4HAWB

Crystal structure of crm1 inhibitor leptomycin b in complex with crm1(k548a)-ran-ranbp1
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
138
structure length
131
Chain Sequence
IHFEPVVKTMEEDEEVLYKVRAKLFRFDKDAKEWKERGTGDCKFLKNKKTNKVRILMRRDKTLKICANHIIAPEYTLKPNVGSDRSWVYACTADIAEGEAEAFTFAIRFGSKENADKFKEEFEKAQEINKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Nuclear export inhibition through covalent conjugation and hydrolysis of Leptomycin B by CRM1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport/antibiotic
molecule keywords GTP-binding nuclear protein Ran
total genus 36
structure length 131
sequence length 138
ec nomenclature
pdb deposition date 2012-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00638 Ran_BP1 RanBP1 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 4hawB00
3PVUA 2W2WA 4YONA 2G35A 1Y19B 2DYNA 2MWNB 1RRPB 2CY4A 1DYNA 1UPQA 3X23A 5DHAB 3TFMA 3LJUX 3HK0A 3OANA 4HDQA 2ZPYA 1FB8A 2R09A 4Z2NA 2RVBB 5LOPB 1BAKA 1U2BA 1WI1A 1TQZA 3A98B 1X86A 3N7CA 4DX8A 5KQ1A 4WJ7A 4DX90 1WJMA 5CLLB 4HAUB 1X1GA 1DDVA 3V5WA 2ELBA 5HE3A 3ODWA 1J19A 3SYXA 3HQCA 3TVVA 2EC1A 3D8EA 1TJ6A 2DX5A 1EF1A 3UZTA 3MPXA 1K5DB 1U5FA 5JP4A 3SUZA 1ISNA 3F5RA 1MIZB 2N23A 1B55A 2OTXA 4GPTB 1XD4A 1V61A 2COFA 2I5FA 1K5GB 1SGHA 1BTNA 4NY0A 1XX0A 3ZDTA 4A6FA 3KZ1A 2ADZA 1E5WA 3TCAA 2YRYA 4CYEA 2ROZB 3HW2B 2DHJA 1XR0B 1N3HA 1RJ2A 1J0WA 4IFSA 2GCLA 2Z0OA 3AJ4A 3QBVB 1ZSQA 1W1HA 2Y8GA 4F7GA 3PP2A 1NU2A 4EJNA 3ODXA 2P0FA 2NZ8B 2J59M 1QC6A 3TW1A 5KCVA 2QKMA 1LB1A 1UPRA 2PZ1A 4A6HA 2VRWB 2BCJA 3P7ZA 1U5GA 3P6AA 3VIAA 5DHFB 1V5PA 4HB0B 4KAXB 4HB3B 1H10A 1MK9B 4HB2B 5J3TA 3PVLA 1MKEA 2YS5A 4WSFA 4CHMA 5DH9B 2QKLA 3CIKA 3KSYA 2D9VA 5J3QA 1PMSA 2VKIA 4HHVA 3ODOA 1OQNA 3FSSA 2L2IA 4MY6A 2N0YA 1P5TA 2W2XD 1DDWA 2YVCA 1MAIA 1MK7B 2COCA 3FM8C 3PEGA 1OY2A 5CLQB 2YT1A 2IYBA 1AWEA 2X18A 1EAZA 3WYFB 2Y7BA 5FI1A 2DKQA 1M7EA 3GYPA 2D10A 2J0JA 4WVFB 1WG7A 2K2JA 1EGXA 4HB4B 3ML4A 2DYQA 4K2OA 4XWXA 2CRFA 2Q13A 2DN6A 3SNHA 1GC6A 4CHJA 1WGUA 3IVFA 1FHXA 2NMBA 2YF0A 3BJIA 2MKRA 1DBHA 1FGYA 2EMSA 3D8DA 2J0KA 2P8VA 2K00A 2P0DA 1ZVRA 1Z87A 2LOZA 1NTVA 1IRSA 4D0NB 1U27A 2DFKA 2DTCA 4KHOA 3G9WA 4F7UP 2D9ZA 4ZRJA 1W1DA 1V88A 2J0MA 2D9WA 4IAPA 1U5DA 3PSCA 1X1FA 2EMTA 2E2XA 3DXEA 4L6EA 4PNKA 1QQGA 4DBBA 4GMXB 4HAWB 4HAYB 1AQCA 2YS1A 2EJ8A 5HE2A 2Z0PA 2R0DA 3PVWA 2ELAA 3CXBB 1DROA 5JLJB 1KI1B 2AL6A 2LOXA 3PZDA 2M14A 3DXDA 2OQBA 1ZC3B 1UEFA 3KRXA 4TYZA 2D4QA 4A5KA 4EMOA 2RLOA 1P6SA 3SO6A 2COAA 3QIJA 4EKUA 3U8ZA 4BBKA 3T06A 2M38A 2DHKA 3WA0A 2I5CA 5C6RA 3QWMA 3BINA 3FEHA 4PQ0A 1LW3A 1XKEA 1KZGA 5KQ4A 4A6KA 1MPHA 5D3YA 1BWNA 1BTKA 2LYDA 4H8SA 4B6HA 2RGNB 4KVGB 2YT0A 4HATB 3DXCA 5C79A 1X05A 3U7DA 1WVHA 1NTYA 2FJLA 2RSGA 2UVMA 3ULBA 2RNRB 4Z2MB 5D3XA 2W2XC 4K17A 4MT7A 1UNRA 1PFJA 1ZM0A 1GC7A 3KRWA 4IOYX 1DDMA 2DHIA 2D2QA 1WJ1A 5D3VA 2VSZA 2HE7A 2I1JA 5JHHA 3SV1A 5DIFB 3D8FA 5EFXA 5HE0A 2H7DA 4GZUA 4MK0A 2KCJA 