4HAWB

Crystal structure of crm1 inhibitor leptomycin b in complex with crm1(k548a)-ran-ranbp1
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
138
structure length
131
Chain Sequence
IHFEPVVKTMEEDEEVLYKVRAKLFRFDKDAKEWKERGTGDCKFLKNKKTNKVRILMRRDKTLKICANHIIAPEYTLKPNVGSDRSWVYACTADIAEGEAEAFTFAIRFGSKENADKFKEEFEKAQEINKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein transport/antibiotic
molecule keywords GTP-binding nuclear protein Ran
publication title Nuclear export inhibition through covalent conjugation and hydrolysis of Leptomycin B by CRM1.
pubmed doi rcsb
source organism Homo sapiens
total genus 36
structure length 131
sequence length 138
ec nomenclature
pdb deposition date 2012-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00638 Ran_BP1 RanBP1 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 4hawB00
2AEHA 2COAA 1DDVA 3ZVRA 1RRPB 1UNQA 1U27A 1WI1A 3DXEA 1V61A 2DYNA 5DIFB 4GMVA 4CHJA 3WYFB 3FEHA 1W1GA 5J3TA 2Z0QA 1FGYA 4WJ7A 1BWNA 3IVFA 3ULBA 2M38A 5HE3A 1RJ2A 1GC7A 1WJMA 2J0KA 4F7HA 5FI1A 1AQCA 4EMOA 2AL6A 1PMSA 1WVHA 2BCJA 4YONA 1U5DA 4DX8A 2YS1A 1FHOA 4P7IA 3QIJA 3ODOA 4MY6A 2I1JA 2VRWB 3F5RA 4HAYB 2UZSA 2RGNB 4HAUB 5JLJB 1DROA 2D9ZA 4DBBA 1M7EA 2COCA 3T06A 1ZVRA 2P0HA 4A6FA 5L81A 4GN1A 2GCJA 3KRXA 4GZUA 3PVUA 3AU5A 2W2WA 2KCJA 4MT7A 4KAXB 3MDBC 3D8DA 1N3HA 4IAPA 1J19A 2EMSA 1V5UA 4HB4B 1X05A 4A6FB 5DI9B 5HE1A 3PVLA 3HW2B 1WJ1A 2YRYA 1XX0A 1SHCA 3SYXA 2EC1A 1MIXA 1TJ6A 4WVFB 5HE2A 1ZC4B 2CODA 2MKRA 1OY2A 2Z0OA 4A5KA 1PFJA 3NSUA 1FGZA 2J0JA 4PNKA 2ROVA 4K81A 4HDOA 4GMXB 3RCPA 3MPXA 3PG7A 3BINA 2I1KA 3FM8C 3WA0A 1UEFA 3PVWA 3DXCA 2DKPA 3TFMA 2DHIA 1Q67A 1X1FA 2MWNB 1U5EA 2RVBB 1TXDA 1BTNA 2JP2A 1LW3A 1XD4A 1I7AA 3A8QA 4H8SA 5D3VA 4A6HA 2M14A 1EF1A 1MK9B 1AWEA 3PEGA 2R09A 3QWMA 2YF0A 5HE0A 1P3RA 2DYQA 2V76A 2NMBA 4B6HA 4HAVB 2Y7BA 1V5MA 4KHAA 2PZ1A 5D3XA 3KZ1A 3UZTA 2IYBA 3ODXA 5C79A 1X11A 2MDXA 4ZRJA 1UPQA 2EJ8A 1BTKA 2K2UA 4PQ0A 1IRSA 4HB0B 3DXDA 3TW1A 3PZDA 3P7ZA 1K5GB 4NSWA 3FSSA 2MFQA 4HB2B 2N23A 3LJUX 1P6SA 2ZPYA 3TVVA 2ADZA 2J59M 3V5WA 2QKMA 2YT1A 2YVCA 5D3YA 2YSZA 2DTCA 2D9XA 3A98B 4Y94A 2GCLA 2K00A 4IOYX 2X18A 4HAXB 4MK0A 1TQZA 2COFA 1V89A 1U2BA 1X86A 3GYOA 2RSGA 1FHWA 2VKIA 5DHAB 5KCVA 2L2IA 5D27A 1J0WA 2KUPA 2RLOA 1NTYA 2ROZB 3SUZA 1DYNA 2LOZA 4K2PA 1FHXA 2D11A 3SNHA 1X1GA 2P0FA 2ELBA 2EMTA 1U5GA 3AJ4A 2CAYA 2G35A 2P8VA 1Y5OA 3P6AA 3X23A 2UVMA 2XQNM 1U29A 2D9VA 5EFXA 5JHHA 2DA0A 2UZRA 2R0DA 5JHGA 1W1HA 2YT0A 2D4QA 4L6EA 3GYPA 3VOQA 3OANA 1LB1A 3QBVB 2P0DA 3KY9A 1KI1B 4KVGB 4GXBA 2CRFA 3N7CA 1H4RA 4EJNA 5CLLB 4CYEA 1U5FA 4NY0A 2RNRB 2D9YA 1UNPA 2FJLA 1PLSA 3D8FA 3ML4A 4HB3B 3U7DA 3ULCA 2DX1A 4A6KA 2IFSA 4KHOA 1QC6A 1BAKA 2D10A 2CY5A 4HAZB 1DDMA 4K17A 4CHMA 3D8EA 3PP2A 3VIAA 4YL8A 2D9WA 5KQ1A 1MKEA 4XWXA 4WSFA 1WGQA 2Y8FA 4Z2MB 2Z0PA 2W2XC 1V88A 2E2XA 2HE7A 2LULA 4F7GA 3KRWA 4C0AA 1ZSQA 2DLWA 1M7RA 1ZM0A 4K2OA 5LOPB 2DX5A 1FAOA 2OTXA 1ZC3B 