2V76A

Crystal structure of the human dok1 ptb domain
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
103
structure length
99
Chain Sequence
PLGSQFWVTVQRTEAAERCGLHGSYVLRVEAERLTLLTVGILEPLLSWPYTLLRRYGRDKVMFSFEAGRRCPSGPGTFTFQTAQGNDIFQAVETAIHRQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DOCKING PROTEIN 1
publication title An Integrin Phosphorylation Switch: The Effect of {Beta}3 Integrin Tail Phosphorylation on Dok1 and Talin Binding.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 25
structure length 99
sequence length 103
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2007-07-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2v76A00
2QKLA 2YVCA 3RCPA 3GYPA 4K81A 5L81A 3PVLA 4HATB 1MKEA 1WI1A 1RJ2A 2YSZA 4Z2MB 4F7HA 4YL8A 4MY6A 3N7CA 2J0JA 4B6HA 3M1IB 2V76A 2YT0A 2R0DA 2Z0PA 1V5PA 1ZC3B 5D3YA 2P8VA 2DLWA 3AJ4A 4MK0A 4ZRJA 1OQNA 2YS1A 1MK9B 3F0WA 2OTXA 3DXCA 1UNRA 1U29A 2ADZA 4ZRIA 2IFSA 3O96A 1MIZB 4HAXB 4WJ7A 3DXDA 4NY0A 1MAIA 2ELBA 2MKRA 4HAWB 1ISNA 2GS0A 3ODXA 1NI2A 4KAXB 2R09A 2DTCA 1PMSA 3D8EA 3U7DA 1GG3A 2OQBA 1U5FA 2YT1A 5J3QA 2VKIA 1U5GA 2NZ8B 2IYBA 1X1FA 2CAYA 4K2PA 1UNPA 2Y8FA 1V5UA 4HAYB 1N3HA 1XX0A 2P0HA 3SYXA 1MIXA 2MWNB 4HAVB 4IOYX 1I2HA 4HB0B 3SUZA 2VRWB 1Y5OA 4GMXB 5D3VA 1M7RA 1B55A 1DROA 2GCLA 3WYFB 4EJNA 4NSWA 4A6HA 3QIJA 1X86A 3KRWA 4K17A 2K2UA 2D9ZA 1DDWA 3TO1A 1BAKA 2I1KA 1WG7A 1QC6A 1V61A 1KI1B 3PG7A 1EAZA 1Y19B 3TFMA 1PLSA 5KQ1A 5CLLB 2EC1A 3FEHA 1EF1A 4K2OA 2I5FA 4TYZA 1Z87A 2DKQA 4EKUA 3DXEA 1K5DB 1J19A 1NTVA 2RGNB 2Q13A 1I7AA 2I1JA 4CYEA 5DH9B 2LOZA 2CY5A 4IAPA 3TCAA 4A6FB 5KQ4A 5FI1A 2N23A 2DHJA 2M38A 3ODOA 4HB2B 5D3XA 4Y94A 2N0YA 2UZRA 1P6SA 1Q67A 4YONA 5JHGA 1TXDA 2KCJA 2DX1A 2K2JA 2Z0OA 3PP2A 5C5BB 2MFQA 5KCVA 1UNQA 4XWXA 2CRFA 2DHKA 3BJIA 2D9XA 2H7EA 3PVWA 3ZDTA 3A8QA 2JP2A 2DYQA 1M7EA 1RRPB 2W2WA 2DHIA 2PZ1A 4KHOA 5HE3A 4P7IA 4HDOA 1WJMA 3BINA 1DYNA 2RNRB 1U5DA 3TVVA 2I5CA 1MK7B 2DFKA 5LOPB 2Y8GA 2COCA 2P0FA 4GN1A 2CY4A 2UZSA 1K5GB 1FHWA 2D9VA 5DHFB 1V88A 4HHVA 3KRXA 1TJ6A 1X05A 4A5KA 5DI9B 1FAOA 1V89A 3HK0A 2L1CA 1E5WA 2ROZB 4CHJA 3KY9A 2DX5A 1UEFA 5EFXA 2CODA 5JP4A 4DX8A 4GZUA 3QBVB 2D9YA 3CXBB 1U5EA 3UZTA 3FM8C 3P6AA 2MDXA 5LONB 2M14A 1EGXA 1OMWA 3NSUA 3ODWA 1J0WA 4DX90 3GYOA 2AL6A 1DDVA 2EJ8A 2HTHB 4IFSA 5DHAB 3A98B 1AQCA 1H10A 3SV1A 2Y7BA 2DA0A 3PZDA 5J3TA 1QQGA 4KHBB 2D9WA 3VIAA 1BTKA 1XR0B 2W2XD 2K00A 4WSFA 2QKMA 4L6EA 2DN6A 1W1GA 4BBKA 2YRYA 2DYNA 1U2BA 3MPXA 5CLQB 5JLJB 3KZ1A 3F5RA 4KHAA 4KVGB 5C6RA 1U27A 1WJ1A 2COAA 3P7ZA 1DDMA 2RVBB 4HAZB 4PQ0A 1SGHA 5D27A 1ZVRA 1WVHA 4MT7A 1OY2A 4HAUB 1XKEA 3SNHA 1LB1A 1V5MA 1EVHA 3ZVRA 2VSZA 1H4RA 4Z2NA 2G35A 3AU4A 1MPHA 5GOWB 2EMTA 1TQZA 2W2XC 1BTNA 1SHCA 3X23A 3TW1A 3D8FA 3OANA 1WGQA 2J59M 2Z0QA 1FHXA 3T06A 4GXBA 3ULCA 4DXAB 3G9WA 1KZ7A 4GMVA 4A6KA 1GC6A 3LJUX 2LG1A 2KUPA 2YS5A 2LOXA 3IVFA 4WVFB 1PFJA 2UVMA 1W1HA 3PSCA 3ULBA 1NTYA 2HE7A 2YF0A 