA 5LG4B 2EC1A 3PG7A 5LOPB 4B6HA 4CYEA 2CY4A 3PP2A 1UPRA 1DYNA 1BTKA 2FJLA 2K00A 1U27A 2CAYA 5D3VA 2Z0OA 1ZM0A 1I7AA 1UEFA 2AEHA 3SO6A 2XQNM 4PQ0A 2D9ZA 5J3YA 3P6AA 3NW8A 3A8QA 4Z2NA 4QJ3B 3PVWA 4HAYB 4EKUA 1NU2A 2ZPYA 1FAOA 4KAXB 2COAA 4GZUA 1V61A 1OMWA 2Z4DA 1BWNA 1WGQA 3ODOA 4L6EA 2D11A 2P8VA 4QJ5B 1M7EA 4WSFA 4HDOA 1K5DB 5D3XA 2M38A 1P3RA 5KQ1A 1K5GB 1XR0B 4EMOA 1NTYA 2W2WA 1UPQA 2PZ1A 2Y7BA 2D9VA 1FOEA 2ROVA 4K2OA 4KHOA 2BCJA 1RRPB 1EGXA 1KI1B 2YS5A 2R0DA 1PLSA 1XX0A 3NSUA 3U12A 2Q13A 1TXDA 4IOYX 4YL8A 5FI0A 1EAZA 1U2BA 2D9YA 2NZ8B 4ZRIA 4QXAB 1U5FA 2GCJA 3RCPA 2GCLA 1UNPA 5M4YB 4HAWB 2DYNA 5FI1A 5KQ4A 1DBHA 1OQNA 2Z59A 1X11A 1KZ7A 2ZKMX 1ZYIA 1MIXA 2DHKA 4XWXA 5GOWB 1BTNA 5JP4A 2QKMA 3A58A 2NBVA 1H4RA 2UVMA 3TO1A 3FEHA 4KHBA 4KHAA 1FGZA 2MKRA 3DXCA 1SGHA 4HAVB 2YRYA 2G35A 1P6SA 3UZTA 1AQCA 4BBKA 2I1KA 3D8DA 4ZRJA 1DDMA 2RVBB 4HAUB 5J3TA 3KSYA 3PZDA 1M7RA 3G9WA 2N0YA 4MK0A 2DFKA 4CHJA 2RSGA 3SUZA 3SNHA 5DIFB 2DTCA 3AU5A 1MAIA 3LJUX 2V76A 1FHWA
chains in the Genus database with same CATH topology
1XCGA 4DX90 1MK7B 2NMBA 3ZDTA 1Y19B 2LULA 3FM8C 1GG3A 2P0FA 1EVHA 3QWMA 3PVUA 4YONA 4GMVA 3TW1A 3ZVRA 1V5MA 4WJ7A 1DDWA 3DXDA 1E5WA 2Y8FA 2H7DA 2K2UA 3BJIA 3VIAA 4DX8A 1U5EA 1WJ1A 3PEGA 5DHAB 4HATB 2RGNB 2DHJA 5C6RA 1P5TA 1J0WA 3O96A 1IRSA 4Z2MB 3AU4A 5L81A 2MDXA 3D8EA 5HE1A 4HB3B 4PNKA 2Z0QA 5DI9B 3MPXA 1J19A 2ELAA 1U5GA 2CRFA 5JLJB 2R09A 3T06A 4GXBA 3ULBA 3KRWA 4HHVA 2YVCA 1XD4A 2YT0A 1EF1A 1X05A 2RUKB 2VSZA 3BINA 1W1HA 2I5FA 5KCVA 1V89A 2YS3A 1U5DA 1OY2A 4A6FA 4NSWA 2ROZB 2LKOA 1NTVA 2N23A 3IVFA 2GJYA 4A6FB 4HAXB 2L2IA 4A5KA 4HDQA 2KUPA 4K17A 4DBBA 4DXAB 2IYBA 3N7CA 2ADZA 2CODA 1ZC3B 1QC6A 2LOZA 4H8SA 4MT7A 2DKQA 1NI2A 2RNRB 3V5WA 4K2PA 5LONB 5HE0A 2D9XA 3HK0A 3ULCA 2DHIA 3QIJA 1FHXA 3GYOA 4HB4B 3MDBC 5DHFB 5D3WA 4EJNA 2W2XC 1GC6A 1MIZB 2COCA 4IAPA 1XKEA 1ZVRA 5EFXA 1PMSA 3CXBB 1QQGA 1N3HA 1W1GA 3WYFB 3HQCA 3PVLA 2LG1A 1GC7A 2YSZA 2MFQA 3KRXA 1PFJA 1LW3A 1I2HA 3KY9A 4F7GA 1Q67A 2KCJA 2D4QA 4Y94A 3F5RA 2Z0PA 2OTXA 3A98B 1SHCA 1FB8A 4NY0A 2HE7A 3TVVA 1U29A 3D8FA 1W1DA 1UNQA 2HTHB 3M1IB 4F7HA 4IFSA 3ML4A 1X1FA 3F0WA 2JP2A 4HAZB 3ODXA 1B55A 5JHHA 4C0AA 2RLOA 1WJMA 2K2JA 