4HAWB

Crystal structure of crm1 inhibitor leptomycin b in complex with crm1(k548a)-ran-ranbp1
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
138
structure length
131
Chain Sequence
IHFEPVVKTMEEDEEVLYKVRAKLFRFDKDAKEWKERGTGDCKFLKNKKTNKVRILMRRDKTLKICANHIIAPEYTLKPNVGSDRSWVYACTADIAEGEAEAFTFAIRFGSKENADKFKEEFEKAQEINKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Nuclear export inhibition through covalent conjugation and hydrolysis of Leptomycin B by CRM1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport/antibiotic
molecule keywords GTP-binding nuclear protein Ran
total genus 36
structure length 131
sequence length 138
ec nomenclature
pdb deposition date 2012-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00638 Ran_BP1 RanBP1 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 4hawB00
2PZ1A 5C5BA 4ZRKA 3F5RA 2VSZA 5J3QA 1GG3A 4KAXB 2E2XA 3GYPA 2BCJA 5JHGA 4WVFB 3FEHA 1EF1A 1I2HA 3CXBB 4C0AA 3SUZA 2UVMA 1P5TA 3KZ1A 2N23A 2KGXB 2D9XA 1U5DA 1IRSA 3ODOA 1GC7A 4WSFA 1LB1A 1WGUA 2NZ8B 5LOPB 3A8PA 4K2OA 2L2IA 2W2XC 2CAYA 3OANA 1UNRA 1EVHA 1XCGA 1U29A 3PZDA 4HB0B 4GMVA 2FJLA 4HB2B 2DYQA 1ISNA 5D3YA 1BTNA 4TYZA 2RNRB 1ZC4B 1ZSQA 1XODA 3KRXA 2ELBA 2V76A 4K2PA 1WG7A 1J0WA 4HAZB 4CHMA 5JLJB 4GN1A 4IAPA 2X18A 2D9ZA 3SO6A 2Z0PA 1UPQA 4H8SA 2LYDA 4TKNA 1FHXA 3HW2B 3TO1A 4DXAB 5C6RA 2YS1A 3BINA 4DX8A 3CIKA 3V5WA 2HE7A 3BJIA 2Z0OA 2UZRA 2RUKB 2M14A 4EKUA 1NI2A 4KHBB 2YT1A 1DDWA 1AQCA 3N7CA 2GCLA 3F0WA 3KRWA 2QKLA 4HHVA 3SYXA 3NSUA 4NSWA 4EMOA 4DX90 2W2XD 4HAWB 3U8ZA 1OY2A 3TFMA 3TW1A 2P0FA 2P0DA 1N3HA 1LW3A 5J3YA 3LJUX 1H4RA 1XR0B 1Y5OA 1QC6A 1U5GA 4CYEA 2YT0A 2KCJA 1SHCA 1X11A 1FAOA 2OTXA 1Q67A 3AU5A 3PVLA 1MPHA 4HAUB 5JHHA 2L1CA 4HAVB 4K81A 3KY9A 3GYOA 4IFSA 5L81A 1KZ7A 2J59M 4XWXA 5D3VA 2ZPYA 3VIAA 1UEFA 1KZGA 1MK7B 4B6HA 2YVCA 3PP2A 4F7GA 3D8EA 5C79A 1PMSA 1MAIA 2D9VA 1P6SA 3D8DA 4KHAA 2Q13A 1UNPA 1OMWA 2DX5A 1GC6A 2YS3A 5C5BB 1V5MA 2YRYA 5D3XA 5HE2A 2IFSA 2Y8FA 4KHOA 1B55A 3MDBC 4HB4B 2DX1A 1TQZA 1ZC3B 1U5FA 3DXEA 3HQCA 3TVVA 4MT7A 2D2QA 4A6HA 2CRFA 2LULA 2NMBA 4A6FA 5HE3A 1ZVRA 1MIXA 3A98B 4WJ7A 1W1DA 3SNHA 4IOYX 2XQNM 1PLSA 2K00A 2QKMA 4K17A 3QBVB 5CLLB 2RLOA 1J19A 1E5WA 4F7UP 5GOWB 2J0MA 3PG7A 1FGZA 3T06A 2GCJA 4HAXB 2I1KA 5D27A 3ULCA 1AWEA 1NU2A 4Y94A 2LG1A 3VOQA 1TJ6A 2COAA 2J0JA 2DLWA 2UZSA 3AJ4A 2K2UA 3ZDTA 2K2JA 3ULBA 1MKEA 5FI0A 2HTHB 1BTKA 2AL6A 2DKQA 5LONB 3QIJA 5KQ1A 1X1GA 5D3WA 2YF0A 2RGNB 1UNQA 3D8FA 4MK0A 1WJMA 3KSYA 5DH9B 1OQNA 2G35A 1DROA 2Y7BA 1RJ2A 2COCA 2Y8GA 1DYNA 1K5DB 2CY5A 4GMXB 1X1FA 2ROVA 1DBHA 4EJNA 2DKPA 2DTCA 4HATB 3X23A 1ZM0A 1BAKA 2M38A 3FM8C 2I5CA 1X05A 4YONA 2IYBA 3P7ZA 3A8QA 4P7IA 1M7EA 1V89A 5EFXA 3O96A 3DXDA 5CLQB 4DBBA 2Z0QA 1WVHA 2I5FA 4HAYB 1V5UA 3RCPA 5KCVA 4YL8A 2RSGA 1W1GA 4NY0A 1U5EA 1WJ1A 4HDQA 2EC1A 4CHJA 1QQGA 1K5GB 2D9WA 3U7DA 4ZRIA 4KVGB 1NTVA 3SV1A 2ROZB 3TCAA 2VRWB 2VKIA 2D11A 2H7EA 2GJYA 3WYFB 3DXCA 2J0KA 2COFA 