4HAWB

Crystal structure of crm1 inhibitor leptomycin b in complex with crm1(k548a)-ran-ranbp1
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
138
structure length
131
Chain Sequence
IHFEPVVKTMEEDEEVLYKVRAKLFRFDKDAKEWKERGTGDCKFLKNKKTNKVRILMRRDKTLKICANHIIAPEYTLKPNVGSDRSWVYACTADIAEGEAEAFTFAIRFGSKENADKFKEEFEKAQEINKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GTP-binding nuclear protein Ran
publication title Nuclear export inhibition through covalent conjugation and hydrolysis of Leptomycin B by CRM1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport/antibiotic
total genus 36
structure length 131
sequence length 138
ec nomenclature
pdb deposition date 2012-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00638 Ran_BP1 RanBP1 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 4hawB00
1V61A 3KSYA 3U7DA 4HAWB 1BTKA 2Y8GA 2J0MA 1OY2A 1GG3A 1ZM0A 1SHCA 2DX5A 2J59M 3G9WA 1KZ7A 1Y5OA 3QWMA 2D4QA 3WA0A 1ISNA 1WJMA 4Z2MB 4F7HA 1FHXA 4EJNA 1U5EA 2VSZA 1NI2A 2K2UA 1FHOA 2Q13A 1FB8A 2CY4A 4HB0B 4DX90 1ZVRA 3PVLA 2MDXA 4HB3B 2DKPA 2ROZB 2ZPYA 4WVFB 1BTNA 2L2IA 3VOQA 1MIXA 1U27A 4A6KA 1ZSQA 5HE0A 3KZ1A 4Y94A 3P6AA 2ADZA 2COAA 5GOWB 4MK0A 4TKNA 4YONA 1NTYA 1XKEA 5L81A 5D3WA 4NY0A 5D3YA 1B55A 1KI1B 1Q67A 2W2WA 4EMOA 1OQNA 3RCPA 1BAKA 4A6FA 1WG7A 1W1HA 5D27A 1FGYA 3U8ZA 2P0DA 5DIFB 5C16A 2V76A 5HE3A 1PLSA 3AJ4A 3TFMA 1W1GA 4HB4B 3AU4A 5HE1A 3PVUA 5DI9B 2PZ1A 1U5GA 4B6HA 3UZTA 3SNHA 2ELAA 3QIJA 3N7CA 4HAXB 2DYNA 2W2XC 2QKMA 2YS3A 2DN6A 2JP2A 2ELBA 4C0AA 1X1FA 3KRXA 3SV1A 1RJ2A 4MY6A 1WGQA 2L1CA 4IAPA 1FAOA 4GMXB 4KAXB 2J0JA 3WYFB 3M1IB 2DYQA 2RUKB 4YL8A 2D11A 5C79A 2COCA 1PMSA 2OQBA 1UNRA 2IYBA 5J3TA 1AQCA 1MPHA 2P0FA 2HTHB 3KY9A 1K5GB 2AEHA 2LYDA 3ML4A 1WVHA 3KRWA 1Y19B 2Z0QA 3LJUX 1U2BA 4NSWA 1I7AA 1GC6A 2D9VA 2GJYA 1KZGA 4GMVA 1LW3A 2VRWB 2HE7A 2R0DA 1EGXA 2DX1A 1DROA 1EVHA 4GZUA 2GCLA 3VIAA 4A6HA 2E2XA 4HATB 2AL6A 5JHGA 4KHBB 3A8PA 1TXDA 2X18A 5HE2A 2M38A 2DHIA 1X11A 1RRPB 1QQGA 4HDOA 2D9ZA 3D8DA 2I5FA 3FSSA 4CYEA 5DHAB 1V5MA 1XX0A 2GS0A 3NSUA 5C5BA 4Z2NA 2D2QA 4BBKA 3HK0A 2I1KA 3IVFA 3PSCA 1WJ1A 3ULBA 2H7EA 1XR0B 4F7GA 2YVCA 2N23A 4HAZB 2J0KA 1M7EA 2RNRB 4K2OA 3BINA 4TYZA 5DH9B 3GYPA 1U5FA 1MKEA 2H7DA 2DHJA 1WI1A 3PP2A 3OANA 2DA0A 2MWNB 1XODA 1V5UA 5EFXA 3SYXA 4XWXA 4KHAA 2FJLA 5KQ4A 2RGNB 3QBVB 2LKOA 4P7IA 4F7UP 2CODA 3DXDA 3FEHA 2K2JA 3MPXA 3A98B 1FHWA 5D3XA 3P7ZA 2MFQA 2CRFA 4DBBA 1UPRA 3TO1A 1U29A 3DXCA 4K81A 4GN1A 3V5WA 2KUPA 2EJ8A 2UVMA 4KVGB 1N3HA 2D10A 2D9XA 1WGUA 2YS1A 1ZC4B 2BCJA 1GC7A 5JHHA 1TQZA 4HAUB 2OTXA 3ODWA 3T06A 3PZDA 1Z87A 1FGZA 3BJIA 3HW2B 4D0NB 1MIZB 1UPQA 3A8QA 3ULCA 5CLQB 4ZRJA 5KCVA 5C6RA 1J19A 1DYNA 4ZRIA 2DHKA 1V89A 4CHJA 4A6FB 2EC1A 4MT7A 3TW1A 2CY5A 1DDWA 4KHOA 2LG1A 1DBHA 1NTVA 1TJ6A 2NMBA 1DDVA 3ODOA 3D8FA 1DDMA 3F0WA 1W1DA 5LONB 4H8SA 1XD4A 3PEGA 1H4RA 4HB2B 2LOZA 4HHVA 3X23A 3TVVA 4DX8A 2I5CA 1P5TA 2CAYA 2EMSA 1MK7B 1PFJA 4EKUA 