2UZRA 4TYZA 3TCAA 2UZSA 1WG7A 1TQZA 2EJ8A 1UNRA 3GYPA 4KHBB 2VRWB 2IFSA 2E2XA 2I5CA 5J3QA 1ZC4B 2Y8GA 4D0NB 1X1GA 3HW2B 1DROA 4GPTB 2DKPA 5C5BA 4A6KA 2J0KA 5CLLB 1MPHA 2D2QA 2DN6A 3SYXA 1X86A 3OANA 1TJ6A 2EMSA 2I1JA 2YF0A 3FSSA 4CHMA 2M14A 1WI1A 1RJ2A 3DXEA 1ZSQA 2GS0A 5C79A 3PSCA 1FGYA 2LYDA 1H10A 1Y5OA 1BAKA 5HE3A 2CY5A 5HE2A 2P0DA 2J59M 2H7EA 4F7UP 1KZGA 5CLQB 2OQBA 5DH9B 2D10A 2DLWA 4KVGB 1DDVA 5D27A 1WVHA 1WGUA 1XODA 4WVFB 2DX5A 1MKEA 3TFMA 5C16A 3KZ1A 2QKLA 4K81A 4P7IA 1Z87A 1MK9B 2W2XD 2J0MA 3AJ4A 2YS1A 1FHOA 2YT1A 4TKNA 4GN1A 4GMXB 2L1CA 4MY6A 4A6HA 3U7DA 2DYQA 3X23A 4HB0B 1ISNA 2ELBA 2J0JA 2EMTA 1V5UA 3VOQA 3CIKA 2P0HA 1V5PA 3QBVB 2MWNB 4ZRKA 2COFA 2VKIA 1LB1A 5D3YA 2DA0A 3U8ZA 2X18A 5JHGA 3P7ZA 4HB2B 2AL6A 5C5BB 2LOXA 2DX1A 3ODWA 1V88A 2KGXB 3SV1A 1AWEA 2D9WA 3WA0A 3A8PA 2EC1A 3PG7A 5LOPB 4B6HA 4CYEA 2CY4A 3PP2A 1UPRA 1DYNA 1BTKA 2FJLA 2K00A 1U27A 2CAYA 5D3VA 2Z0OA 1ZM0A 1I7AA 1UEFA 2AEHA 3SO6A 2XQNM 4PQ0A 2D9ZA 5J3YA 3P6AA 3A8QA 4Z2NA 3PVWA 4HAYB 4EKUA 1NU2A 2ZPYA 1FAOA 4KAXB 2COAA 4GZUA 1V61A 1OMWA 1BWNA 1WGQA 3ODOA 4L6EA 2D11A 2P8VA 1M7EA 4WSFA 4HDOA 1K5DB 5D3XA 2M38A 1P3RA 5KQ1A 1K5GB 1XR0B 4EMOA 1NTYA 2W2WA 1UPQA 2PZ1A 2Y7BA 2D9VA 1FOEA 2ROVA 4K2OA 4KHOA 2BCJA 1RRPB 1EGXA 1KI1B 2YS5A 2R0DA 1PLSA 1XX0A 3NSUA 2Q13A 1TXDA 4IOYX 4YL8A 5FI0A 1EAZA 1U2BA 2D9YA 2NZ8B 4ZRIA 1U5FA 2GCJA 3RCPA 2GCLA 1UNPA 4HAWB 2DYNA 5FI1A 5KQ4A 1DBHA 1OQNA 1X11A 1KZ7A 1MIXA 2DHKA 4XWXA 5GOWB 1BTNA 5JP4A 2QKMA 1H4RA 2UVMA 3TO1A 3FEHA 4KHAA 1FGZA 2MKRA 3DXCA 1SGHA 4HAVB 2YRYA 2G35A 1P6SA 3UZTA 1AQCA 4BBKA 2I1KA 3D8DA 4ZRJA 1DDMA 2RVBB 4HAUB 5J3TA 3KSYA 3PZDA 1M7RA 3G9WA 2N0YA 4MK0A 2DFKA 4CHJA 2RSGA 3SUZA 3SNHA 5DIFB 2DTCA 3AU5A 1MAIA 3LJUX 2V76A 1FHWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XCG A;  4DX9 0;  1MK7 B;  2NMB A;  3ZDT A;  1Y19 B;  2LUL A;  3FM8 C;  1GG3 A;  2P0F A;  1EVH A;  3QWM A;  3PVU A;  4YON A;  4GMV A;  3TW1 A;  3ZVR A;  1V5M A;  4WJ7 A;  1DDW A;  3DXD A;  1E5W A;  2Y8F A;  2H7D A;  2K2U A;  3BJI A;  3VIA A;  4DX8 A;  1U5E A;  1WJ1 A;  3PEG A;  5DHA B;  4HAT B;  2RGN B;  2DHJ A;  5C6R A;  1P5T A;  1J0W A;  3O96 A;  1IRS A;  4Z2M B;  3AU4 A;  5L81 A;  