4HAWB

Crystal structure of crm1 inhibitor leptomycin b in complex with crm1(k548a)-ran-ranbp1
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
138
structure length
131
Chain Sequence
b'IHFEPVVKTMEEDEEVLYKVRAKLFRFDKDAKEWKERGTGDCKFLKNKKTNKVRILMRRDKTLKICANHIIAPEYTLKPNVGSDRSWVYACTADIAEGEAEAFTFAIRFGSKENADKFKEEFEKAQEINKK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GTP-binding nuclear protein Ran
publication title Nuclear export inhibition through covalent conjugation and hydrolysis of Leptomycin B by CRM1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport/antibiotic
total genus 36
structure length 131
sequence length 138
ec nomenclature
pdb deposition date 2012-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00638 Ran_BP1 RanBP1 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 4hawB00
2XQNM 4EKUA 2P0DA 3DXDA 1OY2A 4WSFA 3QWMA 1Y19B 2N23A 2NMBA 2CAYA 1QC6A 3ODWA 4HHVA 1RJ2A 4K81A 2JP2A 3KZ1A 4A6FA 4A6HA 4A6FB 1DDWA 1MPHA 3OANA 1WGUA 3V5WA 1U5EA 2RGNB 2PZ1A 3PVLA 3SUZA 2FJLA 2EMTA 1B55A 4K2OA 3ODOA 1BAKA 3KSYA 1DDMA 3O96A 3WA0A 2DTCA 1DBHA 2GCLA 1NTYA 2K2JA 5CLQB 2YF0A 1M7EA 1WJMA 5C5BA 4ZRKA 2IYBA 2OQBA 1FAOA 2D11A 5C5BB 3LJUX 4HB0B 5D3VA 1TJ6A 3DXCA 1KZGA 1SGHA 3KY9A 4WJ7A 4HB2B 2YS1A 2D9WA 4L6EA 4F7HA 3P7ZA 1W1HA 4HDQA 1PLSA 1UPQA 4C0AA 4CHMA 4Z2NA 4HAYB 2VRWB 3U7DA 3HK0A 4HB3B 1UNQA 1MK7B 3ZVRA 1GC6A 2D2QA 5EFXA 4KHOA 4DBBA 1BTNA 5FI1A 2ADZA 1IRSA 1XX0A 2RLOA 3N7CA 2H7DA 2P0FA 1QQGA 1GC7A 2YVCA 4MK0A 2W2XD 1FHOA 4TKNA 2VSZA 4D0NB 3NSUA 5J3TA 4ZRIA 3ULCA 2LULA 2LYDA 5LOPB 1OQNA 1X1FA 4TYZA 3QIJA 4IFSA 2P8VA 1E5WA 2CRFA 1MAIA 1TQZA 4K17A 1UNPA 2DKQA 2ROZB 4KVGB 2M38A 3F0WA 5C79A 1J0WA 2Y8FA 4GN1A 4Y94A 1V5PA 1H4RA 1WJ1A 2G35A 3A8PA 1I7AA 3MDBC 1GG3A 3SO6A 1ZC3B 2K2UA 2YT1A 2QKLA 2MDXA 3ODXA 2KCJA 2DX5A 5D27A 4CYEA 4HAUB 3X23A 1BWNA 1V5UA 2DN6A 2UZRA 1NTVA 5HE3A 4GZUA 3SV1A 2L1CA 2KGXB 1V88A 3CIKA 3FEHA 1UEFA 2KUPA 4WVFB 5DHFB 2RNRB 2RSGA 4EJNA 2EC1A 2CY4A 4KHAA 3A8QA 1AWEA 3HW2B 1W1GA 1X05A 1X11A 2QKMA 1X86A 2GJYA 2M14A 5D3WA 4GMXB 5KCVA 3D8DA 2N0YA 3F5RA 1EGXA 4DX8A 2DFKA 1ZM0A 2MWNB 2DYQA 1RRPB 2Y7BA 3PVUA 1U5DA 5DIFB 3AU5A 1NI2A 3ULBA 1KZ7A 2BCJA 1Q67A 2E2XA 5J3YA 3WYFB 4YONA 1PMSA 3P6AA 5HE0A 3G9WA 3FSSA 5C16A 2D4QA 3DXEA 2DYNA 1XODA 2DKPA 4PQ0A 1BTKA 2R09A 3U8ZA 4H8SA 3TO1A 1W1DA 5JHHA 2COCA 1V89A 2W2WA 4DXAB 3RCPA 2YS3A 1FOEA 1MKEA 1Y5OA 4XWXA 1DDVA 2LG1A 1ISNA 4BBKA 2DHIA 2J0MA 2Z0PA 1MIZB 1XCGA 2YT0A 5JHGA 2J0KA 1PFJA 3PSCA 4MT7A 1V61A 2P0HA 1I2HA 2LKOA 2OTXA 2YRYA 2Z0QA 3M1IB 3AJ4A 4IAPA 1UPRA 2ELAA 1WG7A 1M7RA 2AL6A 4IOYX 1MK9B 2AEHA 2ELBA 3HQCA 4Z2MB 4HATB 3GYPA 3IVFA 4YL8A 4HAVB 3CXBB 2Z0OA 4KHBB 1ZSQA 1EAZA 2DHKA 4MY6A 1DYNA 1EVHA 1P5TA 1WGQA 2LOZA 2I5FA 1LB1A 3PZDA 3BJIA 4KAXB 2GCJA 4NY0A 3D8FA 4CHJA 1FB8A 4P7IA 4K2PA 4HAWB 1TXDA 1MIXA 2LOXA 1FGZA 4GPTB 2VKIA 4NSWA 3SNHA 4A6KA 4B6HA 4PNKA 1DROA 2HE7A 5KQ1A 3BINA 2X18A 2CODA 5DI9B 