2CY4A 3P6AA 2MDXA 2MKRA 4ZRJA 5HE0A 4PNKA 1FHOA 3WA0A 2KUPA 1RRPB 5J3TA 4Z2NA 4GXBA 2R0DA 3AU4A 4L6EA 4A5KA 2ADZA 4BBKA 1FGYA 2DYNA 1XD4A 2D4QA 1DDVA 1Y19B 2GS0A 3PEGA 3QWMA 1XKEA 2MFQA 5DIFB 3M1IB 3PSCA 1Z87A 1I7AA 2DHKA 2YS5A 1MIZB 4A6KA 2DA0A 2H7DA 3G9WA 4D0NB 3ODXA 2CODA 3ZVRA 2ELAA 5DHAB 1V61A 1P3RA 4Z2MB 5KQ4A 1FOEA 2YSZA 4A6FB 1U2BA 1FB8A 1W1HA 1V5PA 1M7RA 2R09A 1U27A 2MWNB 3ODWA 5DI9B 2P0HA 1V88A 1EGXA 1EAZA 5JP4A 1FHWA 2DHIA 3HK0A 5DHFB 2JP2A 3PVUA 2EMSA 1XX0A 3ML4A 2LOXA 2OQBA 2RVBB 2LKOA 1H10A 1KI1B 4GZUA 2AEHA 1NTYA 2EJ8A 2EMTA 3IVFA 2DN6A 3PVWA 5HE1A 1PFJA 5C16A 3UZTA 4HB3B 1UPRA 4GPTB 1WI1A 1BWNA 1MK9B 1SGHA 2DFKA 1WGQA 4MY6A 2DHJA 4PQ0A 1TXDA 2N0YA 2W2WA 2D9YA 3MPXA 2P8VA 3FSSA 1DDMA 1X86A 2LOZA 5FI1A 4F7HA 2I1JA 4HDOA 2D10A
chains in the Genus database with same CATH superfamily
2PZ1A 5C5BA 4ZRKA 3F5RA 2VSZA 5J3QA 2KIGA 1GG3A 3NWAA 4KAXB 2E2XA 3GYPA 2BCJA 5JHGA 4WVFB 3FEHA 1EF1A 1I2HA 3CXBB 4C0AA 3SUZA 2UVMA 1P5TA 3KZ1A 2N23A 2KGXB 2YT2A 2D9XA 1U5DA 1IRSA 3ODOA 1GC7A 4WSFA 4L1RA 1LB1A 1WGUA 5I2SA 2NZ8B 5LOPB 3A8PA 4K2OA 2L2IA 2W2XC 2CAYA 3OANA 1UNRA 1EVHA 1XCGA 1U29A 2R2YA 3PZDA 4DIXA 4HB0B 4GMVA 2FJLA 4HB2B 2DYQA 1ISNA 4OT1A 5D3YA 1BTNA 4TYZA 2RNRB 1ZC4B 1ZSQA 1XODA 3KRXA 2ELBA 2V76A 4K2PA 1WG7A 1J0WA 4HAZB 4CHMA 5JLJB 4GN1A 4IAPA 2X18A 2D9ZA 3SO6A 2Z0PA 1UPQA 4H8SA 3B77A 2LYDA 4TKNA 1FHXA 3HW2B 3TO1A 4DXAB 5C6RA 2YS1A 3BINA 4DX8A 3CIKA 3V5WA 2HE7A 5M4YB 3BJIA 2Z0OA 2UZRA 2RUKB 2M14A 3DCXA 4EKUA 1NI2A 4KHBB 2YT1A 1DDWA 1AQCA 3N7CA 2GCLA 3F0WA 3KRWA 2QKLA 4HHVA 3SYXA 3NSUA 4NSWA 4EMOA 4DX90 2W2XD 5I2MA 4HAWB 3U8ZA 1OY2A 3TFMA 3TW1A 2P0FA 2P0DA 1N3HA 1LW3A 5J3YA 3LJUX 2Z4DA 1H4RA 1XR0B 1Y5OA 1QC6A 1U5GA 4CYEA 2YT0A 2KCJA 1SHCA 1X11A 1FAOA 2OTXA 1Q67A 3AU5A 3PVLA 1MPHA 4HAUB 4KHBA 3NWDA 2L1CA 4HAVB 4K81A 5JHHA 3KY9A 3GYOA 4IFSA 5L81A 1KZ7A 1T77A 2J59M 4XWXA 5D3VA 2ZPYA 3VIAA 1UEFA 1KZGA 1MK7B 4B6HA 2YVCA 2ZKMX 3HSAA 3PP2A 4F7GA 3D8EA 5C79A 1PMSA 1MAIA 2D9VA 1P6SA 3D8DA 4KHAA 2Q13A 1UNPA 1OMWA 2DX5A 1GC6A 2YS3A 5C5BB 1V5MA 2YRYA 5D3XA 5HE2A 2IFSA 2Y8FA 4KHOA 1B55A 3MDBC 3U12A 4HB4B 2DX1A 1TQZA 1ZC3B 1U5FA 3DXEA 3HQCA 3TVVA 4MT7A 2D2QA 4A6HA 2CRFA 2LULA 2NMBA 4A6FA 3OHMB 5HE3A 1ZVRA 1MIXA 3A98B 4WJ7A 1W1DA 3SNHA 4IOYX 2XQNM 1PLSA 2K00A 2QKMA 4K17A 3QBVB 5CLLB 2RLOA 1J19A 1E5WA 4F7UP 5GOWB 4QJ4B 2J0MA 3PG7A 1FGZA 2Z13A 3T06A 2GCJA 4HAXB 2I1KA 5D27A 3ULCA 3A58A 1AWEA 1NU2A 3HIEA 4Y94A 2LG1A 3VOQA 1TJ6A 2COAA 2J0JA 2DLWA 2UZSA 3AJ4A 2K2UA 2NBVA 3ZDTA 2K2JA 3ULBA 1MKEA 5FI0A 2HTHB 1BTKA 2AL6A 2DKQA 5LONB 3QIJA 2K49A 5KQ1A 1X1GA 5LG4B 5D3WA 2YF0A 2RGNB 1UNQA 3D8FA 4MK0A 4HSIA 1WJMA 3KSYA 5DH9B 1OQNA 2G35A 2Z14A 1DROA 2Y7BA 1RJ2A 2COCA 2Y8GA 1DYNA 1K5DB 2CY5A 3NWFA 4GMXB 1X1FA 2ROVA 1DBHA 4EJNA 2DKPA 2DTCA 4HATB 3X23A 1ZM0A 2KR0A 1BAKA 2M38A 3FM8C 2I5CA 1X05A 4YONA 2IYBA 3P7ZA 3NW8A 3A8QA 4P7IA 2GUMA 1M7EA 1V89A 5EFXA 3O96A 3DXDA 5CLQB 4DBBA 2Z0QA 1WVHA 2I5FA 