3SO6A 4D0NB 2D2QA 1AWEA 3FSSA 1X1GA 3KSYA 5J3YA 2ROVA 5HE2A 1FGYA 3WA0A 1FOEA 4H8SA 1ZSQA 4F7GA 4CHMA 2GCJA 3PEGA 1UPQA 2LULA 2XQNM 5C79A 1FHOA 5DIFB 1UPRA 3HW2B 3ML4A 3AU5A 5FI0A 2D4QA 3QWMA 2DKPA 1W1DA 3CIKA 2P0DA 2KGXB 2X18A 4A6FA 1BWNA 3MDBC 4ZRKA 1NU2A 2FJLA 1XODA 2D10A 1ZM0A 3HQCA 3U8ZA 4TKNA 2LYDA 2EMSA 1GC7A 2ELAA 2J0KA 1XCGA 1LW3A 4C0AA 2YS3A 1IRSA 1FGZA 2E2XA 2NMBA 2BCJA 2GJYA 3D8DA 5D3WA 1ZC4B 2COFA 2AEHA 5C5BA 2D11A 1DBHA 1KZGA 2LKOA 4DBBA 3V5WA 5HE0A 1P3RA 4HB4B 2RUKB 4F7UP 3VOQA 1FB8A 1P5TA 2RSGA 2H7DA 4HB3B 2RLOA 1X11A 1WGUA 4EMOA 4HDQA 5C16A 5JHHA 2L2IA 5HE1A 1XD4A 3A8PA 4PNKA 2J0MA 2ZPYA 4GPTB 3PVUA
chains in the Genus database with same CATH superfamily
4QJ5B 2QKLA 2KIGA 2YVCA 3RCPA 3GYPA 4K81A 5L81A 3PVLA 2KR0A 3OHMB 4HATB 1MKEA 1WI1A 1RJ2A 2YSZA 4Z2MB 4F7HA 4YL8A 4MY6A 3N7CA 2J0JA 4B6HA 2KUQA 3M1IB 2V76A 2YT0A 2R0DA 2Z0PA 1V5PA 1ZC3B 5D3YA 2P8VA 2DLWA 3AJ4A 4MK0A 4ZRJA 1OQNA 2YS1A 1MK9B 3F0WA 2OTXA 3DXCA 1UNRA 1U29A 2FJUB 2ADZA 4ZRIA 2IFSA 3O96A 1MIZB 4HAXB 4WJ7A 3DXDA 4NY0A 1MAIA 2ELBA 2MKRA 4HAWB 1ISNA 2GS0A 3ODXA 1NI2A 2RRFA 4KAXB 2R09A 4D6WA 2DTCA 4QXAB 1PMSA 3D8EA 3U7DA 1GG3A 2OQBA 1U5FA 2YT1A 5J3QA 2VKIA 4KHBA 1U5GA 2NZ8B 2IYBA 1X1FA 2CAYA 4K2PA 1UNPA 2Y8FA 1V5UA 4HAYB 1N3HA 1XX0A 2P0HA 3SYXA 1MIXA 2MWNB 4HAVB 4IOYX 1I2HA 4HB0B 3A58A 4QJ4B 3SUZA 3HIEA 2VRWB 1Y5OA 3U12A 4GMXB 5D3VA 2Z14A 1M7RA 1B55A 1DROA 2GCLA 3WYFB 4EJNA 4NSWA 4A6HA 3QIJA 1X86A 3KRWA 4K17A 2K2UA 2K8EA 2D9ZA 1DDWA 3TO1A 1BAKA 2I1KA 1WG7A 1QC6A 1V61A 1KI1B 1EAZA 3PG7A 1Y19B 3TFMA 1PLSA 5KQ1A 5CLLB 2EC1A 5IRSA 3FEHA 1EF1A 4K2OA 2I5FA 4TYZA 1Z87A 2DKQA 4EKUA 3DXEA 1K5DB 1J19A 1NTVA 2RGNB 3DCXA 4HSIA 2Q13A 1I7AA 2I1JA 4CYEA 5DH9B 2LOZA 2CY5A 4IAPA 3TCAA 4A6FB 5KQ4A 5FI1A 2N23A 2DHJA 2M38A 3ODOA 4HB2B 5D3XA 4Y94A 2N0YA 2UZRA 1P6SA 1Q67A 4YONA 5JHGA 1TXDA 2KCJA 2DX1A 2K2JA 2Z0OA 2YT2A 3PP2A 5C5BB 2MFQA 5KCVA 2GUMA 1UNQA 4XWXA 2CRFA 2DHKA 3BJIA 2D9XA 2H7EA 3PVWA 3ZDTA 3A8QA 2JP2A 2DYQA 1M7EA 1RRPB 2W2WA 2DHIA 2PZ1A 4KHOA 5HE3A 2ZKMX 4P7IA 4HDOA 1WJMA 3BINA 1DYNA 2RNRB 1U5DA 3HSAA 3TVVA 2I5CA 5LG4B 1MK7B 1MI1A 2DFKA 5LOPB 2Y8GA 2COCA 2P0FA 4GN1A 2CY4A 2UZSA 1K5GB 4CSQA 1FHWA 2D9VA 5DHFB 1V88A 5I2SA 4HHVA 2K49A 3KRXA 1TJ6A 1X05A 4A5KA 5DI9B 1FAOA 1V89A 3HK0A 2L1CA 1E5WA 2ROZB 4CHJA 3KY9A 2DX5A 1UEFA 5EFXA 2CODA 5JP4A 4DX8A 4GZUA 3QBVB 2D9YA 3CXBB 4QJ3B 1U5EA 3UZTA 3FM8C 3P6AA 2MDXA 5LONB 2M14A 1EGXA 1OMWA 3NSUA 3ODWA 1J0WA 4DX90 3GYOA 4L1RA 2AL6A 1DDVA 2EJ8A 2HTHB 4IFSA 5DHAB 3A98B 3FVCA 1AQCA 1H10A 3SV1A 2Y7BA 2DA0A 3PZDA 5J3TA 2Z13A 1QQGA 4KHBB 2D9WA 3VIAA 1BTKA 1XR0B 2W2XD 2K00A 4WSFA 2QKMA 4L6EA 2DN6A 1W1GA 4GOUA 4GNKB 4BBKA 3NWDA 2YRYA 2DYNA 1U2BA 3MPXA 5CLQB 5JLJB 3KZ1A 3F5RA 4KHAA 4KVGB 5C6RA 1U27A 1WJ1A 2COAA 3P7ZA 2R2YA 1DDMA 2RVBB 4HAZB 4PQ0A 1SGHA 5D27A 1ZVRA 1WVHA 4MT7A 1OY2A 5M4YB 4HAUB 1XKEA 3SNHA 1LB1A 1V5MA 1EVHA 3ZVRA 2VSZA 1H4RA 4Z2NA 2G35A 3AU4A 2Z59A 