5DH9B 1X1GA 2RVBB 3GYOA 2IFSA 4ZRJA 1OMWA 1U5FA 3KRXA 2DLWA 1P6SA 2V76A 5FI0A 3KRWA 1XKEA 2CY5A 1NU2A 3A98B 3PEGA 2UVMA 2ROVA 1J19A 2D9ZA 2HTHB 1FHWA 1XR0B 4A5KA 5CLLB 1U29A 2DX1A 4HAZB 1XD4A 4GXBA 1SHCA 1V5MA 3TCAA 2K00A 4EMOA 1U27A 2COFA 2GS0A 3D8EA 2W2XC 2D9VA 5C6RA 2ZPYA 5L81A 1ZC4B 2EJ8A 1KI1B 3VOQA 2DHJA 1U2BA 3PVWA 2I1KA 3MPXA 1K5GB 1U5GA 1WVHA 5KQ4A 5JLJB 3PG7A 4HB4B 2UZSA 1LW3A 2YS5A 2MFQA 3PP2A 2I1JA 5GOWB 5DHAB 1EF1A 3TW1A 1H10A 2J59M 1N3HA 2NZ8B 2Y8GA 5LONB 3TVVA 5D3YA 5D3XA 2MKRA 1K5DB 3SYXA 2COAA 4GMVA 3T06A 2I5CA 2J0JA 2D9YA 5HE1A 1AQCA 2RUKB 3AU4A 3ML4A 4DX90 5J3QA 2YSZA 2DA0A 2EMSA 3QBVB 3ZDTA 1Z87A 2L2IA 3UZTA 1FGYA 3TFMA 2D10A 4F7GA 5HE2A 5JP4A 2D9XA 3FM8C 4HDOA 1ZVRA 2R0DA 1FHXA 1UNRA 3VIAA 4HAXB 4F7UP 2Q13A 2H7EA 1P3RA 1WI1A
chains in the Genus database with same CATH superfamily
2NBVA 2XQNM 1ZYIA 4EKUA 2P0DA 2KUQA 3DXDA 1OY2A 4WSFA 3QWMA 3DCXA 1Y19B 2N23A 2NMBA 2CAYA 1QC6A 3ODWA 2KIEA 4HHVA 1RJ2A 2KIGA 4K81A 2JP2A 3KZ1A 4A6FA 4A6HA 1T77A 4A6FB 1DDWA 1MPHA 3A58A 1WGUA 3OANA 1U5EA 3V5WA 2RGNB 2PZ1A 3PVLA 2FJUB 3SUZA 2FJLA 2EMTA 1B55A 4K2OA 3ODOA 2K49A 1BAKA 3KSYA 1DDMA 3O96A 3WA0A 2DTCA 1DBHA 2GCLA 1NTYA 2K2JA 5CLQB 2YF0A 1M7EA 1WJMA 4HSIA 5C5BA 4ZRKA 2IYBA 2OQBA 1FAOA 2D11A 5C5BB 3LJUX 4HB0B 5D3VA 1TJ6A 3DXCA 1KZGA 1SGHA 3KY9A 4WJ7A 3U12A 4HB2B 2YS1A 2D9WA 4L6EA 4F7HA 3P7ZA 2ZKMX 1W1HA 4HDQA 1PLSA 1UPQA 5I2MA 4C0AA 4CHMA 4Z2NA 4HAYB 2VRWB 3U7DA 3HK0A 4HB3B 1UNQA 1MK7B 3ZVRA 1GC6A 2D2QA 2YT2A 5EFXA 4KHOA 4DBBA 1BTNA 5FI1A 2ADZA 1IRSA 1XX0A 2RLOA 3N7CA 2H7DA 2P0FA 1QQGA 1GC7A 2YVCA 4MK0A 2W2XD 1FHOA 4TKNA 2VSZA 4D0NB 3NSUA 5J3TA 4ZRIA 3ULCA 2LULA 2LYDA 5LOPB 1OQNA 1X1FA 4TYZA 3QIJA 4IFSA 2P8VA 1E5WA 2CRFA 1MAIA 1TQZA 4K17A 1UNPA 2DKQA 2ROZB 4KVGB 2M38A 3F0WA 5C79A 1J0WA 2Y8FA 4GN1A 4Y94A 1V5PA 1H4RA 1WJ1A 2G35A 3A8PA 1I7AA 3MDBC 1GG3A 3SO6A 1ZC3B 2K2UA 3NW8A 4QJ4B 2YT1A 3HIEA 4GOUA 2QKLA 2MDXA 3ODXA 2KCJA 2DX5A 5D27A 4CYEA 4HAUB 3X23A 1BWNA 1V5UA 2DN6A 2UZRA 1NTVA 5HE3A 4GZUA 3SV1A 2L1CA 2KGXB 1V88A 3CIKA 3FEHA 5IRSA 1UEFA 2KUPA 4WVFB 5DHFB 2RNRB 2RSGA 4EJNA 2EC1A 2CY4A 4KHAA 2Z59A 3A8QA 1AWEA 4D6WA 3HW2B 1W1GA 1X05A 2GUMA 1X11A 3HSAA 2QKMA 1X86A 2GJYA 2M14A 5D3WA 4GMXB 5KCVA 3D8DA 2N0YA 3F5RA 1EGXA 4DX8A 2DFKA 5LG4B 1ZM0A 2MWNB 2DYQA 1RRPB 2Y7BA 3PVUA 1U5DA 5DIFB 3AU5A 1NI2A 3ULBA 1KZ7A 2BCJA 1Q67A 2E2XA 5J3YA 3WYFB 4YONA 1PMSA 3P6AA 5HE0A 3G9WA 3FSSA 5C16A 2D4QA 3DXEA 2DYNA 1XODA 2DKPA 4PQ0A 1BTKA 2R09A 3U8ZA 4H8SA 3TO1A 1W1DA 5JHHA 2COCA 1V89A 2W2WA 4DXAB 3RCPA 2YS3A 1FOEA 1MKEA 1Y5OA 4XWXA 1DDVA 2LG1A 1ISNA 4BBKA 2DHIA 2J0MA 2Z0PA 1MIZB 1XCGA 3OHMB 3NWAA 2YT0A 5JHGA 2J0KA 1PFJA 3PSCA 4MT7A 1V61A 2P0HA 1I2HA 4DIXA 2LKOA 2OTXA 2YRYA 2Z0QA 3M1IB 3AJ4A 4IAPA 1UPRA 2ELAA 1WG7A 4GNKB 1M7RA 2AL6A 4IOYX 1MK9B 3B77A 2AEHA 4L1RA 2ELBA 3HQCA 4Z2MB 3NWFA 4HATB 3GYPA 3IVFA 5I2SA 4KHBA 4YL8A 4HAVB 3CXBB 2Z0OA 4KHBB 1ZSQA 1EAZA 2DHKA 4MY6A 1DYNA 1EVHA 1P5TA 1WGQA 