1XCGA 1E5WA 5J3QA 1KZGA 1H10A 1MIZB 3ODWA 1Z87A 3A8PA 3CIKA 5DHFB 1DDWA 1EGXA 1QQGA 3TCAA 2OQBA 1XR0B 1NU2A 2ELAA 1DBHA 1XODA 2I5FA 4D0NB 1NI2A 1SGHA 1WG7A 2LG1A 5LONB 1OMWA 3BJIA 1ISNA 5CLQB 1EVHA 2QKLA 2DHJA 3O96A 3KSYA 4HAWB 1KZ7A 1UNRA 2DHKA 2DFKA 1OQNA 4EKUA 2YS5A 5DH9B 3F0WA 1P5TA 4HHVA 2VSZA 3U8ZA 3AU4A 1W1DA 5C5BA 3HK0A 2DKQA 4DX90 1FOEA 5KQ4A 2LYDA 2LOXA 2L1CA 1FB8A 2RUKB 2W2XD 4F7UP 1B55A 2J0MA 1MPHA 3HQCA 3ZDTA 1NTVA 4TKNA 2CY4A 1XKEA 4TYZA 4ZRIA 5D3WA 5C6RA 5C5BB 5J3YA 4GPTB 2GS0A 2GJYA 3PSCA 5FI0A 2HTHB 1GG3A 1K5DB 2NZ8B 1GC6A 5JP4A 4HDQA 3G9WA 1MAIA 3TO1A 5C16A 2N0YA 1WGUA 4ZRKA 2YS3A 2I5CA 2KGXB 2H7EA 3SV1A 4DXAB 4HATB 4KHBB 1V5PA 4BBKA 2DN6A 1UPRA 4IFSA 1MK7B 5GOWB 2H7DA 1EAZA 4Z2NA 3SO6A 2Y8GA 2K2JA 3CXBB 2Q13A 3M1IB 2LKOA 1I2HA 2D2QA 1Y19B
chains in the Genus database with same CATH superfamily
2AEHA 2COAA 1DDVA 3ZVRA 1RRPB 1UNQA 2GUMA 1U27A 1WI1A 3DXEA 1V61A 2DYNA 5DIFB 4GMVA 4CHJA 3WYFB 3FEHA 1W1GA 5J3TA 4CSQA 2Z0QA 1FGYA 4WJ7A 1BWNA 3IVFA 3ULBA 2KUQA 2M38A 4OT1A 5HE3A 1RJ2A 1GC7A 1WJMA 2J0KA 4F7HA 5FI1A 1AQCA 4EMOA 2AL6A 1PMSA 1WVHA 3B77A 2BCJA 4YONA 1U5DA 3NWDA 3U12A 4DX8A 2YS1A 1FHOA 4P7IA 3HIEA 3QIJA 3ODOA 4MY6A 2I1JA 2VRWB 3F5RA 4HAYB 2UZSA 2RGNB 4HAUB 5JLJB 1DROA 2D9ZA 4DBBA 1M7EA 2COCA 3T06A 1ZVRA 2P0HA 1ZYIA 4A6FA 5L81A 4GN1A 2GCJA 3KRXA 4GZUA 3PVUA 2Z59A 3AU5A 2W2WA 3NWAA 2KCJA 4QJ5B 4MT7A 4KAXB 4DIXA 4QJ4B 3MDBC 3D8DA 1N3HA 4IAPA 1J19A 2EMSA 1V5UA 4HB4B 1X05A 4A6FB 5DI9B 5HE1A 3PVLA 3HW2B 1WJ1A 2YRYA 1XX0A 1SHCA 3SYXA 2EC1A 1MIXA 1TJ6A 4WVFB 5HE2A 1ZC4B 2CODA 2MKRA 1OY2A 2Z0OA 4A5KA 1PFJA 3NSUA 1FGZA 2J0JA 4PNKA 2ROVA 4K81A 4HDOA 4GMXB 3RCPA 1MI1A 3MPXA 3PG7A 3BINA 2I1KA 3FM8C 3WA0A 1UEFA 3PVWA 3DXCA 2DKPA 3TFMA 2DHIA 1Q67A 1X1FA 4L1RA 2MWNB 1U5EA 2RVBB 1TXDA 1BTNA 2JP2A 1LW3A 1XD4A 1I7AA 3A8QA 4H8SA 5D3VA 4A6HA 2M14A 1EF1A 1MK9B 1AWEA 3PEGA 2R09A 4GOUA 3QWMA 2YF0A 4QJ3B 5HE0A 1P3RA 2DYQA 2V76A 2NMBA 5IRSA 4B6HA 4HAVB 2Y7BA 3OHMB 1V5MA 4KHAA 2PZ1A 5D3XA 3FVCA 3KZ1A 3UZTA 2IYBA 3ODXA 5C79A 1X11A 2MDXA 4ZRJA 1UPQA 2EJ8A 1BTKA 2K2UA 4PQ0A 1IRSA 4HB0B 3DXDA 3TW1A 3PZDA 2Z4DA 3P7ZA 1K5GB 4NSWA 3FSSA 2MFQA 4HB2B 2N23A 3LJUX 1P6SA 2ZPYA 3TVVA 2ADZA 2J59M 3V5WA 2NBVA 2Z13A 2QKMA 2YT1A 2YVCA 5D3YA 2YSZA 2DTCA 2D9XA 3A98B 4Y94A 2GCLA 2K00A 4IOYX 2X18A 4HAXB 4MK0A 4QXAB 1TQZA 2K49A 2COFA 1V89A 1U2BA 1X86A 3GYOA 2RSGA 4OSNA 1FHWA 2VKIA 5DHAB 5KCVA 2L2IA 5D27A 1J0WA 2KUPA 2RLOA 1NTYA 2ROZB 3SUZA 1DYNA 2LOZA 4GNKB 4K2PA 1FHXA 2D11A 3SNHA 1X1GA 2P0FA 2KIGA 2ELBA 2EMTA 3DCXA 1U5GA 3AJ4A 2CAYA 2G35A 2P8VA 3NW8A 1Y5OA 3P6AA 5I2MA 2UVMA 3X23A 2XQNM 1U29A 2D9VA 5EFXA 2K8EA 5JHHA 2DA0A 2UZRA 2R0DA 2ZKMX 5JHGA 1W1HA 2YT0A 2D4QA 4L6EA 3GYPA 3VOQA 3OANA 1LB1A 3QBVB 2P0DA 3KY9A 1KI1B 4KVGB 4GXBA 2CRFA 2RRFA 3N7CA 1H4RA 4EJNA 5CLLB 4CYEA 1U5FA 4NY0A 2RNRB 5M4YB 2D9YA 1UNPA 2FJLA 1PLSA 3D8FA 3ML4A 4HB3B 3U7DA 3ULCA 2DX1A 4A6KA 2IFSA 4KHOA 1QC6A 1BAKA 2D10A 2CY5A 4HAZB 