4OSNA 1MPHA 4OT1A 5GOWB 2EMTA 5I2MA 1TQZA 2W2XC 1BTNA 1SHCA 3X23A 3TW1A 3D8FA 3OANA 1WGQA 2J59M 2Z0QA 1FHXA 3T06A 4GXBA 3ULCA 4DXAB 3G9WA 1KZ7A 4GMVA 4A6KA 3NWFA 3B77A 1GC6A 3LJUX 2LG1A 2KUPA 2YS5A 2LOXA 3IVFA 4WVFB 3NWAA 1PFJA 2UVMA 1W1HA 3PSCA 3ULBA 1NTYA 2HE7A 2YF0A 3SO6A 4D0NB 2D2QA 1AWEA 3FSSA 1X1GA 3KSYA 5J3YA 2ROVA 5HE2A 1FGYA 3WA0A 1FOEA 4H8SA 1ZSQA 4F7GA 4CHMA 2GCJA 3PEGA 1UPQA 2LULA 2XQNM 5C79A 1FHOA 5DIFB 1UPRA 3HW2B 3ML4A 3AU5A 1ZYIA 5FI0A 2D4QA 3QWMA 2DKPA 1W1DA 3CIKA 2P0DA 2KGXB 2X18A 4A6FA 1BWNA 3MDBC 4ZRKA 1NU2A 2FJLA 1XODA 2D10A 1ZM0A 3HQCA 3U8ZA 4TKNA 2LYDA 2EMSA 1GC7A 2ELAA 2Z4DA 2J0KA 1XCGA 1LW3A 4C0AA 2YS3A 1IRSA 1FGZA 2E2XA 2NMBA 2BCJA 2GJYA 3D8DA 5D3WA 1ZC4B 2COFA 2AEHA 5C5BA 2NBVA 2D11A 1DBHA 1KZGA 2LKOA 4DBBA 3NW8A 3V5WA 1T77A 5HE0A 1P3RA 4HB4B 2RUKB 4DIXA 4F7UP 3VOQA 1FB8A 1P5TA 2RSGA 2H7DA 4HB3B 2RLOA 1X11A 1WGUA 4EMOA 2KIEA 4HDQA 5C16A 5JHHA 2L2IA 5HE1A 1XD4A 3A8PA 4PNKA 2J0MA 2ZPYA 4GPTB 3PVUA
chains in the Genus database with same CATH topology
2QKLA 2YVCA 3RCPA 3GYPA 4K81A 5L81A 3PVLA 4HATB 1MKEA 1WI1A 1RJ2A 2YSZA 4Z2MB 4F7HA 4YL8A 4MY6A 3N7CA 2J0JA 4B6HA 3M1IB 2V76A 2YT0A 2R0DA 2Z0PA 1V5PA 1ZC3B 5D3YA 2P8VA 2DLWA 3AJ4A 4MK0A 4ZRJA 1OQNA 2YS1A 1MK9B 3F0WA 2OTXA 3DXCA 1UNRA 1U29A 2ADZA 4ZRIA 2IFSA 3O96A 1MIZB 4HAXB 4WJ7A 3DXDA 4NY0A 1MAIA 2ELBA 2MKRA 4HAWB 1ISNA 2GS0A 3ODXA 1NI2A 4KAXB 2R09A 2DTCA 1PMSA 3D8EA 3U7DA 1GG3A 2OQBA 1U5FA 2YT1A 5J3QA 2VKIA 1U5GA 2NZ8B 2IYBA 1X1FA 2CAYA 4K2PA 1UNPA 2Y8FA 1V5UA 4HAYB 1N3HA 1XX0A 2P0HA 3SYXA 1MIXA 2MWNB 4HAVB 4IOYX 1I2HA 4HB0B 3SUZA 2VRWB 1Y5OA 4GMXB 5D3VA 1M7RA 1B55A 1DROA 2GCLA 3WYFB 4EJNA 4NSWA 4A6HA 3QIJA 1X86A 3KRWA 4K17A 2K2UA 2D9ZA 1DDWA 3TO1A 1BAKA 2I1KA 1WG7A 1QC6A 1V61A 1KI1B 3PG7A 1EAZA 1Y19B 3TFMA 1PLSA 5KQ1A 5CLLB 2EC1A 3FEHA 1EF1A 4K2OA 2I5FA 4TYZA 1Z87A 2DKQA 4EKUA 3DXEA 1K5DB 1J19A 1NTVA 2RGNB 2Q13A 1I7AA 2I1JA 4CYEA 5DH9B 2LOZA 2CY5A 4IAPA 3TCAA 4A6FB 5KQ4A 5FI1A 2N23A 2DHJA 2M38A 3ODOA 4HB2B 5D3XA 4Y94A 2N0YA 2UZRA 1P6SA 1Q67A 4YONA 5JHGA 1TXDA 2KCJA 2DX1A 2K2JA 2Z0OA 3PP2A 5C5BB 2MFQA 5KCVA 1UNQA 4XWXA 2CRFA 2DHKA 3BJIA 2D9XA 2H7EA 3PVWA 3ZDTA 3A8QA 2JP2A 2DYQA 1M7EA 1RRPB 2W2WA 2DHIA 2PZ1A 4KHOA 5HE3A 4P7IA 4HDOA 1WJMA 3BINA 1DYNA 2RNRB 1U5DA 3TVVA 2I5CA 1MK7B 2DFKA 5LOPB 2Y8GA 2COCA 2P0FA 4GN1A 2CY4A 2UZSA 1K5GB 1FHWA 2D9VA 5DHFB 1V88A 4HHVA 3KRXA 1TJ6A 1X05A 4A5KA 5DI9B 1FAOA 1V89A 3HK0A 2L1CA 1E5WA 2ROZB 4CHJA 3KY9A 2DX5A 1UEFA 5EFXA 2CODA 5JP4A 4DX8A 4GZUA 3QBVB 2D9YA 3CXBB 1U5EA 3UZTA 3FM8C 3P6AA 2MDXA 5LONB 2M14A 1EGXA 1OMWA 3NSUA 3ODWA 1J0WA 4DX90 3GYOA 2AL6A 1DDVA 2EJ8A 2HTHB 4IFSA 5DHAB 3A98B 1AQCA 1H10A 3SV1A 2Y7BA 2DA0A 3PZDA 5J3TA 1QQGA 4KHBB 2D9WA 3VIAA 1BTKA 1XR0B 2W2XD 2K00A 4WSFA 2QKMA 4L6EA 2DN6A 1W1GA 4BBKA 2YRYA 2DYNA 1U2BA 3MPXA 5CLQB 5JLJB 3KZ1A 3F5RA 4KHAA 4KVGB 5C6RA 1U27A 1WJ1A 2COAA 3P7ZA 1DDMA 2RVBB 4HAZB 4PQ0A 1SGHA 5D27A 1ZVRA 1WVHA 