2LOZA 2I5FA 1LB1A 3PZDA 3BJIA 4KAXB 4CSQA 2GCJA 4NY0A 3D8FA 4CHJA 3FVCA 1FB8A 4P7IA 4K2PA 4HAWB 1TXDA 1MIXA 2LOXA 1FGZA 4GPTB 2VKIA 4NSWA 3SNHA 4A6KA 1MI1A 4B6HA 4PNKA 1DROA 2HE7A 5KQ1A 3BINA 2X18A 2CODA 5DI9B 4OSNA 5DH9B 1X1GA 2RVBB 3GYOA 2IFSA 4ZRJA 1OMWA 1U5FA 3KRXA 2DLWA 1P6SA 2V76A 5FI0A 3KRWA 1XKEA 2CY5A 1NU2A 3A98B 3PEGA 2UVMA 2ROVA 1J19A 2D9ZA 2HTHB 1FHWA 1XR0B 4A5KA 5CLLB 1U29A 2DX1A 4HAZB 1XD4A 4GXBA 1SHCA 1V5MA 3TCAA 2K00A 4QJ5B 4EMOA 1U27A 2RRFA 2COFA 2GS0A 3D8EA 2W2XC 2D9VA 5C6RA 2ZPYA 5L81A 1ZC4B 2EJ8A 1KI1B 3VOQA 2DHJA 1U2BA 3PVWA 2I1KA 5M4YB 3MPXA 1K5GB 1U5GA 1WVHA 2R2YA 5KQ4A 5JLJB 2KR0A 2Z13A 3PG7A 4HB4B 2UZSA 1LW3A 2YS5A 3NWDA 2MFQA 3PP2A 2I1JA 2K8EA 5GOWB 5DHAB 1EF1A 2Z14A 3TW1A 1H10A 4QJ3B 2J59M 1N3HA 2NZ8B 2Y8GA 5LONB 3TVVA 5D3YA 5D3XA 2MKRA 1K5DB 3SYXA 2COAA 4GMVA 3T06A 2I5CA 4OT1A 2J0JA 2D9YA 5HE1A 1AQCA 2RUKB 3AU4A 3ML4A 4DX90 5J3QA 2YSZA 2DA0A 2EMSA 3QBVB 3ZDTA 1Z87A 2L2IA 3UZTA 1FGYA 3TFMA 2D10A 4F7GA 5HE2A 5JP4A 2Z4DA 2D9XA 3FM8C 4HDOA 1ZVRA 2R0DA 4QXAB 1FHXA 1UNRA 3VIAA 4HAXB 4F7UP 2Q13A 2H7EA 1P3RA 1WI1A
chains in the Genus database with same CATH topology
2XQNM 4EKUA 2P0DA 3DXDA 1OY2A 4WSFA 3QWMA 1Y19B 2N23A 2NMBA 2CAYA 1QC6A 3ODWA 4HHVA 1RJ2A 4K81A 2JP2A 3KZ1A 4A6FA 4A6HA 4A6FB 1DDWA 1MPHA 3OANA 1WGUA 3V5WA 1U5EA 2RGNB 2PZ1A 3PVLA 3SUZA 2FJLA 2EMTA 1B55A 4K2OA 3ODOA 1BAKA 3KSYA 1DDMA 3O96A 3WA0A 2DTCA 1DBHA 2GCLA 1NTYA 2K2JA 5CLQB 2YF0A 1M7EA 1WJMA 5C5BA 4ZRKA 2IYBA 2OQBA 1FAOA 2D11A 5C5BB 3LJUX 4HB0B 5D3VA 1TJ6A 3DXCA 1KZGA 1SGHA 3KY9A 4WJ7A 4HB2B 2YS1A 2D9WA 4L6EA 4F7HA 3P7ZA 1W1HA 4HDQA 1PLSA 1UPQA 4C0AA 4CHMA 4Z2NA 4HAYB 2VRWB 3U7DA 3HK0A 4HB3B 1UNQA 1MK7B 3ZVRA 1GC6A 2D2QA 5EFXA 4KHOA 4DBBA 1BTNA 5FI1A 2ADZA 1IRSA 1XX0A 2RLOA 3N7CA 2H7DA 2P0FA 1QQGA 1GC7A 2YVCA 4MK0A 2W2XD 1FHOA 4TKNA 2VSZA 4D0NB 3NSUA 5J3TA 4ZRIA 3ULCA 2LULA 2LYDA 5LOPB 1OQNA 1X1FA 4TYZA 3QIJA 4IFSA 2P8VA 1E5WA 2CRFA 1MAIA 1TQZA 4K17A 1UNPA 2DKQA 2ROZB 4KVGB 2M38A 3F0WA 5C79A 1J0WA 2Y8FA 4GN1A 4Y94A 1V5PA 1H4RA 1WJ1A 2G35A 3A8PA 1I7AA 3MDBC 1GG3A 3SO6A 1ZC3B 2K2UA 2YT1A 2QKLA 2MDXA 3ODXA 2KCJA 2DX5A 5D27A 4CYEA 4HAUB 3X23A 1BWNA 1V5UA 2DN6A 2UZRA 1NTVA 5HE3A 4GZUA 3SV1A 2L1CA 2KGXB 1V88A 3CIKA 3FEHA 1UEFA 2KUPA 4WVFB 5DHFB 2RNRB 2RSGA 4EJNA 2EC1A 2CY4A 4KHAA 3A8QA 1AWEA 3HW2B 1W1GA 1X05A 1X11A 2QKMA 1X86A 2GJYA 2M14A 5D3WA 4GMXB 5KCVA 3D8DA 2N0YA 3F5RA 1EGXA 4DX8A 2DFKA 1ZM0A 2MWNB 2DYQA 1RRPB 2Y7BA 3PVUA 1U5DA 5DIFB 3AU5A 1NI2A 3ULBA 1KZ7A 2BCJA 1Q67A 2E2XA 5J3YA 3WYFB 4YONA 1PMSA 3P6AA 5HE0A 3G9WA 3FSSA 5C16A 2D4QA 3DXEA 2DYNA 1XODA 2DKPA 4PQ0A 1BTKA 2R09A 3U8ZA 4H8SA 3TO1A 1W1DA 5JHHA 2COCA 1V89A 2W2WA 4DXAB 3RCPA 2YS3A 1FOEA 1MKEA 1Y5OA 4XWXA 1DDVA 2LG1A 1ISNA 4BBKA 2DHIA 2J0MA 2Z0PA 1MIZB 1XCGA 2YT0A 5JHGA 2J0KA 1PFJA 3PSCA 4MT7A 1V61A 2P0HA 1I2HA 2LKOA 2OTXA 2YRYA 2Z0QA 3M1IB 3AJ4A 4IAPA 1UPRA 2ELAA 1WG7A 1M7RA 2AL6A 4IOYX 1MK9B 2AEHA 2ELBA 3HQCA 4Z2MB 4HATB 