2COFA 1V88A 2QKLA 3GYOA 1H10A 2GCJA 1U5DA 2KCJA 3O96A 4K17A 2YT1A 3ODXA 1EAZA 4HAYB 2P8VA 1X86A 3CXBB 3FM8C 4A5KA 2D9WA 2Z0PA 2XQNM 2VKIA 2DLWA 4HAVB 3TCAA 1EF1A 2G35A 4GXBA 1MAIA 3F5RA 2KGXB 2MKRA 5J3QA 3ZVRA 2YS5A 3SUZA 2W2XD 2YF0A 5JLJB 1FOEA 1X1GA 5D3VA 4L6EA 1P3RA 5JP4A 2N0YA 1V5PA 2Y8FA 1LB1A 3DXEA 4IOYX 1SGHA 3ZDTA 2UZSA 2LOXA 4DXAB 2M14A 2EMTA 2DKQA 4IFSA 2RSGA 2LULA 2Y7BA 4WSFA 2UZRA 2RLOA 1K5DB 2Z0OA 5J3YA 4CHMA 2K00A 1OMWA 1QC6A 2RVBB 3PG7A 5C5BB 1ZC3B 5DHFB 1P6SA 2YT0A 2DTCA 1X05A 3CIKA 3AU5A 1UNPA 4K2PA 5LOPB 1AWEA 2ROVA 1NU2A 2P0HA 2NZ8B 4GPTB 1M7RA 1XCGA 1J0WA 1E5WA 5KQ1A 2DFKA 3D8EA 3PVWA 3MDBC 1I2HA 2D9YA 5CLLB 3SO6A 1IRSA 2R09A 4PQ0A 1BWNA 2I1JA 5FI1A 1MK9B 1UNQA 4WJ7A 5FI0A 2IFSA 4PNKA 1UEFA 2YRYA 3HQCA 2YSZA 4HDQA 4ZRKA
chains in the Genus database with same CATH superfamily
1V61A 3KSYA 3U7DA 4HAWB 1BTKA 2Y8GA 2J0MA 1OY2A 1GG3A 1ZM0A 1SHCA 2DX5A 2J59M 3G9WA 1KZ7A 1Y5OA 3QWMA 2D4QA 3WA0A 1ISNA 1WJMA 4Z2MB 4F7HA 1FHXA 4EJNA 1U5EA 2VSZA 1NI2A 2K2UA 1FHOA 2Q13A 1FB8A 2CY4A 4HB0B 4DX90 1ZVRA 3PVLA 2MDXA 4HB3B 2DKPA 2ROZB 2KIEA 2ZPYA 4WVFB 1BTNA 2L2IA 3VOQA 1MIXA 1U27A 4A6KA 1ZSQA 5HE0A 3KZ1A 4Y94A 3P6AA 2ADZA 2COAA 5GOWB 4MK0A 4TKNA 4YONA 1NTYA 1XKEA 2GUMA 5L81A 4OT1A 5D3WA 4NY0A 5D3YA 1B55A 1KI1B 1Q67A 2W2WA 4EMOA 1OQNA 3RCPA 1BAKA 4A6FA 1WG7A 1W1HA 5D27A 1FGYA 3U8ZA 4GNKB 2P0DA 5DIFB 5C16A 2V76A 5HE3A 1PLSA 3AJ4A 3TFMA 1W1GA 4HB4B 2ZKMX 3AU4A 5HE1A 3PVUA 5DI9B 2PZ1A 1U5GA 4B6HA 3UZTA 3SNHA 2ELAA 3QIJA 3N7CA 4HAXB 2DYNA 2W2XC 2QKMA 2YS3A 2DN6A 2Z13A 2JP2A 2ELBA 4C0AA 1X1FA 3KRXA 3SV1A 1RJ2A 4MY6A 5LG4B 1WGQA 2L1CA 4IAPA 1FAOA 4GMXB 4KAXB 2J0JA 3WYFB 3M1IB 2DYQA 2RUKB 4YL8A 2D11A 5C79A 3FVCA 2COCA 2R2YA 1PMSA 2OQBA 1UNRA 2IYBA 5J3TA 1AQCA 1MPHA 2P0FA 2HTHB 3KY9A 1K5GB 2AEHA 2LYDA 3ML4A 1WVHA 3KRWA 1Y19B 2Z0QA 3LJUX 1U2BA 4NSWA 1I7AA 1GC6A 2D9VA 2GJYA 1KZGA 4GMVA 1LW3A 2VRWB 2HE7A 2R0DA 1EGXA 2FJUB 2DX1A 1DROA 1EVHA 4GZUA 2GCLA 3VIAA 4A6HA 2E2XA 4HATB 2AL6A 5JHGA 4KHBB 3A8PA 1TXDA 2X18A 5HE2A 2M38A 2DHIA 1X11A 1RRPB 3A58A 1QQGA 5I2MA 4HDOA 2D9ZA 3D8DA 2I5FA 3FSSA 4CYEA 5DHAB 1V5MA 1XX0A 2GS0A 3NSUA 5C5BA 4Z2NA 2D2QA 4BBKA 3HK0A 2I1KA 3IVFA 3PSCA 1WJ1A 3ULBA 2H7EA 1XR0B 4F7GA 2YVCA 2N23A 4HAZB 2J0KA 1M7EA 2RNRB 4K2OA 3NWFA 3BINA 4TYZA 5DH9B 3GYPA 1U5FA 1MKEA 2H7DA 2Z4DA 2DHJA 1WI1A 2RRFA 3PP2A 3OHMB 3OANA 2DA0A 2MWNB 1XODA 1V5UA 3B77A 5EFXA 3SYXA 4XWXA 4KHAA 2FJLA 5KQ4A 2RGNB 3QBVB 2LKOA 4P7IA 4F7UP 2CODA 3DXDA 3FEHA 2K2JA 3MPXA 4DIXA 3A98B 1FHWA 5D3XA 3P7ZA 2MFQA 2CRFA 4DBBA 1UPRA 3TO1A 1U29A 2NBVA 3DXCA 4K81A 3NWDA 4GN1A 3V5WA 1ZYIA 2KUPA 2EJ8A 2UVMA 4KVGB 1N3HA 2D10A 2D9XA 1WGUA 2YS1A 1ZC4B 2KUQA 2BCJA 1GC7A 5JHHA 1TQZA 4HAUB 2OTXA 3ODWA 2YT2A 3T06A 3PZDA 1Z87A 1FGZA 3BJIA 3HW2B 4D0NB 1MIZB 5IRSA 1UPQA 3A8QA 3ULCA 5CLQB 3U12A 4ZRJA 5KCVA 3DCXA 4QJ3B 5C6RA 1J19A 1DYNA 4ZRIA 2DHKA 1V89A 4CHJA 4A6FB 2EC1A 4MT7A 3TW1A 2CY5A 1DDWA 4KHOA 2LG1A 1DBHA 1NTVA 