4XWXA

Crystal structure of the ptb domain of shc
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
167
structure length
160
Chain Sequence
SMGWLHPNDKVMGPGVSYLVRYMGCVEVLQSMRALDFNTRTQVTREAISLVCEAVPGAKGASRPLSSILGRSNLKFAGMPITLTVSTSSLNLMAADCKQIIANHHMQSISFASGGDPDTAEYVAYVAKDPVNQRACHILECPEGLAQDVISTIGQAFELR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SHC-transforming protein 1
publication title Crystal structure of the PTB domain of SHC
rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 43
structure length 160
sequence length 167
ec nomenclature
pdb deposition date 2015-01-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 4xwxA00
1PLSA 1FHOA 3ULCA 1RRPB 3V5WA 5C5BA 5C79A 1X11A 2YS1A 3TVVA 4A6FB 4HAVB 2JP2A 4MY6A 2W2XC 1M7EA 1ZM0A 2LULA 1IRSA 1GG3A 1I2HA 1X1GA 2ROZB 4P7IA 2ZPYA 3X23A 5J3YA 2QKMA 2Z0PA 2M14A 4WSFA 5HE3A 4KAXB 2ROVA 3IVFA 1V89A 2DKPA 2EJ8A 3SUZA 1TXDA 1E5WA 4CHMA 3PVWA 4K81A 4H8SA 5JHHA 1KI1B 1BTNA 5GOWB 3FM8C 5DI9B 1N3HA 1GC7A 2DN6A 4HDQA 2RVBB 1BTKA 3QBVB 5D3YA 1LW3A 2D9XA 3T06A 1TJ6A 2GS0A 5KCVA 2DHKA 2LKOA 2BCJA 1XR0B 4ZRIA 1TQZA 3PG7A 1MK7B 2J59M 1UNRA 4ZRJA 4MT7A 3LJUX 3O96A 1OY2A 2EMTA 1P6SA 4DXAB 1I7AA 4GXBA 2YSZA 4CYEA 2DHIA 2X18A 5D3WA 1U29A 1ZVRA 1PFJA 1BWNA 1WJMA 1DYNA 2PZ1A 4DX8A 2G35A 3DXDA 3GYOA 1Z87A 1W1GA 1PMSA 1X86A 1WG7A 4EKUA 5DHAB 2GCJA 2UVMA 2P8VA 2E2XA 1XX0A 2VKIA 1NI2A 4TKNA 3FEHA 5DHFB 1BAKA 1UNPA 5FI0A 5C6RA 1DROA 1X05A 2V76A 4IOYX 3MPXA 2ELAA 2P0HA 1NTVA 1ISNA 1W1HA 1FAOA 2J0JA 2IYBA 2H7DA 2DLWA 1FGYA 5KQ4A 4EMOA 1MIZB 2YF0A 2D11A 3GYPA 4WVFB 1XKEA 5HE2A 2EC1A 3SNHA 2I5CA 2GCLA 1J0WA 4KHBB 4A5KA 1XD4A 2VSZA 4Z2NA 2DHJA 2DYNA 1UPRA 3SO6A 5LONB 2MKRA 3A8QA 4IFSA 1MPHA 1QC6A 2Q13A 5C16A 3KY9A 1DDVA 3FSSA 3PEGA 4B6HA 5J3QA 3SYXA 1MK9B 3RCPA 3PP2A 1GC6A 3AJ4A 2K2JA 5DH9B 3TW1A 2Y8FA 2OQBA 2COAA 5JLJB 2L2IA 2LYDA 3KRXA 2NZ8B 2RGNB 4HAUB 3AU4A 2DA0A 1WJ1A 2MWNB 5CLQB 2XQNM 3ODXA 5C5BB 4A6KA 2Y7BA 1Y19B 2KCJA 5JHGA 2P0FA 2COCA 3SV1A 4BBKA 2AL6A 4NSWA 1V88A 3QIJA 5LOPB 3F0WA 1EAZA 3ML4A 1DDMA 3BINA 4PQ0A 5HE0A 3PZDA 2I1JA 2UZSA 5D3VA 3D8EA 1V5PA 2DTCA 2RSGA 4HB0B 2CRFA 3ODWA 1H4RA 2J0MA 3KRWA 4HB3B 4PNKA 1ZC4B 1DDWA 5JP4A 1X1FA 5D27A 3TFMA 1FB8A 2K00A 2D9YA 3U7DA 3N7CA 3PVLA 3WYFB 2H7EA 3CXBB 1OMWA 1FHXA 3PVUA 4MK0A 3AU5A 1EF1A 2NMBA 2Y8GA 1FOEA 2EMSA 2K2UA 1AQCA 4GPTB 4YL8A 2R09A 3VIAA 1U5FA 1XCGA 3P7ZA 2LG1A 1ZC3B 2I1KA 4WJ7A 2RNRB 1UNQA 4K2OA 4YONA 2YRYA 1EGXA 3DXCA 4HB4B 3HK0A 2DX1A 2D9WA 4F7UP 4IAPA 3VOQA 2DKQA 5CLLB 1MKEA 4HB2B 4L6EA 4KHAA 2CY5A 2VRWB 5D3XA 4A6FA 2DFKA 2D10A 1AWEA 4DX90 4A6HA 3KSYA 2CY4A 1W1DA 1V5MA 4GN1A 2Z0QA 3D8DA 2MFQA 2ADZA 4Z2MB 1FGZA 3ULBA 1LB1A 2FJLA 1EVHA 4D0NB 3PSCA 2L1CA 2KGXB 4HAXB 2LOXA 3ZDTA 2YS3A 2MDXA 3M1IB 4HATB 3DXEA 1RJ2A 1FHWA 4DBBA 2COFA 1KZGA 3QWMA 2M38A 3OANA 4F7HA 1MAIA 2W2XD 3KZ1A 4HHVA 2P0DA 1U27A 2LOZA 1UPQA 1NU2A 1WGQA 2R0DA 4HAWB 5L81A 3G9WA 2Z0OA 3ZVRA 