3GYPA 3IVFA 4YL8A 4HAVB 3CXBB 2Z0OA 4KHBB 1ZSQA 1EAZA 2DHKA 4MY6A 1DYNA 1EVHA 1P5TA 1WGQA 2LOZA 2I5FA 1LB1A 3PZDA 3BJIA 4KAXB 2GCJA 4NY0A 3D8FA 4CHJA 1FB8A 4P7IA 4K2PA 4HAWB 1TXDA 1MIXA 2LOXA 1FGZA 4GPTB 2VKIA 4NSWA 3SNHA 4A6KA 4B6HA 4PNKA 1DROA 2HE7A 5KQ1A 3BINA 2X18A 2CODA 5DI9B 5DH9B 1X1GA 2RVBB 3GYOA 2IFSA 4ZRJA 1OMWA 1U5FA 3KRXA 2DLWA 1P6SA 2V76A 5FI0A 3KRWA 1XKEA 2CY5A 1NU2A 3A98B 3PEGA 2UVMA 2ROVA 1J19A 2D9ZA 2HTHB 1FHWA 1XR0B 4A5KA 5CLLB 1U29A 2DX1A 4HAZB 1XD4A 4GXBA 1SHCA 1V5MA 3TCAA 2K00A 4EMOA 1U27A 2COFA 2GS0A 3D8EA 2W2XC 2D9VA 5C6RA 2ZPYA 5L81A 1ZC4B 2EJ8A 1KI1B 3VOQA 2DHJA 1U2BA 3PVWA 2I1KA 3MPXA 1K5GB 1U5GA 1WVHA 5KQ4A 5JLJB 3PG7A 4HB4B 2UZSA 1LW3A 2YS5A 2MFQA 3PP2A 2I1JA 5GOWB 5DHAB 1EF1A 3TW1A 1H10A 2J59M 1N3HA 2NZ8B 2Y8GA 5LONB 3TVVA 5D3YA 5D3XA 2MKRA 1K5DB 3SYXA 2COAA 4GMVA 3T06A 2I5CA 2J0JA 2D9YA 5HE1A 1AQCA 2RUKB 3AU4A 3ML4A 4DX90 5J3QA 2YSZA 2DA0A 2EMSA 3QBVB 3ZDTA 1Z87A 2L2IA 3UZTA 1FGYA 3TFMA 2D10A 4F7GA 5HE2A 5JP4A 2D9XA 3FM8C 4HDOA 1ZVRA 2R0DA 1FHXA 1UNRA 3VIAA 4HAXB 4F7UP 2Q13A 2H7EA 1P3RA 1WI1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XQN M;  4EKU A;  2P0D A;  3DXD A;  1OY2 A;  4WSF A;  3QWM A;  1Y19 B;  2N23 A;  2NMB A;  2CAY A;  1QC6 A;  3ODW A;  4HHV A;  1RJ2 A;  4K81 A;  2JP2 A;  3KZ1 A;  4A6F A;  4A6H A;  4A6F B;  1DDW A;  1MPH A;  3OAN A;  1WGU A;  3V5W A;  1U5E A;  2RGN B;  2PZ1 A;  3PVL A;  3SUZ A;  2FJL A;  2EMT A;  1B55 A;  4K2O A;  3ODO A;  1BAK A;  3KSY A;  1DDM A;  3O96 A;  3WA0 A;  2DTC A;  1DBH A;  2GCL A;  1NTY A;  2K2J A;  5CLQ B;  2YF0 A;  1M7E A;  1WJM A;  5C5B A;  4ZRK A;  2IYB A;  2OQB A;  1FAO A;  2D11 A;  5C5B B;  3LJU X;  4HB0 B;  5D3V A;  1TJ6 A;  3DXC A;  1KZG A;  1SGH A;  3KY9 A;  4WJ7 A;  4HB2 B;  2YS1 A;  2D9W A;  4L6E A;  4F7H A;  3P7Z A;  1W1H A;  4HDQ A;  1PLS A;  1UPQ A;  4C0A A;  4CHM A;  4Z2N A;  4HAY B;  2VRW B;  3U7D A;  3HK0 A;  4HB3 B;  1UNQ A;  1MK7 B;  3ZVR A;  1GC6 A;  2D2Q A;  5EFX A;  4KHO A;  4DBB A;  1BTN A;  5FI1 A;  2ADZ A;  1IRS A;  1XX0 A;  2RLO A;  3N7C A;  2H7D A;  2P0F A;  1QQG A;  1GC7 A;  2YVC A;  4MK0 A;  2W2X D;  1FHO A;  4TKN A;  2VSZ A;  4D0N B;  3NSU A;  5J3T A;  4ZRI A;  3ULC A;  2LUL A;  2LYD A;  5LOP B;  1OQN A;  1X1F A;  4TYZ A;  3QIJ A;  4IFS A;  2P8V A;  1E5W A;  2CRF A;  1MAI A;  1TQZ A;  4K17 A;  1UNP A;  2DKQ A;  2ROZ B;  4KVG B;  2M38 A;  3F0W A;  5C79 A;  1J0W A;  2Y8F A;  4GN1 A;  4Y94 A;  1V5P A;  1H4R A;  1WJ1 A;  2G35 A;  3A8P A;  1I7A A;  3MDB C;  1GG3 A;  3SO6 A;  1ZC3 B;  2K2U A;  2YT1 A;  2QKL A;  2MDX A;  3ODX A;  2KCJ A;  2DX5 A;  5D27 A;  4CYE A;  4HAU B;  3X23 A;  1BWN A;  1V5U A;  2DN6 A;  2UZR A;  1NTV A;  5HE3 A;  4GZU A;  3SV1 A;  2L1C A;  2KGX B;  1V88 A;  3CIK A;  3FEH A;  1UEF A;  2KUP A;  4WVF B;  5DHF B;  2RNR B;  2RSG A;  4EJN A;  2EC1 A;  2CY4 A;  4KHA A;  3A8Q A;  1AWE A;  3HW2 B;  1W1G A;  1X05 A;  1X11 A;  2QKM A;  1X86 A;  2GJY A;  2M14 