4XWXA

Crystal structure of the ptb domain of shc
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
167
structure length
160
Chain Sequence
SMGWLHPNDKVMGPGVSYLVRYMGCVEVLQSMRALDFNTRTQVTREAISLVCEAVPGAKGASRPLSSILGRSNLKFAGMPITLTVSTSSLNLMAADCKQIIANHHMQSISFASGGDPDTAEYVAYVAKDPVNQRACHILECPEGLAQDVISTIGQAFELR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords SHC-transforming protein 1
publication title Crystal structure of the PTB domain of SHC
rcsb
source organism Homo sapiens
total genus 43
structure length 160
sequence length 167
ec nomenclature
pdb deposition date 2015-01-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 4xwxA00
1GC7A 1Q67A 1XODA 1K5GB 5DHFB 5CLQB 5GOWB 1WI1A 1Y5OA 1X11A 2RUKB 2RLOA 2I5FA 2V76A 1IRSA 1MIXA 1X05A 2ELAA 2AL6A 3LJUX 4A6FA 2LKOA 2Y7BA 3VIAA 1AWEA 1PMSA 1WJMA 2MDXA 1NTVA 5C79A 2LOXA 4IFSA 1UPQA 1X1GA 4HB4B 2COFA 1MK9B 5DHAB 1PLSA 3DXEA 4K81A 1ISNA 2IFSA 3BJIA 2EMSA 3U7DA 5C6RA 4GZUA 1P5TA 1H10A 1SGHA 3O96A 2HE7A 1OQNA 4NSWA 3G9WA 1GC6A 3IVFA 4A6FB 2Z0OA 1RJ2A 2L2IA 4HAUB 1RRPB 3MDBC 1NI2A 2DKQA 5JHHA 4TYZA 1WGQA 2YVCA 2DX5A 2J59M 2GJYA 1H4RA 2D2QA 5DI9B 3TCAA 2GCLA 3D8EA 3PEGA 3ODWA 1Y19B 2P8VA 4C0AA 2DYNA 2VRWB 4HAYB 4WSFA 1NTYA 3MPXA 2D9YA 1ZSQA 2AEHA 2ELBA 1AQCA 3CIKA 3TFMA 2CAYA 1FHXA 2UZRA 3DXCA 3SYXA 3D8FA 3FEHA 5D3WA 5HE1A 3WYFB 3PZDA 2DYQA 2DLWA 5HE2A 1V5UA 3U8ZA 1MK7B 2COAA 3SNHA 3N7CA 2YT0A 1WGUA 3X23A 1FGYA 2D10A 3ULBA 4CHJA 5KQ1A 3F5RA 1ZC4B 2I5CA 2E2XA 4MY6A 1W1HA 4GMXB 3T06A 3NSUA 1K5DB 1WVHA 1X86A 4KHBB 2N23A 1WJ1A 1TXDA 1QC6A 1BAKA 1FAOA 4HAZB 5J3YA 4CHMA 5LONB 1BWNA 1SHCA 5HE3A 2Z0PA 3ULCA 1V5PA 2N0YA 2ADZA 2P0DA 4EKUA 4A6KA 3HK0A 5D3VA 1DYNA 3CXBB 4TKNA 1V88A 4WJ7A 2DX1A 2KCJA 1FOEA 3AU5A 4GPTB 2MKRA 2D11A 2GCJA 4HDOA 1DDWA 4IOYX 1U29A 1V61A 2LULA 3AJ4A 1U27A 1V89A 2J0MA 4L6EA 1UNRA 2DHIA 2KGXB 2NMBA 1XCGA 2J0JA 2R0DA 3PSCA 2Y8FA 1U5GA 2RVBB 2K2UA 1MPHA 4HB2B 2JP2A 2VSZA 2YS5A 4HAWB 4Z2NA 1E5WA 1P3RA 1Z87A 2Y8GA 4ZRKA 4MT7A 2DTCA 4HHVA 1I7AA 1W1GA 1UNPA 3TO1A 1EGXA 3PVWA 4BBKA 2OQBA 3ZDTA 5D3XA 1ZC3B 1FGZA 1X1FA 4K17A 4PNKA 3PVUA 2LG1A 2W2WA 4HATB 1UEFA 4KHAA 3P7ZA 3TVVA 4D0NB 2DN6A 1TJ6A 3AU4A 1OY2A 3QWMA 3A98B 1FHOA 2W2XC 3OANA 2H7DA 3P6AA 1U5FA 3PP2A 3ODOA 2CY5A 1TQZA 3KSYA 2I1JA 1EF1A 2LOZA 1EAZA 4PQ0A 3KRWA 5C16A 1LB1A 2EC1A 4CYEA 2QKLA 4GMVA 2YS3A 5D3YA 3KZ1A 4K2OA 2R09A 4Z2MB 2D9WA 5FI1A 4DX90 3ODXA 2YF0A 1J19A 2CRFA 2P0HA 3V5WA 2YT1A 4GN1A 2J0KA 4Y94A 2PZ1A 2EJ8A 1XD4A 1W1DA 2BCJA 2G35A 1UNQA 2X18A 2ZPYA 1P6SA 3PG7A 4ZRJA 1BTKA 4A5KA 3SO6A 3TW1A 2DKPA 1U5DA 2OTXA 1LW3A 4YONA 1XR0B 3SV1A 1DDVA 3GYOA 4HDQA 4WVFB 4HB0B 4K2PA 2EMTA 4HAVB 1BTNA 1I2HA 4DBBA 5HE0A 2CY4A 3SUZA 5EFXA 1XKEA 5C5BA 3ML4A 5LOPB 3HW2B 5DIFB 2K00A 3KY9A 3D8DA 4DXAB 5JP4A 2YRYA 4IAPA 4H8SA 2Q13A 4KHOA 2D9XA 2H7EA 2L1CA 5D27A 3M1IB 4HAXB 2VKIA 4GXBA 3WA0A 1FHWA 1ZVRA 3ZVRA 3DXDA 5JLJB 2DHKA 1MKEA 4YL8A 2UVMA 5DH9B 2W2XD 4DX8A 2D9ZA 5KCVA 2MFQA 2ROVA 2MWNB 1M7EA 2XQNM 4EJNA 2UZSA 3QIJA 3RCPA 2YSZA 2NZ8B 3F0WA 3VOQA 4ZRIA 3QBVB 2QKMA 5C5BB 2KUPA 5J3QA 4P7IA 5L81A 4EMOA 2DA0A 4A6HA 2RGNB 1DBHA 1WG7A 2D4QA 2HTHB 4KAXB 2D9VA 1OMWA 1MAIA 2YS1A 3FM8C 1PFJA 4KVGB 4F7GA 1GG3A 5FI0A 1J0WA 2DFKA 3A8QA 2Z0QA 4XWXA 2RNRB 4NY0A 1DROA 1UPRA 2M38A 5CLLB 1B55A 3PVLA 1FB8A 1N3HA 1QQGA 4MK0A 1KI1B 2M14A 2DHJA 1U5EA 1V5MA 4F7UP 1NU2A 2CODA 1MIZB 4B6HA 4F7HA 2GS0A 1DDMA 3A8PA 2RSGA 3GYPA 1ZM0A 5JHGA 2I1KA 3KRXA 2IYBA 3UZTA 2LYDA 2P0FA 1KZGA 1XX0A 2FJLA 1M7RA 5J3TA 4HB3B 2COCA 3BINA 5KQ4A 1U2BA 3HQCA 1KZ7A 2ROZB 2K2JA 3FSSA 1EVHA
chains in the Genus database with same CATH superfamily
1GC7A 1Q67A 1XODA 1K5GB 5LG4B 5DHFB 5CLQB 5GOWB 1WI1A 1Y5OA 1X11A 2RUKB 2RLOA 2I5FA 2V76A 1IRSA 1MIXA 1X05A 2ELAA 2AL6A 3LJUX 4A6FA 2LKOA 2Y7BA 3VIAA 1AWEA 1PMSA 1WJMA 2MDXA 1NTVA 5C79A 2LOXA 3NW8A 4IFSA 1UPQA 1X1GA 4HB4B 2COFA 1MK9B 5DHAB 1PLSA 3DXEA 4K81A 1ISNA 2IFSA 3BJIA 2EMSA 3U7DA 5C6RA 4GZUA 1P5TA 1H10A 1SGHA 3O96A 2HE7A 2RRFA 1OQNA 4NSWA 3G9WA 1GC6A 3IVFA 4A6FB 2Z0OA 1RJ2A 2L2IA 4HAUB 1RRPB 3MDBC 1NI2A 2DKQA 5JHHA 4TYZA 1WGQA 2YVCA 2DX5A 2J59M 2KR0A 4QJ3B 4HSIA 2GJYA 1H4RA 2D2QA 5DI9B 3TCAA 2GCLA 3D8EA 2Z13A 3PEGA 3ODWA 1Y19B 2P8VA 4C0AA 2DYNA 2VRWB 4HAYB 4WSFA 1NTYA 1ZYIA 3MPXA 2D9YA 1ZSQA 2AEHA 2ELBA 1AQCA 3CIKA 3TFMA 2CAYA 1FHXA 2UZRA 3DXCA 3SYXA 3D8FA 3FEHA 5D3WA 5HE1A 3WYFB 3PZDA 2DYQA 2DLWA 5HE2A 1V5UA 3U8ZA 1MK7B 2COAA 3SNHA 3N7CA 2YT0A 1WGUA 3X23A 1FGYA 2D10A 3NWFA 3ULBA 4CHJA 5KQ1A 2GUMA 4QXAB 3FVCA 3HIEA 3F5RA 4OT1A 1ZC4B 2I5CA 2E2XA 4MY6A 1W1HA 4GMXB 4DIXA 3T06A 3NSUA 1K5DB 1WVHA 1X86A 4KHBB 2N23A 1WJ1A 1T77A 1TXDA 1QC6A 1BAKA 1FAOA 4HAZB 5J3YA 4CHMA 5LONB 1BWNA 1SHCA 5HE3A 2Z0PA 3ULCA 1V5PA 2R2YA 2N0YA 2ADZA 2P0DA 4EKUA 4A6KA 3HK0A 5D3VA 1DYNA 3CXBB 4TKNA 1V88A 4L1RA 4WJ7A 2DX1A 2KCJA 1FOEA 3AU5A 4GPTB 2MKRA 2D11A 2GCJA 4HDOA 3U12A 1DDWA 4IOYX 1U29A 1V61A 2LULA 3HSAA 3AJ4A 1U27A 1V89A 2J0MA 4L6EA 1UNRA 2DHIA 2KGXB 3NWAA 2NMBA 1XCGA 2J0JA 2R0DA 3PSCA 2Y8FA 1U5GA 5M4YB 2RVBB 2K2UA 1MPHA 4HB2B 5IRSA 2JP2A 2VSZA 2YS5A 2Z4DA 4HAWB 4Z2NA 1E5WA 1P3RA 1Z87A 2Y8GA 4ZRKA 3DCXA 4MT7A 2DTCA 4HHVA 1I7AA 1W1GA 1UNPA 3TO1A 1EGXA 3PVWA 4BBKA 2OQBA 3ZDTA 5D3XA 1ZC3B 1FGZA 1X1FA 4K17A 4PNKA 4GOUA 3PVUA 2LG1A 2W2WA 4HATB 1UEFA 4KHAA 3P7ZA 3TVVA 4D0NB 2K49A 2DN6A 1TJ6A 3AU4A 1OY2A 3QWMA 3A98B 1FHOA 2W2XC 4QJ5B 3OANA 2H7DA 4KHBA 3P6AA 1U5FA 3PP2A 3ODOA 2CY5A 2KIGA 1TQZA 3KSYA 2I1JA 1EF1A 2LOZA 3OHMB 1EAZA 4PQ0A 1MI1A 3KRWA 5C16A 1LB1A 2EC1A 4CYEA 2QKLA 3NWDA 4GMVA 2YS3A 5D3YA 3KZ1A 4K2OA 2R09A 4Z2MB 2D9WA 5FI1A 4DX90 2Z59A 3ODXA 2YF0A 4GNKB 1J19A 2CRFA 2P0HA 3V5WA 2YT1A 4GN1A 2J0KA 4Y94A 2PZ1A 2EJ8A 1XD4A 1W1DA 4D6WA 2BCJA 2ZKMX 2G35A 1UNQA 2X18A 2ZPYA 5I2MA 1P6SA 3PG7A 4ZRJA 1BTKA 4A5KA 3SO6A 3TW1A 2DKPA 1U5DA 2OTXA 1LW3A 4YONA 1XR0B 3SV1A 1DDVA 3GYOA 4HDQA 4WVFB 4HB0B 4K2PA 2EMTA 4HAVB 2K8EA 1BTNA 1I2HA 