1TJ6A 2K49A 2NMBA 1DDVA 3ODOA 3D8FA 1DDMA 3F0WA 1W1DA 5LONB 4H8SA 1XD4A 3PEGA 1H4RA 4HB2B 2LOZA 4HHVA 3X23A 3TVVA 4DX8A 2Z14A 2I5CA 1P5TA 2CAYA 2EMSA 1MK7B 1PFJA 4EKUA 2KR0A 2COFA 1V88A 2QKLA 3GYOA 1H10A 3HIEA 2GCJA 2K8EA 1MI1A 3NWAA 1U5DA 2KCJA 3HSAA 3O96A 4K17A 2YT1A 3ODXA 1EAZA 4CSQA 4HAYB 5I2SA 2P8VA 1X86A 3CXBB 3FM8C 4QJ5B 4A5KA 2D9WA 2Z0PA 2XQNM 2VKIA 2DLWA 4HAVB 3TCAA 1EF1A 2G35A 4GXBA 1MAIA 3F5RA 2KGXB 2MKRA 5J3QA 3ZVRA 2YS5A 3SUZA 2W2XD 4OSNA 2YF0A 5JLJB 1FOEA 1X1GA 4L1RA 5D3VA 4D6WA 3NW8A 4L6EA 1P3RA 1T77A 5JP4A 2N0YA 1V5PA 2Y8FA 1LB1A 3DXEA 4IOYX 1SGHA 3ZDTA 2UZSA 2LOXA 4KHBA 4DXAB 2M14A 2EMTA 2DKQA 4HSIA 4IFSA 2RSGA 2LULA 2Y7BA 4WSFA 2UZRA 2RLOA 1K5DB 4QXAB 4GOUA 2Z0OA 5J3YA 4CHMA 4QJ4B 2K00A 1OMWA 1QC6A 2KIGA 2RVBB 3PG7A 5C5BB 1ZC3B 5DHFB 1P6SA 2YT0A 2DTCA 1X05A 3CIKA 2Z59A 3AU5A 1UNPA 4K2PA 5LOPB 1AWEA 2ROVA 1NU2A 2P0HA 2NZ8B 4GPTB 1M7RA 1XCGA 1J0WA 1E5WA 5KQ1A 2DFKA 5M4YB 3D8EA 3PVWA 3MDBC 1I2HA 2D9YA 5CLLB 3SO6A 1IRSA 2R09A 4PQ0A 1BWNA 2I1JA 5FI1A 1MK9B 1UNQA 4WJ7A 5FI0A 2IFSA 4PNKA 1UEFA 2YRYA 3HQCA 2YSZA 4HDQA 4ZRKA
chains in the Genus database with same CATH topology
1V61A 3KSYA 3U7DA 4HAWB 1BTKA 2Y8GA 2J0MA 1OY2A 1GG3A 1ZM0A 1SHCA 2DX5A 2J59M 3G9WA 1KZ7A 1Y5OA 3QWMA 2D4QA 3WA0A 1ISNA 1WJMA 4Z2MB 4F7HA 1FHXA 4EJNA 1U5EA 2VSZA 1NI2A 2K2UA 1FHOA 2Q13A 1FB8A 2CY4A 4HB0B 4DX90 1ZVRA 3PVLA 2MDXA 4HB3B 2DKPA 2ROZB 2ZPYA 4WVFB 1BTNA 2L2IA 3VOQA 1MIXA 1U27A 4A6KA 1ZSQA 5HE0A 3KZ1A 4Y94A 3P6AA 2ADZA 2COAA 5GOWB 4MK0A 4TKNA 4YONA 1NTYA 1XKEA 5L81A 5D3WA 4NY0A 5D3YA 1B55A 1KI1B 1Q67A 2W2WA 4EMOA 1OQNA 3RCPA 1BAKA 4A6FA 1WG7A 1W1HA 5D27A 1FGYA 3U8ZA 2P0DA 5DIFB 5C16A 2V76A 5HE3A 1PLSA 3AJ4A 3TFMA 1W1GA 4HB4B 3AU4A 5HE1A 3PVUA 5DI9B 2PZ1A 1U5GA 4B6HA 3UZTA 3SNHA 2ELAA 3QIJA 3N7CA 4HAXB 2DYNA 2W2XC 2QKMA 2YS3A 2DN6A 2JP2A 2ELBA 4C0AA 1X1FA 3KRXA 3SV1A 1RJ2A 4MY6A 1WGQA 2L1CA 4IAPA 1FAOA 4GMXB 4KAXB 2J0JA 3WYFB 3M1IB 2DYQA 2RUKB 4YL8A 2D11A 5C79A 2COCA 1PMSA 2OQBA 1UNRA 2IYBA 5J3TA 1AQCA 1MPHA 2P0FA 2HTHB 3KY9A 1K5GB 2AEHA 2LYDA 3ML4A 1WVHA 3KRWA 1Y19B 2Z0QA 3LJUX 1U2BA 4NSWA 1I7AA 1GC6A 2D9VA 2GJYA 1KZGA 4GMVA 1LW3A 2VRWB 2HE7A 2R0DA 1EGXA 2DX1A 1DROA 1EVHA 4GZUA 2GCLA 3VIAA 4A6HA 2E2XA 4HATB 2AL6A 5JHGA 4KHBB 3A8PA 1TXDA 2X18A 5HE2A 2M38A 2DHIA 1X11A 1RRPB 1QQGA 4HDOA 2D9ZA 3D8DA 2I5FA 3FSSA 4CYEA 5DHAB 1V5MA 1XX0A 2GS0A 3NSUA 5C5BA 4Z2NA 2D2QA 4BBKA 3HK0A 2I1KA 3IVFA 3PSCA 1WJ1A 3ULBA 2H7EA 1XR0B 4F7GA 2YVCA 2N23A 4HAZB 2J0KA 1M7EA 2RNRB 4K2OA 3BINA 4TYZA 5DH9B 3GYPA 1U5FA 1MKEA 2H7DA 2DHJA 1WI1A 3PP2A 3OANA 2DA0A 2MWNB 1XODA 1V5UA 5EFXA 3SYXA 4XWXA 4KHAA 2FJLA 5KQ4A 2RGNB 3QBVB 2LKOA 4P7IA 4F7UP 2CODA 3DXDA 3FEHA 2K2JA 3MPXA 3A98B 1FHWA 5D3XA 3P7ZA 2MFQA 2CRFA 4DBBA 1UPRA 3TO1A 1U29A 3DXCA 4K81A 4GN1A 3V5WA 2KUPA 2EJ8A 2UVMA 4KVGB 1N3HA 2D10A 2D9XA 1WGUA 2YS1A 1ZC4B 2BCJA 1GC7A 5JHHA 1TQZA 4HAUB 2OTXA 3ODWA 3T06A 3PZDA 1Z87A 1FGZA 3BJIA 3HW2B 4D0NB 1MIZB 1UPQA 3A8QA 