1XODA 1FGZA 2GCJA 5HE1A 1V5UA 4A6FB 2V76A 1M7RA 3AU4A 2DKPA 1I2HA 4P7IA 1KZ7A 3M1IB 2MDXA 4K81A 3O96A 4K2PA 4C0AA 1MIXA 2KUPA 2XQNM 5FI0A 4YL8A 2L1CA 5JHGA 1WGQA 1I7AA 2LG1A 2AEHA 1UNPA 4NSWA 1FHOA 2CY5A 1W1GA 1SHCA 1ZC4B 1FHWA 1FOEA 4ZRKA 2DLWA 2Y8FA 3A8QA 4GN1A 3MDBC 3TO1A 3ZVRA 5L81A 4DXAB 2GJYA 5DI9B 2GS0A 2MFQA 1GG3A 1OMWA 1TXDA 2HTHB 1X11A 1FAOA 5C16A 1V89A 2D11A 2YS3A 1P3RA 4TKNA 4ZRIA 5J3YA 2DA0A 2I1KA 1NI2A 1Q67A 1U29A 1EVHA 5D3WA 2UZSA 4KHBB 1UNQA 2JP2A 3VOQA 3NSUA 2UZRA 5C5BA 2H7EA 2D9YA 3GYOA 1Y5OA 4KHAA 5D27A 4F7HA 2CODA 2KGXB 5LONB 3KY9A 1U5EA 2LULA 2K2UA 5C5BB 4HAVB 4GMVA 4HDOA 5GOWB 2RUKB 3A8PA 4HAXB 2LKOA 3RCPA 4Y94A 1PLSA 2CAYA 2YSZA 1V5MA 4GXBA 3F0WA 1XCGA 2DX1A 3AU5A 4HAZB 2IFSA 2ROVA 3PG7A 2D9XA 3ULCA 2P0HA 1H4RA 2Z0QA
chains in the Genus database with same CATH superfamily
3PVUA 2W2WA 2K49A 4YONA 2G35A 1Y19B 2DYNA 2MWNB 1RRPB 2CY4A 4GNKB 1DYNA 1UPQA 3X23A 5DHAB 3TFMA 3LJUX 3HK0A 3OANA 4HDQA 2ZPYA 1FB8A 2R09A 4Z2NA 2RVBB 5LOPB 1BAKA 1U2BA 1WI1A 1TQZA 3A98B 1X86A 3N7CA 4DX8A 3A58A 5KQ1A 4WJ7A 4DX90 1WJMA 5CLLB 4HAUB 1X1GA 3FVCA 2Z14A 1DDVA 4HSIA 3V5WA 2ELBA 5HE3A 3ODWA 1J19A 3SYXA 3HQCA 3TVVA 2EC1A 3D8EA 1TJ6A 2DX5A 1EF1A 3UZTA 2Z4DA 3MPXA 1K5DB 1U5FA 5JP4A 3SUZA 1ISNA 3F5RA 1MIZB 2N23A 4D6WA 1B55A 2OTXA 4GPTB 1XD4A 1V61A 2COFA 2I5FA 1K5GB 1SGHA 2NBVA 1BTNA 5I2SA 4NY0A 1XX0A 3ZDTA 4A6FA 3KZ1A 2ADZA 1E5WA 3TCAA 2YRYA 2KIGA 4CYEA 2ROZB 3HW2B 2DHJA 1XR0B 1N3HA 1RJ2A 1J0WA 4IFSA 2GCLA 2Z0OA 5I2MA 3AJ4A 3QBVB 1ZSQA 1W1HA 2Y8GA 4F7GA 2R2YA 3PP2A 1NU2A 4EJNA 3ODXA 4QXAB 2P0FA 2NZ8B 2J59M 1QC6A 3TW1A 5KCVA 3OHMB 2QKMA 1LB1A 1T77A 1UPRA 2PZ1A 4A6HA 2VRWB 2BCJA 3P7ZA 1U5GA 3P6AA 3VIAA 5DHFB 1V5PA 4HB0B 4KAXB 4DIXA 4HB3B 1H10A 1MK9B 4HB2B 5J3TA 3PVLA 1MKEA 2YS5A 4WSFA 4GOUA 4CHMA 5DH9B 2YT2A 2QKLA 3CIKA 3KSYA 2D9VA 3NWFA 5J3QA 1PMSA 2VKIA 4HHVA 3ODOA 1OQNA 3FSSA 2L2IA 4MY6A 2N0YA 1P5TA 2W2XD 1DDWA 2YVCA 1MAIA 1MK7B 2COCA 3FM8C 3PEGA 1OY2A 5CLQB 2YT1A 2IYBA 1AWEA 2X18A 1EAZA 3WYFB 2Y7BA 5FI1A 2DKQA 1M7EA 3GYPA 2D10A 2J0JA 4WVFB 1WG7A 2K2JA 1EGXA 1ZYIA 4HB4B 3DCXA 3ML4A 2DYQA 4K2OA 4XWXA 2CRFA 2Q13A 2DN6A 3SNHA 1GC6A 4CHJA 1WGUA 3IVFA 1FHXA 2NMBA 2YF0A 3BJIA 2MKRA 1DBHA 1FGYA 2EMSA 3D8DA 2J0KA 2P8VA 2K00A 2P0DA 3U12A 1ZVRA 1Z87A 2LOZA 1NTVA 1IRSA 4D0NB 1U27A 2DFKA 2DTCA 4KHOA 3NWAA 3G9WA 4F7UP 2D9ZA 4ZRJA 1W1DA 1V88A 2J0MA 2D9WA 4IAPA 1U5DA 3PSCA 1X1FA 2EMTA 2E2XA 3DXEA 4L6EA 4PNKA 1QQGA 4DBBA 3HIEA 4GMXB 4HAWB 4HAYB 1AQCA 2RRFA 5M4YB 2YS1A 2EJ8A 5HE2A 2Z0PA 2R0DA 3PVWA 2ELAA 3CXBB 1DROA 5JLJB 1KI1B 2AL6A 2LOXA 3PZDA 2M14A 3DXDA 2OQBA 1ZC3B 1UEFA 3KRXA 4TYZA 2D4QA 4A5KA 4EMOA 2RLOA 4QJ4B 1P6SA 3SO6A 2COAA 3QIJA 2FJUB 4EKUA 3NW8A 2ZKMX 3U8ZA 4OT1A 4BBKA 3T06A 2M38A 2DHKA 3WA0A 2I5CA 5C6RA 3QWMA 3BINA 3FEHA 4PQ0A 1LW3A 1XKEA 1KZGA 5KQ4A 4A6KA 1MPHA 5D3YA 1BWNA 1BTKA 2LYDA 4H8SA 4B6HA 2RGNB 4KVGB 2YT0A 4HATB 2KR0A 3DXCA 5C79A 1X05A 3U7DA 1WVHA 1NTYA 2FJLA 2RSGA 