1DDMA 4K17A 4CHMA 3D8EA 3PP2A 3VIAA 4YL8A 2D9WA 5KQ1A 1MKEA 4XWXA 4WSFA 5LG4B 1WGQA 2Y8FA 4Z2MB 2Z0PA 2W2XC 1V88A 2E2XA 2HE7A 2LULA 4F7GA 3KRWA 4C0AA 1ZSQA 2DLWA 2Z14A 1M7RA 1ZM0A 4K2OA 5LOPB 2DX5A 1FAOA 2OTXA 1ZC3B 1XCGA 2R2YA 1E5WA 5J3QA 3NWFA 1KZGA 4D6WA 1H10A 1MIZB 3ODWA 1Z87A 3A8PA 3CIKA 5DHFB 1DDWA 1EGXA 1QQGA 3TCAA 2OQBA 1XR0B 1NU2A 2ELAA 1DBHA 1XODA 2I5FA 4D0NB 1NI2A 1SGHA 1WG7A 2LG1A 5LONB 1OMWA 3BJIA 1ISNA 5CLQB 1EVHA 2QKLA 2DHJA 3O96A 3KSYA 4HAWB 1KZ7A 1UNRA 2DHKA 2DFKA 1OQNA 4EKUA 2YS5A 5DH9B 3F0WA 1P5TA 4HHVA 2VSZA 3U8ZA 3AU4A 1W1DA 5C5BA 3HK0A 2DKQA 4DX90 1FOEA 2LKOA 5KQ4A 2LYDA 2LOXA 2L1CA 1FB8A 2RUKB 2W2XD 4F7UP 1B55A 2J0MA 1MPHA 3HQCA 3ZDTA 1NTVA 4TKNA 2CY4A 1XKEA 4TYZA 4ZRIA 5D3WA 5C6RA 5C5BB 5J3YA 5I2SA 4GPTB 2GS0A 2GJYA 3PSCA 5FI0A 4KHBA 2HTHB 1GG3A 1K5DB 2NZ8B 1GC6A 5JP4A 3HSAA 4HDQA 3G9WA 1MAIA 1T77A 3TO1A 5C16A 2N0YA 1WGUA 4ZRKA 2YS3A 2I5CA 2YT2A 2FJUB 2KGXB 2H7EA 3SV1A 2KIEA 4DXAB 4HATB 2KR0A 4KHBB 1V5PA 4BBKA 2DN6A 1UPRA 4IFSA 1MK7B 5GOWB 2H7DA 1EAZA 4Z2NA 3SO6A 2Y8GA 2K2JA 3CXBB 2Q13A 3M1IB 4HSIA 3A58A 1I2HA 2D2QA 1Y19B
chains in the Genus database with same CATH topology
2AEHA 2COAA 1DDVA 3ZVRA 1RRPB 1UNQA 1U27A 1WI1A 3DXEA 1V61A 2DYNA 5DIFB 4GMVA 4CHJA 3WYFB 3FEHA 1W1GA 5J3TA 2Z0QA 1FGYA 4WJ7A 1BWNA 3IVFA 3ULBA 2M38A 5HE3A 1RJ2A 1GC7A 1WJMA 2J0KA 4F7HA 5FI1A 1AQCA 4EMOA 2AL6A 1PMSA 1WVHA 2BCJA 4YONA 1U5DA 4DX8A 2YS1A 1FHOA 4P7IA 3QIJA 3ODOA 4MY6A 2I1JA 2VRWB 3F5RA 4HAYB 2UZSA 2RGNB 4HAUB 5JLJB 1DROA 2D9ZA 4DBBA 1M7EA 2COCA 3T06A 1ZVRA 2P0HA 4A6FA 5L81A 4GN1A 2GCJA 3KRXA 4GZUA 3PVUA 3AU5A 2W2WA 2KCJA 4MT7A 4KAXB 3MDBC 3D8DA 1N3HA 4IAPA 1J19A 2EMSA 1V5UA 4HB4B 1X05A 4A6FB 5DI9B 5HE1A 3PVLA 3HW2B 1WJ1A 2YRYA 1XX0A 1SHCA 3SYXA 2EC1A 1MIXA 1TJ6A 4WVFB 5HE2A 1ZC4B 2CODA 2MKRA 1OY2A 2Z0OA 4A5KA 1PFJA 3NSUA 1FGZA 2J0JA 4PNKA 2ROVA 4K81A 4HDOA 4GMXB 3RCPA 3MPXA 3PG7A 3BINA 2I1KA 3FM8C 3WA0A 1UEFA 3PVWA 3DXCA 2DKPA 3TFMA 2DHIA 1Q67A 1X1FA 2MWNB 1U5EA 2RVBB 1TXDA 1BTNA 2JP2A 1LW3A 1XD4A 1I7AA 3A8QA 4H8SA 5D3VA 4A6HA 2M14A 1EF1A 1MK9B 1AWEA 3PEGA 2R09A 3QWMA 2YF0A 5HE0A 1P3RA 2DYQA 2V76A 2NMBA 4B6HA 4HAVB 2Y7BA 1V5MA 4KHAA 2PZ1A 5D3XA 3KZ1A 3UZTA 2IYBA 3ODXA 5C79A 1X11A 2MDXA 4ZRJA 1UPQA 2EJ8A 1BTKA 2K2UA 4PQ0A 1IRSA 4HB0B 3DXDA 3TW1A 3PZDA 3P7ZA 1K5GB 4NSWA 3FSSA 2MFQA 4HB2B 2N23A 3LJUX 1P6SA 2ZPYA 3TVVA 2ADZA 2J59M 3V5WA 2QKMA 2YT1A 2YVCA 5D3YA 2YSZA 2DTCA 2D9XA 3A98B 4Y94A 2GCLA 2K00A 4IOYX 2X18A 4HAXB 4MK0A 1TQZA 2COFA 1V89A 1U2BA 1X86A 3GYOA 2RSGA 1FHWA 2VKIA 5DHAB 5KCVA 2L2IA 5D27A 1J0WA 2KUPA 2RLOA 1NTYA 2ROZB 3SUZA 1DYNA 2LOZA 4K2PA 1FHXA 2D11A 3SNHA 1X1GA 2P0FA 2ELBA 2EMTA 1U5GA 3AJ4A 2CAYA 2G35A 2P8VA 1Y5OA 3P6AA 3X23A 2UVMA 2XQNM 1U29A 2D9VA 5EFXA 5JHHA 2DA0A 2UZRA 2R0DA 5JHGA 1W1HA 2YT0A 2D4QA 4L6EA 3GYPA 3VOQA 3OANA 1LB1A 3QBVB 2P0DA 3KY9A 1KI1B 4KVGB 4GXBA 2CRFA 3N7CA 1H4RA 4EJNA 5CLLB 4CYEA 1U5FA 4NY0A 2RNRB 2D9YA 1UNPA 2FJLA 1PLSA 3D8FA 