2K8EA 4CSQA 4HAYB 1V5UA 3RCPA 5KCVA 4YL8A 2RSGA 1W1GA 4NY0A 4QXAB 1U5EA 1WJ1A 4HDQA 4OSNA 2EC1A 4QJ5B 5IRSA 4CHJA 1QQGA 1K5GB 2D9WA 3U7DA 4ZRIA 4KVGB 2KIEA 1NTVA 3SV1A 2ROZB 3TCAA 2VRWB 1MI1A 2VKIA 2RRFA 2D11A 4QJ3B 2H7EA 2GJYA 3WYFB 3DXCA 2J0KA 2COFA 2CY4A 3P6AA 2MDXA 2MKRA 4ZRJA 5HE0A 4PNKA 1FHOA 3WA0A 2KUPA 1RRPB 5J3TA 4Z2NA 4GXBA 2R0DA 3AU4A 4L6EA 4A5KA 2ADZA 4BBKA 1FGYA 2DYNA 1XD4A 2D4QA 1DDVA 1Y19B 2GS0A 3PEGA 3QWMA 1XKEA 2MFQA 5DIFB 4D6WA 3M1IB 3FVCA 3PSCA 1Z87A 1I7AA 2DHKA 2YS5A 1MIZB 4GOUA 4A6KA 2DA0A 2H7DA 3G9WA 4D0NB 3ODXA 2CODA 3ZVRA 1ZYIA 2ELAA 5DHAB 1V61A 1P3RA 4Z2MB 5KQ4A 1FOEA 2YSZA 4A6FB 1U2BA 1FB8A 1W1HA 1V5PA 2KUQA 1M7RA 2R09A 1U27A 2Z59A 2FJUB 2MWNB 3ODWA 5DI9B 2P0HA 1V88A 1EGXA 1EAZA 5JP4A 1FHWA 2DHIA 3HK0A 5DHFB 2JP2A 3PVUA 2EMSA 1XX0A 3ML4A 2LOXA 2OQBA 2RVBB 2LKOA 1H10A 1KI1B 4GZUA 2AEHA 1NTYA 4GNKB 2EJ8A 2EMTA 3IVFA 2DN6A 3PVWA 5HE1A 1PFJA 5C16A 3UZTA 4HB3B 1UPRA 4GPTB 1WI1A 1BWNA 1MK9B 1SGHA 2DFKA 1WGQA 4MY6A 2DHJA 4PQ0A 1TXDA 2N0YA 2W2WA 2D9YA 3MPXA 2P8VA 3FSSA 1DDMA 1X86A 2LOZA 5FI1A 4F7HA 2I1JA 4HDOA 2D10A
chains in the Genus database with same CATH topology
2PZ1A 5C5BA 4ZRKA 3F5RA 2VSZA 5J3QA 1GG3A 4KAXB 2E2XA 3GYPA 2BCJA 5JHGA 4WVFB 3FEHA 1EF1A 1I2HA 3CXBB 4C0AA 3SUZA 2UVMA 1P5TA 3KZ1A 2N23A 2KGXB 2D9XA 1U5DA 1IRSA 3ODOA 1GC7A 4WSFA 1LB1A 1WGUA 2NZ8B 5LOPB 3A8PA 4K2OA 2L2IA 2W2XC 2CAYA 3OANA 1UNRA 1EVHA 1XCGA 1U29A 3PZDA 4HB0B 4GMVA 2FJLA 4HB2B 2DYQA 1ISNA 5D3YA 1BTNA 4TYZA 2RNRB 1ZC4B 1ZSQA 1XODA 3KRXA 2ELBA 2V76A 4K2PA 1WG7A 1J0WA 4HAZB 4CHMA 5JLJB 4GN1A 4IAPA 2X18A 2D9ZA 3SO6A 2Z0PA 1UPQA 4H8SA 2LYDA 4TKNA 1FHXA 3HW2B 3TO1A 4DXAB 5C6RA 2YS1A 3BINA 4DX8A 3CIKA 3V5WA 2HE7A 3BJIA 2Z0OA 2UZRA 2RUKB 2M14A 4EKUA 1NI2A 4KHBB 2YT1A 1DDWA 1AQCA 3N7CA 2GCLA 3F0WA 3KRWA 2QKLA 4HHVA 3SYXA 3NSUA 4NSWA 4EMOA 4DX90 2W2XD 4HAWB 3U8ZA 1OY2A 3TFMA 3TW1A 2P0FA 2P0DA 1N3HA 1LW3A 5J3YA 3LJUX 1H4RA 1XR0B 1Y5OA 1QC6A 1U5GA 4CYEA 2YT0A 2KCJA 1SHCA 1X11A 1FAOA 2OTXA 1Q67A 3AU5A 3PVLA 1MPHA 4HAUB 5JHHA 2L1CA 4HAVB 4K81A 3KY9A 3GYOA 4IFSA 5L81A 1KZ7A 2J59M 4XWXA 5D3VA 2ZPYA 3VIAA 1UEFA 1KZGA 1MK7B 4B6HA 2YVCA 3PP2A 4F7GA 3D8EA 5C79A 1PMSA 1MAIA 2D9VA 1P6SA 3D8DA 4KHAA 2Q13A 1UNPA 1OMWA 2DX5A 1GC6A 2YS3A 5C5BB 1V5MA 2YRYA 5D3XA 5HE2A 2IFSA 2Y8FA 4KHOA 1B55A 3MDBC 4HB4B 2DX1A 1TQZA 1ZC3B 1U5FA 3DXEA 3HQCA 3TVVA 4MT7A 2D2QA 4A6HA 2CRFA 2LULA 2NMBA 4A6FA 5HE3A 1ZVRA 1MIXA 3A98B 4WJ7A 1W1DA 3SNHA 4IOYX 2XQNM 1PLSA 2K00A 2QKMA 4K17A 3QBVB 5CLLB 2RLOA 1J19A 1E5WA 4F7UP 5GOWB 2J0MA 3PG7A 1FGZA 3T06A 2GCJA 4HAXB 2I1KA 5D27A 3ULCA 1AWEA 1NU2A 4Y94A 2LG1A 3VOQA 1TJ6A 2COAA 2J0JA 2DLWA 2UZSA 3AJ4A 2K2UA 3ZDTA 2K2JA 3ULBA 1MKEA 5FI0A 2HTHB 1BTKA 2AL6A 2DKQA 5LONB 3QIJA 5KQ1A 1X1GA 5D3WA 2YF0A 2RGNB 1UNQA 3D8FA 4MK0A 1WJMA 3KSYA 5DH9B 1OQNA 2G35A 1DROA 2Y7BA 1RJ2A 2COCA 2Y8GA 1DYNA 1K5DB 2CY5A 4GMXB 1X1FA 2ROVA 1DBHA 4EJNA 2DKPA 2DTCA 4HATB 3X23A 1ZM0A 1BAKA 2M38A 3FM8C 2I5CA 1X05A 