4L1RA 2UVMA 3ULBA 2RNRB 4Z2MB 5D3XA 2W2XC 2K8EA 4K17A 4MT7A 1UNRA 1PFJA 1ZM0A 1GC7A 3KRWA 4IOYX 1DDMA 2DHIA 2D2QA 4QJ5B 1WJ1A 5D3VA 5LG4B 2VSZA 2HE7A 2I1JA 5JHHA 3SV1A 5DIFB 3D8FA 5EFXA 5HE0A 2H7DA 4GZUA 4MK0A 2KCJA 1XODA 1FGZA 2GCJA 5HE1A 2GUMA 4CSQA 1V5UA 4A6FB 2V76A 1M7RA 3AU4A 2DKPA 1I2HA 4P7IA 1KZ7A 3M1IB 2MDXA 4K81A 3HSAA 3O96A 4K2PA 4C0AA 1MIXA 2KUPA 2XQNM 5FI0A 4YL8A 2L1CA 5JHGA 1WGQA 1I7AA 2LG1A 2AEHA 1UNPA 4NSWA 1FHOA 2CY5A 1W1GA 1SHCA 1ZC4B 2Z59A 1FHWA 2Z13A 1FOEA 4ZRKA 2DLWA 2Y8FA 3A8QA 4GN1A 3MDBC 3TO1A 3ZVRA 5L81A 4DXAB 2GJYA 5DI9B 2GS0A 2MFQA 1GG3A 1OMWA 1TXDA 2HTHB 1X11A 1FAOA 5C16A 1V89A 2D11A 2YS3A 1P3RA 4TKNA 4ZRIA 1MI1A 5J3YA 2DA0A 2I1KA 1NI2A 1Q67A 1U29A 1EVHA 5D3WA 2UZSA 4KHBB 1UNQA 2JP2A 3VOQA 3NSUA 2UZRA 5C5BA 2H7EA 2D9YA 3GYOA 1Y5OA 4KHAA 5D27A 4F7HA 2CODA 2KGXB 5LONB 3KY9A 1U5EA 2LULA 2K2UA 5C5BB 2KUQA 5IRSA 4HAVB 4GMVA 4HDOA 5GOWB 2RUKB 3A8PA 4HAXB 2LKOA 3RCPA 3NWDA 4OSNA 4QJ3B 4Y94A 1PLSA 2CAYA 2YSZA 1V5MA 4GXBA 3F0WA 1XCGA 2DX1A 3AU5A 4HAZB 2IFSA 2ROVA 3PG7A 2D9XA 3ULCA 3B77A 2KIEA 2P0HA 4KHBA 1H4RA 2Z0QA
chains in the Genus database with same CATH topology
3PVUA 2W2WA 4YONA 2G35A 1Y19B 2DYNA 2MWNB 1RRPB 2CY4A 1DYNA 1UPQA 3X23A 5DHAB 3TFMA 3LJUX 3HK0A 3OANA 4HDQA 2ZPYA 1FB8A 2R09A 4Z2NA 2RVBB 5LOPB 1BAKA 1U2BA 1WI1A 1TQZA 3A98B 1X86A 3N7CA 4DX8A 5KQ1A 4WJ7A 4DX90 1WJMA 5CLLB 4HAUB 1X1GA 1DDVA 3V5WA 2ELBA 5HE3A 3ODWA 1J19A 3SYXA 3HQCA 3TVVA 2EC1A 3D8EA 1TJ6A 2DX5A 1EF1A 3UZTA 3MPXA 1K5DB 1U5FA 5JP4A 3SUZA 1ISNA 3F5RA 1MIZB 2N23A 1B55A 2OTXA 4GPTB 1XD4A 1V61A 2COFA 2I5FA 1K5GB 1SGHA 1BTNA 4NY0A 1XX0A 3ZDTA 4A6FA 3KZ1A 2ADZA 1E5WA 3TCAA 2YRYA 4CYEA 2ROZB 3HW2B 2DHJA 1XR0B 1N3HA 1RJ2A 1J0WA 4IFSA 2GCLA 2Z0OA 3AJ4A 3QBVB 1ZSQA 1W1HA 2Y8GA 4F7GA 3PP2A 1NU2A 4EJNA 3ODXA 2P0FA 2NZ8B 2J59M 1QC6A 3TW1A 5KCVA 2QKMA 1LB1A 1UPRA 2PZ1A 4A6HA 2VRWB 2BCJA 3P7ZA 1U5GA 3P6AA 3VIAA 5DHFB 1V5PA 4HB0B 4KAXB 4HB3B 1H10A 1MK9B 4HB2B 5J3TA 3PVLA 1MKEA 2YS5A 4WSFA 4CHMA 5DH9B 2QKLA 3CIKA 3KSYA 2D9VA 5J3QA 1PMSA 2VKIA 4HHVA 3ODOA 1OQNA 3FSSA 2L2IA 4MY6A 2N0YA 1P5TA 2W2XD 1DDWA 2YVCA 1MAIA 1MK7B 2COCA 3FM8C 3PEGA 1OY2A 5CLQB 2YT1A 2IYBA 1AWEA 2X18A 1EAZA 3WYFB 2Y7BA 5FI1A 2DKQA 1M7EA 3GYPA 2D10A 2J0JA 4WVFB 1WG7A 2K2JA 1EGXA 4HB4B 3ML4A 2DYQA 4K2OA 4XWXA 2CRFA 2Q13A 2DN6A 3SNHA 1GC6A 4CHJA 1WGUA 3IVFA 1FHXA 2NMBA 2YF0A 3BJIA 2MKRA 1DBHA 1FGYA 2EMSA 3D8DA 2J0KA 2P8VA 2K00A 2P0DA 1ZVRA 1Z87A 2LOZA 1NTVA 1IRSA 4D0NB 1U27A 2DFKA 2DTCA 4KHOA 3G9WA 4F7UP 2D9ZA 4ZRJA 1W1DA 1V88A 2J0MA 2D9WA 4IAPA 1U5DA 3PSCA 1X1FA 2EMTA 2E2XA 3DXEA 4L6EA 4PNKA 1QQGA 4DBBA 4GMXB 4HAWB 4HAYB 1AQCA 2YS1A 2EJ8A 5HE2A 2Z0PA 2R0DA 3PVWA 2ELAA 3CXBB 1DROA 5JLJB 1KI1B 2AL6A 2LOXA 3PZDA 2M14A 3DXDA 2OQBA 1ZC3B 1UEFA 3KRXA 4TYZA 2D4QA 4A5KA 4EMOA 2RLOA 1P6SA 3SO6A 2COAA 3QIJA 4EKUA 3U8ZA 4BBKA 3T06A 2M38A 2DHKA 3WA0A 2I5CA 5C6RA 3QWMA 3BINA 3FEHA 4PQ0A 1LW3A 1XKEA 1KZGA 5KQ4A 4A6KA 1MPHA 5D3YA 1BWNA 