3ML4A 4HB3B 3U7DA 3ULCA 2DX1A 4A6KA 2IFSA 4KHOA 1QC6A 1BAKA 2D10A 2CY5A 4HAZB 1DDMA 4K17A 4CHMA 3D8EA 3PP2A 3VIAA 4YL8A 2D9WA 5KQ1A 1MKEA 4XWXA 4WSFA 1WGQA 2Y8FA 4Z2MB 2Z0PA 2W2XC 1V88A 2E2XA 2HE7A 2LULA 4F7GA 3KRWA 4C0AA 1ZSQA 2DLWA 1M7RA 1ZM0A 4K2OA 5LOPB 2DX5A 1FAOA 2OTXA 1ZC3B 1XCGA 1E5WA 5J3QA 1KZGA 1H10A 1MIZB 3ODWA 1Z87A 3A8PA 3CIKA 5DHFB 1DDWA 1EGXA 1QQGA 3TCAA 2OQBA 1XR0B 1NU2A 2ELAA 1DBHA 1XODA 2I5FA 4D0NB 1NI2A 1SGHA 1WG7A 2LG1A 5LONB 1OMWA 3BJIA 1ISNA 5CLQB 1EVHA 2QKLA 2DHJA 3O96A 3KSYA 4HAWB 1KZ7A 1UNRA 2DHKA 2DFKA 1OQNA 4EKUA 2YS5A 5DH9B 3F0WA 1P5TA 4HHVA 2VSZA 3U8ZA 3AU4A 1W1DA 5C5BA 3HK0A 2DKQA 4DX90 1FOEA 5KQ4A 2LYDA 2LOXA 2L1CA 1FB8A 2RUKB 2W2XD 4F7UP 1B55A 2J0MA 1MPHA 3HQCA 3ZDTA 1NTVA 4TKNA 2CY4A 1XKEA 4TYZA 4ZRIA 5D3WA 5C6RA 5C5BB 5J3YA 4GPTB 2GS0A 2GJYA 3PSCA 5FI0A 2HTHB 1GG3A 1K5DB 2NZ8B 1GC6A 5JP4A 4HDQA 3G9WA 1MAIA 3TO1A 5C16A 2N0YA 1WGUA 4ZRKA 2YS3A 2I5CA 2KGXB 2H7EA 3SV1A 4DXAB 4HATB 4KHBB 1V5PA 4BBKA 2DN6A 1UPRA 4IFSA 1MK7B 5GOWB 2H7DA 1EAZA 4Z2NA 3SO6A 2Y8GA 2K2JA 3CXBB 2Q13A 3M1IB 2LKOA 1I2HA 2D2QA 1Y19B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AEH A;  2COA A;  1DDV A;  3ZVR A;  1RRP B;  1UNQ A;  1U27 A;  1WI1 A;  3DXE A;  1V61 A;  2DYN A;  5DIF B;  4GMV A;  4CHJ A;  3WYF B;  3FEH A;  1W1G A;  5J3T A;  2Z0Q A;  1FGY A;  4WJ7 A;  1BWN A;  3IVF A;  3ULB A;  2M38 A;  5HE3 A;  1RJ2 A;  1GC7 A;  1WJM A;  2J0K A;  4F7H A;  5FI1 A;  1AQC A;  4EMO A;  2AL6 A;  1PMS A;  1WVH A;  2BCJ A;  4YON A;  1U5D A;  4DX8 A;  2YS1 A;  1FHO A;  4P7I A;  3QIJ A;  3ODO A;  4MY6 A;  2I1J A;  2VRW B;  3F5R A;  4HAY B;  2UZS A;  2RGN B;  4HAU B;  5JLJ B;  1DRO A;  2D9Z A;  4DBB A;  1M7E A;  2COC A;  3T06 A;  1ZVR A;  2P0H A;  4A6F A;  5L81 A;  4GN1 A;  2GCJ A;  3KRX A;  4GZU A;  3PVU A;  3AU5 A;  2W2W A;  2KCJ A;  4MT7 A;  4KAX B;  3MDB C;  3D8D A;  1N3H A;  4IAP A;  1J19 A;  2EMS A;  1V5U A;  4HB4 B;  1X05 A;  4A6F B;  5DI9 B;  5HE1 A;  3PVL A;  3HW2 B;  1WJ1 A;  2YRY A;  1XX0 A;  1SHC A;  3SYX A;  2EC1 A;  1MIX A;  1TJ6 A;  4WVF B;  5HE2 A;  1ZC4 B;  2COD A;  2MKR A;  1OY2 A;  2Z0O A;  4A5K A;  1PFJ A;  3NSU A;  1FGZ A;  2J0J A;  4PNK A;  2ROV A;  4K81 A;  4HDO A;  4GMX B;  3RCP A;  3MPX A;  3PG7 A;  3BIN A;  2I1K A;  3FM8 C;  3WA0 A;  1UEF A;  3PVW A;  3DXC A;  2DKP A;  3TFM A;  2DHI A;  1Q67 A;  1X1F A;  2MWN B;  1U5E A;  2RVB B;  1TXD A;  1BTN A;  2JP2 A;  1LW3 A;  1XD4 A;  1I7A A;  3A8Q A;  4H8S A;  5D3V A;  4A6H A;  2M14 A;  1EF1 A;  1MK9 B;  1AWE A;  3PEG A;  2R09 A;  3QWM A;  2YF0 A;  5HE0 A;  1P3R A;  2DYQ A;  2V76 A;  2NMB A;  4B6H A;  4HAV B;  2Y7B A;  1V5M A;  4KHA A;  2PZ1 A;  5D3X A;  3KZ1 A;  3UZT A;  2IYB A;  3ODX A;  5C79 A;  1X11 A;  2MDX A;  4ZRJ A;  1UPQ A;  2EJ8 A;  1BTK A;  2K2U A;  4PQ0 A;  1IRS A;  4HB0 B;  3DXD A;  3TW1 A;  3PZD A;  3P7Z A;  1K5G B;  4NSW A;  3FSS A;  2MFQ A;  4HB2 B;  2N23 A;  3LJU X;  1P6S A;  2ZPY A;  3TVV A;  2ADZ A;  2J59 M;  3V5W A;  2QKM A;  2YT1 A;  2YVC A;  5D3Y A;  2YSZ A;  2DTC A;  2D9X A;  3A98 B;  4Y94 A;  2GCL A;  2K00 A;  4IOY X;  2X18 A;  4HAX B;  4MK0 A;  1TQZ A;  2COF A;  1V89 A;  1U2B A;  1X86 A;  3GYO A;  2RSG A;  1FHW A;  2VKI A;  5DHA B;  5KCV A;  2L2I A;  5D27 A;  1J0W A;  2KUP A;  2RLO A;  1NTY A;  2ROZ B;  3SUZ A;  1DYN A;  2LOZ A;  4K2P A;  1FHX A;  2D11 A;  3SNH A;  1X1G A;  2P0F A;  2ELB A;  2EMT A;  1U5G A;  3AJ4 A;  2CAY A;  2G35 A;  2P8V A;  1Y5O A;  3P6A A;  3X23 A;  2UVM A;  2XQN M;  1U29 A;  2D9V A;  5EFX A;  5JHH A;  2DA0 A;  2UZR A;  2R0D A;  5JHG A;  1W1H A;  2YT0 A;  2D4Q A;  4L6E A;  3GYP A;  3VOQ A;  3OAN A;  1LB1 A;  3QBV B;  2P0D A;  3KY9 A;  1KI1 B;  4KVG B;  4GXB A;  2CRF A;  3N7C A;  1H4R A;  4EJN A;  5CLL B;  4CYE A;  1U5F A;  4NY0 A;  2RNR B;  2D9Y A;  1UNP A;  2FJL A;  1PLS A;  3D8F A;  3ML4 A;  4HB3 B;  3U7D A;  3ULC A;  2DX1 A;  4A6K A;  2IFS A;  4KHO A;  1QC6 A;  1BAK A;  2D10 A;  2CY5 A;  4HAZ B;  1DDM A;  4K17 A;  4CHM A;  3D8E A;  3PP2 A;  3VIA A;  4YL8 A;  2D9W A;  5KQ1 A;  1MKE A;  4XWX A;  4WSF A;  1WGQ A;  2Y8F A;  4Z2M B;  2Z0P A;  2W2X C;  1V88 A;  2E2X A;  2HE7 A;  2LUL A;  4F7G A;  3KRW A;  4C0A A;  1ZSQ A;  2DLW A;  1M7R A;  1ZM0 A;  4K2O A;  5LOP B;  2DX5 A;  1FAO A;  2OTX A;  1ZC3 B;  1XCG A;  1E5W A;  5J3Q A;  1KZG A;  1H10 A;  1MIZ B;  3ODW A;  1Z87 A;  3A8P A;  3CIK A;  5DHF B;  1DDW A;  1EGX A;  1QQG A;  3TCA A;  2OQB A;  1XR0 B;  1NU2 A;  2ELA A;  1DBH A;  1XOD A;  2I5F A;  4D0N B;  1NI2 A;  1SGH A;  1WG7 A;  2LG1 A;  5LON B;  1OMW A;  3BJI A;  1ISN A;  5CLQ B;  1EVH A;  2QKL A;  2DHJ A;  3O96 A;  3KSY A;  4HAW B;  1KZ7 A;  1UNR A;  2DHK A;  2DFK A;  1OQN A;  4EKU A;  2YS5 A;  5DH9 B;  3F0W A;  1P5T A;  4HHV A;  2VSZ A;  3U8Z A;  3AU4 A;  1W1D A;  5C5B A;  3HK0 A;  2DKQ A;  4DX9 0;  1FOE A;  5KQ4 A;  2LYD A;  2LOX A;  2L1C A;  1FB8 A;  2RUK B;  2W2X D;  4F7U P;  1B55 A;  2J0M A;  1MPH A;  3HQC A;  3ZDT A;  1NTV A;  4TKN A;  2CY4 A;  1XKE A;  4TYZ A;  4ZRI A;  5D3W A;  5C6R A;  5C5B B;  5J3Y A;  4GPT B;  2GS0 A;  2GJY A;  3PSC A;  5FI0 A;  2HTH B;  1GG3 A;  1K5D B;  2NZ8 B;  1GC6 A;  5JP4 A;  4HDQ A;  3G9W A;  1MAI A;  3TO1 A;  5C16 A;  2N0Y A;  1WGU A;  4ZRK A;  2YS3 A;  2I5C A;  2KGX B;  2H7E A;  3SV1 A;  4DXA B;  4HAT B;  4KHB B;  1V5P A;  4BBK A;  2DN6 A;  1UPR A;  4IFS A;  1MK7 B;  5GOW B;  2H7D A;  1EAZ A;  4Z2N A;  3SO6 A;  2Y8G A;  2K2J A;  3CXB B;  2Q13 A;  3M1I B;  2LKO A;  1I2H A;  2D2Q A;  1Y19 B; 
#chains in the Genus database with same CATH topology