4MT7A 1OY2A 4HAUB 1XKEA 3SNHA 1LB1A 1V5MA 1EVHA 3ZVRA 2VSZA 1H4RA 4Z2NA 2G35A 3AU4A 1MPHA 5GOWB 2EMTA 1TQZA 2W2XC 1BTNA 1SHCA 3X23A 3TW1A 3D8FA 3OANA 1WGQA 2J59M 2Z0QA 1FHXA 3T06A 4GXBA 3ULCA 4DXAB 3G9WA 1KZ7A 4GMVA 4A6KA 1GC6A 3LJUX 2LG1A 2KUPA 2YS5A 2LOXA 3IVFA 4WVFB 1PFJA 2UVMA 1W1HA 3PSCA 3ULBA 1NTYA 2HE7A 2YF0A 3SO6A 4D0NB 2D2QA 1AWEA 3FSSA 1X1GA 3KSYA 5J3YA 2ROVA 5HE2A 1FGYA 3WA0A 1FOEA 4H8SA 1ZSQA 4F7GA 4CHMA 2GCJA 3PEGA 1UPQA 2LULA 2XQNM 5C79A 1FHOA 5DIFB 1UPRA 3HW2B 3ML4A 3AU5A 5FI0A 2D4QA 3QWMA 2DKPA 1W1DA 3CIKA 2P0DA 2KGXB 2X18A 4A6FA 1BWNA 3MDBC 4ZRKA 1NU2A 2FJLA 1XODA 2D10A 1ZM0A 3HQCA 3U8ZA 4TKNA 2LYDA 2EMSA 1GC7A 2ELAA 2J0KA 1XCGA 1LW3A 4C0AA 2YS3A 1IRSA 1FGZA 2E2XA 2NMBA 2BCJA 2GJYA 3D8DA 5D3WA 1ZC4B 2COFA 2AEHA 5C5BA 2D11A 1DBHA 1KZGA 2LKOA 4DBBA 3V5WA 5HE0A 1P3RA 4HB4B 2RUKB 4F7UP 3VOQA 1FB8A 1P5TA 2RSGA 2H7DA 4HB3B 2RLOA 1X11A 1WGUA 4EMOA 4HDQA 5C16A 5JHHA 2L2IA 5HE1A 1XD4A 3A8PA 4PNKA 2J0MA 2ZPYA 4GPTB 3PVUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QKL A;  2YVC A;  3RCP A;  3GYP A;  4K81 A;  5L81 A;  3PVL A;  4HAT B;  1MKE A;  1WI1 A;  1RJ2 A;  2YSZ A;  4Z2M B;  4F7H A;  4YL8 A;  4MY6 A;  3N7C A;  2J0J A;  4B6H A;  3M1I B;  2V76 A;  2YT0 A;  2R0D A;  2Z0P A;  1V5P A;  1ZC3 B;  5D3Y A;  2P8V A;  2DLW A;  3AJ4 A;  4MK0 A;  4ZRJ A;  1OQN A;  2YS1 A;  1MK9 B;  3F0W A;  2OTX A;  3DXC A;  1UNR A;  1U29 A;  2ADZ A;  4ZRI A;  2IFS A;  3O96 A;  1MIZ B;  4HAX B;  4WJ7 A;  3DXD A;  4NY0 A;  1MAI A;  2ELB A;  2MKR A;  4HAW B;  1ISN A;  2GS0 A;  3ODX A;  1NI2 A;  4KAX B;  2R09 A;  2DTC A;  1PMS A;  3D8E A;  3U7D A;  1GG3 A;  2OQB A;  1U5F A;  2YT1 A;  5J3Q A;  2VKI A;  1U5G A;  2NZ8 B;  2IYB A;  1X1F A;  2CAY A;  4K2P A;  1UNP A;  2Y8F A;  1V5U A;  4HAY B;  1N3H A;  1XX0 A;  2P0H A;  3SYX A;  1MIX A;  2MWN B;  4HAV B;  4IOY X;  1I2H A;  4HB0 B;  3SUZ A;  2VRW B;  1Y5O A;  4GMX B;  5D3V A;  1M7R A;  1B55 A;  1DRO A;  2GCL A;  3WYF B;  4EJN A;  4NSW A;  4A6H A;  3QIJ A;  1X86 A;  3KRW A;  4K17 A;  2K2U A;  2D9Z A;  1DDW A;  3TO1 A;  1BAK A;  2I1K A;  1WG7 A;  1QC6 A;  1V61 A;  1KI1 B;  3PG7 A;  1EAZ A;  1Y19 B;  3TFM A;  1PLS A;  5KQ1 A;  5CLL B;  2EC1 A;  3FEH A;  1EF1 A;  4K2O A;  2I5F A;  4TYZ A;  1Z87 A;  2DKQ A;  4EKU A;  3DXE A;  1K5D B;  1J19 A;  1NTV A;  2RGN B;  2Q13 A;  1I7A A;  2I1J A;  4CYE A;  5DH9 B;  2LOZ A;  2CY5 A;  4IAP A;  3TCA A;  4A6F B;  5KQ4 A;  5FI1 A;  2N23 A;  2DHJ A;  2M38 A;  3ODO A;  4HB2 B;  5D3X A;  4Y94 A;  2N0Y A;  2UZR A;  1P6S A;  1Q67 A;  4YON A;  5JHG A;  1TXD A;  2KCJ A;  2DX1 A;  2K2J A;  2Z0O A;  3PP2 A;  5C5B B;  2MFQ A;  5KCV A;  1UNQ A;  4XWX A;  2CRF A;  2DHK A;  3BJI A;  2D9X A;  2H7E A;  3PVW A;  3ZDT A;  3A8Q A;  2JP2 A;  2DYQ A;  1M7E A;  1RRP B;  2W2W A;  2DHI A;  2PZ1 A;  4KHO A;  5HE3 A;  4P7I A;  4HDO A;  1WJM A;  3BIN A;  1DYN A;  2RNR B;  1U5D A;  3TVV A;  2I5C A;  1MK7 B;  2DFK A;  