3ULCA 5CLQB 4ZRJA 5KCVA 5C6RA 1J19A 1DYNA 4ZRIA 2DHKA 1V89A 4CHJA 4A6FB 2EC1A 4MT7A 3TW1A 2CY5A 1DDWA 4KHOA 2LG1A 1DBHA 1NTVA 1TJ6A 2NMBA 1DDVA 3ODOA 3D8FA 1DDMA 3F0WA 1W1DA 5LONB 4H8SA 1XD4A 3PEGA 1H4RA 4HB2B 2LOZA 4HHVA 3X23A 3TVVA 4DX8A 2I5CA 1P5TA 2CAYA 2EMSA 1MK7B 1PFJA 4EKUA 2COFA 1V88A 2QKLA 3GYOA 1H10A 2GCJA 1U5DA 2KCJA 3O96A 4K17A 2YT1A 3ODXA 1EAZA 4HAYB 2P8VA 1X86A 3CXBB 3FM8C 4A5KA 2D9WA 2Z0PA 2XQNM 2VKIA 2DLWA 4HAVB 3TCAA 1EF1A 2G35A 4GXBA 1MAIA 3F5RA 2KGXB 2MKRA 5J3QA 3ZVRA 2YS5A 3SUZA 2W2XD 2YF0A 5JLJB 1FOEA 1X1GA 5D3VA 4L6EA 1P3RA 5JP4A 2N0YA 1V5PA 2Y8FA 1LB1A 3DXEA 4IOYX 1SGHA 3ZDTA 2UZSA 2LOXA 4DXAB 2M14A 2EMTA 2DKQA 4IFSA 2RSGA 2LULA 2Y7BA 4WSFA 2UZRA 2RLOA 1K5DB 2Z0OA 5J3YA 4CHMA 2K00A 1OMWA 1QC6A 2RVBB 3PG7A 5C5BB 1ZC3B 5DHFB 1P6SA 2YT0A 2DTCA 1X05A 3CIKA 3AU5A 1UNPA 4K2PA 5LOPB 1AWEA 2ROVA 1NU2A 2P0HA 2NZ8B 4GPTB 1M7RA 1XCGA 1J0WA 1E5WA 5KQ1A 2DFKA 3D8EA 3PVWA 3MDBC 1I2HA 2D9YA 5CLLB 3SO6A 1IRSA 2R09A 4PQ0A 1BWNA 2I1JA 5FI1A 1MK9B 1UNQA 4WJ7A 5FI0A 2IFSA 4PNKA 1UEFA 2YRYA 3HQCA 2YSZA 4HDQA 4ZRKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1V61 A;  3KSY A;  3U7D A;  4HAW B;  1BTK A;  2Y8G A;  2J0M A;  1OY2 A;  1GG3 A;  1ZM0 A;  1SHC A;  2DX5 A;  2J59 M;  3G9W A;  1KZ7 A;  1Y5O A;  3QWM A;  2D4Q A;  3WA0 A;  1ISN A;  1WJM A;  4Z2M B;  4F7H A;  1FHX A;  4EJN A;  1U5E A;  2VSZ A;  1NI2 A;  2K2U A;  1FHO A;  2Q13 A;  1FB8 A;  2CY4 A;  4HB0 B;  4DX9 0;  1ZVR A;  3PVL A;  2MDX A;  4HB3 B;  2DKP A;  2ROZ B;  2ZPY A;  4WVF B;  1BTN A;  2L2I A;  3VOQ A;  1MIX A;  1U27 A;  4A6K A;  1ZSQ A;  5HE0 A;  3KZ1 A;  4Y94 A;  3P6A A;  2ADZ A;  2COA A;  5GOW B;  4MK0 A;  4TKN A;  4YON A;  1NTY A;  1XKE A;  5L81 A;  5D3W A;  4NY0 A;  5D3Y A;  1B55 A;  1KI1 B;  1Q67 A;  2W2W A;  4EMO A;  1OQN A;  3RCP A;  1BAK A;  4A6F A;  1WG7 A;  1W1H A;  5D27 A;  1FGY A;  3U8Z A;  2P0D A;  5DIF B;  5C16 A;  2V76 A;  5HE3 A;  1PLS A;  3AJ4 A;  3TFM A;  1W1G A;  4HB4 B;  3AU4 A;  5HE1 A;  3PVU A;  5DI9 B;  2PZ1 A;  1U5G A;  4B6H A;  3UZT A;  3SNH A;  2ELA A;  3QIJ A;  3N7C A;  4HAX B;  2DYN A;  2W2X C;  2QKM A;  2YS3 A;  2DN6 A;  2JP2 A;  2ELB A;  4C0A A;  1X1F A;  3KRX A;  3SV1 A;  1RJ2 A;  4MY6 A;  1WGQ A;  2L1C A;  4IAP A;  1FAO A;  4GMX B;  4KAX B;  2J0J A;  3WYF B;  3M1I B;  2DYQ A;  2RUK B;  4YL8 A;  2D11 A;  5C79 A;  2COC A;  1PMS A;  2OQB A;  1UNR A;  2IYB A;  5J3T A;  1AQC A;  1MPH A;  2P0F A;  2HTH B;  3KY9 A;  1K5G B;  2AEH A;  2LYD A;  3ML4 A;  1WVH A;  3KRW A;  1Y19 B;  2Z0Q A;  3LJU X;  1U2B A;  4NSW A;  1I7A A;  1GC6 A;  2D9V A;  2GJY A;  1KZG A;  4GMV A;  1LW3 A;  2VRW B;  2HE7 A;  2R0D A;  1EGX A;  2DX1 A;  1DRO A;  1EVH A;  4GZU A;  2GCL A;  3VIA A;  4A6H A;  2E2X A;  4HAT B;  2AL6 A;  5JHG A;  4KHB B;  3A8P A;  1TXD A;  2X18 A;  5HE2 A;  2M38 A;  2DHI A;  1X11 A;  1RRP B;  1QQG A;  4HDO A;  2D9Z A;  3D8D A;  2I5F A;  3FSS A;  4CYE A;  5DHA B;  1V5M A;  1XX0 