 2AEH A;  2COA A;  1DDV A;  3ZVR A;  1RRP B;  1UNQ A;  2GUM A;  1U27 A;  1WI1 A;  3DXE A;  1V61 A;  2DYN A;  5DIF B;  4GMV A;  4CHJ A;  3WYF B;  3FEH A;  1W1G A;  5J3T A;  4CSQ A;  2Z0Q A;  1FGY A;  4WJ7 A;  1BWN A;  3IVF A;  3ULB A;  2KUQ A;  2M38 A;  4OT1 A;  5HE3 A;  1RJ2 A;  1GC7 A;  1WJM A;  2J0K A;  4F7H A;  5FI1 A;  1AQC A;  4EMO A;  2AL6 A;  1PMS A;  1WVH A;  3B77 A;  2BCJ A;  4YON A;  1U5D A;  3NWD A;  3U12 A;  4DX8 A;  2YS1 A;  1FHO A;  4P7I A;  3HIE A;  3QIJ A;  3ODO A;  4MY6 A;  2I1J A;  2VRW B;  3F5R A;  4HAY B;  2UZS A;  2RGN B;  4HAU B;  5JLJ B;  1DRO A;  2D9Z A;  4DBB A;  1M7E A;  2COC A;  3T06 A;  1ZVR A;  2P0H A;  1ZYI A;  4A6F A;  5L81 A;  4GN1 A;  2GCJ A;  3KRX A;  4GZU A;  3PVU A;  2Z59 A;  3AU5 A;  2W2W A;  3NWA A;  2KCJ A;  4QJ5 B;  4MT7 A;  4KAX B;  4DIX A;  4QJ4 B;  3MDB C;  3D8D A;  1N3H A;  4IAP A;  1J19 A;  2EMS A;  1V5U A;  4HB4 B;  1X05 A;  4A6F B;  5DI9 B;  5HE1 A;  3PVL A;  3HW2 B;  1WJ1 A;  2YRY A;  1XX0 A;  1SHC A;  3SYX A;  2EC1 A;  1MIX A;  1TJ6 A;  4WVF B;  5HE2 A;  1ZC4 B;  2COD A;  2MKR A;  1OY2 A;  2Z0O A;  4A5K A;  1PFJ A;  3NSU A;  1FGZ A;  2J0J A;  4PNK A;  2ROV A;  4K81 A;  4HDO A;  4GMX B;  3RCP A;  1MI1 A;  3MPX A;  3PG7 A;  3BIN A;  2I1K A;  3FM8 C;  3WA0 A;  1UEF A;  3PVW A;  3DXC A;  2DKP A;  3TFM A;  2DHI A;  1Q67 A;  1X1F A;  4L1R A;  2MWN B;  1U5E A;  2RVB B;  1TXD A;  1BTN A;  2JP2 A;  1LW3 A;  1XD4 A;  1I7A A;  3A8Q A;  4H8S A;  5D3V A;  4A6H A;  2M14 A;  1EF1 A;  1MK9 B;  1AWE A;  3PEG A;  2R09 A;  4GOU A;  3QWM A;  2YF0 A;  4QJ3 B;  5HE0 A;  1P3R A;  2DYQ A;  2V76 A;  2NMB A;  5IRS A;  4B6H A;  4HAV B;  2Y7B A;  3OHM B;  1V5M A;  4KHA A;  2PZ1 A;  5D3X A;  3FVC A;  3KZ1 A;  3UZT A;  2IYB A;  3ODX A;  5C79 A;  1X11 A;  2MDX A;  4ZRJ A;  1UPQ A;  2EJ8 A;  1BTK A;  2K2U A;  4PQ0 A;  1IRS A;  4HB0 B;  3DXD A;  3TW1 A;  3PZD A;  2Z4D A;  3P7Z A;  1K5G B;  4NSW A;  3FSS A;  2MFQ A;  4HB2 B;  2N23 A;  3LJU X;  1P6S A;  2ZPY A;  3TVV A;  2ADZ A;  2J59 M;  3V5W A;  2NBV A;  2Z13 A;  2QKM A;  2YT1 A;  2YVC A;  5D3Y A;  2YSZ A;  2DTC A;  2D9X A;  3A98 B;  4Y94 A;  2GCL A;  2K00 A;  4IOY X;  2X18 A;  4HAX B;  4MK0 A;  4QXA B;  1TQZ A;  2K49 A;  2COF A;  1V89 A;  1U2B A;  1X86 A;  3GYO A;  2RSG A;  4OSN A;  1FHW A;  2VKI A;  5DHA B;  5KCV A;  2L2I A;  5D27 A;  1J0W A;  2KUP A;  2RLO A;  1NTY A;  2ROZ B;  3SUZ A;  1DYN A;  2LOZ A;  4GNK B;  4K2P A;  1FHX A;  2D11 A;  3SNH A;  1X1G A;  2P0F A;  2KIG A;  2ELB A;  2EMT A;  3DCX A;  1U5G A;  3AJ4 A;  2CAY A;  2G35 A;  2P8V A;  3NW8 A;  1Y5O A;  3P6A A;  5I2M A;  2UVM A;  3X23 A;  2XQN M;  1U29 A;  2D9V A;  5EFX A;  2K8E A;  5JHH A;  2DA0 A;  2UZR A;  2R0D A;  2ZKM X;  5JHG A;  1W1H A;  2YT0 A;  2D4Q A;  4L6E A;  3GYP A;  3VOQ A;  3OAN A;  1LB1 A;  3QBV B;  2P0D A;  3KY9 A;  1KI1 B;  4KVG B;  4GXB A;  2CRF A;  2RRF A;  3N7C A;  1H4R A;  4EJN A;  5CLL B;  4CYE A;  1U5F A;  4NY0 A;  2RNR B;  5M4Y B;  2D9Y A;  1UNP A;  2FJL A;  1PLS A;  3D8F A;  3ML4 A;  4HB3 B;  3U7D A;  3ULC A;  2DX1 A;  4A6K A;  2IFS A;  4KHO A;  1QC6 A;  1BAK A;  2D10 A;  2CY5 A;  4HAZ B;  1DDM A;  4K17 A;  4CHM A;  3D8E A;  3PP2 A;  3VIA A;  4YL8 A;  2D9W A;  5KQ1 A;  1MKE A;  4XWX A;  4WSF A;  5LG4 B;  1WGQ A;  2Y8F A;  4Z2M B;  2Z0P A;  2W2X C;  1V88 A;  2E2X A;  2HE7 