5LOP B;  2Y8G A;  2COC A;  2P0F A;  4GN1 A;  2CY4 A;  2UZS A;  1K5G B;  1FHW A;  2D9V A;  5DHF B;  1V88 A;  4HHV A;  3KRX A;  1TJ6 A;  1X05 A;  4A5K A;  5DI9 B;  1FAO A;  1V89 A;  3HK0 A;  2L1C A;  1E5W A;  2ROZ B;  4CHJ A;  3KY9 A;  2DX5 A;  1UEF A;  5EFX A;  2COD A;  5JP4 A;  4DX8 A;  4GZU A;  3QBV B;  2D9Y A;  3CXB B;  1U5E A;  3UZT A;  3FM8 C;  3P6A A;  2MDX A;  5LON B;  2M14 A;  1EGX A;  1OMW A;  3NSU A;  3ODW A;  1J0W A;  4DX9 0;  3GYO A;  2AL6 A;  1DDV A;  2EJ8 A;  2HTH B;  4IFS A;  5DHA B;  3A98 B;  1AQC A;  1H10 A;  3SV1 A;  2Y7B A;  2DA0 A;  3PZD A;  5J3T A;  1QQG A;  4KHB B;  2D9W A;  3VIA A;  1BTK A;  1XR0 B;  2W2X D;  2K00 A;  4WSF A;  2QKM A;  4L6E A;  2DN6 A;  1W1G A;  4BBK A;  2YRY A;  2DYN A;  1U2B A;  3MPX A;  5CLQ B;  5JLJ B;  3KZ1 A;  3F5R A;  4KHA A;  4KVG B;  5C6R A;  1U27 A;  1WJ1 A;  2COA A;  3P7Z A;  1DDM A;  2RVB B;  4HAZ B;  4PQ0 A;  1SGH A;  5D27 A;  1ZVR A;  1WVH A;  4MT7 A;  1OY2 A;  4HAU B;  1XKE A;  3SNH A;  1LB1 A;  1V5M A;  1EVH A;  3ZVR A;  2VSZ A;  1H4R A;  4Z2N A;  2G35 A;  3AU4 A;  1MPH A;  5GOW B;  2EMT A;  1TQZ A;  2W2X C;  1BTN A;  1SHC A;  3X23 A;  3TW1 A;  3D8F A;  3OAN A;  1WGQ A;  2J59 M;  2Z0Q A;  1FHX A;  3T06 A;  4GXB A;  3ULC A;  4DXA B;  3G9W A;  1KZ7 A;  4GMV A;  4A6K A;  1GC6 A;  3LJU X;  2LG1 A;  2KUP A;  2YS5 A;  2LOX A;  3IVF A;  4WVF B;  1PFJ A;  2UVM A;  1W1H A;  3PSC A;  3ULB A;  1NTY A;  2HE7 A;  2YF0 A;  3SO6 A;  4D0N B;  2D2Q A;  1AWE A;  3FSS A;  1X1G A;  3KSY A;  5J3Y A;  2ROV A;  5HE2 A;  1FGY A;  3WA0 A;  1FOE A;  4H8S A;  1ZSQ A;  4F7G A;  4CHM A;  2GCJ A;  3PEG A;  1UPQ A;  2LUL A;  2XQN M;  5C79 A;  1FHO A;  5DIF B;  1UPR A;  3HW2 B;  3ML4 A;  3AU5 A;  5FI0 A;  2D4Q A;  3QWM A;  2DKP A;  1W1D A;  3CIK A;  2P0D A;  2KGX B;  2X18 A;  4A6F A;  1BWN A;  3MDB C;  4ZRK A;  1NU2 A;  2FJL A;  1XOD A;  2D10 A;  1ZM0 A;  3HQC A;  3U8Z A;  4TKN A;  2LYD A;  2EMS A;  1GC7 A;  2ELA A;  2J0K A;  1XCG A;  1LW3 A;  4C0A A;  2YS3 A;  1IRS A;  1FGZ A;  2E2X A;  2NMB A;  2BCJ A;  2GJY A;  3D8D A;  5D3W A;  1ZC4 B;  2COF A;  2AEH A;  5C5B A;  2D11 A;  1DBH A;  1KZG A;  2LKO A;  4DBB A;  3V5W A;  5HE0 A;  1P3R A;  4HB4 B;  2RUK B;  4F7U P;  3VOQ A;  1FB8 A;  1P5T A;  2RSG A;  2H7D A;  4HB3 B;  2RLO A;  1X11 A;  1WGU A;  4EMO A;  4HDQ A;  5C16 A;  5JHH A;  2L2I A;  5HE1 A;  1XD4 A;  3A8P A;  4PNK A;  2J0M A;  2ZPY A;  4GPT B;  3PVU A; 
#chains in the Genus database with same CATH topology
 4QJ5 B;  2QKL A;  2KIG A;  2YVC A;  3RCP A;  3GYP A;  4K81 A;  5L81 A;  3PVL A;  2KR0 A;  3OHM B;  4HAT B;  1MKE A;  1WI1 A;  1RJ2 A;  2YSZ A;  4Z2M B;  4F7H A;  4YL8 A;  4MY6 A;  3N7C A;  2J0J A;  4B6H A;  2KUQ A;  3M1I B;  2V76 A;  2YT0 A;  2R0D A;  2Z0P A;  1V5P A;  1ZC3 B;  5D3Y A;  2P8V A;  2DLW A;  3AJ4 A;  4MK0 A;  4ZRJ A;  1OQN A;  2YS1 A;  1MK9 B;  3F0W A;  2OTX A;  3DXC A;  1UNR A;  1U29 A;  2FJU B;  2ADZ A;  