4YONA 2IYBA 3P7ZA 3A8QA 4P7IA 1M7EA 1V89A 5EFXA 3O96A 3DXDA 5CLQB 4DBBA 2Z0QA 1WVHA 2I5FA 4HAYB 1V5UA 3RCPA 5KCVA 4YL8A 2RSGA 1W1GA 4NY0A 1U5EA 1WJ1A 4HDQA 2EC1A 4CHJA 1QQGA 1K5GB 2D9WA 3U7DA 4ZRIA 4KVGB 1NTVA 3SV1A 2ROZB 3TCAA 2VRWB 2VKIA 2D11A 2H7EA 2GJYA 3WYFB 3DXCA 2J0KA 2COFA 2CY4A 3P6AA 2MDXA 2MKRA 4ZRJA 5HE0A 4PNKA 1FHOA 3WA0A 2KUPA 1RRPB 5J3TA 4Z2NA 4GXBA 2R0DA 3AU4A 4L6EA 4A5KA 2ADZA 4BBKA 1FGYA 2DYNA 1XD4A 2D4QA 1DDVA 1Y19B 2GS0A 3PEGA 3QWMA 1XKEA 2MFQA 5DIFB 3M1IB 3PSCA 1Z87A 1I7AA 2DHKA 2YS5A 1MIZB 4A6KA 2DA0A 2H7DA 3G9WA 4D0NB 3ODXA 2CODA 3ZVRA 2ELAA 5DHAB 1V61A 1P3RA 4Z2MB 5KQ4A 1FOEA 2YSZA 4A6FB 1U2BA 1FB8A 1W1HA 1V5PA 1M7RA 2R09A 1U27A 2MWNB 3ODWA 5DI9B 2P0HA 1V88A 1EGXA 1EAZA 5JP4A 1FHWA 2DHIA 3HK0A 5DHFB 2JP2A 3PVUA 2EMSA 1XX0A 3ML4A 2LOXA 2OQBA 2RVBB 2LKOA 1H10A 1KI1B 4GZUA 2AEHA 1NTYA 2EJ8A 2EMTA 3IVFA 2DN6A 3PVWA 5HE1A 1PFJA 5C16A 3UZTA 4HB3B 1UPRA 4GPTB 1WI1A 1BWNA 1MK9B 1SGHA 2DFKA 1WGQA 4MY6A 2DHJA 4PQ0A 1TXDA 2N0YA 2W2WA 2D9YA 3MPXA 2P8VA 3FSSA 1DDMA 1X86A 2LOZA 5FI1A 4F7HA 2I1JA 4HDOA 2D10A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PZ1 A;  5C5B A;  4ZRK A;  3F5R A;  2VSZ A;  5J3Q A;  1GG3 A;  4KAX B;  2E2X A;  3GYP A;  2BCJ A;  5JHG A;  4WVF B;  3FEH A;  1EF1 A;  1I2H A;  3CXB B;  4C0A A;  3SUZ A;  2UVM A;  1P5T A;  3KZ1 A;  2N23 A;  2KGX B;  2D9X A;  1U5D A;  1IRS A;  3ODO A;  1GC7 A;  4WSF A;  1LB1 A;  1WGU A;  2NZ8 B;  5LOP B;  3A8P A;  4K2O A;  2L2I A;  2W2X C;  2CAY A;  3OAN A;  1UNR A;  1EVH A;  1XCG A;  1U29 A;  3PZD A;  4HB0 B;  4GMV A;  2FJL A;  4HB2 B;  2DYQ A;  1ISN A;  5D3Y A;  1BTN A;  4TYZ A;  2RNR B;  1ZC4 B;  1ZSQ A;  1XOD A;  3KRX A;  2ELB A;  2V76 A;  4K2P A;  1WG7 A;  1J0W A;  4HAZ B;  4CHM A;  5JLJ B;  4GN1 A;  4IAP A;  2X18 A;  2D9Z A;  3SO6 A;  2Z0P A;  1UPQ A;  4H8S A;  2LYD A;  4TKN A;  1FHX A;  3HW2 B;  3TO1 A;  4DXA B;  5C6R A;  2YS1 A;  3BIN A;  4DX8 A;  3CIK A;  3V5W A;  2HE7 A;  3BJI A;  2Z0O A;  2UZR A;  2RUK B;  2M14 A;  4EKU A;  1NI2 A;  4KHB B;  2YT1 A;  1DDW A;  1AQC A;  3N7C A;  2GCL A;  3F0W A;  3KRW A;  2QKL A;  4HHV A;  3SYX A;  3NSU A;  4NSW A;  4EMO A;  4DX9 0;  2W2X D;  4HAW B;  3U8Z A;  1OY2 A;  3TFM A;  3TW1 A;  2P0F A;  2P0D A;  1N3H A;  1LW3 A;  5J3Y A;  3LJU X;  1H4R A;  1XR0 B;  1Y5O A;  1QC6 A;  1U5G A;  4CYE A;  2YT0 A;  2KCJ A;  1SHC A;  1X11 A;  1FAO A;  2OTX A;  1Q67 A;  3AU5 A;  3PVL A;  1MPH A;  4HAU B;  5JHH A;  2L1C A;  4HAV B;  4K81 A;  3KY9 A;  3GYO A;  4IFS A;  5L81 A;  1KZ7 A;  2J59 M;  4XWX A;  5D3V A;  2ZPY A;  3VIA A;  1UEF A;  1KZG A;  1MK7 B;  4B6H A;  2YVC A;  3PP2 A;  4F7G A;  3D8E A;  5C79 A;  1PMS A;  1MAI A;  2D9V A;  1P6S A;  3D8D A;  4KHA A;  2Q13 A;  1UNP A;  1OMW A;  2DX5 A;  1GC6 A;  2YS3 A;  5C5B B;  1V5M A;  2YRY A;  5D3X A;  5HE2 A;  2IFS A;  2Y8F A;  4KHO A;  1B55 A;  3MDB C;  4HB4 B;  2DX1 A;  1TQZ A;  1ZC3 B;  1U5F A;  3DXE A;  3HQC A;  3TVV A;  4MT7 