A;  2GS0 A;  3NSU A;  5C5B A;  4Z2N A;  2D2Q A;  4BBK A;  3HK0 A;  2I1K A;  3IVF A;  3PSC A;  1WJ1 A;  3ULB A;  2H7E A;  1XR0 B;  4F7G A;  2YVC A;  2N23 A;  4HAZ B;  2J0K A;  1M7E A;  2RNR B;  4K2O A;  3BIN A;  4TYZ A;  5DH9 B;  3GYP A;  1U5F A;  1MKE A;  2H7D A;  2DHJ A;  1WI1 A;  3PP2 A;  3OAN A;  2DA0 A;  2MWN B;  1XOD A;  1V5U A;  5EFX A;  3SYX A;  4XWX A;  4KHA A;  2FJL A;  5KQ4 A;  2RGN B;  3QBV B;  2LKO A;  4P7I A;  4F7U P;  2COD A;  3DXD A;  3FEH A;  2K2J A;  3MPX A;  3A98 B;  1FHW A;  5D3X A;  3P7Z A;  2MFQ A;  2CRF A;  4DBB A;  1UPR A;  3TO1 A;  1U29 A;  3DXC A;  4K81 A;  4GN1 A;  3V5W A;  2KUP A;  2EJ8 A;  2UVM A;  4KVG B;  1N3H A;  2D10 A;  2D9X A;  1WGU A;  2YS1 A;  1ZC4 B;  2BCJ A;  1GC7 A;  5JHH A;  1TQZ A;  4HAU B;  2OTX A;  3ODW A;  3T06 A;  3PZD A;  1Z87 A;  1FGZ A;  3BJI A;  3HW2 B;  4D0N B;  1MIZ B;  1UPQ A;  3A8Q A;  3ULC A;  5CLQ B;  4ZRJ A;  5KCV A;  5C6R A;  1J19 A;  1DYN A;  4ZRI A;  2DHK A;  1V89 A;  4CHJ A;  4A6F B;  2EC1 A;  4MT7 A;  3TW1 A;  2CY5 A;  1DDW A;  4KHO A;  2LG1 A;  1DBH A;  1NTV A;  1TJ6 A;  2NMB A;  1DDV A;  3ODO A;  3D8F A;  1DDM A;  3F0W A;  1W1D A;  5LON B;  4H8S A;  1XD4 A;  3PEG A;  1H4R A;  4HB2 B;  2LOZ A;  4HHV A;  3X23 A;  3TVV A;  4DX8 A;  2I5C A;  1P5T A;  2CAY A;  2EMS A;  1MK7 B;  1PFJ A;  4EKU A;  2COF A;  1V88 A;  2QKL A;  3GYO A;  1H10 A;  2GCJ A;  1U5D A;  2KCJ A;  3O96 A;  4K17 A;  2YT1 A;  3ODX A;  1EAZ A;  4HAY B;  2P8V A;  1X86 A;  3CXB B;  3FM8 C;  4A5K A;  2D9W A;  2Z0P A;  2XQN M;  2VKI A;  2DLW A;  4HAV B;  3TCA A;  1EF1 A;  2G35 A;  4GXB A;  1MAI A;  3F5R A;  2KGX B;  2MKR A;  5J3Q A;  3ZVR A;  2YS5 A;  3SUZ A;  2W2X D;  2YF0 A;  5JLJ B;  1FOE A;  1X1G A;  5D3V A;  4L6E A;  1P3R A;  5JP4 A;  2N0Y A;  1V5P A;  2Y8F A;  1LB1 A;  3DXE A;  4IOY X;  1SGH A;  3ZDT A;  2UZS A;  2LOX A;  4DXA B;  2M14 A;  2EMT A;  2DKQ A;  4IFS A;  2RSG A;  2LUL A;  2Y7B A;  4WSF A;  2UZR A;  2RLO A;  1K5D B;  2Z0O A;  5J3Y A;  4CHM A;  2K00 A;  1OMW A;  1QC6 A;  2RVB B;  3PG7 A;  5C5B B;  1ZC3 B;  5DHF B;  1P6S A;  2YT0 A;  2DTC A;  1X05 A;  3CIK A;  3AU5 A;  1UNP A;  4K2P A;  5LOP B;  1AWE A;  2ROV A;  1NU2 A;  2P0H A;  2NZ8 B;  4GPT B;  1M7R A;  1XCG A;  1J0W A;  1E5W A;  5KQ1 A;  2DFK A;  3D8E A;  3PVW A;  3MDB C;  1I2H A;  2D9Y A;  5CLL B;  3SO6 A;  1IRS A;  2R09 A;  4PQ0 A;  1BWN A;  2I1J A;  5FI1 A;  1MK9 B;  1UNQ A;  4WJ7 A;  5FI0 A;  2IFS A;  4PNK A;  1UEF A;  2YRY A;  3HQC A;  2YSZ A;  4HDQ A;  4ZRK A; 
#chains in the Genus database with same CATH topology