4ZRI A;  2IFS A;  3O96 A;  1MIZ B;  4HAX B;  4WJ7 A;  3DXD A;  4NY0 A;  1MAI A;  2ELB A;  2MKR A;  4HAW B;  1ISN A;  2GS0 A;  3ODX A;  1NI2 A;  2RRF A;  4KAX B;  2R09 A;  4D6W A;  2DTC A;  4QXA B;  1PMS A;  3D8E A;  3U7D A;  1GG3 A;  2OQB A;  1U5F A;  2YT1 A;  5J3Q A;  2VKI A;  4KHB A;  1U5G A;  2NZ8 B;  2IYB A;  1X1F A;  2CAY A;  4K2P A;  1UNP A;  2Y8F A;  1V5U A;  4HAY B;  1N3H A;  1XX0 A;  2P0H A;  3SYX A;  1MIX A;  2MWN B;  4HAV B;  4IOY X;  1I2H A;  4HB0 B;  3A58 A;  4QJ4 B;  3SUZ A;  3HIE A;  2VRW B;  1Y5O A;  3U12 A;  4GMX B;  5D3V A;  2Z14 A;  1M7R A;  1B55 A;  1DRO A;  2GCL A;  3WYF B;  4EJN A;  4NSW A;  4A6H A;  3QIJ A;  1X86 A;  3KRW A;  4K17 A;  2K2U A;  2K8E A;  2D9Z A;  1DDW A;  3TO1 A;  1BAK A;  2I1K A;  1WG7 A;  1QC6 A;  1V61 A;  1KI1 B;  1EAZ A;  3PG7 A;  1Y19 B;  3TFM A;  1PLS A;  5KQ1 A;  5CLL B;  2EC1 A;  5IRS A;  3FEH A;  1EF1 A;  4K2O A;  2I5F A;  4TYZ A;  1Z87 A;  2DKQ A;  4EKU A;  3DXE A;  1K5D B;  1J19 A;  1NTV A;  2RGN B;  3DCX A;  4HSI A;  2Q13 A;  1I7A A;  2I1J A;  4CYE A;  5DH9 B;  2LOZ A;  2CY5 A;  4IAP A;  3TCA A;  4A6F B;  5KQ4 A;  5FI1 A;  2N23 A;  2DHJ A;  2M38 A;  3ODO A;  4HB2 B;  5D3X A;  4Y94 A;  2N0Y A;  2UZR A;  1P6S A;  1Q67 A;  4YON A;  5JHG A;  1TXD A;  2KCJ A;  2DX1 A;  2K2J A;  2Z0O A;  2YT2 A;  3PP2 A;  5C5B B;  2MFQ A;  5KCV A;  2GUM A;  1UNQ A;  4XWX A;  2CRF A;  2DHK A;  3BJI A;  2D9X A;  2H7E A;  3PVW A;  3ZDT A;  3A8Q A;  2JP2 A;  2DYQ A;  1M7E A;  1RRP B;  2W2W A;  2DHI A;  2PZ1 A;  4KHO A;  5HE3 A;  2ZKM X;  4P7I A;  4HDO A;  1WJM A;  3BIN A;  1DYN A;  2RNR B;  1U5D A;  3HSA A;  3TVV A;  2I5C A;  5LG4 B;  1MK7 B;  1MI1 A;  2DFK A;  5LOP B;  2Y8G A;  2COC A;  2P0F A;  4GN1 A;  2CY4 A;  2UZS A;  1K5G B;  4CSQ A;  1FHW A;  2D9V A;  5DHF B;  1V88 A;  5I2S A;  4HHV A;  2K49 A;  3KRX A;  1TJ6 A;  1X05 A;  4A5K A;  5DI9 B;  1FAO A;  1V89 A;  3HK0 A;  2L1C A;  1E5W A;  2ROZ B;  4CHJ A;  3KY9 A;  2DX5 A;  1UEF A;  5EFX A;  2COD A;  5JP4 A;  4DX8 A;  4GZU A;  3QBV B;  2D9Y A;  3CXB B;  4QJ3 B;  1U5E A;  3UZT A;  3FM8 C;  3P6A A;  2MDX A;  5LON B;  2M14 A;  1EGX A;  1OMW A;  3NSU A;  3ODW A;  1J0W A;  4DX9 0;  3GYO A;  4L1R A;  2AL6 A;  1DDV A;  2EJ8 A;  2HTH B;  4IFS A;  5DHA B;  3A98 B;  3FVC A;  1AQC A;  1H10 A;  3SV1 A;  2Y7B A;  2DA0 A;  3PZD A;  5J3T A;  2Z13 A;  1QQG A;  4KHB B;  2D9W A;  3VIA A;  1BTK A;  1XR0 B;  2W2X D;  2K00 A;  4WSF A;  2QKM A;  4L6E A;  2DN6 A;  1W1G A;  4GOU A;  4GNK B;  4BBK A;  3NWD A;  2YRY A;  2DYN A;  1U2B A;  3MPX A;  5CLQ B;  5JLJ B;  3KZ1 A;  3F5R A;  4KHA A;  4KVG B;  5C6R A;  1U27 A;  1WJ1 A;  2COA A;  3P7Z A;  2R2Y A;  1DDM A;  2RVB B;  4HAZ B;  4PQ0 A;  1SGH A;  5D27 A;  1ZVR A;  1WVH A;  4MT7 A;  1OY2 A;  5M4Y B;  4HAU B;  1XKE A;  3SNH A;  1LB1 A;  1V5M A;  1EVH A;  3ZVR A;  2VSZ A;  1H4R A;  4Z2N A;  2G35 A;  3AU4 A;  2Z59 A;  4OSN A;  1MPH A;  4OT1 A;  5GOW B;  2EMT