4DBBA 5HE0A 2CY4A 3SUZA 5EFXA 1XKEA 5C5BA 3ML4A 5LOPB 3HW2B 5DIFB 2K00A 3KY9A 3D8DA 4DXAB 5JP4A 2YRYA 4IAPA 4H8SA 2Q13A 4KHOA 2D9XA 2H7EA 2L1CA 5D27A 4CSQA 3M1IB 4HAXB 2VKIA 4GXBA 3WA0A 2KIEA 1FHWA 1ZVRA 3ZVRA 3DXDA 5JLJB 2DHKA 1MKEA 4YL8A 2UVMA 5DH9B 2W2XD 4DX8A 2D9ZA 5KCVA 2MFQA 2ROVA 2MWNB 1M7EA 2XQNM 4EJNA 2NBVA 2UZSA 3QIJA 3RCPA 2YSZA 2NZ8B 3F0WA 3VOQA 4ZRIA 3QBVB 2QKMA 5C5BB 2KUPA 5J3QA 4P7IA 4OSNA 5L81A 4EMOA 2DA0A 4A6HA 4QJ4B 2RGNB 1DBHA 3B77A 1WG7A 2D4QA 2HTHB 4KAXB 2D9VA 1OMWA 1MAIA 2YS1A 3FM8C 1PFJA 4KVGB 4F7GA 1GG3A 5FI0A 1J0WA 2DFKA 3A8QA 2Z0QA 4XWXA 2RNRB 4NY0A 1DROA 1UPRA 5I2SA 2M38A 5CLLB 1B55A 3PVLA 1FB8A 1N3HA 1QQGA 4MK0A 1KI1B 2M14A 2DHJA 1U5EA 1V5MA 4F7UP 1NU2A 3A58A 2CODA 1MIZB 4B6HA 4F7HA 2GS0A 1DDMA 3A8PA 2RSGA 3GYPA 1ZM0A 2YT2A 5JHGA 2FJUB 2I1KA 3KRXA 2IYBA 3UZTA 2LYDA 2P0FA 1KZGA 1XX0A 2FJLA 1M7RA 5J3TA 4HB3B 2COCA 3BINA 5KQ4A 1U2BA 3HQCA 1KZ7A 2ROZB 2K2JA 3FSSA 2Z14A 1EVHA 2KUQA
chains in the Genus database with same CATH topology
1GC7A 1Q67A 1XODA 1K5GB 5DHFB 5CLQB 5GOWB 1WI1A 1Y5OA 1X11A 2RUKB 2RLOA 2I5FA 2V76A 1IRSA 1MIXA 1X05A 2ELAA 2AL6A 3LJUX 4A6FA 2LKOA 2Y7BA 3VIAA 1AWEA 1PMSA 1WJMA 2MDXA 1NTVA 5C79A 2LOXA 4IFSA 1UPQA 1X1GA 4HB4B 2COFA 1MK9B 5DHAB 1PLSA 3DXEA 4K81A 1ISNA 2IFSA 3BJIA 2EMSA 3U7DA 5C6RA 4GZUA 1P5TA 1H10A 1SGHA 3O96A 2HE7A 1OQNA 4NSWA 3G9WA 1GC6A 3IVFA 4A6FB 2Z0OA 1RJ2A 2L2IA 4HAUB 1RRPB 3MDBC 1NI2A 2DKQA 5JHHA 4TYZA 1WGQA 2YVCA 2DX5A 2J59M 2GJYA 1H4RA 2D2QA 5DI9B 3TCAA 2GCLA 3D8EA 3PEGA 3ODWA 1Y19B 2P8VA 4C0AA 2DYNA 2VRWB 4HAYB 4WSFA 1NTYA 3MPXA 2D9YA 1ZSQA 2AEHA 2ELBA 1AQCA 3CIKA 3TFMA 2CAYA 1FHXA 2UZRA 3DXCA 3SYXA 3D8FA 3FEHA 5D3WA 5HE1A 3WYFB 3PZDA 2DYQA 2DLWA 5HE2A 1V5UA 3U8ZA 1MK7B 2COAA 3SNHA 3N7CA 2YT0A 1WGUA 3X23A 1FGYA 2D10A 3ULBA 4CHJA 5KQ1A 3F5RA 1ZC4B 2I5CA 2E2XA 4MY6A 1W1HA 4GMXB 3T06A 3NSUA 1K5DB 1WVHA 1X86A 4KHBB 2N23A 1WJ1A 1TXDA 1QC6A 1BAKA 1FAOA 4HAZB 5J3YA 4CHMA 5LONB 1BWNA 1SHCA 5HE3A 2Z0PA 3ULCA 1V5PA 2N0YA 2ADZA 2P0DA 4EKUA 4A6KA 3HK0A 5D3VA 1DYNA 3CXBB 4TKNA 1V88A 4WJ7A 2DX1A 2KCJA 1FOEA 3AU5A 4GPTB 2MKRA 2D11A 2GCJA 4HDOA 1DDWA 4IOYX 1U29A 1V61A 2LULA 3AJ4A 1U27A 1V89A 2J0MA 4L6EA 1UNRA 2DHIA 2KGXB 2NMBA 1XCGA 2J0JA 2R0DA 3PSCA 2Y8FA 1U5GA 2RVBB 2K2UA 1MPHA 4HB2B 2JP2A 2VSZA 2YS5A 4HAWB 4Z2NA 1E5WA 1P3RA 1Z87A 2Y8GA 4ZRKA 4MT7A 2DTCA 4HHVA 1I7AA 1W1GA 1UNPA 3TO1A 1EGXA 3PVWA 4BBKA 2OQBA 3ZDTA 5D3XA 1ZC3B 1FGZA 1X1FA 4K17A 4PNKA 3PVUA 2LG1A 2W2WA 4HATB 1UEFA 4KHAA 3P7ZA 3TVVA 4D0NB 2DN6A 1TJ6A 3AU4A 1OY2A 3QWMA 3A98B 1FHOA 2W2XC 3OANA 2H7DA 3P6AA 1U5FA 3PP2A 3ODOA 2CY5A 1TQZA 3KSYA 2I1JA 1EF1A 2LOZA 1EAZA 4PQ0A 3KRWA 5C16A 1LB1A 2EC1A 4CYEA 2QKLA 4GMVA 2YS3A 5D3YA 3KZ1A 4K2OA 2R09A 4Z2MB 2D9WA 5FI1A 4DX90 3ODXA 2YF0A 1J19A 2CRFA 2P0HA 3V5WA 2YT1A 4GN1A 2J0KA 4Y94A 2PZ1A 2EJ8A 1XD4A 1W1DA 2BCJA 2G35A 1UNQA 2X18A 2ZPYA 1P6SA 3PG7A 4ZRJA 1BTKA 4A5KA 3SO6A 3TW1A 2DKPA 1U5DA 2OTXA 