A;  2D2Q A;  4A6H A;  2CRF A;  2LUL A;  2NMB A;  4A6F A;  5HE3 A;  1ZVR A;  1MIX A;  3A98 B;  4WJ7 A;  1W1D A;  3SNH A;  4IOY X;  2XQN M;  1PLS A;  2K00 A;  2QKM A;  4K17 A;  3QBV B;  5CLL B;  2RLO A;  1J19 A;  1E5W A;  4F7U P;  5GOW B;  2J0M A;  3PG7 A;  1FGZ A;  3T06 A;  2GCJ A;  4HAX B;  2I1K A;  5D27 A;  3ULC A;  1AWE A;  1NU2 A;  4Y94 A;  2LG1 A;  3VOQ A;  1TJ6 A;  2COA A;  2J0J A;  2DLW A;  2UZS A;  3AJ4 A;  2K2U A;  3ZDT A;  2K2J A;  3ULB A;  1MKE A;  5FI0 A;  2HTH B;  1BTK A;  2AL6 A;  2DKQ A;  5LON B;  3QIJ A;  5KQ1 A;  1X1G A;  5D3W A;  2YF0 A;  2RGN B;  1UNQ A;  3D8F A;  4MK0 A;  1WJM A;  3KSY A;  5DH9 B;  1OQN A;  2G35 A;  1DRO A;  2Y7B A;  1RJ2 A;  2COC A;  2Y8G A;  1DYN A;  1K5D B;  2CY5 A;  4GMX B;  1X1F A;  2ROV A;  1DBH A;  4EJN A;  2DKP A;  2DTC A;  4HAT B;  3X23 A;  1ZM0 A;  1BAK A;  2M38 A;  3FM8 C;  2I5C A;  1X05 A;  4YON A;  2IYB A;  3P7Z A;  3A8Q A;  4P7I A;  1M7E A;  1V89 A;  5EFX A;  3O96 A;  3DXD A;  5CLQ B;  4DBB A;  2Z0Q A;  1WVH A;  2I5F A;  4HAY B;  1V5U A;  3RCP A;  5KCV A;  4YL8 A;  2RSG A;  1W1G A;  4NY0 A;  1U5E A;  1WJ1 A;  4HDQ A;  2EC1 A;  4CHJ A;  1QQG A;  1K5G B;  2D9W A;  3U7D A;  4ZRI A;  4KVG B;  1NTV A;  3SV1 A;  2ROZ B;  3TCA A;  2VRW B;  2VKI A;  2D11 A;  2H7E A;  2GJY A;  3WYF B;  3DXC A;  2J0K A;  2COF A;  2CY4 A;  3P6A A;  2MDX A;  2MKR A;  4ZRJ A;  5HE0 A;  4PNK A;  1FHO A;  3WA0 A;  2KUP A;  1RRP B;  5J3T A;  4Z2N A;  4GXB A;  2R0D A;  3AU4 A;  4L6E A;  4A5K A;  2ADZ A;  4BBK A;  1FGY A;  2DYN A;  1XD4 A;  2D4Q A;  1DDV A;  1Y19 B;  2GS0 A;  3PEG A;  3QWM A;  1XKE A;  2MFQ A;  5DIF B;  3M1I B;  3PSC A;  1Z87 A;  1I7A A;  2DHK A;  2YS5 A;  1MIZ B;  4A6K A;  2DA0 A;  2H7D A;  3G9W A;  4D0N B;  3ODX A;  2COD A;  3ZVR A;  2ELA A;  5DHA B;  1V61 A;  1P3R A;  4Z2M B;  5KQ4 A;  1FOE A;  2YSZ A;  4A6F B;  1U2B A;  1FB8 A;  1W1H A;  1V5P A;  1M7R A;  2R09 A;  1U27 A;  2MWN B;  3ODW A;  5DI9 B;  2P0H A;  1V88 A;  1EGX A;  1EAZ A;  5JP4 A;  1FHW A;  2DHI A;  3HK0 A;  5DHF B;  2JP2 A;  3PVU A;  2EMS A;  1XX0 A;  3ML4 A;  2LOX A;  2OQB A;  2RVB B;  2LKO A;  1H10 A;  1KI1 B;  4GZU A;  2AEH A;  1NTY A;  2EJ8 A;  2EMT A;  3IVF A;  2DN6 A;  3PVW A;  5HE1 A;  1PFJ A;  5C16 A;  3UZT A;  4HB3 B;  1UPR A;  4GPT B;  1WI1 A;  1BWN A;  1MK9 B;  1SGH A;  2DFK A;  1WGQ A;  4MY6 A;  2DHJ A;  4PQ0 A;  1TXD A;  2N0Y A;  2W2W A;  2D9Y A;  3MPX A;  2P8V A;  3FSS A;  1DDM A;  1X86 A;  2LOZ A;  5FI1 A;  4F7H A;  2I1J A;  4HDO A;  2D10 A; 
#chains in the Genus database with same CATH topology