A;  5I2M A;  1TQZ A;  2W2X C;  1BTN A;  1SHC A;  3X23 A;  3TW1 A;  3D8F A;  3OAN A;  1WGQ A;  2J59 M;  2Z0Q A;  1FHX A;  3T06 A;  4GXB A;  3ULC A;  4DXA B;  3G9W A;  1KZ7 A;  4GMV A;  4A6K A;  3NWF A;  3B77 A;  1GC6 A;  3LJU X;  2LG1 A;  2KUP A;  2YS5 A;  2LOX A;  3IVF A;  4WVF B;  3NWA A;  1PFJ A;  2UVM A;  1W1H A;  3PSC A;  3ULB A;  1NTY A;  2HE7 A;  2YF0 A;  3SO6 A;  4D0N B;  2D2Q A;  1AWE A;  3FSS A;  1X1G A;  3KSY A;  5J3Y A;  2ROV A;  5HE2 A;  1FGY A;  3WA0 A;  1FOE A;  4H8S A;  1ZSQ A;  4F7G A;  4CHM A;  2GCJ A;  3PEG A;  1UPQ A;  2LUL A;  2XQN M;  5C79 A;  1FHO A;  5DIF B;  1UPR A;  3HW2 B;  3ML4 A;  3AU5 A;  1ZYI A;  5FI0 A;  2D4Q A;  3QWM A;  2DKP A;  1W1D A;  3CIK A;  2P0D A;  2KGX B;  2X18 A;  4A6F A;  1BWN A;  3MDB C;  4ZRK A;  1NU2 A;  2FJL A;  1XOD A;  2D10 A;  1ZM0 A;  3HQC A;  3U8Z A;  4TKN A;  2LYD A;  2EMS A;  1GC7 A;  2ELA A;  2Z4D A;  2J0K A;  1XCG A;  1LW3 A;  4C0A A;  2YS3 A;  1IRS A;  1FGZ A;  2E2X A;  2NMB A;  2BCJ A;  2GJY A;  3D8D A;  5D3W A;  1ZC4 B;  2COF A;  2AEH A;  5C5B A;  2NBV A;  2D11 A;  1DBH A;  1KZG A;  2LKO A;  4DBB A;  3NW8 A;  3V5W A;  1T77 A;  5HE0 A;  1P3R A;  4HB4 B;  2RUK B;  4DIX A;  4F7U P;  3VOQ A;  1FB8 A;  1P5T A;  2RSG A;  2H7D A;  4HB3 B;  2RLO A;  1X11 A;  1WGU A;  4EMO A;  2KIE A;  4HDQ A;  5C16 A;  5JHH A;  2L2I A;  5HE1 A;  1XD4 A;  3A8P A;  4PNK A;  2J0M A;  2ZPY A;  4GPT B;  3PVU A; 
#chains in the Genus database with same CATH homology
 2QKL A;  2YVC A;  3RCP A;  3GYP A;  4K81 A;  5L81 A;  3PVL A;  4HAT B;  1MKE A;  1WI1 A;  1RJ2 A;  2YSZ A;  4Z2M B;  4F7H A;  4YL8 A;  4MY6 A;  3N7C A;  2J0J A;  4B6H A;  3M1I B;  2V76 A;  2YT0 A;  2R0D A;  2Z0P A;  1V5P A;  1ZC3 B;  5D3Y A;  2P8V A;  2DLW A;  3AJ4 A;  4MK0 A;  4ZRJ A;  1OQN A;  2YS1 A;  1MK9 B;  3F0W A;  2OTX A;  3DXC A;  1UNR A;  1U29 A;  2ADZ A;  4ZRI A;  2IFS A;  3O96 A;  1MIZ B;  4HAX B;  4WJ7 A;  3DXD A;  4NY0 A;  1MAI A;  2ELB A;  2MKR A;  4HAW B;  1ISN A;  2GS0 A;  3ODX A;  1NI2 A;  4KAX B;  2R09 A;  2DTC A;  1PMS A;  3D8E A;  3U7D A;  1GG3 A;  2OQB A;  1U5F A;  2YT1 A;  5J3Q A;  2VKI A;  1U5G A;  2NZ8 B;  2IYB A;  1X1F A;  2CAY A;  4K2P A;  1UNP A;  2Y8F A;  1V5U A;  4HAY B;  1N3H A;  1XX0 A;  2P0H A;  3SYX A;  1MIX A;  2MWN B;  4HAV B;  4IOY X;  1I2H A;  4HB0 B;  3SUZ A;  2VRW B;  1Y5O A;  4GMX B;  5D3V A;  1M7R A;  1B55 A;  1DRO A;  2GCL A;  3WYF B;  4EJN A;  4NSW A;  4A6H A;  3QIJ A;  1X86 A;  3KRW A;  4K17 A;  2K2U A;  2D9Z A;  1DDW A;  3TO1 A;  1BAK A;  2I1K A;  1WG7 A;  1QC6 A;  1V61 A;  1KI1 B;  3PG7 A;  1EAZ A;  1Y19 B;  3TFM A;  1PLS A;  5KQ1 A;  5CLL B;  2EC1 A;  3FEH A;  1EF1 A;  4K2O A;  2I5F A;  4TYZ A;  1Z87 A;  2DKQ A;  4EKU A;  3DXE A;  1K5D B;  1J19 A;  1NTV A;  2RGN B;  2Q13 A;  1I7A A;  2I1J A;  4CYE A;  5DH9 B;  2LOZ A;  2CY5 A;  4IAP A;  3TCA A;  4A6F B;  5KQ4 A;  5FI1 A;  2N23 A;  2DHJ A;  2M38 A;  3ODO A;  4HB2 