1LW3A 4YONA 1XR0B 3SV1A 1DDVA 3GYOA 4HDQA 4WVFB 4HB0B 4K2PA 2EMTA 4HAVB 1BTNA 1I2HA 4DBBA 5HE0A 2CY4A 3SUZA 5EFXA 1XKEA 5C5BA 3ML4A 5LOPB 3HW2B 5DIFB 2K00A 3KY9A 3D8DA 4DXAB 5JP4A 2YRYA 4IAPA 4H8SA 2Q13A 4KHOA 2D9XA 2H7EA 2L1CA 5D27A 3M1IB 4HAXB 2VKIA 4GXBA 3WA0A 1FHWA 1ZVRA 3ZVRA 3DXDA 5JLJB 2DHKA 1MKEA 4YL8A 2UVMA 5DH9B 2W2XD 4DX8A 2D9ZA 5KCVA 2MFQA 2ROVA 2MWNB 1M7EA 2XQNM 4EJNA 2UZSA 3QIJA 3RCPA 2YSZA 2NZ8B 3F0WA 3VOQA 4ZRIA 3QBVB 2QKMA 5C5BB 2KUPA 5J3QA 4P7IA 5L81A 4EMOA 2DA0A 4A6HA 2RGNB 1DBHA 1WG7A 2D4QA 2HTHB 4KAXB 2D9VA 1OMWA 1MAIA 2YS1A 3FM8C 1PFJA 4KVGB 4F7GA 1GG3A 5FI0A 1J0WA 2DFKA 3A8QA 2Z0QA 4XWXA 2RNRB 4NY0A 1DROA 1UPRA 2M38A 5CLLB 1B55A 3PVLA 1FB8A 1N3HA 1QQGA 4MK0A 1KI1B 2M14A 2DHJA 1U5EA 1V5MA 4F7UP 1NU2A 2CODA 1MIZB 4B6HA 4F7HA 2GS0A 1DDMA 3A8PA 2RSGA 3GYPA 1ZM0A 5JHGA 2I1KA 3KRXA 2IYBA 3UZTA 2LYDA 2P0FA 1KZGA 1XX0A 2FJLA 1M7RA 5J3TA 4HB3B 2COCA 3BINA 5KQ4A 1U2BA 3HQCA 1KZ7A 2ROZB 2K2JA 3FSSA 1EVHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GC7 A;  1Q67 A;  1XOD A;  1K5G B;  5DHF B;  5CLQ B;  5GOW B;  1WI1 A;  1Y5O A;  1X11 A;  2RUK B;  2RLO A;  2I5F A;  2V76 A;  1IRS A;  1MIX A;  1X05 A;  2ELA A;  2AL6 A;  3LJU X;  4A6F A;  2LKO A;  2Y7B A;  3VIA A;  1AWE A;  1PMS A;  1WJM A;  2MDX A;  1NTV A;  5C79 A;  2LOX A;  4IFS A;  1UPQ A;  1X1G A;  4HB4 B;  2COF A;  1MK9 B;  5DHA B;  1PLS A;  3DXE A;  4K81 A;  1ISN A;  2IFS A;  3BJI A;  2EMS A;  3U7D A;  5C6R A;  4GZU A;  1P5T A;  1H10 A;  1SGH A;  3O96 A;  2HE7 A;  1OQN A;  4NSW A;  3G9W A;  1GC6 A;  3IVF A;  4A6F B;  2Z0O A;  1RJ2 A;  2L2I A;  4HAU B;  1RRP B;  3MDB C;  1NI2 A;  2DKQ A;  5JHH A;  4TYZ A;  1WGQ A;  2YVC A;  2DX5 A;  2J59 M;  2GJY A;  1H4R A;  2D2Q A;  5DI9 B;  3TCA A;  2GCL A;  3D8E A;  3PEG A;  3ODW A;  1Y19 B;  2P8V A;  4C0A A;  2DYN A;  2VRW B;  4HAY B;  4WSF A;  1NTY A;  3MPX A;  2D9Y A;  1ZSQ A;  2AEH A;  2ELB A;  1AQC A;  3CIK A;  3TFM A;  2CAY A;  1FHX A;  2UZR A;  3DXC A;  3SYX A;  3D8F A;  3FEH A;  5D3W A;  5HE1 A;  3WYF B;  3PZD A;  2DYQ A;  2DLW A;  5HE2 A;  1V5U A;  3U8Z A;  1MK7 B;  2COA A;  3SNH A;  3N7C A;  2YT0 A;  1WGU A;  3X23 A;  1FGY A;  2D10 A;  3ULB A;  4CHJ A;  5KQ1 A;  3F5R A;  1ZC4 B;  2I5C A;  2E2X A;  4MY6 A;  1W1H A;  4GMX B;  3T06 A;  3NSU A;  1K5D B;  1WVH A;  1X86 A;  4KHB B;  2N23 A;  1WJ1 A;  1TXD A;  1QC6 A;  1BAK A;  1FAO A;  4HAZ B;  5J3Y A;  4CHM A;  5LON B;  1BWN A;  1SHC A;  5HE3 A;  2Z0P A;  3ULC A;  1V5P A;  2N0Y A;  2ADZ A;  2P0D A;  4EKU A;  4A6K A;  3HK0 A;  5D3V A;  1DYN A;  3CXB B;  4TKN A;  1V88 A;  4WJ7 A;  2DX1 A;  2KCJ A;  1FOE A;  3AU5 A;  4GPT B;  2MKR A;  2D11 A;  2GCJ A;  4HDO A;  1DDW A;  4IOY X;  1U29 A;  1V61 A;  2LUL A;  3AJ4 A;  1U27 A;  1V89 A;  2J0M A;  4L6E A;  1UNR A;  2DHI A;  2KGX B;  2NMB A;  1XCG A;  2J0J A;  2R0D A;  3PSC A;  2Y8F A;  1U5G A;  2RVB B;  2K2U A;  1MPH A;  4HB2 B;  2JP2 A;  2VSZ A;  