2MDX A;  3D8E A;  5HE1 A;  4HB3 B;  4PNK A;  2Z0Q A;  5DI9 B;  3MPX A;  1J19 A;  2ELA A;  1U5G A;  2CRF A;  5JLJ B;  2R09 A;  3T06 A;  4GXB A;  3ULB A;  3KRW A;  4HHV A;  2YVC A;  1XD4 A;  2YT0 A;  1EF1 A;  1X05 A;  2RUK B;  2VSZ A;  3BIN A;  1W1H A;  2I5F A;  5KCV A;  1V89 A;  2YS3 A;  1U5D A;  1OY2 A;  4A6F A;  4NSW A;  2ROZ B;  2LKO A;  1NTV A;  2N23 A;  3IVF A;  2GJY A;  4A6F B;  4HAX B;  2L2I A;  4A5K A;  4HDQ A;  2KUP A;  4K17 A;  4DBB A;  4DXA B;  2IYB A;  3N7C A;  2ADZ A;  2COD A;  1ZC3 B;  1QC6 A;  2LOZ A;  4H8S A;  4MT7 A;  2DKQ A;  1NI2 A;  2RNR B;  3V5W A;  4K2P A;  5LON B;  5HE0 A;  2D9X A;  3HK0 A;  3ULC A;  2DHI A;  3QIJ A;  1FHX A;  3GYO A;  4HB4 B;  3MDB C;  5DHF B;  5D3W A;  4EJN A;  2W2X C;  1GC6 A;  1MIZ B;  2COC A;  4IAP A;  1XKE A;  1ZVR A;  5EFX A;  1PMS A;  3CXB B;  1QQG A;  1N3H A;  1W1G A;  3WYF B;  3HQC A;  3PVL A;  2LG1 A;  1GC7 A;  2YSZ A;  2MFQ A;  3KRX A;  1PFJ A;  1LW3 A;  1I2H A;  3KY9 A;  4F7G A;  1Q67 A;  2KCJ A;  2D4Q A;  4Y94 A;  3F5R A;  2Z0P A;  2OTX A;  3A98 B;  1SHC A;  1FB8 A;  4NY0 A;  2HE7 A;  3TVV A;  1U29 A;  3D8F A;  1W1D A;  1UNQ A;  2HTH B;  3M1I B;  4F7H A;  4IFS A;  3ML4 A;  1X1F A;  3F0W A;  2JP2 A;  4HAZ B;  3ODX A;  1B55 A;  5JHH A;  4C0A A;  2RLO A;  1WJM A;  2K2J A;  2UZR A;  4TYZ A;  3TCA A;  2UZS A;  1WG7 A;  1TQZ A;  2EJ8 A;  1UNR A;  3GYP A;  4KHB B;  2VRW B;  2IFS A;  2E2X A;  2I5C A;  5J3Q A;  1ZC4 B;  2Y8G A;  4D0N B;  1X1G A;  3HW2 B;  1DRO A;  4GPT B;  2DKP A;  5C5B A;  4A6K A;  2J0K A;  5CLL B;  1MPH A;  2D2Q A;  2DN6 A;  3SYX A;  1X86 A;  3OAN A;  1TJ6 A;  2EMS A;  2I1J A;  2YF0 A;  3FSS A;  4CHM A;  2M14 A;  1WI1 A;  1RJ2 A;  3DXE A;  1ZSQ A;  2GS0 A;  5C79 A;  3PSC A;  1FGY A;  2LYD A;  1H10 A;  1Y5O A;  1BAK A;  5HE3 A;  2CY5 A;  5HE2 A;  2P0D A;  2J59 M;  2H7E A;  4F7U P;  1KZG A;  5CLQ B;  2OQB A;  5DH9 B;  2D10 A;  2DLW A;  4KVG B;  1DDV A;  5D27 A;  1WVH A;  1WGU A;  1XOD A;  4WVF B;  2DX5 A;  1MKE A;  3TFM A;  5C16 A;  3KZ1 A;  2QKL A;  4K81 A;  4P7I A;  1Z87 A;  1MK9 B;  2W2X D;  2J0M A;  3AJ4 A;  2YS1 A;  1FHO A;  2YT1 A;  4TKN A;  4GN1 A;  4GMX B;  2L1C A;  4MY6 A;  4A6H A;  3U7D A;  2DYQ A;  