 1V61 A;  3KSY A;  3U7D A;  4HAW B;  1BTK A;  2Y8G A;  2J0M A;  1OY2 A;  1GG3 A;  1ZM0 A;  1SHC A;  2DX5 A;  2J59 M;  3G9W A;  1KZ7 A;  1Y5O A;  3QWM A;  2D4Q A;  3WA0 A;  1ISN A;  1WJM A;  4Z2M B;  4F7H A;  1FHX A;  4EJN A;  1U5E A;  2VSZ A;  1NI2 A;  2K2U A;  1FHO A;  2Q13 A;  1FB8 A;  2CY4 A;  4HB0 B;  4DX9 0;  1ZVR A;  3PVL A;  2MDX A;  4HB3 B;  2DKP A;  2ROZ B;  2KIE A;  2ZPY A;  4WVF B;  1BTN A;  2L2I A;  3VOQ A;  1MIX A;  1U27 A;  4A6K A;  1ZSQ A;  5HE0 A;  3KZ1 A;  4Y94 A;  3P6A A;  2ADZ A;  2COA A;  5GOW B;  4MK0 A;  4TKN A;  4YON A;  1NTY A;  1XKE A;  2GUM A;  5L81 A;  4OT1 A;  5D3W A;  4NY0 A;  5D3Y A;  1B55 A;  1KI1 B;  1Q67 A;  2W2W A;  4EMO A;  1OQN A;  3RCP A;  1BAK A;  4A6F A;  1WG7 A;  1W1H A;  5D27 A;  1FGY A;  3U8Z A;  4GNK B;  2P0D A;  5DIF B;  5C16 A;  2V76 A;  5HE3 A;  1PLS A;  3AJ4 A;  3TFM A;  1W1G A;  4HB4 B;  2ZKM X;  3AU4 A;  5HE1 A;  3PVU A;  5DI9 B;  2PZ1 A;  1U5G A;  4B6H A;  3UZT A;  3SNH A;  2ELA A;  3QIJ A;  3N7C A;  4HAX B;  2DYN A;  2W2X C;  2QKM A;  2YS3 A;  2DN6 A;  2Z13 A;  2JP2 A;  2ELB A;  4C0A A;  1X1F A;  3KRX A;  3SV1 A;  1RJ2 A;  4MY6 A;  5LG4 B;  1WGQ A;  2L1C A;  4IAP A;  1FAO A;  4GMX B;  4KAX B;  2J0J A;  3WYF B;  3M1I B;  2DYQ A;  2RUK B;  4YL8 A;  2D11 A;  5C79 A;  3FVC A;  2COC A;  2R2Y A;  1PMS A;  2OQB A;  1UNR A;  2IYB A;  5J3T A;  1AQC A;  1MPH A;  2P0F A;  2HTH B;  3KY9 A;  1K5G B;  2AEH A;  2LYD A;  3ML4 A;  1WVH A;  3KRW A;  1Y19 B;  2Z0Q A;  3LJU X;  1U2B A;  4NSW A;  1I7A A;  1GC6 A;  2D9V A;  2GJY A;  1KZG A;  4GMV A;  1LW3 A;  2VRW B;  2HE7 A;  2R0D A;  1EGX A;  2FJU B;  2DX1 A;  1DRO A;  1EVH A;  4GZU A;  2GCL A;  3VIA A;  4A6H A;  2E2X A;  4HAT B;  2AL6 A;  5JHG A;  4KHB B;  3A8P A;  1TXD A;  2X18 A;  5HE2 A;  2M38 A;  2DHI A;  1X11 A;  1RRP B;  3A58 A;  1QQG A;  5I2M A;  4HDO A;  2D9Z A;  3D8D A;  2I5F A;  3FSS A;  4CYE A;  5DHA B;  1V5M A;  1XX0 A;  2GS0 A;  3NSU A;  5C5B A;  4Z2N A;  2D2Q A;  4BBK A;  3HK0 A;  2I1K A;  3IVF A;  3PSC A;  1WJ1 A;  3ULB A;  2H7E A;  1XR0 B;  4F7G A;  2YVC A;  2N23 A;  4HAZ B;  2J0K A;  1M7E A;  2RNR B;  4K2O A;  3NWF A;  3BIN A;  4TYZ A;  5DH9 B;  3GYP A;  1U5F A;  1MKE A;  2H7D A;  2Z4D A;  2DHJ A;  1WI1 A;  2RRF A;  3PP2 A;  3OHM B;  3OAN A;  2DA0 A;  2MWN B;  1XOD A;  1V5U A;  3B77 A;  5EFX A;  3SYX A;  4XWX A;  4KHA A;  2FJL A;  5KQ4 A;  2RGN B;  3QBV B;  2LKO A;  4P7I A;  4F7U P;  2COD A;  3DXD A;  3FEH A;  2K2J A;  3MPX A;  4DIX A;  3A98 B;  1FHW A;  5D3X A;  3P7Z A;  2MFQ A;  2CRF A;  4DBB A;  1UPR A;  3TO1 A;  1U29 A;  2NBV A;  3DXC A;  4K81 A;  3NWD A;  4GN1 A;  3V5W A;  1ZYI A;  2KUP A;  2EJ8 A;  2UVM A;  4KVG B;  1N3H A;  2D10 A;  2D9X A;  1WGU A;  2YS1 A;  1ZC4 B;  2KUQ A;  2BCJ A;  1GC7 A;  5JHH A;  1TQZ A;  4HAU B;  2OTX A;  3ODW A;  2YT2 A;  3T06 A;  3PZD A;  1Z87 A;  1FGZ A;  3BJI A;  3HW2 B;  4D0N B;  1MIZ B;  5IRS A;  1UPQ A;  3A8Q A;  3ULC A;  5CLQ B;  3U12 A;  4ZRJ A;  5KCV A;  3DCX A;  4QJ3 B;  5C6R A;  1J19 A;  1DYN A;  4ZRI A;  2DHK A;  1V89 A;  4CHJ A;  4A6F B;  2EC1 A;  4MT7 A;  3TW1 A;  2CY5 A;  1DDW A;  4KHO A;  2LG1 A;  1DBH A;  1NTV A;  1TJ6 A;  2K49 A;  2NMB A;  1DDV A;  3ODO A;  3D8F A;  1DDM A;  3F0W A;  1W1D A;  5LON B;  4H8S A;  1XD4 A;  3PEG A;  1H4R A;  4HB2 B;  2LOZ A;  4HHV A;  3X23 A;  3TVV A;  