1BTKA 2LYDA 4H8SA 4B6HA 2RGNB 4KVGB 2YT0A 4HATB 3DXCA 5C79A 1X05A 3U7DA 1WVHA 1NTYA 2FJLA 2RSGA 2UVMA 3ULBA 2RNRB 4Z2MB 5D3XA 2W2XC 4K17A 4MT7A 1UNRA 1PFJA 1ZM0A 1GC7A 3KRWA 4IOYX 1DDMA 2DHIA 2D2QA 1WJ1A 5D3VA 2VSZA 2HE7A 2I1JA 5JHHA 3SV1A 5DIFB 3D8FA 5EFXA 5HE0A 2H7DA 4GZUA 4MK0A 2KCJA 1XODA 1FGZA 2GCJA 5HE1A 1V5UA 4A6FB 2V76A 1M7RA 3AU4A 2DKPA 1I2HA 4P7IA 1KZ7A 3M1IB 2MDXA 4K81A 3O96A 4K2PA 4C0AA 1MIXA 2KUPA 2XQNM 5FI0A 4YL8A 2L1CA 5JHGA 1WGQA 1I7AA 2LG1A 2AEHA 1UNPA 4NSWA 1FHOA 2CY5A 1W1GA 1SHCA 1ZC4B 1FHWA 1FOEA 4ZRKA 2DLWA 2Y8FA 3A8QA 4GN1A 3MDBC 3TO1A 3ZVRA 5L81A 4DXAB 2GJYA 5DI9B 2GS0A 2MFQA 1GG3A 1OMWA 1TXDA 2HTHB 1X11A 1FAOA 5C16A 1V89A 2D11A 2YS3A 1P3RA 4TKNA 4ZRIA 5J3YA 2DA0A 2I1KA 1NI2A 1Q67A 1U29A 1EVHA 5D3WA 2UZSA 4KHBB 1UNQA 2JP2A 3VOQA 3NSUA 2UZRA 5C5BA 2H7EA 2D9YA 3GYOA 1Y5OA 4KHAA 5D27A 4F7HA 2CODA 2KGXB 5LONB 3KY9A 1U5EA 2LULA 2K2UA 5C5BB 4HAVB 4GMVA 4HDOA 5GOWB 2RUKB 3A8PA 4HAXB 2LKOA 3RCPA 4Y94A 1PLSA 2CAYA 2YSZA 1V5MA 4GXBA 3F0WA 1XCGA 2DX1A 3AU5A 4HAZB 2IFSA 2ROVA 3PG7A 2D9XA 3ULCA 2P0HA 1H4RA 2Z0QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PVU A;  2W2W A;  4YON A;  2G35 A;  1Y19 B;  2DYN A;  2MWN B;  1RRP B;  2CY4 A;  1DYN A;  1UPQ A;  3X23 A;  5DHA B;  3TFM A;  3LJU X;  3HK0 A;  3OAN A;  4HDQ A;  2ZPY A;  1FB8 A;  2R09 A;  4Z2N A;  2RVB B;  5LOP B;  1BAK A;  1U2B A;  1WI1 A;  1TQZ A;  3A98 B;  1X86 A;  3N7C A;  4DX8 A;  5KQ1 A;  4WJ7 A;  4DX9 0;  1WJM A;  5CLL B;  4HAU B;  1X1G A;  1DDV A;  3V5W A;  2ELB A;  5HE3 A;  3ODW A;  1J19 A;  3SYX A;  3HQC A;  3TVV A;  2EC1 A;  3D8E A;  1TJ6 A;  2DX5 A;  1EF1 A;  3UZT A;  3MPX A;  1K5D B;  1U5F A;  5JP4 A;  3SUZ A;  1ISN A;  3F5R A;  1MIZ B;  2N23 A;  1B55 A;  2OTX A;  4GPT B;  1XD4 A;  1V61 A;  2COF A;  2I5F A;  1K5G B;  1SGH A;  1BTN A;  4NY0 A;  1XX0 A;  3ZDT A;  4A6F A;  3KZ1 A;  2ADZ A;  1E5W A;  3TCA A;  2YRY A;  4CYE A;  2ROZ B;  3HW2 B;  2DHJ A;  1XR0 B;  1N3H A;  1RJ2 A;  1J0W A;  4IFS A;  2GCL A;  2Z0O A;  3AJ4 A;  3QBV B;  1ZSQ A;  1W1H A;  2Y8G A;  4F7G A;  3PP2 A;  1NU2 A;  4EJN A;  3ODX A;  2P0F A;  2NZ8 B;  2J59 M;  1QC6 A;  3TW1 A;  5KCV A;  2QKM A;  1LB1 A;  1UPR A;  2PZ1 A;  4A6H A;  2VRW B;  2BCJ A;  3P7Z A;  1U5G A;  3P6A A;  3VIA A;  5DHF B;  1V5P A;  4HB0 B;  4KAX B;  4HB3 B;  1H10 A;  1MK9 B;  4HB2 B;  5J3T A;  3PVL A;  1MKE A;  2YS5 A;  4WSF A;  4CHM A;  5DH9 B;  2QKL A;  3CIK A;  3KSY A;  2D9V A;  5J3Q A;  1PMS A;  2VKI A;  4HHV A;  3ODO A;  1OQN A;  3FSS A;  2L2I A;  4MY6 A;  2N0Y A;  1P5T A;  2W2X D;  1DDW A;  2YVC A;  1MAI A;  1MK7 B;  2COC A;  3FM8 C;  3PEG A;  1OY2 A;  5CLQ B;  2YT1 A;  2IYB A;  1AWE A;  2X18 A;  1EAZ A;  3WYF B;  2Y7B A;  5FI1 A;  2DKQ A;  1M7E A;  3GYP A;  2D10 A;  2J0J A;  4WVF B;  1WG7 A;  2K2J A;  1EGX A;  4HB4 B;  3ML4 A;  2DYQ A;  4K2O A;  4XWX A;  2CRF A;  2Q13 A;  2DN6 A;  3SNH A;  1GC6 A;  4CHJ A;  1WGU A;  3IVF A;  1FHX A;  2NMB A;  2YF0 