3X23 A;  4HB0 B;  1ISN A;  2ELB A;  2J0J A;  2EMT A;  1V5U A;  3VOQ A;  3CIK A;  2P0H A;  1V5P A;  3QBV B;  2MWN B;  4ZRK A;  2COF A;  2VKI A;  1LB1 A;  5D3Y A;  2DA0 A;  3U8Z A;  2X18 A;  5JHG A;  3P7Z A;  4HB2 B;  2AL6 A;  5C5B B;  2LOX A;  2DX1 A;  3ODW A;  1V88 A;  2KGX B;  3SV1 A;  1AWE A;  2D9W A;  3WA0 A;  3A8P A;  2EC1 A;  3PG7 A;  5LOP B;  4B6H A;  4CYE A;  2CY4 A;  3PP2 A;  1UPR A;  1DYN A;  1BTK A;  2FJL A;  2K00 A;  1U27 A;  2CAY A;  5D3V A;  2Z0O A;  1ZM0 A;  1I7A A;  1UEF A;  2AEH A;  3SO6 A;  2XQN M;  4PQ0 A;  2D9Z A;  5J3Y A;  3P6A A;  3A8Q A;  4Z2N A;  3PVW A;  4HAY B;  4EKU A;  1NU2 A;  2ZPY A;  1FAO A;  4KAX B;  2COA A;  4GZU A;  1V61 A;  1OMW A;  1BWN A;  1WGQ A;  3ODO A;  4L6E A;  2D11 A;  2P8V A;  1M7E A;  4WSF A;  4HDO A;  1K5D B;  5D3X A;  2M38 A;  1P3R A;  5KQ1 A;  1K5G B;  1XR0 B;  4EMO A;  1NTY A;  2W2W A;  1UPQ A;  2PZ1 A;  2Y7B A;  2D9V A;  1FOE A;  2ROV A;  4K2O A;  4KHO A;  2BCJ A;  1RRP B;  1EGX A;  1KI1 B;  2YS5 A;  2R0D A;  1PLS A;  1XX0 A;  3NSU A;  2Q13 A;  1TXD A;  4IOY X;  4YL8 A;  5FI0 A;  1EAZ A;  1U2B A;  2D9Y A;  2NZ8 B;  4ZRI A;  1U5F A;  2GCJ A;  3RCP A;  2GCL A;  1UNP A;  4HAW B;  2DYN A;  5FI1 A;  5KQ4 A;  1DBH A;  1OQN A;  1X11 A;  1KZ7 A;  1MIX A;  2DHK A;  4XWX A;  5GOW B;  1BTN A;  5JP4 A;  2QKM A;  1H4R A;  2UVM A;  3TO1 A;  3FEH A;  4KHA A;  1FGZ A;  2MKR A;  3DXC A;  1SGH A;  4HAV B;  2YRY A;  2G35 A;  1P6S A;  3UZT A;  1AQC A;  4BBK A;  2I1K A;  3D8D A;  4ZRJ A;  1DDM A;  2RVB B;  4HAU B;  5J3T A;  3KSY A;  3PZD A;  1M7R A;  3G9W A;  2N0Y A;  4MK0 A;  2DFK A;  4CHJ A;  2RSG A;  3SUZ A;  3SNH A;  5DIF B;  2DTC A;  3AU5 A;  1MAI A;  3LJU X;  2V76 A;  1FHW A; 
#chains in the Genus database with same CATH topology
 1XCG A;  4DX9 0;  1MK7 B;  2NMB A;  3HSA A;  3ZDT A;  1Y19 B;  2LUL A;  3FM8 C;  1GG3 A;  2P0F A;  1EVH A;  3QWM A;  3PVU A;  4YON A;  4GMV A;  3TW1 A;  3ZVR A;  1V5M A;  4WJ7 A;  1DDW A;  3DXD A;  1E5W A;  2Y8F A;  2H7D A;  2K2U A;  3BJI A;  3VIA A;  4DX8 A;  1U5E A;  1WJ1 A;  3PEG A;  5DHA B;  4HAT B;  2RGN B;  3NWF A;  2DHJ A;  5C6R A;  1P5T A;  1J0W A;  3O96 A;  1IRS A;  4Z2M B;  3AU4 A;  4L1R A;  5L81 