2RLOA 4TYZA 5HE1A 2IFSA 2D9VA 4ZRKA 3A8PA 1UEFA 3TO1A 5DIFB 1QQGA 3MDBC 3F5RA 3CIKA 3A98B 4HAYB 1U5EA 2DX5A 2KUPA 2OTXA 5EFXA 3WA0A 2RUKB 3BJIA 3HW2B 2N0YA 2YS5A 5FI1A 2D4QA 2YT0A 2YVCA 2D9ZA 4Y94A 1P3RA 1ZSQA 2J0KA 1WI1A 2N23A 1V61A 2W2WA 1XODA 4KHOA 1OQNA 2ELBA 3HQCA 3D8FA 1SGHA 1B55A 4K17A 5J3TA 4F7GA 1Q67A 1DBHA 1J19A 2HTHB 1WVHA 2D2QA 4GMXB 4GMVA 1V5UA 3NSUA 1K5DB 1K5GB 2DYQA 3UZTA 1H10A 1KZ7A 1P5TA 4HDOA 2AEHA 1U2BA 5KQ1A 2GJYA 1WGUA 2QKLA 3ODOA 4C0AA 1M7RA 1SHCA 2CODA 2UZRA 2I5FA 4XWXA 1NTYA 2HE7A 4K2PA 4EJNA 4HAZB 4NY0A 3P6AA 3U8ZA 1Y5OA 2YT1A 2CAYA 4GZUA 3TCAA 1MIXA 4KVGB 1U5GA 1U5DA 4CHJA
chains in the Genus database with same CATH superfamily
1PLSA 1FHOA 3ULCA 1RRPB 3V5WA 5C5BA 5C79A 1X11A 2YS1A 3TVVA 4A6FB 3NWFA 4HAVB 3HSAA 2JP2A 4MY6A 2W2XC 1M7EA 5I2MA 4DIXA 1ZM0A 2LULA 1IRSA 1GG3A 1I2HA 1X1GA 2ROZB 4P7IA 2ZPYA 3X23A 5J3YA 2QKMA 2Z0PA 2M14A 4WSFA 5HE3A 3U12A 2Z4DA 4KAXB 2ROVA 3IVFA 1V89A 2DKPA 2KIGA 2EJ8A 3SUZA 1TXDA 1E5WA 4CHMA 3PVWA 4K81A 4H8SA 5JHHA 2GUMA 4CSQA 1KI1B 1BTNA 5GOWB 3FM8C 4L1RA 5DI9B 1N3HA 1GC7A 2DN6A 4HDQA 5M4YB 2RVBB 1BTKA 3QBVB 4D6WA 5D3YA 4QXAB 1LW3A 2D9XA 3T06A 1TJ6A 2GS0A 5KCVA 2DHKA 2LKOA 2BCJA 1XR0B 4ZRIA 1TQZA 3PG7A 1MK7B 2J59M 1UNRA 4ZRJA 4MT7A 3LJUX 3O96A 4QJ3B 1OY2A 2EMTA 1P6SA 4DXAB 1I7AA 4GXBA 4QJ5B 2YSZA 4CYEA 2DHIA 2X18A 5D3WA 1U29A 1ZVRA 1PFJA 1BWNA 1WJMA 1DYNA 2PZ1A 2Z59A 4DX8A 2G35A 3DXDA 3GYOA 1Z87A 1W1GA 2RRFA 1PMSA 1X86A 1WG7A 4EKUA 5LG4B 5DHAB 2GCJA 2UVMA 2P8VA 2E2XA 1XX0A 2VKIA 1NI2A 4TKNA 3FEHA 5DHFB 1BAKA 3OHMB 1UNPA 3DCXA 5FI0A 5C6RA 1DROA 1X05A 2V76A 4IOYX 3MPXA 2ELAA 2P0HA 1NTVA 1ISNA 1W1HA 1FAOA 2J0JA 2IYBA 2H7DA 2DLWA 1FGYA 5KQ4A 4EMOA 1MIZB 2YF0A 2D11A 3GYPA 4WVFB 1XKEA 5HE2A 2EC1A 3SNHA 2I5CA 2GCLA 1J0WA 4KHBB 4A5KA 1XD4A 2VSZA 2Z14A 4Z2NA 2DHJA 2DYNA 1UPRA 3SO6A 5LONB 2MKRA 3NW8A 3A8QA 4IFSA 1MPHA 1QC6A 2Q13A 5C16A 3KY9A 1DDVA 3FSSA 3PEGA 4B6HA 5J3QA 3SYXA 1MK9B 3RCPA 3PP2A 1GC6A 3AJ4A 3NWAA 2K2JA 5DH9B 3TW1A 2Y8FA 2OQBA 2COAA 5JLJB 2L2IA 2YT2A 2LYDA 3KRXA 2NZ8B 2RGNB 4HAUB 3AU4A 2DA0A 1WJ1A 2MWNB 5CLQB 2XQNM 3ODXA 4GNKB 5C5BB 4A6KA 2Y7BA 1Y19B 2KCJA 5JHGA 2P0FA 2COCA 3SV1A 4BBKA 2AL6A 4NSWA 1V88A 3QIJA 5LOPB 3F0WA 1EAZA 3ML4A 1DDMA 3BINA 4PQ0A 5HE0A 1MI1A 3PZDA 2I1JA 2UZSA 2K8EA 5D3VA 3D8EA 1V5PA 2DTCA 2RSGA 4HB0B 2CRFA 3ODWA 1H4RA 2J0MA 3KRWA 4HB3B 4PNKA 1ZC4B 1DDWA 5JP4A 1X1FA 5D27A 3TFMA 1FB8A 2K00A 2D9YA 3U7DA 3N7CA 3PVLA 3WYFB 2H7EA 3CXBB 2FJUB 1OMWA 1FHXA 3PVUA 4MK0A 3AU5A 3A58A 1EF1A 2NMBA 2KUQA 2Y8GA 1FOEA 2EMSA 4GOUA 2K2UA 1AQCA 4GPTB 4YL8A 2R09A 3VIAA 1U5FA 1XCGA 3P7ZA 2LG1A 1ZC3B 2I1KA 4WJ7A 2K49A 2RNRB 1UNQA 4K2OA 4YONA 2YRYA 1EGXA 3DXCA 4HB4B 3HK0A 2DX1A 4KHBA 2D9WA 4F7UP 4IAPA 3VOQA 2DKQA 5CLLB 1MKEA 4HB2B 4L6EA 4KHAA 2CY5A 2VRWB 5D3XA 4A6FA 2DFKA 2D10A 1AWEA 4DX90 4A6HA 2KR0A 3KSYA 2CY4A 1W1DA 3B77A 1V5MA 4GN1A 2Z0QA 3D8DA 2MFQA 2ADZA 4Z2MB 1FGZA 3ULBA 1LB1A 2FJLA 1EVHA 