A;  5D3W A;  4GMX B;  5KCV A;  3D8D A;  2N0Y A;  3F5R A;  1EGX A;  4DX8 A;  2DFK A;  1ZM0 A;  2MWN B;  2DYQ A;  1RRP B;  2Y7B A;  3PVU A;  1U5D A;  5DIF B;  3AU5 A;  1NI2 A;  3ULB A;  1KZ7 A;  2BCJ A;  1Q67 A;  2E2X A;  5J3Y A;  3WYF B;  4YON A;  1PMS A;  3P6A A;  5HE0 A;  3G9W A;  3FSS A;  5C16 A;  2D4Q A;  3DXE A;  2DYN A;  1XOD A;  2DKP A;  4PQ0 A;  1BTK A;  2R09 A;  3U8Z A;  4H8S A;  3TO1 A;  1W1D A;  5JHH A;  2COC A;  1V89 A;  2W2W A;  4DXA B;  3RCP A;  2YS3 A;  1FOE A;  1MKE A;  1Y5O A;  4XWX A;  1DDV A;  2LG1 A;  1ISN A;  4BBK A;  2DHI A;  2J0M A;  2Z0P A;  1MIZ B;  1XCG A;  2YT0 A;  5JHG A;  2J0K A;  1PFJ A;  3PSC A;  4MT7 A;  1V61 A;  2P0H A;  1I2H A;  2LKO A;  2OTX A;  2YRY A;  2Z0Q A;  3M1I B;  3AJ4 A;  4IAP A;  1UPR A;  2ELA A;  1WG7 A;  1M7R A;  2AL6 A;  4IOY X;  1MK9 B;  2AEH A;  2ELB A;  3HQC A;  4Z2M B;  4HAT B;  3GYP A;  3IVF A;  4YL8 A;  4HAV B;  3CXB B;  2Z0O A;  4KHB B;  1ZSQ A;  1EAZ A;  2DHK A;  4MY6 A;  1DYN A;  1EVH A;  1P5T A;  1WGQ A;  2LOZ A;  2I5F A;  1LB1 A;  3PZD A;  3BJI A;  4KAX B;  2GCJ A;  4NY0 A;  3D8F A;  4CHJ A;  1FB8 A;  4P7I A;  4K2P A;  4HAW B;  1TXD A;  1MIX A;  2LOX A;  1FGZ A;  4GPT B;  2VKI A;  4NSW A;  3SNH A;  4A6K A;  4B6H A;  4PNK A;  1DRO A;  2HE7 A;  5KQ1 A;  3BIN A;  2X18 A;  2COD A;  5DI9 B;  5DH9 B;  1X1G A;  2RVB B;  3GYO A;  2IFS A;  4ZRJ A;  1OMW A;  1U5F A;  3KRX A;  2DLW A;  1P6S A;  2V76 A;  5FI0 A;  3KRW A;  1XKE A;  2CY5 A;  1NU2 A;  3A98 B;  3PEG A;  2UVM A;  2ROV A;  1J19 A;  2D9Z A;  2HTH B;  1FHW A;  1XR0 B;  4A5K A;  5CLL B;  1U29 A;  2DX1 A;  4HAZ B;  1XD4 A;  4GXB A;  1SHC A;  1V5M A;  3TCA A;  2K00 A;  4EMO A;  1U27 A;  2COF A;  2GS0 A;  3D8E A;  2W2X C;  2D9V A;  5C6R A;  2ZPY A;  5L81 A;  1ZC4 B;  2EJ8 A;  1KI1 B;  3VOQ A;  2DHJ A;  1U2B A;  3PVW A;  2I1K A;  3MPX A;  1K5G B;  1U5G A;  1WVH A;  5KQ4 A;  5JLJ B;  3PG7 A;  4HB4 B;  2UZS A;  1LW3 A;  2YS5 A;  2MFQ A;  3PP2 A;  2I1J A;  5GOW B;  5DHA B;  1EF1 A;  3TW1 A;  1H10 A;  2J59 M;  1N3H A;  2NZ8 B;  2Y8G A;  5LON B;  3TVV A;  5D3Y A;  5D3X A;  2MKR A;  1K5D B;  3SYX A;  2COA A;  4GMV A;  3T06 A;  2I5C A;  2J0J A;  2D9Y A;  5HE1 A;  1AQC A;  2RUK B;  3AU4 A;  3ML4 A;  4DX9 0;  5J3Q A;  2YSZ A;  2DA0 A;  2EMS A;  3QBV B;  3ZDT A;  1Z87 A;  2L2I A;  3UZT A;  1FGY A;  3TFM A;  2D10 A;  4F7G A;  5HE2 A;  5JP4 A;  2D9X A;  3FM8 C;  4HDO A;  1ZVR A;  2R0D A;  1FHX A;  1UNR A;  3VIA A;  4HAX B;  4F7U P;  2Q13 A;  2H7E A;  1P3R A;  1WI1 A; 
#chains in the Genus database with same CATH topology