A;  2MDX A;  3D8E A;  5HE1 A;  4HB3 B;  4PNK A;  2Z0Q A;  5DI9 B;  3MPX A;  1J19 A;  5I2M A;  2ELA A;  1U5G A;  2CRF A;  5JLJ B;  2R09 A;  3T06 A;  4GXB A;  3ULB A;  3KRW A;  4HHV A;  2YT2 A;  2YVC A;  1XD4 A;  2YT0 A;  1EF1 A;  1X05 A;  2RUK B;  2VSZ A;  3BIN A;  1W1H A;  2I5F A;  5KCV A;  1V89 A;  2YS3 A;  1U5D A;  2FJU B;  3B77 A;  1OY2 A;  4A6F A;  4NSW A;  2ROZ B;  2LKO A;  1NTV A;  2N23 A;  3IVF A;  2GJY A;  4A6F B;  4D6W A;  4HAX B;  2KIE A;  2L2I A;  4A5K A;  4HDQ A;  2KUP A;  4K17 A;  4DBB A;  4DXA B;  2IYB A;  3N7C A;  2ADZ A;  2COD A;  1ZC3 B;  1QC6 A;  2LOZ A;  4H8S A;  4MT7 A;  2DKQ A;  1NI2 A;  2RNR B;  3V5W A;  4K2P A;  5LON B;  5HE0 A;  4DIX A;  2D9X A;  3HK0 A;  3ULC A;  2K49 A;  2DHI A;  3QIJ A;  1FHX A;  3GYO A;  4HB4 B;  3MDB C;  5DHF B;  5D3W A;  4OSN A;  4EJN A;  2W2X C;  1GC6 A;  3DCX A;  1MIZ B;  2COC A;  4IAP A;  1XKE A;  1ZVR A;  5EFX A;  1PMS A;  3CXB B;  1QQG A;  1N3H A;  1W1G A;  3WYF B;  3HQC A;  3PVL A;  2LG1 A;  1GC7 A;  2YSZ A;  2MFQ A;  3KRX A;  1PFJ A;  1LW3 A;  1I2H A;  3KY9 A;  4F7G A;  1Q67 A;  2KCJ A;  2D4Q A;  4Y94 A;  3F5R A;  2GUM A;  3FVC A;  2Z0P A;  2OTX A;  3NWA A;  3A98 B;  1SHC A;  1FB8 A;  4NY0 A;  2HE7 A;  3TVV A;  1U29 A;  3D8F A;  1W1D A;  1UNQ A;  2HTH B;  3M1I B;  4F7H A;  4IFS A;  3ML4 A;  1X1F A;  3F0W A;  2JP2 A;  4HAZ B;  3ODX A;  1B55 A;  5JHH A;  4C0A A;  2RLO A;  1WJM A;  2K2J A;  2UZR A;  4TYZ A;  1T77 A;  3TCA A;  2UZS A;  1WG7 A;  1TQZ A;  2EJ8 A;  1UNR A;  3GYP A;  4KHB B;  2VRW B;  2IFS A;  2E2X A;  2I5C A;  5J3Q A;  1ZC4 B;  2Y8G A;  4D0N B;  1X1G A;  5IRS A;  3HW2 B;  1DRO A;  4GPT B;  2DKP A;  5C5B A;  4A6K A;  2J0K A;  5CLL B;  1MPH A;  2D2Q A;  2DN6 A;  3SYX A;  1X86 A;  3OAN A;  2KIG A;  2RRF A;  4QJ4 B;  1TJ6 A;  2EMS A;  2I1J A;  2YF0 A;  3FSS A;  4CHM A;  2M14 A;  1WI1 A;  3OHM B;  1RJ2 A;  3DXE A;  1ZSQ A;  2GS0 A;  5C79 A;  3PSC A;  2R2Y A;  1FGY A;  5I2S A;  4GNK B;  2LYD A;  1H10 A;  1Y5O A;  1BAK A;  5HE3 A;  2CY5 A;  5HE2 A;  2P0D A;  2J59 M;  2H7E A;  4F7U P;  1KZG A;  5CLQ B;  2OQB A;  2KR0 A;  5DH9 B;  2D10 A;  2DLW A;  4KVG B;  1DDV A;  5D27 A;  1WVH A;  1WGU A;  2Z14 A;  1XOD A;  4WVF