A;  3BJI A;  2MKR A;  1DBH A;  1FGY A;  2EMS A;  3D8D A;  2J0K A;  2P8V A;  2K00 A;  2P0D A;  1ZVR A;  1Z87 A;  2LOZ A;  1NTV A;  1IRS A;  4D0N B;  1U27 A;  2DFK A;  2DTC A;  4KHO A;  3G9W A;  4F7U P;  2D9Z A;  4ZRJ A;  1W1D A;  1V88 A;  2J0M A;  2D9W A;  4IAP A;  1U5D A;  3PSC A;  1X1F A;  2EMT A;  2E2X A;  3DXE A;  4L6E A;  4PNK A;  1QQG A;  4DBB A;  4GMX B;  4HAW B;  4HAY B;  1AQC A;  2YS1 A;  2EJ8 A;  5HE2 A;  2Z0P A;  2R0D A;  3PVW A;  2ELA A;  3CXB B;  1DRO A;  5JLJ B;  1KI1 B;  2AL6 A;  2LOX A;  3PZD A;  2M14 A;  3DXD A;  2OQB A;  1ZC3 B;  1UEF A;  3KRX A;  4TYZ A;  2D4Q A;  4A5K A;  4EMO A;  2RLO A;  1P6S A;  3SO6 A;  2COA A;  3QIJ A;  4EKU A;  3U8Z A;  4BBK A;  3T06 A;  2M38 A;  2DHK A;  3WA0 A;  2I5C A;  5C6R A;  3QWM A;  3BIN A;  3FEH A;  4PQ0 A;  1LW3 A;  1XKE A;  1KZG A;  5KQ4 A;  4A6K A;  1MPH A;  5D3Y A;  1BWN A;  1BTK A;  2LYD A;  4H8S A;  4B6H A;  2RGN B;  4KVG B;  2YT0 A;  4HAT B;  3DXC A;  5C79 A;  1X05 A;  3U7D A;  1WVH A;  1NTY A;  2FJL A;  2RSG A;  2UVM A;  3ULB A;  2RNR B;  4Z2M B;  5D3X A;  2W2X C;  4K17 A;  4MT7 A;  1UNR A;  1PFJ A;  1ZM0 A;  1GC7 A;  3KRW A;  4IOY X;  1DDM A;  2DHI A;  2D2Q A;  1WJ1 A;  5D3V A;  2VSZ A;  2HE7 A;  2I1J A;  5JHH A;  3SV1 A;  5DIF B;  3D8F A;  5EFX A;  5HE0 A;  2H7D A;  4GZU A;  4MK0 A;  2KCJ A;  1XOD A;  1FGZ A;  2GCJ A;  5HE1 A;  1V5U A;  4A6F B;  2V76 A;  1M7R A;  3AU4 A;  2DKP A;  1I2H A;  4P7I A;  1KZ7 A;  3M1I B;  2MDX A;  4K81 A;  3O96 A;  4K2P A;  4C0A A;  1MIX A;  2KUP A;  2XQN M;  5FI0 A;  4YL8 A;  2L1C A;  5JHG A;  1WGQ A;  1I7A A;  2LG1 A;  2AEH A;  1UNP A;  4NSW A;  1FHO A;  2CY5 A;  1W1G A;  1SHC A;  1ZC4 B;  1FHW A;  1FOE A;  4ZRK A;  2DLW A;  2Y8F A;  3A8Q A;  4GN1 A;  3MDB C;  3TO1 A;  3ZVR A;  5L81 A;  4DXA B;  2GJY A;  5DI9 B;  2GS0 A;  2MFQ A;  1GG3 A;  1OMW A;  1TXD A;  2HTH B;  1X11 A;  1FAO A;  5C16 A;  1V89 A;  2D11 A;  2YS3 A;  1P3R A;  4TKN A;  4ZRI A;  5J3Y A;  2DA0 A;  2I1K A;  1NI2 A;  1Q67 A;  1U29 A;  1EVH A;  5D3W A;  2UZS A;  4KHB B;  1UNQ A;  2JP2 A;  3VOQ A;  3NSU A;  2UZR A;  5C5B A;  2H7E A;  2D9Y A;  3GYO A;  1Y5O A;  4KHA A;  5D27 A;  4F7H A;  2COD A;  2KGX B;  5LON B;  3KY9 A;  1U5E A;  2LUL A;  2K2U A;  5C5B B;  4HAV B;  4GMV A;  4HDO A;  5GOW B;  2RUK B;  3A8P A;  4HAX B;  2LKO A;  3RCP A;  4Y94 A;  1PLS A;  2CAY A;  2YSZ A;  1V5M A;  4GXB A;  3F0W A;  1XCG A;  2DX1 A;  3AU5 A;  4HAZ B;  2IFS A;  2ROV A;  3PG7 A;  2D9X A;  3ULC A;  2P0H A;  1H4R A;  2Z0Q A; 
#chains in the Genus database with same CATH topology