4D0NB 3PSCA 2L1CA 2KGXB 1T77A 4HAXB 2LOXA 3ZDTA 2YS3A 2MDXA 3M1IB 4HATB 3DXEA 1RJ2A 1FHWA 4DBBA 2COFA 1KZGA 3QWMA 2M38A 3OANA 4F7HA 1MAIA 2W2XD 3KZ1A 4HHVA 2P0DA 1U27A 5I2SA 2LOZA 1UPQA 1NU2A 2NBVA 1WGQA 2R0DA 4HAWB 5L81A 3G9WA 4HSIA 2Z0OA 3ZVRA 2RLOA 4TYZA 5HE1A 3HIEA 2IFSA 4OT1A 2D9VA 4ZRKA 3A8PA 1UEFA 3TO1A 5DIFB 1QQGA 3MDBC 3F5RA 3CIKA 3A98B 4HAYB 1U5EA 2DX5A 2KUPA 2OTXA 5EFXA 3WA0A 2RUKB 2KIEA 3BJIA 3HW2B 2N0YA 2YS5A 3NWDA 5FI1A 2D4QA 2YT0A 2YVCA 2D9ZA 4Y94A 1P3RA 1ZSQA 2J0KA 5IRSA 1WI1A 2N23A 1V61A 1ZYIA 2W2WA 1XODA 4KHOA 1OQNA 2ELBA 3HQCA 3D8FA 2R2YA 1SGHA 4QJ4B 1B55A 4K17A 5J3TA 4F7GA 1Q67A 1DBHA 1J19A 2HTHB 1WVHA 2D2QA 4GMXB 4GMVA 4OSNA 1V5UA 3NSUA 1K5DB 1K5GB 2DYQA 3UZTA 1H10A 1KZ7A 1P5TA 4HDOA 2AEHA 1U2BA 5KQ1A 2GJYA 1WGUA 3FVCA 2QKLA 3ODOA 4C0AA 1M7RA 1SHCA 2CODA 2UZRA 2I5FA 4XWXA 1NTYA 2HE7A 4K2PA 4EJNA 2Z13A 4HAZB 4NY0A 2ZKMX 3P6AA 3U8ZA 1Y5OA 2YT1A 2CAYA 4GZUA 3TCAA 1MIXA 4KVGB 1U5GA 1U5DA 4CHJA
chains in the Genus database with same CATH topology
1PLSA 1FHOA 3ULCA 1RRPB 3V5WA 5C5BA 5C79A 1X11A 2YS1A 3TVVA 4A6FB 4HAVB 2JP2A 4MY6A 2W2XC 1M7EA 1ZM0A 2LULA 1IRSA 1GG3A 1I2HA 1X1GA 2ROZB 4P7IA 2ZPYA 3X23A 5J3YA 2QKMA 2Z0PA 2M14A 4WSFA 5HE3A 4KAXB 2ROVA 3IVFA 1V89A 2DKPA 2EJ8A 3SUZA 1TXDA 1E5WA 4CHMA 3PVWA 4K81A 4H8SA 5JHHA 1KI1B 1BTNA 5GOWB 3FM8C 5DI9B 1N3HA 1GC7A 2DN6A 4HDQA 2RVBB 1BTKA 3QBVB 5D3YA 1LW3A 2D9XA 3T06A 1TJ6A 2GS0A 5KCVA 2DHKA 2LKOA 2BCJA 1XR0B 4ZRIA 1TQZA 3PG7A 1MK7B 2J59M 1UNRA 4ZRJA 4MT7A 3LJUX 3O96A 1OY2A 2EMTA 1P6SA 4DXAB 1I7AA 4GXBA 2YSZA 4CYEA 2DHIA 2X18A 5D3WA 1U29A 1ZVRA 1PFJA 1BWNA 1WJMA 1DYNA 2PZ1A 4DX8A 2G35A 3DXDA 3GYOA 1Z87A 1W1GA 1PMSA 1X86A 1WG7A 4EKUA 5DHAB 2GCJA 2UVMA 2P8VA 2E2XA 1XX0A 2VKIA 1NI2A 4TKNA 3FEHA 5DHFB 1BAKA 1UNPA 5FI0A 5C6RA 1DROA 1X05A 2V76A 4IOYX 3MPXA 2ELAA 2P0HA 1NTVA 1ISNA 1W1HA 1FAOA 2J0JA 2IYBA 2H7DA 2DLWA 1FGYA 5KQ4A 4EMOA 1MIZB 2YF0A 2D11A 3GYPA 4WVFB 1XKEA 5HE2A 2EC1A 3SNHA 2I5CA 2GCLA 1J0WA 4KHBB 4A5KA 1XD4A 2VSZA 4Z2NA 2DHJA 2DYNA 1UPRA 3SO6A 5LONB 2MKRA 3A8QA 4IFSA 1MPHA 1QC6A 2Q13A 5C16A 3KY9A 1DDVA 3FSSA 3PEGA 4B6HA 5J3QA 3SYXA 1MK9B 3RCPA 3PP2A 1GC6A 3AJ4A 2K2JA 5DH9B 3TW1A 2Y8FA 2OQBA 2COAA 5JLJB 2L2IA 2LYDA 3KRXA 2NZ8B 2RGNB 4HAUB 3AU4A 2DA0A 1WJ1A 2MWNB 5CLQB 2XQNM 3ODXA 5C5BB 4A6KA 2Y7BA 1Y19B 2KCJA 5JHGA 2P0FA 2COCA 3SV1A 4BBKA 2AL6A 4NSWA 1V88A 3QIJA 5LOPB 3F0WA 1EAZA 3ML4A 1DDMA 3BINA 4PQ0A 5HE0A 3PZDA 2I1JA 2UZSA 5D3VA 3D8EA 1V5PA 2DTCA 2RSGA 4HB0B 2CRFA 3ODWA 1H4RA 2J0MA 3KRWA 4HB3B 4PNKA 1ZC4B 1DDWA 5JP4A 1X1FA 5D27A 3TFMA 1FB8A 2K00A 2D9YA 3U7DA 3N7CA 3PVLA 3WYFB 2H7EA 3CXBB 1OMWA 1FHXA 3PVUA 4MK0A 3AU5A 1EF1A 2NMBA 2Y8GA 1FOEA 2EMSA 2K2UA 1AQCA 4GPTB 4YL8A 2R09A 3VIAA 1U5FA 1XCGA 3P7ZA 2LG1A 1ZC3B 2I1KA 4WJ7A 2RNRB 1UNQA 4K2OA 4YONA 2YRYA 1EGXA 3DXCA 4HB4B 3HK0A 2DX1A 2D9WA 4F7UP 4IAPA 3VOQA 2DKQA 5CLLB 1MKEA 4HB2B 4L6EA 4KHAA 2CY5A 2VRWB 5D3XA 4A6FA 2DFKA 2D10A 1AWEA 