B;  2DX5 A;  1MKE A;  3NWD A;  3TFM A;  5C16 A;  3KZ1 A;  2QKL A;  1MI1 A;  4K81 A;  4P7I A;  4HSI A;  1Z87 A;  1MK9 B;  2W2X D;  2J0M A;  3AJ4 A;  2YS1 A;  2K8E A;  1FHO A;  4GOU A;  2YT1 A;  4TKN A;  4GN1 A;  4GMX B;  2L1C A;  3HIE A;  4MY6 A;  4A6H A;  3U7D A;  2DYQ A;  3X23 A;  4HB0 B;  1ISN A;  2ELB A;  2J0J A;  2EMT A;  1V5U A;  3VOQ A;  3CIK A;  2P0H A;  1V5P A;  3QBV B;  2MWN B;  4ZRK A;  2COF A;  2VKI A;  1LB1 A;  5D3Y A;  2DA0 A;  3U8Z A;  2X18 A;  5JHG A;  4CSQ A;  3P7Z A;  4HB2 B;  2AL6 A;  5C5B B;  4OT1 A;  2LOX A;  2DX1 A;  2KUQ A;  2Z13 A;  3ODW A;  1V88 A;  2KGX B;  3SV1 A;  1AWE A;  2D9W A;  3WA0 A;  3A8P A;  5LG4 B;  2EC1 A;  3PG7 A;  5LOP B;  4B6H A;  4CYE A;  2CY4 A;  3PP2 A;  1UPR A;  1DYN A;  1BTK A;  2FJL A;  2K00 A;  1U27 A;  2CAY A;  5D3V A;  2Z0O A;  1ZM0 A;  1I7A A;  1UEF A;  2AEH A;  3SO6 A;  2XQN M;  4PQ0 A;  2D9Z A;  5J3Y A;  3P6A A;  3NW8 A;  3A8Q A;  4Z2N A;  4QJ3 B;  3PVW A;  4HAY B;  4EKU A;  1NU2 A;  2ZPY A;  1FAO A;  4KAX B;  2COA A;  4GZU A;  1V61 A;  1OMW A;  2Z4D A;  1BWN A;  1WGQ A;  3ODO A;  4L6E A;  2D11 A;  2P8V A;  4QJ5 B;  1M7E A;  4WSF A;  4HDO A;  1K5D B;  5D3X A;  2M38 A;  1P3R A;  5KQ1 A;  1K5G B;  1XR0 B;  4EMO A;  1NTY A;  2W2W A;  1UPQ A;  2PZ1 A;  2Y7B A;  2D9V A;  1FOE A;  2ROV A;  4K2O A;  4KHO A;  2BCJ A;  1RRP B;  1EGX A;  1KI1 B;  2YS5 A;  2R0D A;  1PLS A;  1XX0 A;  3NSU A;  3U12 A;  2Q13 A;  1TXD A;  4IOY X;  4YL8 A;  5FI0 A;  1EAZ A;  1U2B A;  2D9Y A;  2NZ8 B;  4ZRI A;  4QXA B;  1U5F A;  2GCJ A;  3RCP A;  2GCL A;  1UNP A;  5M4Y B;  4HAW B;  2DYN A;  5FI1 A;  5KQ4 A;  1DBH A;  1OQN A;  2Z59 A;  1X11 A;  1KZ7 A;  2ZKM X;  1ZYI A;  1MIX A;  2DHK A;  4XWX A;  5GOW B;  1BTN A;  5JP4 A;  2QKM A;  3A58 A;  2NBV A;  1H4R A;  2UVM A;  3TO1 A;  3FEH A;  4KHB A;  4KHA A;  1FGZ A;  2MKR A;  3DXC A;  1SGH A;  4HAV B;  2YRY A;  2G35 A;  1P6S A;  3UZT A;  1AQC A;  4BBK A;  2I1K A;  3D8D A;  4ZRJ A;  1DDM A;  2RVB B;  4HAU B;  5J3T A;  3KSY A;  3PZD A;  1M7R A;  3G9W A;  2N0Y A;  4MK0 A;  2DFK A;  4CHJ A;  2RSG A;  3SUZ A;  3SNH A;  5DIF B;  2DTC A;  3AU5 A;  1MAI A;  3LJU X;  2V76 A;  1FHW A; 
#chains in the Genus database with same CATH homology