 3PVU A;  2W2W A;  2K49 A;  4YON A;  2G35 A;  1Y19 B;  2DYN A;  2MWN B;  1RRP B;  2CY4 A;  4GNK B;  1DYN A;  1UPQ A;  3X23 A;  5DHA B;  3TFM A;  3LJU X;  3HK0 A;  3OAN A;  4HDQ A;  2ZPY A;  1FB8 A;  2R09 A;  4Z2N A;  2RVB B;  5LOP B;  1BAK A;  1U2B A;  1WI1 A;  1TQZ A;  3A98 B;  1X86 A;  3N7C A;  4DX8 A;  3A58 A;  5KQ1 A;  4WJ7 A;  4DX9 0;  1WJM A;  5CLL B;  4HAU B;  1X1G A;  3FVC A;  2Z14 A;  1DDV A;  4HSI A;  3V5W A;  2ELB A;  5HE3 A;  3ODW A;  1J19 A;  3SYX A;  3HQC A;  3TVV A;  2EC1 A;  3D8E A;  1TJ6 A;  2DX5 A;  1EF1 A;  3UZT A;  2Z4D A;  3MPX A;  1K5D B;  1U5F A;  5JP4 A;  3SUZ A;  1ISN A;  3F5R A;  1MIZ B;  2N23 A;  4D6W A;  1B55 A;  2OTX A;  4GPT B;  1XD4 A;  1V61 A;  2COF A;  2I5F A;  1K5G B;  1SGH A;  2NBV A;  1BTN A;  5I2S A;  4NY0 A;  1XX0 A;  3ZDT A;  4A6F A;  3KZ1 A;  2ADZ A;  1E5W A;  3TCA A;  2YRY A;  2KIG A;  4CYE A;  2ROZ B;  3HW2 B;  2DHJ A;  1XR0 B;  1N3H A;  1RJ2 A;  1J0W A;  4IFS A;  2GCL A;  2Z0O A;  5I2M A;  3AJ4 A;  3QBV B;  1ZSQ A;  1W1H A;  2Y8G A;  4F7G A;  2R2Y A;  3PP2 A;  1NU2 A;  4EJN A;  3ODX A;  4QXA B;  2P0F A;  2NZ8 B;  2J59 M;  1QC6 A;  3TW1 A;  5KCV A;  3OHM B;  2QKM A;  1LB1 A;  1T77 A;  1UPR A;  2PZ1 A;  4A6H A;  2VRW B;  2BCJ A;  3P7Z A;  1U5G A;  3P6A A;  3VIA A;  5DHF B;  1V5P A;  4HB0 B;  4KAX B;  4DIX A;  4HB3 B;  1H10 A;  1MK9 B;  4HB2 B;  5J3T A;  3PVL A;  1MKE A;  2YS5 A;  4WSF A;  4GOU A;  4CHM A;  5DH9 B;  2YT2 A;  2QKL A;  3CIK A;  3KSY A;  2D9V A;  3NWF A;  5J3Q A;  1PMS A;  2VKI A;  4HHV A;  3ODO A;  1OQN A;  3FSS A;  2L2I A;  4MY6 A;  2N0Y A;  1P5T A;  2W2X D;  1DDW A;  2YVC A;  1MAI A;  1MK7 B;  2COC A;  3FM8 C;  3PEG A;  1OY2 A;  5CLQ B;  2YT1 A;  2IYB A;  1AWE A;  2X18 A;  1EAZ A;  3WYF B;  2Y7B A;  5FI1 A;  2DKQ A;  1M7E A;  3GYP A;  2D10 A;  2J0J A;  4WVF B;  1WG7 A;  2K2J A;  1EGX A;  1ZYI A;  4HB4 B;  3DCX A;  3ML4 A;  2DYQ A;  4K2O A;  4XWX A;  2CRF A;  2Q13 A;  2DN6 A;  3SNH A;  1GC6 A;  4CHJ A;  1WGU A;  3IVF A;  1FHX A;  2NMB A;  2YF0 A;  3BJI A;  2MKR A;  1DBH A;  1FGY A;  2EMS A;  3D8D A;  2J0K A;  2P8V A;  2K00 A;  2P0D A;  3U12 A;  1ZVR A;  1Z87 A;  2LOZ A;  1NTV A;  1IRS A;  4D0N B;  1U27 A;  2DFK A;  2DTC A;  4KHO A;  3NWA A;  3G9W A;  4F7U P;  2D9Z A;  4ZRJ A;  1W1D A;  1V88 A;  2J0M A;  2D9W A;  4IAP A;  1U5D A;  3PSC A;  1X1F A;  2EMT A;  2E2X A;  3DXE A;  4L6E A;  4PNK A;  1QQG A;  4DBB A;  3HIE A;  4GMX B;  4HAW B;  4HAY B;  1AQC A;  2RRF A;  5M4Y B;  2YS1 A;  2EJ8 A;  5HE2 A;  2Z0P A;  2R0D A;  3PVW A;  2ELA A;  3CXB B;  1DRO A;  5JLJ B;  1KI1 B;  2AL6 A;  2LOX A;  3PZD A;  2M14 A;  3DXD A;  2OQB A;  1ZC3 B;  1UEF A;  3KRX A;  4TYZ A;  2D4Q A;  4A5K A;  4EMO A;  2RLO A;  4QJ4 B;  1P6S A;  3SO6 A;  2COA A;  3QIJ A;  2FJU B;  4EKU A;  3NW8 A;  2ZKM X;  3U8Z A;  4OT1 A;  4BBK A;  3T06 A;  2M38 A;  2DHK A;  3WA0 A;  2I5C A;  5C6R A;  3QWM A;  3BIN A;  3FEH A;  4PQ0 A;  1LW3 A;  1XKE A;  1KZG A;  5KQ4 A;  4A6K A;  1MPH A;  5D3Y A;  1BWN A;  1BTK A;  2LYD A;  4H8S A;  4B6H A;  2RGN B;  4KVG B;  2YT0 A;  4HAT B;  2KR0 A;  3DXC A;  5C79 A;  1X05 A;  3U7D A;  1WVH A;  1NTY A;  2FJL A;  2RSG A;  4L1R A;  2UVM A;  3ULB A;  2RNR B;  4Z2M B;  5D3X A;  2W2X C;  2K8E A;  4K17 A;  4MT7 A;  1UNR A;  1PFJ A;  1ZM0 A;  1GC7 A;  3KRW A;  4IOY X;  1DDM A;  2DHI A;  2D2Q A;  