4DX90 4A6HA 3KSYA 2CY4A 1W1DA 1V5MA 4GN1A 2Z0QA 3D8DA 2MFQA 2ADZA 4Z2MB 1FGZA 3ULBA 1LB1A 2FJLA 1EVHA 4D0NB 3PSCA 2L1CA 2KGXB 4HAXB 2LOXA 3ZDTA 2YS3A 2MDXA 3M1IB 4HATB 3DXEA 1RJ2A 1FHWA 4DBBA 2COFA 1KZGA 3QWMA 2M38A 3OANA 4F7HA 1MAIA 2W2XD 3KZ1A 4HHVA 2P0DA 1U27A 2LOZA 1UPQA 1NU2A 1WGQA 2R0DA 4HAWB 5L81A 3G9WA 2Z0OA 3ZVRA 2RLOA 4TYZA 5HE1A 2IFSA 2D9VA 4ZRKA 3A8PA 1UEFA 3TO1A 5DIFB 1QQGA 3MDBC 3F5RA 3CIKA 3A98B 4HAYB 1U5EA 2DX5A 2KUPA 2OTXA 5EFXA 3WA0A 2RUKB 3BJIA 3HW2B 2N0YA 2YS5A 5FI1A 2D4QA 2YT0A 2YVCA 2D9ZA 4Y94A 1P3RA 1ZSQA 2J0KA 1WI1A 2N23A 1V61A 2W2WA 1XODA 4KHOA 1OQNA 2ELBA 3HQCA 3D8FA 1SGHA 1B55A 4K17A 5J3TA 4F7GA 1Q67A 1DBHA 1J19A 2HTHB 1WVHA 2D2QA 4GMXB 4GMVA 1V5UA 3NSUA 1K5DB 1K5GB 2DYQA 3UZTA 1H10A 1KZ7A 1P5TA 4HDOA 2AEHA 1U2BA 5KQ1A 2GJYA 1WGUA 2QKLA 3ODOA 4C0AA 1M7RA 1SHCA 2CODA 2UZRA 2I5FA 4XWXA 1NTYA 2HE7A 4K2PA 4EJNA 4HAZB 4NY0A 3P6AA 3U8ZA 1Y5OA 2YT1A 2CAYA 4GZUA 3TCAA 1MIXA 4KVGB 1U5GA 1U5DA 4CHJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PLS A;  1FHO A;  3ULC A;  1RRP B;  3V5W A;  5C5B A;  5C79 A;  1X11 A;  2YS1 A;  3TVV A;  4A6F B;  4HAV B;  2JP2 A;  4MY6 A;  2W2X C;  1M7E A;  1ZM0 A;  2LUL A;  1IRS A;  1GG3 A;  1I2H A;  1X1G A;  2ROZ B;  4P7I A;  2ZPY A;  3X23 A;  5J3Y A;  2QKM A;  2Z0P A;  2M14 A;  4WSF A;  5HE3 A;  4KAX B;  2ROV A;  3IVF A;  1V89 A;  2DKP A;  2EJ8 A;  3SUZ A;  1TXD A;  1E5W A;  4CHM A;  3PVW A;  4K81 A;  4H8S A;  5JHH A;  1KI1 B;  1BTN A;  5GOW B;  3FM8 C;  5DI9 B;  1N3H A;  1GC7 A;  2DN6 A;  4HDQ A;  2RVB B;  1BTK A;  3QBV B;  5D3Y A;  1LW3 A;  2D9X A;  3T06 A;  1TJ6 A;  2GS0 A;  5KCV A;  2DHK A;  2LKO A;  2BCJ A;  1XR0 B;  4ZRI A;  1TQZ A;  3PG7 A;  1MK7 B;  2J59 M;  1UNR A;  4ZRJ A;  4MT7 A;  3LJU X;  3O96 A;  1OY2 A;  2EMT A;  1P6S A;  4DXA B;  1I7A A;  4GXB A;  2YSZ A;  4CYE A;  2DHI A;  2X18 A;  5D3W A;  1U29 A;  1ZVR A;  1PFJ A;  1BWN A;  1WJM A;  1DYN A;  2PZ1 A;  4DX8 A;  2G35 A;  3DXD A;  3GYO A;  1Z87 A;  1W1G A;  1PMS A;  1X86 A;  1WG7 A;  4EKU A;  5DHA B;  2GCJ A;  2UVM A;  2P8V A;  2E2X A;  1XX0 A;  2VKI A;  1NI2 A;  4TKN A;  3FEH A;  5DHF B;  1BAK A;  1UNP A;  5FI0 A;  5C6R A;  1DRO A;  1X05 A;  2V76 A;  4IOY X;  3MPX A;  2ELA A;  2P0H A;  1NTV A;  1ISN A;  1W1H A;  1FAO A;  2J0J A;  2IYB A;  2H7D A;  2DLW A;  1FGY A;  5KQ4 A;  4EMO A;  1MIZ B;  2YF0 A;  2D11 A;  3GYP A;  4WVF B;  1XKE A;  5HE2 A;  2EC1 A;  3SNH A;  2I5C A;  2GCL A;  1J0W A;  4KHB B;  4A5K A;  1XD4 A;  2VSZ A;  4Z2N A;  2DHJ A;  2DYN A;  1UPR A;  3SO6 A;  5LON B;  2MKR A;  3A8Q A;  4IFS A;  1MPH A;  1QC6 A;  2Q13 A;  5C16 A;  3KY9 A;  1DDV A;  3FSS A;  3PEG A;  4B6H A;  5J3Q A;  3SYX A;  1MK9 B;  3RCP A;  3PP2 A;  1GC6 A;  3AJ4 A;  2K2J A;  5DH9 B;  3TW1 A;  2Y8F A;  2OQB A;  2COA A;  5JLJ B;  2L2I A;  2LYD A;  3KRX A;  2NZ8 B;  2RGN B;  4HAU B;  3AU4 A;  2DA0 A;  1WJ1 A;  2MWN B;  5CLQ B;  2XQN M;  3ODX A;  5C5B B;  