2YS5 A;  4HAW B;  4Z2N A;  1E5W A;  1P3R A;  1Z87 A;  2Y8G A;  4ZRK A;  4MT7 A;  2DTC A;  4HHV A;  1I7A A;  1W1G A;  1UNP A;  3TO1 A;  1EGX A;  3PVW A;  4BBK A;  2OQB A;  3ZDT A;  5D3X A;  1ZC3 B;  1FGZ A;  1X1F A;  4K17 A;  4PNK A;  3PVU A;  2LG1 A;  2W2W A;  4HAT B;  1UEF A;  4KHA A;  3P7Z A;  3TVV A;  4D0N B;  2DN6 A;  1TJ6 A;  3AU4 A;  1OY2 A;  3QWM A;  3A98 B;  1FHO A;  2W2X C;  3OAN A;  2H7D A;  3P6A A;  1U5F A;  3PP2 A;  3ODO A;  2CY5 A;  1TQZ A;  3KSY A;  2I1J A;  1EF1 A;  2LOZ A;  1EAZ A;  4PQ0 A;  3KRW A;  5C16 A;  1LB1 A;  2EC1 A;  4CYE A;  2QKL A;  4GMV A;  2YS3 A;  5D3Y A;  3KZ1 A;  4K2O A;  2R09 A;  4Z2M B;  2D9W A;  5FI1 A;  4DX9 0;  3ODX A;  2YF0 A;  1J19 A;  2CRF A;  2P0H A;  3V5W A;  2YT1 A;  4GN1 A;  2J0K A;  4Y94 A;  2PZ1 A;  2EJ8 A;  1XD4 A;  1W1D A;  2BCJ A;  2G35 A;  1UNQ A;  2X18 A;  2ZPY A;  1P6S A;  3PG7 A;  4ZRJ A;  1BTK A;  4A5K A;  3SO6 A;  3TW1 A;  2DKP A;  1U5D A;  2OTX A;  1LW3 A;  4YON A;  1XR0 B;  3SV1 A;  1DDV A;  3GYO A;  4HDQ A;  4WVF B;  4HB0 B;  4K2P A;  2EMT A;  4HAV B;  1BTN A;  1I2H A;  4DBB A;  5HE0 A;  2CY4 A;  3SUZ A;  5EFX A;  1XKE A;  5C5B A;  3ML4 A;  5LOP B;  3HW2 B;  5DIF B;  2K00 A;  3KY9 A;  3D8D A;  4DXA B;  5JP4 A;  2YRY A;  4IAP A;  4H8S A;  2Q13 A;  4KHO A;  2D9X A;  2H7E A;  2L1C A;  5D27 A;  3M1I B;  4HAX B;  2VKI A;  4GXB A;  3WA0 A;  1FHW A;  1ZVR A;  3ZVR A;  3DXD A;  5JLJ B;  2DHK A;  1MKE A;  4YL8 A;  2UVM A;  5DH9 B;  2W2X D;  4DX8 A;  2D9Z A;  5KCV A;  2MFQ A;  2ROV A;  2MWN B;  1M7E A;  2XQN M;  4EJN A;  2UZS A;  3QIJ A;  3RCP A;  2YSZ A;  2NZ8 B;  3F0W A;  3VOQ A;  4ZRI A;  3QBV B;  2QKM A;  5C5B B;  2KUP A;  5J3Q A;  4P7I A;  5L81 A;  4EMO A;  2DA0 A;  4A6H A;  2RGN B;  1DBH A;  1WG7 A;  2D4Q A;  2HTH B;  4KAX B;  2D9V A;  1OMW A;  1MAI A;  2YS1 A;  3FM8 C;  1PFJ A;  4KVG B;  4F7G A;  1GG3 A;  5FI0 A;  1J0W A;  2DFK A;  3A8Q A;  2Z0Q A;  4XWX A;  2RNR B;  4NY0 A;  1DRO A;  1UPR A;  2M38 A;  5CLL B;  1B55 A;  3PVL A;  1FB8 A;  1N3H A;  1QQG A;  4MK0 A;  1KI1 B;  2M14 A;  2DHJ A;  1U5E A;  1V5M A;  4F7U P;  1NU2 A;  2COD A;  1MIZ B;  4B6H A;  4F7H A;  2GS0 A;  1DDM A;  3A8P A;  2RSG A;  3GYP A;  1ZM0 A;  5JHG A;  2I1K A;  3KRX A;  2IYB A;  3UZT A;  2LYD A;  2P0F A;  1KZG A;  1XX0 A;  2FJL A;  1M7R A;  5J3T A;  4HB3 B;  2COC A;  3BIN A;  5KQ4 A;  1U2B A;  3HQC A;  1KZ7 A;  2ROZ B;  2K2J A;  3FSS A;  1EVH A; 
#chains in the Genus database with same CATH topology
 1GC7 A;  1Q67 A;  1XOD A;  1K5G B;  5LG4 B;  5DHF B;  5CLQ B;  5GOW B;  1WI1 A;  1Y5O A;  1X11 A;  2RUK B;  2RLO A;  2I5F A;  2V76 A;  1IRS A;  1MIX A;  1X05 A;  2ELA A;  2AL6 A;  3LJU X;  4A6F A;  2LKO A;  2Y7B A;  3VIA A;  1AWE A;  1PMS A;  1WJM A;  2MDX A;  1NTV A;  5C79 A;  2LOX A;  3NW8 A;  4IFS A;  1UPQ A;  1X1G A;  4HB4 B;  2COF A;  1MK9 B;  5DHA B;  1PLS A;  3DXE A;  4K81 A;  1ISN A;  2IFS A;  3BJI A;  2EMS A;  3U7D A;  