4DX8 A;  2Z14 A;  2I5C A;  1P5T A;  2CAY A;  2EMS A;  1MK7 B;  1PFJ A;  4EKU A;  2KR0 A;  2COF A;  1V88 A;  2QKL A;  3GYO A;  1H10 A;  3HIE A;  2GCJ A;  2K8E A;  1MI1 A;  3NWA A;  1U5D A;  2KCJ A;  3HSA A;  3O96 A;  4K17 A;  2YT1 A;  3ODX A;  1EAZ A;  4CSQ A;  4HAY B;  5I2S A;  2P8V A;  1X86 A;  3CXB B;  3FM8 C;  4QJ5 B;  4A5K A;  2D9W A;  2Z0P A;  2XQN M;  2VKI A;  2DLW A;  4HAV B;  3TCA A;  1EF1 A;  2G35 A;  4GXB A;  1MAI A;  3F5R A;  2KGX B;  2MKR A;  5J3Q A;  3ZVR A;  2YS5 A;  3SUZ A;  2W2X D;  4OSN A;  2YF0 A;  5JLJ B;  1FOE A;  1X1G A;  4L1R A;  5D3V A;  4D6W A;  3NW8 A;  4L6E A;  1P3R A;  1T77 A;  5JP4 A;  2N0Y A;  1V5P A;  2Y8F A;  1LB1 A;  3DXE A;  4IOY X;  1SGH A;  3ZDT A;  2UZS A;  2LOX A;  4KHB A;  4DXA B;  2M14 A;  2EMT A;  2DKQ A;  4HSI A;  4IFS A;  2RSG A;  2LUL A;  2Y7B A;  4WSF A;  2UZR A;  2RLO A;  1K5D B;  4QXA B;  4GOU A;  2Z0O A;  5J3Y A;  4CHM A;  4QJ4 B;  2K00 A;  1OMW A;  1QC6 A;  2KIG A;  2RVB B;  3PG7 A;  5C5B B;  1ZC3 B;  5DHF B;  1P6S A;  2YT0 A;  2DTC A;  1X05 A;  3CIK A;  2Z59 A;  3AU5 A;  1UNP A;  4K2P A;  5LOP B;  1AWE A;  2ROV A;  1NU2 A;  2P0H A;  2NZ8 B;  4GPT B;  1M7R A;  1XCG A;  1J0W A;  1E5W A;  5KQ1 A;  2DFK A;  5M4Y B;  3D8E A;  3PVW A;  3MDB C;  1I2H A;  2D9Y A;  5CLL B;  3SO6 A;  1IRS A;  2R09 A;  4PQ0 A;  1BWN A;  2I1J A;  5FI1 A;  1MK9 B;  1UNQ A;  4WJ7 A;  5FI0 A;  2IFS A;  4PNK A;  1UEF A;  2YRY A;  3HQC A;  2YSZ A;  4HDQ A;  4ZRK A; 
#chains in the Genus database with same CATH homology
 1V61 A;  3KSY A;  3U7D A;  4HAW B;  1BTK A;  2Y8G A;  2J0M A;  1OY2 A;  1GG3 A;  1ZM0 A;  1SHC A;  2DX5 A;  2J59 M;  3G9W A;  1KZ7 A;  1Y5O A;  3QWM A;  2D4Q A;  3WA0 A;  1ISN A;  1WJM A;  4Z2M B;  4F7H A;  1FHX A;  4EJN A;  1U5E A;  2VSZ A;  1NI2 A;  2K2U A;  1FHO A;  2Q13 A;  1FB8 A;  2CY4 A;  4HB0 B;  4DX9 0;  1ZVR A;  3PVL A;  2MDX A;  4HB3 B;  2DKP A;  2ROZ B;  2ZPY A;  4WVF B;  1BTN A;  2L2I A;  3VOQ A;  1MIX A;  1U27 A;  4A6K A;  1ZSQ A;  5HE0 A;  3KZ1 A;  4Y94 A;  3P6A A;  2ADZ A;  2COA A;  5GOW B;  4MK0 A;  4TKN A;  4YON A;  1NTY A;  1XKE A;  5L81 A;  5D3W A;  4NY0 A;  5D3Y A;  1B55 A;  1KI1 B;  1Q67 A;  2W2W A;  4EMO A;  1OQN A;  3RCP A;  1BAK A;  4A6F A;  1WG7 A;  1W1H A;  5D27 A;  1FGY A;  3U8Z A;  2P0D A;  5DIF B;  5C16 A;  2V76 A;  5HE3 A;  1PLS A;  3AJ4 A;  3TFM A;  1W1G A;  4HB4 B;  3AU4 A;  5HE1 A;  3PVU A;  5DI9 B;  2PZ1 A;  1U5G A;  4B6H A;  3UZT A;  3SNH A;  2ELA A;  3QIJ A;  3N7C A;  4HAX B;  2DYN A;  2W2X C;  2QKM A;  2YS3 A;  2DN6 A;  2JP2 A;  2ELB A;  4C0A A;  1X1F A;  3KRX A;  3SV1 A;  1RJ2 A;  4MY6 A;  1WGQ A;  2L1C A;  4IAP A;  1FAO A;  4GMX B;  4KAX B;  2J0J A;  3WYF B;  3M1I B;  2DYQ A;  2RUK B;  4YL8 A;  2D11 A;  5C79 A;  2COC A;  1PMS A;  2OQB A;  1UNR A;  2IYB A;  5J3T A;  1AQC A;  1MPH A;  2P0F A;  2HTH B;  3KY9 A;  1K5G B;  2AEH A;  2LYD A;  3ML4 A;  1WVH A;  3KRW A;  1Y19 B;  2Z0Q A;  3LJU X;  1U2B A;  4NSW