4A6K A;  2Y7B A;  1Y19 B;  2KCJ A;  5JHG A;  2P0F A;  2COC A;  3SV1 A;  4BBK A;  2AL6 A;  4NSW A;  1V88 A;  3QIJ A;  5LOP B;  3F0W A;  1EAZ A;  3ML4 A;  1DDM A;  3BIN A;  4PQ0 A;  5HE0 A;  3PZD A;  2I1J A;  2UZS A;  5D3V A;  3D8E A;  1V5P A;  2DTC A;  2RSG A;  4HB0 B;  2CRF A;  3ODW A;  1H4R A;  2J0M A;  3KRW A;  4HB3 B;  4PNK A;  1ZC4 B;  1DDW A;  5JP4 A;  1X1F A;  5D27 A;  3TFM A;  1FB8 A;  2K00 A;  2D9Y A;  3U7D A;  3N7C A;  3PVL A;  3WYF B;  2H7E A;  3CXB B;  1OMW A;  1FHX A;  3PVU A;  4MK0 A;  3AU5 A;  1EF1 A;  2NMB A;  2Y8G A;  1FOE A;  2EMS A;  2K2U A;  1AQC A;  4GPT B;  4YL8 A;  2R09 A;  3VIA A;  1U5F A;  1XCG A;  3P7Z A;  2LG1 A;  1ZC3 B;  2I1K A;  4WJ7 A;  2RNR B;  1UNQ A;  4K2O A;  4YON A;  2YRY A;  1EGX A;  3DXC A;  4HB4 B;  3HK0 A;  2DX1 A;  2D9W A;  4F7U P;  4IAP A;  3VOQ A;  2DKQ A;  5CLL B;  1MKE A;  4HB2 B;  4L6E A;  4KHA A;  2CY5 A;  2VRW B;  5D3X A;  4A6F A;  2DFK A;  2D10 A;  1AWE A;  4DX9 0;  4A6H A;  3KSY A;  2CY4 A;  1W1D A;  1V5M A;  4GN1 A;  2Z0Q A;  3D8D A;  2MFQ A;  2ADZ A;  4Z2M B;  1FGZ A;  3ULB A;  1LB1 A;  2FJL A;  1EVH A;  4D0N B;  3PSC A;  2L1C A;  2KGX B;  4HAX B;  2LOX A;  3ZDT A;  2YS3 A;  2MDX A;  3M1I B;  4HAT B;  3DXE A;  1RJ2 A;  1FHW A;  4DBB A;  2COF A;  1KZG A;  3QWM A;  2M38 A;  3OAN A;  4F7H A;  1MAI A;  2W2X D;  3KZ1 A;  4HHV A;  2P0D A;  1U27 A;  2LOZ A;  1UPQ A;  1NU2 A;  1WGQ A;  2R0D A;  4HAW B;  5L81 A;  3G9W A;  2Z0O A;  3ZVR A;  2RLO A;  4TYZ A;  5HE1 A;  2IFS A;  2D9V A;  4ZRK A;  3A8P A;  1UEF A;  3TO1 A;  5DIF B;  1QQG A;  3MDB C;  3F5R A;  3CIK A;  3A98 B;  4HAY B;  1U5E A;  2DX5 A;  2KUP A;  2OTX A;  5EFX A;  3WA0 A;  2RUK B;  3BJI A;  3HW2 B;  2N0Y A;  2YS5 A;  5FI1 A;  2D4Q A;  2YT0 A;  2YVC A;  2D9Z A;  4Y94 A;  1P3R A;  1ZSQ A;  2J0K A;  1WI1 A;  2N23 A;  1V61 A;  2W2W A;  1XOD A;  4KHO A;  1OQN A;  2ELB A;  3HQC A;  3D8F A;  1SGH A;  1B55 A;  4K17 A;  5J3T A;  4F7G A;  1Q67 A;  1DBH A;  1J19 A;  2HTH B;  1WVH A;  2D2Q A;  4GMX B;  4GMV A;  1V5U A;  3NSU A;  1K5D B;  1K5G B;  2DYQ A;  3UZT A;  1H10 A;  1KZ7 A;  1P5T A;  4HDO A;  2AEH A;  1U2B A;  5KQ1 A;  2GJY A;  1WGU A;  2QKL A;  3ODO A;  4C0A A;  1M7R A;  1SHC A;  2COD A;  2UZR A;  2I5F A;  4XWX A;  1NTY A;  2HE7 A;  4K2P A;  4EJN A;  4HAZ B;  4NY0 A;  3P6A A;  3U8Z A;  1Y5O A;  2YT1 A;  2CAY A;  4GZU A;  3TCA A;  1MIX A;  4KVG B;  1U5G A;  1U5D A;  4CHJ A; 
#chains in the Genus database with same CATH topology
 1PLS A;  1FHO A;  3ULC A;  1RRP B;  3V5W A;  5C5B A;  5C79 A;  1X11 A;  2YS1 A;  3TVV A;  4A6F B;  3NWF A;  4HAV B;  3HSA A;  2JP2 A;  4MY6 A;  2W2X C;  1M7E A;  5I2M A;  4DIX A;  1ZM0 A;  2LUL A;  1IRS A;  1GG3 A;  1I2H A;  1X1G A;  2ROZ B;  4P7I A;  2ZPY A;  3X23 A;  5J3Y A;  2QKM A;  2Z0P A;  2M14 A;  4WSF A;  5HE3 A;  3U12 A;  2Z4D A;  4KAX B;  2ROV A;  3IVF A;  1V89 A;  2DKP A;  2KIG A;  2EJ8 A;  3SUZ A;  1TXD A;  1E5W A;  