 2NBV A;  2XQN M;  1ZYI A;  4EKU A;  2P0D A;  2KUQ A;  3DXD A;  1OY2 A;  4WSF A;  3QWM A;  3DCX A;  1Y19 B;  2N23 A;  2NMB A;  2CAY A;  1QC6 A;  3ODW A;  2KIE A;  4HHV A;  1RJ2 A;  2KIG A;  4K81 A;  2JP2 A;  3KZ1 A;  4A6F A;  4A6H A;  1T77 A;  4A6F B;  1DDW A;  1MPH A;  3A58 A;  1WGU A;  3OAN A;  1U5E A;  3V5W A;  2RGN B;  2PZ1 A;  3PVL A;  2FJU B;  3SUZ A;  2FJL A;  2EMT A;  1B55 A;  4K2O A;  3ODO A;  2K49 A;  1BAK A;  3KSY A;  1DDM A;  3O96 A;  3WA0 A;  2DTC A;  1DBH A;  2GCL A;  1NTY A;  2K2J A;  5CLQ B;  2YF0 A;  1M7E A;  1WJM A;  4HSI A;  5C5B A;  4ZRK A;  2IYB A;  2OQB A;  1FAO A;  2D11 A;  5C5B B;  3LJU X;  4HB0 B;  5D3V A;  1TJ6 A;  3DXC A;  1KZG A;  1SGH A;  3KY9 A;  4WJ7 A;  3U12 A;  4HB2 B;  2YS1 A;  2D9W A;  4L6E A;  4F7H A;  3P7Z A;  2ZKM X;  1W1H A;  4HDQ A;  1PLS A;  1UPQ A;  5I2M A;  4C0A A;  4CHM A;  4Z2N A;  4HAY B;  2VRW B;  3U7D A;  3HK0 A;  4HB3 B;  1UNQ A;  1MK7 B;  3ZVR A;  1GC6 A;  2D2Q A;  2YT2 A;  5EFX A;  4KHO A;  4DBB A;  1BTN A;  5FI1 A;  2ADZ A;  1IRS A;  1XX0 A;  2RLO A;  3N7C A;  2H7D A;  2P0F A;  1QQG A;  1GC7 A;  2YVC A;  4MK0 A;  2W2X D;  1FHO A;  4TKN A;  2VSZ A;  4D0N B;  3NSU A;  5J3T A;  4ZRI A;  3ULC A;  2LUL A;  2LYD A;  5LOP B;  1OQN A;  1X1F A;  4TYZ A;  3QIJ A;  4IFS A;  2P8V A;  1E5W A;  2CRF A;  1MAI A;  1TQZ A;  4K17 A;  1UNP A;  2DKQ A;  2ROZ B;  4KVG B;  2M38 A;  3F0W A;  5C79 A;  1J0W A;  2Y8F A;  4GN1 A;  4Y94 A;  1V5P A;  1H4R A;  1WJ1 A;  2G35 A;  3A8P A;  1I7A A;  3MDB C;  1GG3 A;  3SO6 A;  1ZC3 B;  2K2U A;  3NW8 A;  4QJ4 B;  2YT1 A;  3HIE A;  4GOU A;  2QKL A;  2MDX A;  3ODX A;  2KCJ A;  2DX5 A;  5D27 A;  4CYE A;  4HAU B;  3X23 A;  1BWN A;  1V5U A;  2DN6 A;  2UZR A;  1NTV A;  5HE3 A;  4GZU A;  3SV1 A;  2L1C A;  2KGX B;  1V88 A;  3CIK A;  3FEH A;  5IRS A;  1UEF A;  2KUP A;  4WVF B;  5DHF B;  2RNR B;  2RSG A;  4EJN A;  2EC1 A;  2CY4 A;  4KHA A;  2Z59 A;  3A8Q A;  1AWE A;  4D6W A;  3HW2 B;  1W1G A;  1X05 A;  2GUM A;  1X11 A;  3HSA A;  2QKM A;  1X86 A;  2GJY A;  2M14 A;  5D3W A;  4GMX B;  5KCV A;  3D8D A;  2N0Y A;  3F5R A;  1EGX A;  4DX8 A;  2DFK A;  5LG4 B;  1ZM0 A;  2MWN B;  2DYQ A;  1RRP B;  2Y7B A;  3PVU A;  1U5D A;  5DIF B;  3AU5 A;  1NI2 A;  3ULB A;  1KZ7 A;  2BCJ A;  1Q67 A;  2E2X A;  5J3Y A;  3WYF B;  4YON A;  1PMS A;  3P6A A;  5HE0 A;  3G9W A;  3FSS A;  5C16 A;  2D4Q A;  3DXE A;  2DYN A;  1XOD A;  2DKP A;  4PQ0 A;  1BTK A;  2R09 A;  3U8Z A;  4H8S A;  3TO1 A;  1W1D A;  5JHH A;  2COC A;  1V89 A;  2W2W A;  4DXA B;  3RCP A;  2YS3 A;  1FOE A;  1MKE A;  1Y5O A;  4XWX A;  1DDV A;  2LG1 A;  1ISN A;  4BBK A;  2DHI A;  2J0M A;  2Z0P A;  1MIZ B;  1XCG A;  3OHM B;  3NWA A;  2YT0 A;  5JHG A;  2J0K A;  1PFJ A;  3PSC A;  4MT7 A;  1V61 A;  2P0H A;  1I2H A;  4DIX A;  2LKO A;  2OTX A;  2YRY A;  2Z0Q A;  3M1I B;  3AJ4 A;  4IAP A;  1UPR A;  2ELA A;  1WG7 A;  4GNK B;  1M7R A;  2AL6 A;  4IOY X;  1MK9 B;  3B77 A;  2AEH A;  4L1R A;  2ELB A;  3HQC A;  4Z2M B;  3NWF A;  4HAT B;  3GYP A;  3IVF A;  5I2S A;  4KHB A;  4YL8 A;  4HAV B;  3CXB B;  2Z0O A;  4KHB B;  1ZSQ A;  1EAZ A;  2DHK A;  4MY6 A;  1DYN A;  1EVH A;  1P5T A;  1WGQ A;  2LOZ A;  2I5F A;  1LB1 A;  3PZD A;  3BJI A;  4KAX B;  4CSQ A;  2GCJ A;  4NY0 A;  3D8F A;  4CHJ A;  3FVC A;  1FB8 A;  4P7I A;  4K2P A;  4HAW B;  1TXD A;  1MIX A;  2LOX A;  