B;  5D3X A;  4Y94 A;  2N0Y A;  2UZR A;  1P6S A;  1Q67 A;  4YON A;  5JHG A;  1TXD A;  2KCJ A;  2DX1 A;  2K2J A;  2Z0O A;  3PP2 A;  5C5B B;  2MFQ A;  5KCV A;  1UNQ A;  4XWX A;  2CRF A;  2DHK A;  3BJI A;  2D9X A;  2H7E A;  3PVW A;  3ZDT A;  3A8Q A;  2JP2 A;  2DYQ A;  1M7E A;  1RRP B;  2W2W A;  2DHI A;  2PZ1 A;  4KHO A;  5HE3 A;  4P7I A;  4HDO A;  1WJM A;  3BIN A;  1DYN A;  2RNR B;  1U5D A;  3TVV A;  2I5C A;  1MK7 B;  2DFK A;  5LOP B;  2Y8G A;  2COC A;  2P0F A;  4GN1 A;  2CY4 A;  2UZS A;  1K5G B;  1FHW A;  2D9V A;  5DHF B;  1V88 A;  4HHV A;  3KRX A;  1TJ6 A;  1X05 A;  4A5K A;  5DI9 B;  1FAO A;  1V89 A;  3HK0 A;  2L1C A;  1E5W A;  2ROZ B;  4CHJ A;  3KY9 A;  2DX5 A;  1UEF A;  5EFX A;  2COD A;  5JP4 A;  4DX8 A;  4GZU A;  3QBV B;  2D9Y A;  3CXB B;  1U5E A;  3UZT A;  3FM8 C;  3P6A A;  2MDX A;  5LON B;  2M14 A;  1EGX A;  1OMW A;  3NSU A;  3ODW A;  1J0W A;  4DX9 0;  3GYO A;  2AL6 A;  1DDV A;  2EJ8 A;  2HTH B;  4IFS A;  5DHA B;  3A98 B;  1AQC A;  1H10 A;  3SV1 A;  2Y7B A;  2DA0 A;  3PZD A;  5J3T A;  1QQG A;  4KHB B;  2D9W A;  3VIA A;  1BTK A;  1XR0 B;  2W2X D;  2K00 A;  4WSF A;  2QKM A;  4L6E A;  2DN6 A;  1W1G A;  4BBK A;  2YRY A;  2DYN A;  1U2B A;  3MPX A;  5CLQ B;  5JLJ B;  3KZ1 A;  3F5R A;  4KHA A;  4KVG B;  5C6R A;  1U27 A;  1WJ1 A;  2COA A;  3P7Z A;  1DDM A;  2RVB B;  4HAZ B;  4PQ0 A;  1SGH A;  5D27 A;  1ZVR A;  1WVH A;  4MT7 A;  1OY2 A;  4HAU B;  1XKE A;  3SNH A;  1LB1 A;  1V5M A;  1EVH A;  3ZVR A;  2VSZ A;  1H4R A;  4Z2N A;  2G35 A;  3AU4 A;  1MPH A;  5GOW B;  2EMT A;  1TQZ A;  2W2X C;  1BTN A;  1SHC A;  3X23 A;  3TW1 A;  3D8F A;  3OAN A;  1WGQ A;  2J59 M;  2Z0Q A;  1FHX A;  3T06 A;  4GXB A;  3ULC A;  4DXA B;  3G9W A;  1KZ7 A;  4GMV A;  4A6K A;  1GC6 A;  3LJU X;  2LG1 A;  2KUP A;  2YS5 A;  2LOX A;  3IVF A;  4WVF B;  1PFJ A;  2UVM A;  1W1H A;  3PSC A;  3ULB A;  1NTY A;  2HE7 A;  2YF0 A;  3SO6 A;  4D0N B;  2D2Q A;  1AWE A;  3FSS A;  1X1G A;  3KSY A;  5J3Y A;  2ROV A;  5HE2 A;  1FGY A;  3WA0 A;  1FOE A;  4H8S A;  1ZSQ A;  4F7G A;  4CHM A;  2GCJ A;  3PEG A;  1UPQ A;  2LUL A;  2XQN M;  5C79 A;  1FHO A;  5DIF B;  1UPR A;  3HW2 B;  3ML4 A;  3AU5 A;  5FI0 A;  2D4Q A;  3QWM A;  2DKP A;  1W1D A;  3CIK A;  2P0D A;  2KGX B;  2X18 A;  4A6F A;  1BWN A;  3MDB C;  4ZRK A;  1NU2 A;  2FJL A;  1XOD A;  2D10 A;  1ZM0 A;  3HQC A;  3U8Z A;  4TKN A;  2LYD A;  2EMS A;  1GC7 A;  2ELA A;  2J0K A;  1XCG A;  1LW3 A;  4C0A A;  2YS3 A;  1IRS A;  1FGZ A;  2E2X A;  2NMB A;  2BCJ A;  2GJY A;  3D8D A;  5D3W A;  1ZC4 B;  2COF A;  2AEH A;  5C5B A;  2D11 A;  1DBH A;  1KZG A;  2LKO A;  4DBB A;  3V5W A;  5HE0 A;  1P3R A;  4HB4 B;  2RUK B;  4F7U P;  3VOQ A;  1FB8 A;  1P5T A;  2RSG A;  2H7D A;  4HB3 B;  2RLO A;  1X11 A;  1WGU A;  4EMO A;  4HDQ A;  5C16 A;  5JHH A;  2L2I A;  5HE1 A;  1XD4 A;  3A8P A;  4PNK A;  2J0M A;  2ZPY A;  4GPT B;  3PVU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...