 2PZ1 A;  5C5B A;  4ZRK A;  3F5R A;  2VSZ A;  5J3Q A;  2KIG A;  1GG3 A;  3NWA A;  4KAX B;  2E2X A;  3GYP A;  2BCJ A;  5JHG A;  4WVF B;  3FEH A;  1EF1 A;  1I2H A;  3CXB B;  4C0A A;  3SUZ A;  2UVM A;  1P5T A;  3KZ1 A;  2N23 A;  2KGX B;  2YT2 A;  2D9X A;  1U5D A;  1IRS A;  3ODO A;  1GC7 A;  4WSF A;  4L1R A;  1LB1 A;  1WGU A;  5I2S A;  2NZ8 B;  5LOP B;  3A8P A;  4K2O A;  2L2I A;  2W2X C;  2CAY A;  3OAN A;  1UNR A;  1EVH A;  1XCG A;  1U29 A;  2R2Y A;  3PZD A;  4DIX A;  4HB0 B;  4GMV A;  2FJL A;  4HB2 B;  2DYQ A;  1ISN A;  4OT1 A;  5D3Y A;  1BTN A;  4TYZ A;  2RNR B;  1ZC4 B;  1ZSQ A;  1XOD A;  3KRX A;  2ELB A;  2V76 A;  4K2P A;  1WG7 A;  1J0W A;  4HAZ B;  4CHM A;  5JLJ B;  4GN1 A;  4IAP A;  2X18 A;  2D9Z A;  3SO6 A;  2Z0P A;  1UPQ A;  4H8S A;  3B77 A;  2LYD A;  4TKN A;  1FHX A;  3HW2 B;  3TO1 A;  4DXA B;  5C6R A;  2YS1 A;  3BIN A;  4DX8 A;  3CIK A;  3V5W A;  2HE7 A;  5M4Y B;  3BJI A;  2Z0O A;  2UZR A;  2RUK B;  2M14 A;  3DCX A;  4EKU A;  1NI2 A;  4KHB B;  2YT1 A;  1DDW A;  1AQC A;  3N7C A;  2GCL A;  3F0W A;  3KRW A;  2QKL A;  4HHV A;  3SYX A;  3NSU A;  4NSW A;  4EMO A;  4DX9 0;  2W2X D;  5I2M A;  4HAW B;  3U8Z A;  1OY2 A;  3TFM A;  3TW1 A;  2P0F A;  2P0D A;  1N3H A;  1LW3 A;  5J3Y A;  3LJU X;  2Z4D A;  1H4R A;  1XR0 B;  1Y5O A;  1QC6 A;  1U5G A;  4CYE A;  2YT0 A;  2KCJ A;  1SHC A;  1X11 A;  1FAO A;  2OTX A;  1Q67 A;  3AU5 A;  3PVL A;  1MPH A;  4HAU B;  4KHB A;  3NWD A;  2L1C A;  4HAV B;  4K81 A;  5JHH A;  3KY9 A;  3GYO A;  4IFS A;  5L81 A;  1KZ7 A;  1T77 A;  2J59 M;  4XWX A;  5D3V A;  2ZPY A;  3VIA A;  1UEF A;  1KZG A;  1MK7 B;  4B6H A;  2YVC A;  2ZKM X;  3HSA A;  3PP2 A;  4F7G A;  3D8E A;  5C79 A;  1PMS A;  1MAI A;  2D9V A;  1P6S A;  3D8D A;  4KHA A;  2Q13 A;  1UNP A;  1OMW A;  2DX5 A;  1GC6 A;  2YS3 A;  5C5B B;  1V5M A;  2YRY A;  5D3X A;  5HE2 A;  2IFS A;  2Y8F A;  4KHO A;  1B55 A;  3MDB C;  3U12 A;  4HB4 B;  2DX1 A;  1TQZ A;  1ZC3 B;  1U5F A;  3DXE A;  3HQC A;  3TVV A;  4MT7 A;  2D2Q A;  4A6H A;  2CRF A;  2LUL A;  2NMB A;  4A6F A;  3OHM B;  5HE3 A;  1ZVR A;  1MIX A;  3A98 B;  4WJ7 A;  1W1D A;  3SNH A;  4IOY X;  2XQN M;  1PLS A;  2K00 A;  2QKM A;  4K17 A;  3QBV B;  5CLL B;  2RLO A;  1J19 A;  1E5W A;  4F7U P;  5GOW B;  4QJ4 B;  2J0M A;  3PG7 A;  1FGZ A;  2Z13 A;  3T06 A;  2GCJ A;  4HAX B;  2I1K A;  5D27 A;  3ULC A;  3A58 A;  1AWE A;  1NU2 A;  3HIE A;  4Y94 A;  2LG1 A;  3VOQ A;  1TJ6 A;  2COA A;  2J0J A;  2DLW A;  2UZS A;  3AJ4 A;  2K2U A;  2NBV A;  3ZDT A;  2K2J A;  3ULB A;  1MKE A;  5FI0 A;  2HTH B;  1BTK A;  2AL6 A;  2DKQ A;  5LON B;  3QIJ A;  2K49 A;  5KQ1 A;  1X1G A;  5LG4 B;  5D3W A;  2YF0 A;  2RGN B;  1UNQ A;  3D8F A;  4MK0 A;  4HSI A;  1WJM A;  3KSY A;  5DH9 B;  1OQN A;  2G35 A;  2Z14 A;  1DRO A;  2Y7B A;  1RJ2 A;  2COC A;  2Y8G A;  1DYN A;  1K5D B;  2CY5 A;  3NWF A;  4GMX B;  1X1F A;  2ROV A;  1DBH A;  4EJN A;  2DKP A;  2DTC A;  4HAT B;  3X23 A;  1ZM0 A;  2KR0 A;  1BAK A;  2M38 A;  3FM8 C;  2I5C A;  1X05 A;  4YON A;  2IYB A;  3P7Z A;  3NW8 A;  3A8Q A;  4P7I A;  2GUM A;  1M7E A;  1V89 A;  5EFX A;  3O96 A;  3DXD A;  5CLQ B;  4DBB A;  2Z0Q A;  1WVH A;  2I5F A;  2K8E A;  4CSQ A;  4HAY B;  1V5U A;  3RCP A;  5KCV A;  4YL8 A;  2RSG A;  1W1G A;  4NY0 A;  4QXA B;  1U5E A;  1WJ1 A;  4HDQ A;  4OSN A;  2EC1 A;  4QJ5 B;  5IRS A;  4CHJ A;  