4CHM A;  3PVW A;  4K81 A;  4H8S A;  5JHH A;  2GUM A;  4CSQ A;  1KI1 B;  1BTN A;  5GOW B;  3FM8 C;  4L1R A;  5DI9 B;  1N3H A;  1GC7 A;  2DN6 A;  4HDQ A;  5M4Y B;  2RVB B;  1BTK A;  3QBV B;  4D6W A;  5D3Y A;  4QXA B;  1LW3 A;  2D9X A;  3T06 A;  1TJ6 A;  2GS0 A;  5KCV A;  2DHK A;  2LKO A;  2BCJ A;  1XR0 B;  4ZRI A;  1TQZ A;  3PG7 A;  1MK7 B;  2J59 M;  1UNR A;  4ZRJ A;  4MT7 A;  3LJU X;  3O96 A;  4QJ3 B;  1OY2 A;  2EMT A;  1P6S A;  4DXA B;  1I7A A;  4GXB A;  4QJ5 B;  2YSZ A;  4CYE A;  2DHI A;  2X18 A;  5D3W A;  1U29 A;  1ZVR A;  1PFJ A;  1BWN A;  1WJM A;  1DYN A;  2PZ1 A;  2Z59 A;  4DX8 A;  2G35 A;  3DXD A;  3GYO A;  1Z87 A;  1W1G A;  2RRF A;  1PMS A;  1X86 A;  1WG7 A;  4EKU A;  5LG4 B;  5DHA B;  2GCJ A;  2UVM A;  2P8V A;  2E2X A;  1XX0 A;  2VKI A;  1NI2 A;  4TKN A;  3FEH A;  5DHF B;  1BAK A;  3OHM B;  1UNP A;  3DCX A;  5FI0 A;  5C6R A;  1DRO A;  1X05 A;  2V76 A;  4IOY X;  3MPX A;  2ELA A;  2P0H A;  1NTV A;  1ISN A;  1W1H A;  1FAO A;  2J0J A;  2IYB A;  2H7D A;  2DLW A;  1FGY A;  5KQ4 A;  4EMO A;  1MIZ B;  2YF0 A;  2D11 A;  3GYP A;  4WVF B;  1XKE A;  5HE2 A;  2EC1 A;  3SNH A;  2I5C A;  2GCL A;  1J0W A;  4KHB B;  4A5K A;  1XD4 A;  2VSZ A;  2Z14 A;  4Z2N A;  2DHJ A;  2DYN A;  1UPR A;  3SO6 A;  5LON B;  2MKR A;  3NW8 A;  3A8Q A;  4IFS A;  1MPH A;  1QC6 A;  2Q13 A;  5C16 A;  3KY9 A;  1DDV A;  3FSS A;  3PEG A;  4B6H A;  5J3Q A;  3SYX A;  1MK9 B;  3RCP A;  3PP2 A;  1GC6 A;  3AJ4 A;  3NWA A;  2K2J A;  5DH9 B;  3TW1 A;  2Y8F A;  2OQB A;  2COA A;  5JLJ B;  2L2I A;  2YT2 A;  2LYD A;  3KRX A;  2NZ8 B;  2RGN B;  4HAU B;  3AU4 A;  2DA0 A;  1WJ1 A;  2MWN B;  5CLQ B;  2XQN M;  3ODX A;  4GNK B;  5C5B B;  4A6K A;  2Y7B A;  1Y19 B;  2KCJ A;  5JHG A;  2P0F A;  2COC A;  3SV1 A;  4BBK A;  2AL6 A;  4NSW A;  1V88 A;  3QIJ A;  5LOP B;  3F0W A;  1EAZ A;  3ML4 A;  1DDM A;  3BIN A;  4PQ0 A;  5HE0 A;  1MI1 A;  3PZD A;  2I1J A;  2UZS A;  2K8E A;  5D3V A;  3D8E A;  1V5P A;  2DTC A;  2RSG A;  4HB0 B;  2CRF A;  3ODW A;  1H4R A;  2J0M A;  3KRW A;  4HB3 B;  4PNK A;  1ZC4 B;  1DDW A;  5JP4 A;  1X1F A;  5D27 A;  3TFM A;  1FB8 A;  2K00 A;  2D9Y A;  3U7D A;  3N7C A;  3PVL A;  3WYF B;  2H7E A;  3CXB B;  2FJU B;  1OMW A;  1FHX A;  3PVU A;  4MK0 A;  3AU5 A;  3A58 A;  1EF1 A;  2NMB A;  2KUQ A;  2Y8G A;  1FOE A;  2EMS A;  4GOU A;  2K2U A;  1AQC A;  4GPT B;  4YL8 A;  2R09 A;  3VIA A;  1U5F A;  1XCG A;  3P7Z A;  2LG1 A;  1ZC3 B;  2I1K A;  4WJ7 A;  2K49 A;  2RNR B;  1UNQ A;  4K2O A;  4YON A;  2YRY A;  1EGX A;  3DXC A;  4HB4 B;  3HK0 A;  2DX1 A;  4KHB A;  2D9W A;  4F7U P;  4IAP A;  3VOQ A;  2DKQ A;  5CLL B;  1MKE A;  4HB2 B;  4L6E A;  4KHA A;  2CY5 A;  2VRW B;  5D3X A;  4A6F A;  2DFK A;  2D10 A;  1AWE A;  4DX9 0;  4A6H A;  2KR0 A;  3KSY A;  2CY4 A;  1W1D A;  3B77 A;  1V5M A;  4GN1 A;  2Z0Q A;  3D8D A;  2MFQ A;  2ADZ A;  4Z2M B;  1FGZ A;  3ULB A;  1LB1 A;  2FJL A;  1EVH A;  4D0N B;  3PSC A;  2L1C A;  