5C6R A;  4GZU A;  1P5T A;  1H10 A;  1SGH A;  3O96 A;  2HE7 A;  2RRF A;  1OQN A;  4NSW A;  3G9W A;  1GC6 A;  3IVF A;  4A6F B;  2Z0O A;  1RJ2 A;  2L2I A;  4HAU B;  1RRP B;  3MDB C;  1NI2 A;  2DKQ A;  5JHH A;  4TYZ A;  1WGQ A;  2YVC A;  2DX5 A;  2J59 M;  2KR0 A;  4QJ3 B;  4HSI A;  2GJY A;  1H4R A;  2D2Q A;  5DI9 B;  3TCA A;  2GCL A;  3D8E A;  2Z13 A;  3PEG A;  3ODW A;  1Y19 B;  2P8V A;  4C0A A;  2DYN A;  2VRW B;  4HAY B;  4WSF A;  1NTY A;  1ZYI A;  3MPX A;  2D9Y A;  1ZSQ A;  2AEH A;  2ELB A;  1AQC A;  3CIK A;  3TFM A;  2CAY A;  1FHX A;  2UZR A;  3DXC A;  3SYX A;  3D8F A;  3FEH A;  5D3W A;  5HE1 A;  3WYF B;  3PZD A;  2DYQ A;  2DLW A;  5HE2 A;  1V5U A;  3U8Z A;  1MK7 B;  2COA A;  3SNH A;  3N7C A;  2YT0 A;  1WGU A;  3X23 A;  1FGY A;  2D10 A;  3NWF A;  3ULB A;  4CHJ A;  5KQ1 A;  2GUM A;  4QXA B;  3FVC A;  3HIE A;  3F5R A;  4OT1 A;  1ZC4 B;  2I5C A;  2E2X A;  4MY6 A;  1W1H A;  4GMX B;  4DIX A;  3T06 A;  3NSU A;  1K5D B;  1WVH A;  1X86 A;  4KHB B;  2N23 A;  1WJ1 A;  1T77 A;  1TXD A;  1QC6 A;  1BAK A;  1FAO A;  4HAZ B;  5J3Y A;  4CHM A;  5LON B;  1BWN A;  1SHC A;  5HE3 A;  2Z0P A;  3ULC A;  1V5P A;  2R2Y A;  2N0Y A;  2ADZ A;  2P0D A;  4EKU A;  4A6K A;  3HK0 A;  5D3V A;  1DYN A;  3CXB B;  4TKN A;  1V88 A;  4L1R A;  4WJ7 A;  2DX1 A;  2KCJ A;  1FOE A;  3AU5 A;  4GPT B;  2MKR A;  2D11 A;  2GCJ A;  4HDO A;  3U12 A;  1DDW A;  4IOY X;  1U29 A;  1V61 A;  2LUL A;  3HSA A;  3AJ4 A;  1U27 A;  1V89 A;  2J0M A;  4L6E A;  1UNR A;  2DHI A;  2KGX B;  3NWA A;  2NMB A;  1XCG A;  2J0J A;  2R0D A;  3PSC A;  2Y8F A;  1U5G A;  5M4Y B;  2RVB B;  2K2U A;  1MPH A;  4HB2 B;  5IRS A;  2JP2 A;  2VSZ A;  2YS5 A;  2Z4D A;  4HAW B;  4Z2N A;  1E5W A;  1P3R A;  1Z87 A;  2Y8G A;  4ZRK A;  3DCX A;  4MT7 A;  2DTC A;  4HHV A;  1I7A A;  1W1G A;  1UNP A;  3TO1 A;  1EGX A;  3PVW A;  4BBK A;  2OQB A;  3ZDT A;  5D3X A;  1ZC3 B;  1FGZ A;  1X1F A;  4K17 A;  4PNK A;  4GOU A;  3PVU A;  2LG1 A;  2W2W A;  4HAT B;  1UEF A;  4KHA A;  3P7Z A;  3TVV A;  4D0N B;  2K49 A;  2DN6 A;  1TJ6 A;  3AU4 A;  1OY2 A;  3QWM A;  3A98 B;  1FHO A;  2W2X C;  4QJ5 B;  3OAN A;  2H7D A;  4KHB A;  3P6A A;  1U5F A;  3PP2 A;  3ODO A;  2CY5 A;  2KIG A;  1TQZ A;  3KSY A;  2I1J A;  1EF1 A;  2LOZ A;  3OHM B;  1EAZ A;  4PQ0 A;  1MI1 A;  3KRW A;  5C16 A;  1LB1 A;  2EC1 A;  4CYE A;  2QKL A;  3NWD A;  4GMV A;  2YS3 A;  5D3Y A;  3KZ1 A;  4K2O A;  2R09 A;  4Z2M B;  2D9W A;  5FI1 A;  4DX9 0;  2Z59 A;  3ODX A;  2YF0 A;  4GNK B;  1J19 A;  2CRF A;  2P0H A;  3V5W A;  2YT1 A;  4GN1 A;  2J0K A;  4Y94 A;  2PZ1 A;  2EJ8 A;  1XD4 A;  1W1D A;  4D6W A;  2BCJ A;  2ZKM X;  2G35 A;  1UNQ A;  2X18 A;  2ZPY A;  5I2M A;  1P6S A;  3PG7 A;  4ZRJ A;  1BTK A;  4A5K A;  3SO6 A;  3TW1 A;  2DKP A;  1U5D A;  2OTX A;  1LW3 A;  4YON A;  1XR0 B;  3SV1 A;  1DDV A;  3GYO A;  4HDQ A;  4WVF B;  4HB0 B;  4K2P A;  2EMT A;  4HAV B;  2K8E A;  1BTN A;  1I2H A;  4DBB A;  5HE0 A;  