1QQG A;  1K5G B;  2D9W A;  3U7D A;  4ZRI A;  4KVG B;  2KIE A;  1NTV A;  3SV1 A;  2ROZ B;  3TCA A;  2VRW B;  1MI1 A;  2VKI A;  2RRF A;  2D11 A;  4QJ3 B;  2H7E A;  2GJY A;  3WYF B;  3DXC A;  2J0K A;  2COF A;  2CY4 A;  3P6A A;  2MDX A;  2MKR A;  4ZRJ A;  5HE0 A;  4PNK A;  1FHO A;  3WA0 A;  2KUP A;  1RRP B;  5J3T A;  4Z2N A;  4GXB A;  2R0D A;  3AU4 A;  4L6E A;  4A5K A;  2ADZ A;  4BBK A;  1FGY A;  2DYN A;  1XD4 A;  2D4Q A;  1DDV A;  1Y19 B;  2GS0 A;  3PEG A;  3QWM A;  1XKE A;  2MFQ A;  5DIF B;  4D6W A;  3M1I B;  3FVC A;  3PSC A;  1Z87 A;  1I7A A;  2DHK A;  2YS5 A;  1MIZ B;  4GOU A;  4A6K A;  2DA0 A;  2H7D A;  3G9W A;  4D0N B;  3ODX A;  2COD A;  3ZVR A;  1ZYI A;  2ELA A;  5DHA B;  1V61 A;  1P3R A;  4Z2M B;  5KQ4 A;  1FOE A;  2YSZ A;  4A6F B;  1U2B A;  1FB8 A;  1W1H A;  1V5P A;  2KUQ A;  1M7R A;  2R09 A;  1U27 A;  2Z59 A;  2FJU B;  2MWN B;  3ODW A;  5DI9 B;  2P0H A;  1V88 A;  1EGX A;  1EAZ A;  5JP4 A;  1FHW A;  2DHI A;  3HK0 A;  5DHF B;  2JP2 A;  3PVU A;  2EMS A;  1XX0 A;  3ML4 A;  2LOX A;  2OQB A;  2RVB B;  2LKO A;  1H10 A;  1KI1 B;  4GZU A;  2AEH A;  1NTY A;  4GNK B;  2EJ8 A;  2EMT A;  3IVF A;  2DN6 A;  3PVW A;  5HE1 A;  1PFJ A;  5C16 A;  3UZT A;  4HB3 B;  1UPR A;  4GPT B;  1WI1 A;  1BWN A;  1MK9 B;  1SGH A;  2DFK A;  1WGQ A;  4MY6 A;  2DHJ A;  4PQ0 A;  1TXD A;  2N0Y A;  2W2W A;  2D9Y A;  3MPX A;  2P8V A;  3FSS A;  1DDM A;  1X86 A;  2LOZ A;  5FI1 A;  4F7H A;  2I1J A;  4HDO A;  2D10 A; 
#chains in the Genus database with same CATH homology
 2PZ1 A;  5C5B A;  4ZRK A;  3F5R A;  2VSZ A;  5J3Q A;  1GG3 A;  4KAX B;  2E2X A;  3GYP A;  2BCJ A;  5JHG A;  4WVF B;  3FEH A;  1EF1 A;  1I2H A;  3CXB B;  4C0A A;  3SUZ A;  2UVM A;  1P5T A;  3KZ1 A;  2N23 A;  2KGX B;  2D9X A;  1U5D A;  1IRS A;  3ODO A;  1GC7 A;  4WSF A;  1LB1 A;  1WGU A;  2NZ8 B;  5LOP B;  3A8P A;  4K2O A;  2L2I A;  2W2X C;  2CAY A;  3OAN A;  1UNR A;  1EVH A;  1XCG A;  1U29 A;  3PZD A;  4HB0 B;  4GMV A;  2FJL A;  4HB2 B;  2DYQ A;  1ISN A;  5D3Y A;  1BTN A;  4TYZ A;  2RNR B;  1ZC4 B;  1ZSQ A;  1XOD A;  3KRX A;  2ELB A;  2V76 A;  4K2P A;  1WG7 A;  1J0W A;  4HAZ B;  4CHM A;  5JLJ B;  4GN1 A;  4IAP A;  2X18 A;  2D9Z A;  3SO6 A;  2Z0P A;  1UPQ A;  4H8S A;  2LYD A;  4TKN A;  1FHX A;  3HW2 B;  3TO1 A;  4DXA B;  5C6R A;  2YS1 A;  3BIN A;  4DX8 A;  3CIK A;  3V5W A;  2HE7 A;  3BJI A;  2Z0O A;  2UZR A;  2RUK B;  2M14 A;  4EKU A;  1NI2 A;  4KHB B;  2YT1 A;  1DDW A;  1AQC A;  3N7C A;  2GCL A;  3F0W A;  3KRW A;  2QKL A;  4HHV A;  3SYX A;  3NSU A;  4NSW A;  4EMO A;  4DX9 0;  2W2X D;  4HAW B;  3U8Z A;  1OY2 A;  3TFM A;  3TW1 A;  2P0F A;  2P0D A;  1N3H A;  1LW3 A;  5J3Y A;  3LJU X;  1H4R A;  1XR0 B;  1Y5O A;  1QC6 A;  1U5G A;  4CYE A;  2YT0 A;  2KCJ A;  1SHC A;  1X11 A;  1FAO A;  2OTX A;  1Q67 A;  3AU5 A;  3PVL A;  1MPH A;  4HAU B;  5JHH A;  2L1C A;  4HAV B;  4K81 A;  3KY9 A;  3GYO A;  4IFS A;  5L81 A;  1KZ7 A;  2J59 M;  4XWX A;  5D3V A;  2ZPY