 1XCG A;  4DX9 0;  1MK7 B;  2NMB A;  3ZDT A;  1Y19 B;  2LUL A;  3FM8 C;  1GG3 A;  2P0F A;  1EVH A;  3QWM A;  3PVU A;  4YON A;  4GMV A;  3TW1 A;  3ZVR A;  1V5M A;  4WJ7 A;  1DDW A;  3DXD A;  1E5W A;  2Y8F A;  2H7D A;  2K2U A;  3BJI A;  3VIA A;  4DX8 A;  1U5E A;  1WJ1 A;  3PEG A;  5DHA B;  4HAT B;  2RGN B;  2DHJ A;  5C6R A;  1P5T A;  1J0W A;  3O96 A;  1IRS A;  4Z2M B;  3AU4 A;  5L81 A;  2MDX A;  3D8E A;  5HE1 A;  4HB3 B;  4PNK A;  2Z0Q A;  5DI9 B;  3MPX A;  1J19 A;  2ELA A;  1U5G A;  2CRF A;  5JLJ B;  2R09 A;  3T06 A;  4GXB A;  3ULB A;  3KRW A;  4HHV A;  2YVC A;  1XD4 A;  2YT0 A;  1EF1 A;  1X05 A;  2RUK B;  2VSZ A;  3BIN A;  1W1H A;  2I5F A;  5KCV A;  1V89 A;  2YS3 A;  1U5D A;  1OY2 A;  4A6F A;  4NSW A;  2ROZ B;  2LKO A;  1NTV A;  2N23 A;  3IVF A;  2GJY A;  4A6F B;  4HAX B;  2L2I A;  4A5K A;  4HDQ A;  2KUP A;  4K17 A;  4DBB A;  4DXA B;  2IYB A;  3N7C A;  2ADZ A;  2COD A;  1ZC3 B;  1QC6 A;  2LOZ A;  4H8S A;  4MT7 A;  2DKQ A;  1NI2 A;  2RNR B;  3V5W A;  4K2P A;  5LON B;  5HE0 A;  2D9X A;  3HK0 A;  3ULC A;  2DHI A;  3QIJ A;  1FHX A;  3GYO A;  4HB4 B;  3MDB C;  5DHF B;  5D3W A;  4EJN A;  2W2X C;  1GC6 A;  1MIZ B;  2COC A;  4IAP A;  1XKE A;  1ZVR A;  5EFX A;  1PMS A;  3CXB B;  1QQG A;  1N3H A;  1W1G A;  3WYF B;  3HQC A;  3PVL A;  2LG1 A;  1GC7 A;  2YSZ A;  2MFQ A;  3KRX A;  1PFJ A;  1LW3 A;  1I2H A;  3KY9 A;  4F7G A;  1Q67 A;  2KCJ A;  2D4Q A;  4Y94 A;  3F5R A;  2Z0P A;  2OTX A;  3A98 B;  1SHC A;  1FB8 A;  4NY0 A;  2HE7 A;  3TVV A;  1U29 A;  3D8F A;  1W1D A;  1UNQ A;  2HTH B;  3M1I B;  4F7H A;  4IFS A;  3ML4 A;  1X1F A;  3F0W A;  2JP2 A;  4HAZ B;  3ODX A;  1B55 A;  5JHH A;  4C0A A;  2RLO A;  1WJM A;  2K2J A;  2UZR A;  4TYZ A;  3TCA A;  2UZS A;  1WG7 A;  1TQZ A;  2EJ8 A;  1UNR A;  3GYP A;  4KHB B;  2VRW B;  2IFS A;  2E2X A;  2I5C A;  5J3Q A;  1ZC4 B;  2Y8G A;  4D0N B;  1X1G A;  3HW2 B;  1DRO A;  4GPT B;  2DKP A;  5C5B A;  4A6K A;  2J0K A;  5CLL B;  1MPH A;  2D2Q A;  2DN6 A;  3SYX A;  1X86 A;  3OAN A;  1TJ6 A;  2EMS A;  2I1J A;  2YF0 A;  3FSS A;  4CHM A;  2M14 A;  1WI1 A;  1RJ2 A;  3DXE A;  1ZSQ A;  2GS0 A;  5C79 A;  3PSC A;  1FGY A;  2LYD A;  1H10 A;  