2KGX B;  1T77 A;  4HAX B;  2LOX A;  3ZDT A;  2YS3 A;  2MDX A;  3M1I B;  4HAT B;  3DXE A;  1RJ2 A;  1FHW A;  4DBB A;  2COF A;  1KZG A;  3QWM A;  2M38 A;  3OAN A;  4F7H A;  1MAI A;  2W2X D;  3KZ1 A;  4HHV A;  2P0D A;  1U27 A;  5I2S A;  2LOZ A;  1UPQ A;  1NU2 A;  2NBV A;  1WGQ A;  2R0D A;  4HAW B;  5L81 A;  3G9W A;  4HSI A;  2Z0O A;  3ZVR A;  2RLO A;  4TYZ A;  5HE1 A;  3HIE A;  2IFS A;  4OT1 A;  2D9V A;  4ZRK A;  3A8P A;  1UEF A;  3TO1 A;  5DIF B;  1QQG A;  3MDB C;  3F5R A;  3CIK A;  3A98 B;  4HAY B;  1U5E A;  2DX5 A;  2KUP A;  2OTX A;  5EFX A;  3WA0 A;  2RUK B;  2KIE A;  3BJI A;  3HW2 B;  2N0Y A;  2YS5 A;  3NWD A;  5FI1 A;  2D4Q A;  2YT0 A;  2YVC A;  2D9Z A;  4Y94 A;  1P3R A;  1ZSQ A;  2J0K A;  5IRS A;  1WI1 A;  2N23 A;  1V61 A;  1ZYI A;  2W2W A;  1XOD A;  4KHO A;  1OQN A;  2ELB A;  3HQC A;  3D8F A;  2R2Y A;  1SGH A;  4QJ4 B;  1B55 A;  4K17 A;  5J3T A;  4F7G A;  1Q67 A;  1DBH A;  1J19 A;  2HTH B;  1WVH A;  2D2Q A;  4GMX B;  4GMV A;  4OSN A;  1V5U A;  3NSU A;  1K5D B;  1K5G B;  2DYQ A;  3UZT A;  1H10 A;  1KZ7 A;  1P5T A;  4HDO A;  2AEH A;  1U2B A;  5KQ1 A;  2GJY A;  1WGU A;  3FVC A;  2QKL A;  3ODO A;  4C0A A;  1M7R A;  1SHC A;  2COD A;  2UZR A;  2I5F A;  4XWX A;  1NTY A;  2HE7 A;  4K2P A;  4EJN A;  2Z13 A;  4HAZ B;  4NY0 A;  2ZKM X;  3P6A A;  3U8Z A;  1Y5O A;  2YT1 A;  2CAY A;  4GZU A;  3TCA A;  1MIX A;  4KVG B;  1U5G A;  1U5D A;  4CHJ A; 
#chains in the Genus database with same CATH homology
 1PLS A;  1FHO A;  3ULC A;  1RRP B;  3V5W A;  5C5B A;  5C79 A;  1X11 A;  2YS1 A;  3TVV A;  4A6F B;  4HAV B;  2JP2 A;  4MY6 A;  2W2X C;  1M7E A;  1ZM0 A;  2LUL A;  1IRS A;  1GG3 A;  1I2H A;  1X1G A;  2ROZ B;  4P7I A;  2ZPY A;  3X23 A;  5J3Y A;  2QKM A;  2Z0P A;  2M14 A;  4WSF A;  5HE3 A;  4KAX B;  2ROV A;  3IVF A;  1V89 A;  2DKP A;  2EJ8 A;  3SUZ A;  1TXD A;  1E5W A;  4CHM A;  3PVW A;  4K81 A;  4H8S A;  5JHH A;  1KI1 B;  1BTN A;  5GOW B;  3FM8 C;  5DI9 B;  1N3H A;  1GC7 A;  2DN6 A;  4HDQ A;  2RVB B;  1BTK A;  3QBV B;  5D3Y A;  1LW3 A;  2D9X A;  3T06 A;  1TJ6 A;  2GS0 A;  5KCV A;  2DHK A;  2LKO A;  2BCJ A;  1XR0 B;  4ZRI A;  1TQZ A;  3PG7 A;  1MK7 B;  2J59 M;  1UNR A;  4ZRJ A;  4MT7 A;  3LJU X;  3O96 A;  1OY2 A;  2EMT A;  1P6S A;  4DXA B;  1I7A A;  4GXB A;  2YSZ A;  4CYE A;  2DHI A;  2X18 A;  5D3W A;  1U29 A;  1ZVR A;  1PFJ A;  1BWN A;  1WJM A;  1DYN A;  2PZ1 A;  4DX8 A;  2G35 A;  3DXD A;  3GYO A;  1Z87 A;  1W1G A;  1PMS A;  1X86 A;  1WG7 A;  4EKU A;  5DHA B;  2GCJ A;  2UVM A;  2P8V A;  2E2X A;  1XX0 A;  2VKI A;  1NI2 A;  4TKN A;  3FEH A;  5DHF B;  1BAK A;  1UNP A;  5FI0 A;  5C6R A;  1DRO A;  1X05 A;  2V76 A;  4IOY X;  3MPX A;  2ELA A;  2P0H A;  1NTV A;  1ISN A;  1W1H A;  1FAO A;  2J0J A;  2IYB A;  2H7D A;  2DLW A;  1FGY A;  5KQ4 A;  4EMO A;  1MIZ B;  2YF0 A;  2D11 A;  3GYP A;  4WVF B;  1XKE A;  5HE2 A;  2EC1 A;  3SNH A;  2I5C A;  2GCL A;  1J0W A;  4KHB B;  4A5K