1FGZ A;  4GPT B;  2VKI A;  4NSW A;  3SNH A;  4A6K A;  1MI1 A;  4B6H A;  4PNK A;  1DRO A;  2HE7 A;  5KQ1 A;  3BIN A;  2X18 A;  2COD A;  5DI9 B;  4OSN A;  5DH9 B;  1X1G A;  2RVB B;  3GYO A;  2IFS A;  4ZRJ A;  1OMW A;  1U5F A;  3KRX A;  2DLW A;  1P6S A;  2V76 A;  5FI0 A;  3KRW A;  1XKE A;  2CY5 A;  1NU2 A;  3A98 B;  3PEG A;  2UVM A;  2ROV A;  1J19 A;  2D9Z A;  2HTH B;  1FHW A;  1XR0 B;  4A5K A;  5CLL B;  1U29 A;  2DX1 A;  4HAZ B;  1XD4 A;  4GXB A;  1SHC A;  1V5M A;  3TCA A;  2K00 A;  4QJ5 B;  4EMO A;  1U27 A;  2RRF A;  2COF A;  2GS0 A;  3D8E A;  2W2X C;  2D9V A;  5C6R A;  2ZPY A;  5L81 A;  1ZC4 B;  2EJ8 A;  1KI1 B;  3VOQ A;  2DHJ A;  1U2B A;  3PVW A;  2I1K A;  5M4Y B;  3MPX A;  1K5G B;  1U5G A;  1WVH A;  2R2Y A;  5KQ4 A;  5JLJ B;  2KR0 A;  2Z13 A;  3PG7 A;  4HB4 B;  2UZS A;  1LW3 A;  2YS5 A;  3NWD A;  2MFQ A;  3PP2 A;  2I1J A;  2K8E A;  5GOW B;  5DHA B;  1EF1 A;  2Z14 A;  3TW1 A;  1H10 A;  4QJ3 B;  2J59 M;  1N3H A;  2NZ8 B;  2Y8G A;  5LON B;  3TVV A;  5D3Y A;  5D3X A;  2MKR A;  1K5D B;  3SYX A;  2COA A;  4GMV A;  3T06 A;  2I5C A;  4OT1 A;  2J0J A;  2D9Y A;  5HE1 A;  1AQC A;  2RUK B;  3AU4 A;  3ML4 A;  4DX9 0;  5J3Q A;  2YSZ A;  2DA0 A;  2EMS A;  3QBV B;  3ZDT A;  1Z87 A;  2L2I A;  3UZT A;  1FGY A;  3TFM A;  2D10 A;  4F7G A;  5HE2 A;  5JP4 A;  2Z4D A;  2D9X A;  3FM8 C;  4HDO A;  1ZVR A;  2R0D A;  4QXA B;  1FHX A;  1UNR A;  3VIA A;  4HAX B;  4F7U P;  2Q13 A;  2H7E A;  1P3R A;  1WI1 A; 
#chains in the Genus database with same CATH homology
 2XQN M;  4EKU A;  2P0D A;  3DXD A;  1OY2 A;  4WSF A;  3QWM A;  1Y19 B;  2N23 A;  2NMB A;  2CAY A;  1QC6 A;  3ODW A;  4HHV A;  1RJ2 A;  4K81 A;  2JP2 A;  3KZ1 A;  4A6F A;  4A6H A;  4A6F B;  1DDW A;  1MPH A;  3OAN A;  1WGU A;  3V5W A;  1U5E A;  2RGN B;  2PZ1 A;  3PVL A;  3SUZ A;  2FJL A;  2EMT A;  1B55 A;  4K2O A;  3ODO A;  1BAK A;  3KSY A;  1DDM A;  3O96 A;  3WA0 A;  2DTC A;  1DBH A;  2GCL A;  1NTY A;  2K2J A;  5CLQ B;  2YF0 A;  1M7E A;  1WJM A;  5C5B A;  4ZRK A;  2IYB A;  2OQB A;  1FAO A;  2D11 A;  5C5B B;  3LJU X;  4HB0 B;  5D3V A;  1TJ6 A;  3DXC A;  1KZG A;  1SGH A;  3KY9 A;  4WJ7 A;  4HB2 B;  2YS1 A;  2D9W A;  4L6E A;  4F7H A;  3P7Z A;  1W1H A;  4HDQ A;  1PLS A;  1UPQ A;  4C0A A;  4CHM A;  4Z2N A;  4HAY B;  2VRW B;  3U7D A;  3HK0 A;  4HB3 B;  1UNQ A;  1MK7 B;  3ZVR A;  1GC6 A;  2D2Q A;  5EFX A;  4KHO A;  4DBB A;  1BTN A;  5FI1 A;  2ADZ A;  1IRS A;  1XX0 A;  2RLO A;  3N7C A;  2H7D A;  2P0F A;  1QQG A;  1GC7 A;  2YVC A;  4MK0 A;  2W2X D;  1FHO A;  4TKN A;  2VSZ A;  4D0N B;  3NSU A;  5J3T A;  4ZRI A;  3ULC A;  2LUL A;  2LYD A;  5LOP B;  1OQN A;  1X1F A;  4TYZ A;  3QIJ A;  4IFS A;  2P8V A;  1E5W A;  2CRF A;  1MAI A;  1TQZ A;  4K17 A;  1UNP A;  2DKQ A;  2ROZ B;  4KVG B;  2M38 A;  3F0W A;  5C79 A;  1J0W A;  2Y8F A;  4GN1 A;  4Y94 A;  1V5P A;  1H4R A;  1WJ1 A;  2G35 A;  3A8P A;  1I7A A;  3MDB C;  1GG3 A;  3SO6 A;  1ZC3 B;  2K2U A;  2YT1 A;  2QKL