2CY4 A;  3SUZ A;  5EFX A;  1XKE A;  5C5B A;  3ML4 A;  5LOP B;  3HW2 B;  5DIF B;  2K00 A;  3KY9 A;  3D8D A;  4DXA B;  5JP4 A;  2YRY A;  4IAP A;  4H8S A;  2Q13 A;  4KHO A;  2D9X A;  2H7E A;  2L1C A;  5D27 A;  4CSQ A;  3M1I B;  4HAX B;  2VKI A;  4GXB A;  3WA0 A;  2KIE A;  1FHW A;  1ZVR A;  3ZVR A;  3DXD A;  5JLJ B;  2DHK A;  1MKE A;  4YL8 A;  2UVM A;  5DH9 B;  2W2X D;  4DX8 A;  2D9Z A;  5KCV A;  2MFQ A;  2ROV A;  2MWN B;  1M7E A;  2XQN M;  4EJN A;  2NBV A;  2UZS A;  3QIJ A;  3RCP A;  2YSZ A;  2NZ8 B;  3F0W A;  3VOQ A;  4ZRI A;  3QBV B;  2QKM A;  5C5B B;  2KUP A;  5J3Q A;  4P7I A;  4OSN A;  5L81 A;  4EMO A;  2DA0 A;  4A6H A;  4QJ4 B;  2RGN B;  1DBH A;  3B77 A;  1WG7 A;  2D4Q A;  2HTH B;  4KAX B;  2D9V A;  1OMW A;  1MAI A;  2YS1 A;  3FM8 C;  1PFJ A;  4KVG B;  4F7G A;  1GG3 A;  5FI0 A;  1J0W A;  2DFK A;  3A8Q A;  2Z0Q A;  4XWX A;  2RNR B;  4NY0 A;  1DRO A;  1UPR A;  5I2S A;  2M38 A;  5CLL B;  1B55 A;  3PVL A;  1FB8 A;  1N3H A;  1QQG A;  4MK0 A;  1KI1 B;  2M14 A;  2DHJ A;  1U5E A;  1V5M A;  4F7U P;  1NU2 A;  3A58 A;  2COD A;  1MIZ B;  4B6H A;  4F7H A;  2GS0 A;  1DDM A;  3A8P A;  2RSG A;  3GYP A;  1ZM0 A;  2YT2 A;  5JHG A;  2FJU B;  2I1K A;  3KRX A;  2IYB A;  3UZT A;  2LYD A;  2P0F A;  1KZG A;  1XX0 A;  2FJL A;  1M7R A;  5J3T A;  4HB3 B;  2COC A;  3BIN A;  5KQ4 A;  1U2B A;  3HQC A;  1KZ7 A;  2ROZ B;  2K2J A;  3FSS A;  2Z14 A;  1EVH A;  2KUQ A; 
#chains in the Genus database with same CATH homology
 1GC7 A;  1Q67 A;  1XOD A;  1K5G B;  5DHF B;  5CLQ B;  5GOW B;  1WI1 A;  1Y5O A;  1X11 A;  2RUK B;  2RLO A;  2I5F A;  2V76 A;  1IRS A;  1MIX A;  1X05 A;  2ELA A;  2AL6 A;  3LJU X;  4A6F A;  2LKO A;  2Y7B A;  3VIA A;  1AWE A;  1PMS A;  1WJM A;  2MDX A;  1NTV A;  5C79 A;  2LOX A;  4IFS A;  1UPQ A;  1X1G A;  4HB4 B;  2COF A;  1MK9 B;  5DHA B;  1PLS A;  3DXE A;  4K81 A;  1ISN A;  2IFS A;  3BJI A;  2EMS A;  3U7D A;  5C6R A;  4GZU A;  1P5T A;  1H10 A;  1SGH A;  3O96 A;  2HE7 A;  1OQN A;  4NSW A;  3G9W A;  1GC6 A;  3IVF A;  4A6F B;  2Z0O A;  1RJ2 A;  2L2I A;  4HAU B;  1RRP B;  3MDB C;  1NI2 A;  2DKQ A;  5JHH A;  4TYZ A;  1WGQ A;  2YVC A;  2DX5 A;  2J59 M;  2GJY A;  1H4R A;  2D2Q A;  5DI9 B;  3TCA A;  2GCL A;  3D8E A;  3PEG A;  3ODW A;  1Y19 B;  2P8V A;  4C0A A;  2DYN A;  2VRW B;  4HAY B;  4WSF A;  1NTY A;  3MPX A;  2D9Y A;  1ZSQ A;  2AEH A;  2ELB A;  1AQC A;  3CIK A;  3TFM A;  2CAY A;  1FHX A;  2UZR A;  3DXC A;  3SYX A;  3D8F A;  3FEH A;  5D3W A;  5HE1 A;  3WYF B;  3PZD A;  2DYQ A;  2DLW A;  5HE2 A;  1V5U A;  3U8Z A;  1MK7 B;  2COA A;  3SNH A;  3N7C A;  2YT0 A;  1WGU A;  3X23 A;  1FGY A;  2D10 A;  3ULB A;  4CHJ A;  5KQ1 A;  3F5R A;  1ZC4 B;  2I5C A;  2E2X A;  4MY6 A;  1W1H A;  4GMX B;  3T06 A;  3NSU A;  1K5D B;  1WVH A;  1X86 A;  4KHB B;  2N23 A;  1WJ1 A;  1TXD A;  1QC6 A;  1BAK A;  1FAO A;  4HAZ B;  5J3Y A;  4CHM A;  5LON B;  1BWN A;  1SHC A;  5HE3 A;  2Z0P A;  3ULC