A;  1XD4 A;  2VSZ A;  4Z2N A;  2DHJ A;  2DYN A;  1UPR A;  3SO6 A;  5LON B;  2MKR A;  3A8Q A;  4IFS A;  1MPH A;  1QC6 A;  2Q13 A;  5C16 A;  3KY9 A;  1DDV A;  3FSS A;  3PEG A;  4B6H A;  5J3Q A;  3SYX A;  1MK9 B;  3RCP A;  3PP2 A;  1GC6 A;  3AJ4 A;  2K2J A;  5DH9 B;  3TW1 A;  2Y8F A;  2OQB A;  2COA A;  5JLJ B;  2L2I A;  2LYD A;  3KRX A;  2NZ8 B;  2RGN B;  4HAU B;  3AU4 A;  2DA0 A;  1WJ1 A;  2MWN B;  5CLQ B;  2XQN M;  3ODX A;  5C5B B;  4A6K A;  2Y7B A;  1Y19 B;  2KCJ A;  5JHG A;  2P0F A;  2COC A;  3SV1 A;  4BBK A;  2AL6 A;  4NSW A;  1V88 A;  3QIJ A;  5LOP B;  3F0W A;  1EAZ A;  3ML4 A;  1DDM A;  3BIN A;  4PQ0 A;  5HE0 A;  3PZD A;  2I1J A;  2UZS A;  5D3V A;  3D8E A;  1V5P A;  2DTC A;  2RSG A;  4HB0 B;  2CRF A;  3ODW A;  1H4R A;  2J0M A;  3KRW A;  4HB3 B;  4PNK A;  1ZC4 B;  1DDW A;  5JP4 A;  1X1F A;  5D27 A;  3TFM A;  1FB8 A;  2K00 A;  2D9Y A;  3U7D A;  3N7C A;  3PVL A;  3WYF B;  2H7E A;  3CXB B;  1OMW A;  1FHX A;  3PVU A;  4MK0 A;  3AU5 A;  1EF1 A;  2NMB A;  2Y8G A;  1FOE A;  2EMS A;  2K2U A;  1AQC A;  4GPT B;  4YL8 A;  2R09 A;  3VIA A;  1U5F A;  1XCG A;  3P7Z A;  2LG1 A;  1ZC3 B;  2I1K A;  4WJ7 A;  2RNR B;  1UNQ A;  4K2O A;  4YON A;  2YRY A;  1EGX A;  3DXC A;  4HB4 B;  3HK0 A;  2DX1 A;  2D9W A;  4F7U P;  4IAP A;  3VOQ A;  2DKQ A;  5CLL B;  1MKE A;  4HB2 B;  4L6E A;  4KHA A;  2CY5 A;  2VRW B;  5D3X A;  4A6F A;  2DFK A;  2D10 A;  1AWE A;  4DX9 0;  4A6H A;  3KSY A;  2CY4 A;  1W1D A;  1V5M A;  4GN1 A;  2Z0Q A;  3D8D A;  2MFQ A;  2ADZ A;  4Z2M B;  1FGZ A;  3ULB A;  1LB1 A;  2FJL A;  1EVH A;  4D0N B;  3PSC A;  2L1C A;  2KGX B;  4HAX B;  2LOX A;  3ZDT A;  2YS3 A;  2MDX A;  3M1I B;  4HAT B;  3DXE A;  1RJ2 A;  1FHW A;  4DBB A;  2COF A;  1KZG A;  3QWM A;  2M38 A;  3OAN A;  4F7H A;  1MAI A;  2W2X D;  3KZ1 A;  4HHV A;  2P0D A;  1U27 A;  2LOZ A;  1UPQ A;  1NU2 A;  1WGQ A;  2R0D A;  4HAW B;  5L81 A;  3G9W A;  2Z0O A;  3ZVR A;  2RLO A;  4TYZ A;  5HE1 A;  2IFS A;  2D9V A;  4ZRK A;  3A8P A;  1UEF A;  3TO1 A;  5DIF B;  1QQG A;  3MDB C;  3F5R A;  3CIK A;  3A98 B;  4HAY B;  1U5E A;  2DX5 A;  2KUP A;  2OTX A;  5EFX A;  3WA0 A;  2RUK B;  3BJI A;  3HW2 B;  2N0Y A;  2YS5 A;  5FI1 A;  2D4Q A;  2YT0 A;  2YVC A;  2D9Z A;  4Y94 A;  1P3R A;  1ZSQ A;  2J0K A;  1WI1 A;  2N23 A;  1V61 A;  2W2W A;  1XOD A;  4KHO A;  1OQN A;  2ELB A;  3HQC A;  3D8F A;  1SGH A;  1B55 A;  4K17 A;  5J3T A;  4F7G A;  1Q67 A;  1DBH A;  1J19 A;  2HTH B;  1WVH A;  2D2Q A;  4GMX B;  4GMV A;  1V5U A;  3NSU A;  1K5D B;  1K5G B;  2DYQ A;  3UZT A;  1H10 A;  1KZ7 A;  1P5T A;  4HDO A;  2AEH A;  1U2B A;  5KQ1 A;  2GJY A;  1WGU A;  2QKL A;  3ODO A;  4C0A A;  1M7R A;  1SHC A;  2COD A;  2UZR A;  2I5F A;  4XWX A;  1NTY A;  2HE7 A;  4K2P A;  4EJN A;  4HAZ B;  4NY0 A;  3P6A A;  3U8Z A;  1Y5O A;  2YT1 A;  2CAY A;  4GZU A;  3TCA A;  1MIX A;  4KVG B;  1U5G A;  1U5D A;  4CHJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...