A;  2LUL A;  4F7G A;  3KRW A;  4C0A A;  1ZSQ A;  2DLW A;  2Z14 A;  1M7R A;  1ZM0 A;  4K2O A;  5LOP B;  2DX5 A;  1FAO A;  2OTX A;  1ZC3 B;  1XCG A;  2R2Y A;  1E5W A;  5J3Q A;  3NWF A;  1KZG A;  4D6W A;  1H10 A;  1MIZ B;  3ODW A;  1Z87 A;  3A8P A;  3CIK A;  5DHF B;  1DDW A;  1EGX A;  1QQG A;  3TCA A;  2OQB A;  1XR0 B;  1NU2 A;  2ELA A;  1DBH A;  1XOD A;  2I5F A;  4D0N B;  1NI2 A;  1SGH A;  1WG7 A;  2LG1 A;  5LON B;  1OMW A;  3BJI A;  1ISN A;  5CLQ B;  1EVH A;  2QKL A;  2DHJ A;  3O96 A;  3KSY A;  4HAW B;  1KZ7 A;  1UNR A;  2DHK A;  2DFK A;  1OQN A;  4EKU A;  2YS5 A;  5DH9 B;  3F0W A;  1P5T A;  4HHV A;  2VSZ A;  3U8Z A;  3AU4 A;  1W1D A;  5C5B A;  3HK0 A;  2DKQ A;  4DX9 0;  1FOE A;  2LKO A;  5KQ4 A;  2LYD A;  2LOX A;  2L1C A;  1FB8 A;  2RUK B;  2W2X D;  4F7U P;  1B55 A;  2J0M A;  1MPH A;  3HQC A;  3ZDT A;  1NTV A;  4TKN A;  2CY4 A;  1XKE A;  4TYZ A;  4ZRI A;  5D3W A;  5C6R A;  5C5B B;  5J3Y A;  5I2S A;  4GPT B;  2GS0 A;  2GJY A;  3PSC A;  5FI0 A;  4KHB A;  2HTH B;  1GG3 A;  1K5D B;  2NZ8 B;  1GC6 A;  5JP4 A;  3HSA A;  4HDQ A;  3G9W A;  1MAI A;  1T77 A;  3TO1 A;  5C16 A;  2N0Y A;  1WGU A;  4ZRK A;  2YS3 A;  2I5C A;  2YT2 A;  2FJU B;  2KGX B;  2H7E A;  3SV1 A;  2KIE A;  4DXA B;  4HAT B;  2KR0 A;  4KHB B;  1V5P A;  4BBK A;  2DN6 A;  1UPR A;  4IFS A;  1MK7 B;  5GOW B;  2H7D A;  1EAZ A;  4Z2N A;  3SO6 A;  2Y8G A;  2K2J A;  3CXB B;  2Q13 A;  3M1I B;  4HSI A;  3A58 A;  1I2H A;  2D2Q A;  1Y19 B; 
#chains in the Genus database with same CATH homology
 2AEH A;  2COA A;  1DDV A;  3ZVR A;  1RRP B;  1UNQ A;  1U27 A;  1WI1 A;  3DXE A;  1V61 A;  2DYN A;  5DIF B;  4GMV A;  4CHJ A;  3WYF B;  3FEH A;  1W1G A;  5J3T A;  2Z0Q A;  1FGY A;  4WJ7 A;  1BWN A;  3IVF A;  3ULB A;  2M38 A;  5HE3 A;  1RJ2 A;  1GC7 A;  1WJM A;  2J0K A;  4F7H A;  5FI1 A;  1AQC A;  4EMO A;  2AL6 A;  1PMS A;  1WVH A;  2BCJ A;  4YON A;  1U5D A;  4DX8 A;  2YS1 A;  1FHO A;  4P7I A;  3QIJ A;  3ODO A;  4MY6 A;  2I1J A;  2VRW B;  3F5R A;  4HAY B;  2UZS A;  2RGN B;  4HAU B;  5JLJ B;  1DRO A;  2D9Z A;  4DBB A;  1M7E A;  2COC A;  3T06 A;  1ZVR A;  2P0H A;  4A6F A;  5L81 A;  4GN1 A;  2GCJ A;  3KRX A;  4GZU A;  3PVU A;  3AU5 A;  2W2W A;  2KCJ A;  4MT7 A;  4KAX B;  3MDB C;  3D8D A;  1N3H A;  4IAP A;  1J19 A;  2EMS A;  1V5U A;  4HB4 B;  1X05 A;  4A6F B;  5DI9 B;  5HE1 A;  3PVL A;  3HW2 B;  1WJ1 A;  2YRY A;  1XX0 A;  1SHC A;  3SYX A;  2EC1 A;  1MIX A;  1TJ6 A;  4WVF B;  5HE2 A;  1ZC4 B;  2COD A;  2MKR A;  1OY2 A;  2Z0O A;  4A5K A;  1PFJ A;  3NSU A;  1FGZ A;  2J0J A;  4PNK A;  2ROV A;  4K81 A;  4HDO A;  4GMX B;  3RCP A;  3MPX A;  3PG7 A;  3BIN A;  2I1K A;  3FM8 C;  3WA0 A;  1UEF A;  3PVW A;  3DXC A;  2DKP A;  3TFM A;  2DHI A;  1Q67 A;  1X1F A;  2MWN B;  1U5E A;  2RVB B;  1TXD A;  1BTN A;  2JP2 A;  1LW3 A;  1XD4 A;  1I7A A;  3A8Q A;  4H8S A;  5D3V A;  4A6H A;  2M14 A;  1EF1 A;  1MK9 B;  1AWE A;  3PEG A;  2R09 A;  3QWM A;  2YF0 A;  5HE0 A;  