A;  2MDX A;  3ODX A;  2KCJ A;  2DX5 A;  5D27 A;  4CYE A;  4HAU B;  3X23 A;  1BWN A;  1V5U A;  2DN6 A;  2UZR A;  1NTV A;  5HE3 A;  4GZU A;  3SV1 A;  2L1C A;  2KGX B;  1V88 A;  3CIK A;  3FEH A;  1UEF A;  2KUP A;  4WVF B;  5DHF B;  2RNR B;  2RSG A;  4EJN A;  2EC1 A;  2CY4 A;  4KHA A;  3A8Q A;  1AWE A;  3HW2 B;  1W1G A;  1X05 A;  1X11 A;  2QKM A;  1X86 A;  2GJY A;  2M14 A;  5D3W A;  4GMX B;  5KCV A;  3D8D A;  2N0Y A;  3F5R A;  1EGX A;  4DX8 A;  2DFK A;  1ZM0 A;  2MWN B;  2DYQ A;  1RRP B;  2Y7B A;  3PVU A;  1U5D A;  5DIF B;  3AU5 A;  1NI2 A;  3ULB A;  1KZ7 A;  2BCJ A;  1Q67 A;  2E2X A;  5J3Y A;  3WYF B;  4YON A;  1PMS A;  3P6A A;  5HE0 A;  3G9W A;  3FSS A;  5C16 A;  2D4Q A;  3DXE A;  2DYN A;  1XOD A;  2DKP A;  4PQ0 A;  1BTK A;  2R09 A;  3U8Z A;  4H8S A;  3TO1 A;  1W1D A;  5JHH A;  2COC A;  1V89 A;  2W2W A;  4DXA B;  3RCP A;  2YS3 A;  1FOE A;  1MKE A;  1Y5O A;  4XWX A;  1DDV A;  2LG1 A;  1ISN A;  4BBK A;  2DHI A;  2J0M A;  2Z0P A;  1MIZ B;  1XCG A;  2YT0 A;  5JHG A;  2J0K A;  1PFJ A;  3PSC A;  4MT7 A;  1V61 A;  2P0H A;  1I2H A;  2LKO A;  2OTX A;  2YRY A;  2Z0Q A;  3M1I B;  3AJ4 A;  4IAP A;  1UPR A;  2ELA A;  1WG7 A;  1M7R A;  2AL6 A;  4IOY X;  1MK9 B;  2AEH A;  2ELB A;  3HQC A;  4Z2M B;  4HAT B;  3GYP A;  3IVF A;  4YL8 A;  4HAV B;  3CXB B;  2Z0O A;  4KHB B;  1ZSQ A;  1EAZ A;  2DHK A;  4MY6 A;  1DYN A;  1EVH A;  1P5T A;  1WGQ A;  2LOZ A;  2I5F A;  1LB1 A;  3PZD A;  3BJI A;  4KAX B;  2GCJ A;  4NY0 A;  3D8F A;  4CHJ A;  1FB8 A;  4P7I A;  4K2P A;  4HAW B;  1TXD A;  1MIX A;  2LOX A;  1FGZ A;  4GPT B;  2VKI A;  4NSW A;  3SNH A;  4A6K A;  4B6H A;  4PNK A;  1DRO A;  2HE7 A;  5KQ1 A;  3BIN A;  2X18 A;  2COD A;  5DI9 B;  5DH9 B;  1X1G A;  2RVB B;  3GYO A;  2IFS A;  4ZRJ A;  1OMW A;  1U5F A;  3KRX A;  2DLW A;  1P6S A;  2V76 A;  5FI0 A;  3KRW A;  1XKE A;  2CY5 A;  1NU2 A;  3A98 B;  3PEG A;  2UVM A;  2ROV A;  1J19 A;  2D9Z A;  2HTH B;  1FHW A;  1XR0 B;  4A5K A;  5CLL B;  1U29 A;  2DX1 A;  4HAZ B;  1XD4 A;  4GXB A;  1SHC A;  1V5M A;  3TCA A;  2K00 A;  4EMO A;  1U27 A;  2COF A;  2GS0 A;  3D8E A;  2W2X C;  2D9V A;  5C6R A;  2ZPY A;  5L81 A;  1ZC4 B;  2EJ8 A;  1KI1 B;  3VOQ A;  2DHJ A;  1U2B A;  3PVW A;  2I1K A;  3MPX A;  1K5G B;  1U5G A;  1WVH A;  5KQ4 A;  5JLJ B;  3PG7 A;  4HB4 B;  2UZS A;  1LW3 A;  2YS5 A;  2MFQ A;  3PP2 A;  2I1J A;  5GOW B;  5DHA B;  1EF1 A;  3TW1 A;  1H10 A;  2J59 M;  1N3H A;  2NZ8 B;  2Y8G A;  5LON B;  3TVV A;  5D3Y A;  5D3X A;  2MKR A;  1K5D B;  3SYX A;  2COA A;  4GMV A;  3T06 A;  2I5C A;  2J0J A;  2D9Y A;  5HE1 A;  1AQC A;  2RUK B;  3AU4 A;  3ML4 A;  4DX9 0;  5J3Q A;  2YSZ A;  2DA0 A;  2EMS A;  3QBV B;  3ZDT A;  1Z87 A;  2L2I A;  3UZT A;  1FGY A;  3TFM A;  2D10 A;  4F7G A;  5HE2 A;  5JP4 A;  2D9X A;  3FM8 C;  4HDO A;  1ZVR A;  2R0D A;  1FHX A;  1UNR A;  3VIA A;  4HAX B;  4F7U P;  2Q13 A;  2H7E A;  1P3R A;  1WI1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...