4QJ5 B;  1WJ1 A;  5D3V A;  5LG4 B;  2VSZ A;  2HE7 A;  2I1J A;  5JHH A;  3SV1 A;  5DIF B;  3D8F A;  5EFX A;  5HE0 A;  2H7D A;  4GZU A;  4MK0 A;  2KCJ A;  1XOD A;  1FGZ A;  2GCJ A;  5HE1 A;  2GUM A;  4CSQ A;  1V5U A;  4A6F B;  2V76 A;  1M7R A;  3AU4 A;  2DKP A;  1I2H A;  4P7I A;  1KZ7 A;  3M1I B;  2MDX A;  4K81 A;  3HSA A;  3O96 A;  4K2P A;  4C0A A;  1MIX A;  2KUP A;  2XQN M;  5FI0 A;  4YL8 A;  2L1C A;  5JHG A;  1WGQ A;  1I7A A;  2LG1 A;  2AEH A;  1UNP A;  4NSW A;  1FHO A;  2CY5 A;  1W1G A;  1SHC A;  1ZC4 B;  2Z59 A;  1FHW A;  2Z13 A;  1FOE A;  4ZRK A;  2DLW A;  2Y8F A;  3A8Q A;  4GN1 A;  3MDB C;  3TO1 A;  3ZVR A;  5L81 A;  4DXA B;  2GJY A;  5DI9 B;  2GS0 A;  2MFQ A;  1GG3 A;  1OMW A;  1TXD A;  2HTH B;  1X11 A;  1FAO A;  5C16 A;  1V89 A;  2D11 A;  2YS3 A;  1P3R A;  4TKN A;  4ZRI A;  1MI1 A;  5J3Y A;  2DA0 A;  2I1K A;  1NI2 A;  1Q67 A;  1U29 A;  1EVH A;  5D3W A;  2UZS A;  4KHB B;  1UNQ A;  2JP2 A;  3VOQ A;  3NSU A;  2UZR A;  5C5B A;  2H7E A;  2D9Y A;  3GYO A;  1Y5O A;  4KHA A;  5D27 A;  4F7H A;  2COD A;  2KGX B;  5LON B;  3KY9 A;  1U5E A;  2LUL A;  2K2U A;  5C5B B;  2KUQ A;  5IRS A;  4HAV B;  4GMV A;  4HDO A;  5GOW B;  2RUK B;  3A8P A;  4HAX B;  2LKO A;  3RCP A;  3NWD A;  4OSN A;  4QJ3 B;  4Y94 A;  1PLS A;  2CAY A;  2YSZ A;  1V5M A;  4GXB A;  3F0W A;  1XCG A;  2DX1 A;  3AU5 A;  4HAZ B;  2IFS A;  2ROV A;  3PG7 A;  2D9X A;  3ULC A;  3B77 A;  2KIE A;  2P0H A;  4KHB A;  1H4R A;  2Z0Q A; 
#chains in the Genus database with same CATH homology
 3PVU A;  2W2W A;  4YON A;  2G35 A;  1Y19 B;  2DYN A;  2MWN B;  1RRP B;  2CY4 A;  1DYN A;  1UPQ A;  3X23 A;  5DHA B;  3TFM A;  3LJU X;  3HK0 A;  3OAN A;  4HDQ A;  2ZPY A;  1FB8 A;  2R09 A;  4Z2N A;  2RVB B;  5LOP B;  1BAK A;  1U2B A;  1WI1 A;  1TQZ A;  3A98 B;  1X86 A;  3N7C A;  4DX8 A;  5KQ1 A;  4WJ7 A;  4DX9 0;  1WJM A;  5CLL B;  4HAU B;  1X1G A;  1DDV A;  3V5W A;  2ELB A;  5HE3 A;  3ODW A;  1J19 A;  3SYX A;  3HQC A;  3TVV A;  2EC1 A;  3D8E A;  1TJ6 A;  2DX5 A;  1EF1 A;  3UZT A;  3MPX A;  1K5D B;  1U5F A;  5JP4 A;  3SUZ A;  1ISN A;  3F5R A;  1MIZ B;  2N23 A;  1B55 A;  2OTX A;  4GPT B;  1XD4 A;  1V61 A;  2COF A;  2I5F A;  1K5G B;  1SGH A;  1BTN A;  4NY0 A;  1XX0 A;  3ZDT A;  4A6F A;  3KZ1 A;  2ADZ A;  1E5W A;  3TCA A;  2YRY A;  4CYE A;  2ROZ B;  3HW2 B;  2DHJ A;  1XR0 B;  1N3H A;  1RJ2 A;  1J0W A;  4IFS A;  2GCL A;  2Z0O A;  3AJ4 A;  3QBV B;  1ZSQ A;  1W1H A;  2Y8G A;  4F7G A;  3PP2 A;  1NU2 A;  4EJN A;  3ODX A;  2P0F A;  2NZ8 B;  2J59 M;  1QC6 A;  3TW1 A;  5KCV A;  2QKM A;  1LB1 A;  1UPR A;  2PZ1 A;  4A6H A;  2VRW B;  2BCJ A;  3P7Z A;  1U5G A;  3P6A A;  3VIA A;  5DHF B;  1V5P A;  4HB0 B;  4KAX B;  4HB3 B;  1H10 A;  1MK9 B;  4HB2 B;  5J3T A;  3PVL A;  1MKE A;  2YS5 A;  4WSF A;  4CHM A;  5DH9 B;  2QKL A;  3CIK A;  3KSY A;  2D9V A;  5J3Q A;  1PMS A;  2VKI A;  4HHV A;  3ODO A;  1OQN A;  3FSS A;  2L2I A;  4MY6 A;  2N0Y A;  1P5T A;  2W2X D;  