A;  3VIA A;  1UEF A;  1KZG A;  1MK7 B;  4B6H A;  2YVC A;  3PP2 A;  4F7G A;  3D8E A;  5C79 A;  1PMS A;  1MAI A;  2D9V A;  1P6S A;  3D8D A;  4KHA A;  2Q13 A;  1UNP A;  1OMW A;  2DX5 A;  1GC6 A;  2YS3 A;  5C5B B;  1V5M A;  2YRY A;  5D3X A;  5HE2 A;  2IFS A;  2Y8F A;  4KHO A;  1B55 A;  3MDB C;  4HB4 B;  2DX1 A;  1TQZ A;  1ZC3 B;  1U5F A;  3DXE A;  3HQC A;  3TVV A;  4MT7 A;  2D2Q A;  4A6H A;  2CRF A;  2LUL A;  2NMB A;  4A6F A;  5HE3 A;  1ZVR A;  1MIX A;  3A98 B;  4WJ7 A;  1W1D A;  3SNH A;  4IOY X;  2XQN M;  1PLS A;  2K00 A;  2QKM A;  4K17 A;  3QBV B;  5CLL B;  2RLO A;  1J19 A;  1E5W A;  4F7U P;  5GOW B;  2J0M A;  3PG7 A;  1FGZ A;  3T06 A;  2GCJ A;  4HAX B;  2I1K A;  5D27 A;  3ULC A;  1AWE A;  1NU2 A;  4Y94 A;  2LG1 A;  3VOQ A;  1TJ6 A;  2COA A;  2J0J A;  2DLW A;  2UZS A;  3AJ4 A;  2K2U A;  3ZDT A;  2K2J A;  3ULB A;  1MKE A;  5FI0 A;  2HTH B;  1BTK A;  2AL6 A;  2DKQ A;  5LON B;  3QIJ A;  5KQ1 A;  1X1G A;  5D3W A;  2YF0 A;  2RGN B;  1UNQ A;  3D8F A;  4MK0 A;  1WJM A;  3KSY A;  5DH9 B;  1OQN A;  2G35 A;  1DRO A;  2Y7B A;  1RJ2 A;  2COC A;  2Y8G A;  1DYN A;  1K5D B;  2CY5 A;  4GMX B;  1X1F A;  2ROV A;  1DBH A;  4EJN A;  2DKP A;  2DTC A;  4HAT B;  3X23 A;  1ZM0 A;  1BAK A;  2M38 A;  3FM8 C;  2I5C A;  1X05 A;  4YON A;  2IYB A;  3P7Z A;  3A8Q A;  4P7I A;  1M7E A;  1V89 A;  5EFX A;  3O96 A;  3DXD A;  5CLQ B;  4DBB A;  2Z0Q A;  1WVH A;  2I5F A;  4HAY B;  1V5U A;  3RCP A;  5KCV A;  4YL8 A;  2RSG A;  1W1G A;  4NY0 A;  1U5E A;  1WJ1 A;  4HDQ A;  2EC1 A;  4CHJ A;  1QQG A;  1K5G B;  2D9W A;  3U7D A;  4ZRI A;  4KVG B;  1NTV A;  3SV1 A;  2ROZ B;  3TCA A;  2VRW B;  2VKI A;  2D11 A;  2H7E A;  2GJY A;  3WYF B;  3DXC A;  2J0K A;  2COF A;  2CY4 A;  3P6A A;  2MDX A;  2MKR A;  4ZRJ A;  5HE0 A;  4PNK A;  1FHO A;  3WA0 A;  2KUP A;  1RRP B;  5J3T A;  4Z2N A;  4GXB A;  2R0D A;  3AU4 A;  4L6E A;  4A5K A;  2ADZ A;  4BBK A;  1FGY A;  2DYN A;  1XD4 A;  2D4Q A;  1DDV A;  1Y19 B;  2GS0 A;  3PEG A;  3QWM A;  1XKE A;  2MFQ A;  5DIF B;  3M1I B;  3PSC A;  1Z87 A;  1I7A A;  2DHK A;  2YS5 A;  1MIZ B;  4A6K A;  2DA0 A;  2H7D A;  3G9W A;  4D0N B;  3ODX A;  2COD A;  3ZVR A;  2ELA A;  5DHA B;  1V61 A;  1P3R A;  4Z2M B;  5KQ4 A;  1FOE A;  2YSZ A;  4A6F B;  1U2B A;  1FB8 A;  1W1H A;  1V5P A;  1M7R A;  2R09 A;  1U27 A;  2MWN B;  3ODW A;  5DI9 B;  2P0H A;  1V88 A;  1EGX A;  1EAZ A;  5JP4 A;  1FHW A;  2DHI A;  3HK0 A;  5DHF B;  2JP2 A;  3PVU A;  2EMS A;  1XX0 A;  3ML4 A;  2LOX A;  2OQB A;  2RVB B;  2LKO A;  1H10 A;  1KI1 B;  4GZU A;  2AEH A;  1NTY A;  2EJ8 A;  2EMT A;  3IVF A;  2DN6 A;  3PVW A;  5HE1 A;  1PFJ A;  5C16 A;  3UZT A;  4HB3 B;  1UPR A;  4GPT B;  1WI1 A;  1BWN A;  1MK9 B;  1SGH A;  2DFK A;  1WGQ A;  4MY6 A;  2DHJ A;  4PQ0 A;  1TXD A;  2N0Y A;  2W2W A;  2D9Y A;  3MPX A;  2P8V A;  3FSS A;  1DDM A;  1X86 A;  2LOZ A;  5FI1 A;  4F7H A;  2I1J A;  4HDO A;  2D10 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...