1Y5O A;  1BAK A;  5HE3 A;  2CY5 A;  5HE2 A;  2P0D A;  2J59 M;  2H7E A;  4F7U P;  1KZG A;  5CLQ B;  2OQB A;  5DH9 B;  2D10 A;  2DLW A;  4KVG B;  1DDV A;  5D27 A;  1WVH A;  1WGU A;  1XOD A;  4WVF B;  2DX5 A;  1MKE A;  3TFM A;  5C16 A;  3KZ1 A;  2QKL A;  4K81 A;  4P7I A;  1Z87 A;  1MK9 B;  2W2X D;  2J0M A;  3AJ4 A;  2YS1 A;  1FHO A;  2YT1 A;  4TKN A;  4GN1 A;  4GMX B;  2L1C A;  4MY6 A;  4A6H A;  3U7D A;  2DYQ A;  3X23 A;  4HB0 B;  1ISN A;  2ELB A;  2J0J A;  2EMT A;  1V5U A;  3VOQ A;  3CIK A;  2P0H A;  1V5P A;  3QBV B;  2MWN B;  4ZRK A;  2COF A;  2VKI A;  1LB1 A;  5D3Y A;  2DA0 A;  3U8Z A;  2X18 A;  5JHG A;  3P7Z A;  4HB2 B;  2AL6 A;  5C5B B;  2LOX A;  2DX1 A;  3ODW A;  1V88 A;  2KGX B;  3SV1 A;  1AWE A;  2D9W A;  3WA0 A;  3A8P A;  2EC1 A;  3PG7 A;  5LOP B;  4B6H A;  4CYE A;  2CY4 A;  3PP2 A;  1UPR A;  1DYN A;  1BTK A;  2FJL A;  2K00 A;  1U27 A;  2CAY A;  5D3V A;  2Z0O A;  1ZM0 A;  1I7A A;  1UEF A;  2AEH A;  3SO6 A;  2XQN M;  4PQ0 A;  2D9Z A;  5J3Y A;  3P6A A;  3A8Q A;  4Z2N A;  3PVW A;  4HAY B;  4EKU A;  1NU2 A;  2ZPY A;  1FAO A;  4KAX B;  2COA A;  4GZU A;  1V61 A;  1OMW A;  1BWN A;  1WGQ A;  3ODO A;  4L6E A;  2D11 A;  2P8V A;  1M7E A;  4WSF A;  4HDO A;  1K5D B;  5D3X A;  2M38 A;  1P3R A;  5KQ1 A;  1K5G B;  1XR0 B;  4EMO A;  1NTY A;  2W2W A;  1UPQ A;  2PZ1 A;  2Y7B A;  2D9V A;  1FOE A;  2ROV A;  4K2O A;  4KHO A;  2BCJ A;  1RRP B;  1EGX A;  1KI1 B;  2YS5 A;  2R0D A;  1PLS A;  1XX0 A;  3NSU A;  2Q13 A;  1TXD A;  4IOY X;  4YL8 A;  5FI0 A;  1EAZ A;  1U2B A;  2D9Y A;  2NZ8 B;  4ZRI A;  1U5F A;  2GCJ A;  3RCP A;  2GCL A;  1UNP A;  4HAW B;  2DYN A;  5FI1 A;  5KQ4 A;  1DBH A;  1OQN A;  1X11 A;  1KZ7 A;  1MIX A;  2DHK A;  4XWX A;  5GOW B;  1BTN A;  5JP4 A;  2QKM A;  1H4R A;  2UVM A;  3TO1 A;  3FEH A;  4KHA A;  1FGZ A;  2MKR A;  3DXC A;  1SGH A;  4HAV B;  2YRY A;  2G35 A;  1P6S A;  3UZT A;  1AQC A;  4BBK A;  2I1K A;  3D8D A;  4ZRJ A;  1DDM A;  2RVB B;  4HAU B;  5J3T A;  3KSY A;  3PZD A;  1M7R A;  3G9W A;  2N0Y A;  4MK0 A;  2DFK A;  4CHJ A;  2RSG A;  3SUZ A;  3SNH A;  5DIF B;  2DTC A;  3AU5 A;  1MAI A;  3LJU X;  2V76 A;  1FHW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...