1P3R A;  2DYQ A;  2V76 A;  2NMB A;  4B6H A;  4HAV B;  2Y7B A;  1V5M A;  4KHA A;  2PZ1 A;  5D3X A;  3KZ1 A;  3UZT A;  2IYB A;  3ODX A;  5C79 A;  1X11 A;  2MDX A;  4ZRJ A;  1UPQ A;  2EJ8 A;  1BTK A;  2K2U A;  4PQ0 A;  1IRS A;  4HB0 B;  3DXD A;  3TW1 A;  3PZD A;  3P7Z A;  1K5G B;  4NSW A;  3FSS A;  2MFQ A;  4HB2 B;  2N23 A;  3LJU X;  1P6S A;  2ZPY A;  3TVV A;  2ADZ A;  2J59 M;  3V5W A;  2QKM A;  2YT1 A;  2YVC A;  5D3Y A;  2YSZ A;  2DTC A;  2D9X A;  3A98 B;  4Y94 A;  2GCL A;  2K00 A;  4IOY X;  2X18 A;  4HAX B;  4MK0 A;  1TQZ A;  2COF A;  1V89 A;  1U2B A;  1X86 A;  3GYO A;  2RSG A;  1FHW A;  2VKI A;  5DHA B;  5KCV A;  2L2I A;  5D27 A;  1J0W A;  2KUP A;  2RLO A;  1NTY A;  2ROZ B;  3SUZ A;  1DYN A;  2LOZ A;  4K2P A;  1FHX A;  2D11 A;  3SNH A;  1X1G A;  2P0F A;  2ELB A;  2EMT A;  1U5G A;  3AJ4 A;  2CAY A;  2G35 A;  2P8V A;  1Y5O A;  3P6A A;  3X23 A;  2UVM A;  2XQN M;  1U29 A;  2D9V A;  5EFX A;  5JHH A;  2DA0 A;  2UZR A;  2R0D A;  5JHG A;  1W1H A;  2YT0 A;  2D4Q A;  4L6E A;  3GYP A;  3VOQ A;  3OAN A;  1LB1 A;  3QBV B;  2P0D A;  3KY9 A;  1KI1 B;  4KVG B;  4GXB A;  2CRF A;  3N7C A;  1H4R A;  4EJN A;  5CLL B;  4CYE A;  1U5F A;  4NY0 A;  2RNR B;  2D9Y A;  1UNP A;  2FJL A;  1PLS A;  3D8F A;  3ML4 A;  4HB3 B;  3U7D A;  3ULC A;  2DX1 A;  4A6K A;  2IFS A;  4KHO A;  1QC6 A;  1BAK A;  2D10 A;  2CY5 A;  4HAZ B;  1DDM A;  4K17 A;  4CHM A;  3D8E A;  3PP2 A;  3VIA A;  4YL8 A;  2D9W A;  5KQ1 A;  1MKE A;  4XWX A;  4WSF A;  1WGQ A;  2Y8F A;  4Z2M B;  2Z0P A;  2W2X C;  1V88 A;  2E2X A;  2HE7 A;  2LUL A;  4F7G A;  3KRW A;  4C0A A;  1ZSQ A;  2DLW A;  1M7R A;  1ZM0 A;  4K2O A;  5LOP B;  2DX5 A;  1FAO A;  2OTX A;  1ZC3 B;  1XCG A;  1E5W A;  5J3Q A;  1KZG A;  1H10 A;  1MIZ B;  3ODW A;  1Z87 A;  3A8P A;  3CIK A;  5DHF B;  1DDW A;  1EGX A;  1QQG A;  3TCA A;  2OQB A;  1XR0 B;  1NU2 A;  2ELA A;  1DBH A;  1XOD A;  2I5F A;  4D0N B;  1NI2 A;  1SGH A;  1WG7 A;  2LG1 A;  5LON B;  1OMW A;  3BJI A;  1ISN A;  5CLQ B;  1EVH A;  2QKL A;  2DHJ A;  3O96 A;  3KSY A;  4HAW B;  1KZ7 A;  1UNR A;  2DHK A;  2DFK A;  1OQN A;  4EKU A;  2YS5 A;  5DH9 B;  3F0W A;  1P5T A;  4HHV A;  2VSZ A;  3U8Z A;  3AU4 A;  1W1D A;  5C5B A;  3HK0 A;  2DKQ A;  4DX9 0;  1FOE A;  5KQ4 A;  2LYD A;  2LOX A;  2L1C A;  1FB8 A;  2RUK B;  2W2X D;  4F7U P;  1B55 A;  2J0M A;  1MPH A;  3HQC A;  3ZDT A;  1NTV A;  4TKN A;  2CY4 A;  1XKE A;  4TYZ A;  4ZRI A;  5D3W A;  5C6R A;  5C5B B;  5J3Y A;  4GPT B;  2GS0 A;  2GJY A;  3PSC A;  5FI0 A;  2HTH B;  1GG3 A;  1K5D B;  2NZ8 B;  1GC6 A;  5JP4 A;  4HDQ A;  3G9W A;  1MAI A;  3TO1 A;  5C16 A;  2N0Y A;  1WGU A;  4ZRK A;  2YS3 A;  2I5C A;  2KGX B;  2H7E A;  3SV1 A;  4DXA B;  4HAT B;  4KHB B;  1V5P A;  4BBK A;  2DN6 A;  1UPR A;  4IFS A;  1MK7 B;  5GOW B;  2H7D A;  1EAZ A;  4Z2N A;  3SO6 A;  2Y8G A;  2K2J A;  3CXB B;  2Q13 A;  3M1I B;  2LKO A;  1I2H A;  2D2Q A;  1Y19 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...