A;  1I7A A;  1GC6 A;  2D9V A;  2GJY A;  1KZG A;  4GMV A;  1LW3 A;  2VRW B;  2HE7 A;  2R0D A;  1EGX A;  2DX1 A;  1DRO A;  1EVH A;  4GZU A;  2GCL A;  3VIA A;  4A6H A;  2E2X A;  4HAT B;  2AL6 A;  5JHG A;  4KHB B;  3A8P A;  1TXD A;  2X18 A;  5HE2 A;  2M38 A;  2DHI A;  1X11 A;  1RRP B;  1QQG A;  4HDO A;  2D9Z A;  3D8D A;  2I5F A;  3FSS A;  4CYE A;  5DHA B;  1V5M A;  1XX0 A;  2GS0 A;  3NSU A;  5C5B A;  4Z2N A;  2D2Q A;  4BBK A;  3HK0 A;  2I1K A;  3IVF A;  3PSC A;  1WJ1 A;  3ULB A;  2H7E A;  1XR0 B;  4F7G A;  2YVC A;  2N23 A;  4HAZ B;  2J0K A;  1M7E A;  2RNR B;  4K2O A;  3BIN A;  4TYZ A;  5DH9 B;  3GYP A;  1U5F A;  1MKE A;  2H7D A;  2DHJ A;  1WI1 A;  3PP2 A;  3OAN A;  2DA0 A;  2MWN B;  1XOD A;  1V5U A;  5EFX A;  3SYX A;  4XWX A;  4KHA A;  2FJL A;  5KQ4 A;  2RGN B;  3QBV B;  2LKO A;  4P7I A;  4F7U P;  2COD A;  3DXD A;  3FEH A;  2K2J A;  3MPX A;  3A98 B;  1FHW A;  5D3X A;  3P7Z A;  2MFQ A;  2CRF A;  4DBB A;  1UPR A;  3TO1 A;  1U29 A;  3DXC A;  4K81 A;  4GN1 A;  3V5W A;  2KUP A;  2EJ8 A;  2UVM A;  4KVG B;  1N3H A;  2D10 A;  2D9X A;  1WGU A;  2YS1 A;  1ZC4 B;  2BCJ A;  1GC7 A;  5JHH A;  1TQZ A;  4HAU B;  2OTX A;  3ODW A;  3T06 A;  3PZD A;  1Z87 A;  1FGZ A;  3BJI A;  3HW2 B;  4D0N B;  1MIZ B;  1UPQ A;  3A8Q A;  3ULC A;  5CLQ B;  4ZRJ A;  5KCV A;  5C6R A;  1J19 A;  1DYN A;  4ZRI A;  2DHK A;  1V89 A;  4CHJ A;  4A6F B;  2EC1 A;  4MT7 A;  3TW1 A;  2CY5 A;  1DDW A;  4KHO A;  2LG1 A;  1DBH A;  1NTV A;  1TJ6 A;  2NMB A;  1DDV A;  3ODO A;  3D8F A;  1DDM A;  3F0W A;  1W1D A;  5LON B;  4H8S A;  1XD4 A;  3PEG A;  1H4R A;  4HB2 B;  2LOZ A;  4HHV A;  3X23 A;  3TVV A;  4DX8 A;  2I5C A;  1P5T A;  2CAY A;  2EMS A;  1MK7 B;  1PFJ A;  4EKU A;  2COF A;  1V88 A;  2QKL A;  3GYO A;  1H10 A;  2GCJ A;  1U5D A;  2KCJ A;  3O96 A;  4K17 A;  2YT1 A;  3ODX A;  1EAZ A;  4HAY B;  2P8V A;  1X86 A;  3CXB B;  3FM8 C;  4A5K A;  2D9W A;  2Z0P A;  2XQN M;  2VKI A;  2DLW A;  4HAV B;  3TCA A;  1EF1 A;  2G35 A;  4GXB A;  1MAI A;  3F5R A;  2KGX B;  2MKR A;  5J3Q A;  3ZVR A;  2YS5 A;  3SUZ A;  2W2X D;  2YF0 A;  5JLJ B;  1FOE A;  1X1G A;  5D3V A;  4L6E A;  1P3R A;  5JP4 A;  2N0Y A;  1V5P A;  2Y8F A;  1LB1 A;  3DXE A;  4IOY X;  1SGH A;  3ZDT A;  2UZS A;  2LOX A;  4DXA B;  2M14 A;  2EMT A;  2DKQ A;  4IFS A;  2RSG A;  2LUL A;  2Y7B A;  4WSF A;  2UZR A;  2RLO A;  1K5D B;  2Z0O A;  5J3Y A;  4CHM A;  2K00 A;  1OMW A;  1QC6 A;  2RVB B;  3PG7 A;  5C5B B;  1ZC3 B;  5DHF B;  1P6S A;  2YT0 A;  2DTC A;  1X05 A;  3CIK A;  3AU5 A;  1UNP A;  4K2P A;  5LOP B;  1AWE A;  2ROV A;  1NU2 A;  2P0H A;  2NZ8 B;  4GPT B;  1M7R A;  1XCG A;  1J0W A;  1E5W A;  5KQ1 A;  2DFK A;  3D8E A;  3PVW A;  3MDB C;  1I2H A;  2D9Y A;  5CLL B;  3SO6 A;  1IRS A;  2R09 A;  4PQ0 A;  1BWN A;  2I1J A;  5FI1 A;  1MK9 B;  1UNQ A;  4WJ7 A;  5FI0 A;  2IFS A;  4PNK A;  1UEF A;  2YRY A;  3HQC A;  2YSZ A;  4HDQ A;  4ZRK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...