A;  1V5P A;  2N0Y A;  2ADZ A;  2P0D A;  4EKU A;  4A6K A;  3HK0 A;  5D3V A;  1DYN A;  3CXB B;  4TKN A;  1V88 A;  4WJ7 A;  2DX1 A;  2KCJ A;  1FOE A;  3AU5 A;  4GPT B;  2MKR A;  2D11 A;  2GCJ A;  4HDO A;  1DDW A;  4IOY X;  1U29 A;  1V61 A;  2LUL A;  3AJ4 A;  1U27 A;  1V89 A;  2J0M A;  4L6E A;  1UNR A;  2DHI A;  2KGX B;  2NMB A;  1XCG A;  2J0J A;  2R0D A;  3PSC A;  2Y8F A;  1U5G A;  2RVB B;  2K2U A;  1MPH A;  4HB2 B;  2JP2 A;  2VSZ A;  2YS5 A;  4HAW B;  4Z2N A;  1E5W A;  1P3R A;  1Z87 A;  2Y8G A;  4ZRK A;  4MT7 A;  2DTC A;  4HHV A;  1I7A A;  1W1G A;  1UNP A;  3TO1 A;  1EGX A;  3PVW A;  4BBK A;  2OQB A;  3ZDT A;  5D3X A;  1ZC3 B;  1FGZ A;  1X1F A;  4K17 A;  4PNK A;  3PVU A;  2LG1 A;  2W2W A;  4HAT B;  1UEF A;  4KHA A;  3P7Z A;  3TVV A;  4D0N B;  2DN6 A;  1TJ6 A;  3AU4 A;  1OY2 A;  3QWM A;  3A98 B;  1FHO A;  2W2X C;  3OAN A;  2H7D A;  3P6A A;  1U5F A;  3PP2 A;  3ODO A;  2CY5 A;  1TQZ A;  3KSY A;  2I1J A;  1EF1 A;  2LOZ A;  1EAZ A;  4PQ0 A;  3KRW A;  5C16 A;  1LB1 A;  2EC1 A;  4CYE A;  2QKL A;  4GMV A;  2YS3 A;  5D3Y A;  3KZ1 A;  4K2O A;  2R09 A;  4Z2M B;  2D9W A;  5FI1 A;  4DX9 0;  3ODX A;  2YF0 A;  1J19 A;  2CRF A;  2P0H A;  3V5W A;  2YT1 A;  4GN1 A;  2J0K A;  4Y94 A;  2PZ1 A;  2EJ8 A;  1XD4 A;  1W1D A;  2BCJ A;  2G35 A;  1UNQ A;  2X18 A;  2ZPY A;  1P6S A;  3PG7 A;  4ZRJ A;  1BTK A;  4A5K A;  3SO6 A;  3TW1 A;  2DKP A;  1U5D A;  2OTX A;  1LW3 A;  4YON A;  1XR0 B;  3SV1 A;  1DDV A;  3GYO A;  4HDQ A;  4WVF B;  4HB0 B;  4K2P A;  2EMT A;  4HAV B;  1BTN A;  1I2H A;  4DBB A;  5HE0 A;  2CY4 A;  3SUZ A;  5EFX A;  1XKE A;  5C5B A;  3ML4 A;  5LOP B;  3HW2 B;  5DIF B;  2K00 A;  3KY9 A;  3D8D A;  4DXA B;  5JP4 A;  2YRY A;  4IAP A;  4H8S A;  2Q13 A;  4KHO A;  2D9X A;  2H7E A;  2L1C A;  5D27 A;  3M1I B;  4HAX B;  2VKI A;  4GXB A;  3WA0 A;  1FHW A;  1ZVR A;  3ZVR A;  3DXD A;  5JLJ B;  2DHK A;  1MKE A;  4YL8 A;  2UVM A;  5DH9 B;  2W2X D;  4DX8 A;  2D9Z A;  5KCV A;  2MFQ A;  2ROV A;  2MWN B;  1M7E A;  2XQN M;  4EJN A;  2UZS A;  3QIJ A;  3RCP A;  2YSZ A;  2NZ8 B;  3F0W A;  3VOQ A;  4ZRI A;  3QBV B;  2QKM A;  5C5B B;  2KUP A;  5J3Q A;  4P7I A;  5L81 A;  4EMO A;  2DA0 A;  4A6H A;  2RGN B;  1DBH A;  1WG7 A;  2D4Q A;  2HTH B;  4KAX B;  2D9V A;  1OMW A;  1MAI A;  2YS1 A;  3FM8 C;  1PFJ A;  4KVG B;  4F7G A;  1GG3 A;  5FI0 A;  1J0W A;  2DFK A;  3A8Q A;  2Z0Q A;  4XWX A;  2RNR B;  4NY0 A;  1DRO A;  1UPR A;  2M38 A;  5CLL B;  1B55 A;  3PVL A;  1FB8 A;  1N3H A;  1QQG A;  4MK0 A;  1KI1 B;  2M14 A;  2DHJ A;  1U5E A;  1V5M A;  4F7U P;  1NU2 A;  2COD A;  1MIZ B;  4B6H A;  4F7H A;  2GS0 A;  1DDM A;  3A8P A;  2RSG A;  3GYP A;  1ZM0 A;  5JHG A;  2I1K A;  3KRX A;  2IYB A;  3UZT A;  2LYD A;  2P0F A;  1KZG A;  1XX0 A;  2FJL A;  1M7R A;  5J3T A;  4HB3 B;  2COC A;  3BIN A;  5KQ4 A;  1U2B A;  3HQC A;  1KZ7 A;  2ROZ B;  2K2J A;  3FSS A;  1EVH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...