1DDW A;  2YVC A;  1MAI A;  1MK7 B;  2COC A;  3FM8 C;  3PEG A;  1OY2 A;  5CLQ B;  2YT1 A;  2IYB A;  1AWE A;  2X18 A;  1EAZ A;  3WYF B;  2Y7B A;  5FI1 A;  2DKQ A;  1M7E A;  3GYP A;  2D10 A;  2J0J A;  4WVF B;  1WG7 A;  2K2J A;  1EGX A;  4HB4 B;  3ML4 A;  2DYQ A;  4K2O A;  4XWX A;  2CRF A;  2Q13 A;  2DN6 A;  3SNH A;  1GC6 A;  4CHJ A;  1WGU A;  3IVF A;  1FHX A;  2NMB A;  2YF0 A;  3BJI A;  2MKR A;  1DBH A;  1FGY A;  2EMS A;  3D8D A;  2J0K A;  2P8V A;  2K00 A;  2P0D A;  1ZVR A;  1Z87 A;  2LOZ A;  1NTV A;  1IRS A;  4D0N B;  1U27 A;  2DFK A;  2DTC A;  4KHO A;  3G9W A;  4F7U P;  2D9Z A;  4ZRJ A;  1W1D A;  1V88 A;  2J0M A;  2D9W A;  4IAP A;  1U5D A;  3PSC A;  1X1F A;  2EMT A;  2E2X A;  3DXE A;  4L6E A;  4PNK A;  1QQG A;  4DBB A;  4GMX B;  4HAW B;  4HAY B;  1AQC A;  2YS1 A;  2EJ8 A;  5HE2 A;  2Z0P A;  2R0D A;  3PVW A;  2ELA A;  3CXB B;  1DRO A;  5JLJ B;  1KI1 B;  2AL6 A;  2LOX A;  3PZD A;  2M14 A;  3DXD A;  2OQB A;  1ZC3 B;  1UEF A;  3KRX A;  4TYZ A;  2D4Q A;  4A5K A;  4EMO A;  2RLO A;  1P6S A;  3SO6 A;  2COA A;  3QIJ A;  4EKU A;  3U8Z A;  4BBK A;  3T06 A;  2M38 A;  2DHK A;  3WA0 A;  2I5C A;  5C6R A;  3QWM A;  3BIN A;  3FEH A;  4PQ0 A;  1LW3 A;  1XKE A;  1KZG A;  5KQ4 A;  4A6K A;  1MPH A;  5D3Y A;  1BWN A;  1BTK A;  2LYD A;  4H8S A;  4B6H A;  2RGN B;  4KVG B;  2YT0 A;  4HAT B;  3DXC A;  5C79 A;  1X05 A;  3U7D A;  1WVH A;  1NTY A;  2FJL A;  2RSG A;  2UVM A;  3ULB A;  2RNR B;  4Z2M B;  5D3X A;  2W2X C;  4K17 A;  4MT7 A;  1UNR A;  1PFJ A;  1ZM0 A;  1GC7 A;  3KRW A;  4IOY X;  1DDM A;  2DHI A;  2D2Q A;  1WJ1 A;  5D3V A;  2VSZ A;  2HE7 A;  2I1J A;  5JHH A;  3SV1 A;  5DIF B;  3D8F A;  5EFX A;  5HE0 A;  2H7D A;  4GZU A;  4MK0 A;  2KCJ A;  1XOD A;  1FGZ A;  2GCJ A;  5HE1 A;  1V5U A;  4A6F B;  2V76 A;  1M7R A;  3AU4 A;  2DKP A;  1I2H A;  4P7I A;  1KZ7 A;  3M1I B;  2MDX A;  4K81 A;  3O96 A;  4K2P A;  4C0A A;  1MIX A;  2KUP A;  2XQN M;  5FI0 A;  4YL8 A;  2L1C A;  5JHG A;  1WGQ A;  1I7A A;  2LG1 A;  2AEH A;  1UNP A;  4NSW A;  1FHO A;  2CY5 A;  1W1G A;  1SHC A;  1ZC4 B;  1FHW A;  1FOE A;  4ZRK A;  2DLW A;  2Y8F A;  3A8Q A;  4GN1 A;  3MDB C;  3TO1 A;  3ZVR A;  5L81 A;  4DXA B;  2GJY A;  5DI9 B;  2GS0 A;  2MFQ A;  1GG3 A;  1OMW A;  1TXD A;  2HTH B;  1X11 A;  1FAO A;  5C16 A;  1V89 A;  2D11 A;  2YS3 A;  1P3R A;  4TKN A;  4ZRI A;  5J3Y A;  2DA0 A;  2I1K A;  1NI2 A;  1Q67 A;  1U29 A;  1EVH A;  5D3W A;  2UZS A;  4KHB B;  1UNQ A;  2JP2 A;  3VOQ A;  3NSU A;  2UZR A;  5C5B A;  2H7E A;  2D9Y A;  3GYO A;  1Y5O A;  4KHA A;  5D27 A;  4F7H A;  2COD A;  2KGX B;  5LON B;  3KY9 A;  1U5E A;  2LUL A;  2K2U A;  5C5B B;  4HAV B;  4GMV A;  4HDO A;  5GOW B;  2RUK B;  3A8P A;  4HAX B;  2LKO A;  3RCP A;  4Y94 A;  1PLS A;  2CAY A;  2YSZ A;  1V5M A;  4GXB A;  3F0W A;  1XCG A;  2DX1 A;  3AU5 A;  4HAZ B;  2IFS A;  2ROV A;  3PG7 A;  2D9X A;  3ULC A;  2P0H A;  1H4R A;  2Z0Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...