2JP2A

Solution structure and resonance assignment of the n-terminal evh1 domain from the human spred2 protein (sprouty-related protein with evh1 domain isoform 2)
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
126
structure length
126
Chain Sequence
b'GSMTEETHPDDDSYIVRVKAVVMTRDDSSGGWFPQEGGGISRVGVCKVMHPEGNGRSGFLIHGERQKDKLVVLECYVRKDLVYTKANPTFHHWKVDNRKFGLTFQSPADARAFDRGVRKAIEDLIE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Sprouty-related, EVH1 domain-containing protein 2
publication title 1H, 13C and 15N resonance assignment of the human Spred2 EVH1 domain
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 27
structure length 126
sequence length 126
ec nomenclature
pdb deposition date 2007-04-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00568 WH1 WH1 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2jp2A00
3DXCA 2KCJA 1SGHA 5C5BA 2Y8GA 2I5CA 2P0FA 4HDOA 3PVWA 1X1FA 2D9XA 1OMWA 2DLWA 1V5UA 2X18A 4GMXB 2Y8FA 1NTYA 2ROZB 1PLSA 1X1GA 2RSGA 3BINA 1XX0A 3ZDTA 5KQ1A 1QC6A 4HB3B 4CHMA 2EMSA 2BCJA 3TCAA 1EF1A 1U5FA 3SV1A 1X86A 1MKEA 2Q13A 1EVHA 1W1GA 4EMOA 2NMBA 4Z2MB 1TQZA 1MK7B 2I1JA 1N3HA 1U5GA 4YONA 1ZSQA 4HB4B 2GCJA 2XQNM 2EJ8A 3ULBA 3QIJA 4F7GA 3A8QA 4F7UP 3PEGA 4KVGB 5L81A 1KZGA 2Z0PA 2KGXB 2IFSA 2DN6A 4A5KA 2RGNB 1UNRA 1BTNA 5JLJB 2V76A 1U29A 4HATB 2W2XC 1GC7A 2UZSA 4MY6A 4A6HA 3U7DA 3PG7A 3TFMA 1Q67A 1I2HA 4CHJA 2LOXA 4HAXB 1BAKA 2VRWB 5DI9B 1Y5OA 2G35A 3TO1A 1Z87A 2LKOA 4CYEA 5JP4A 1FHWA 2YVCA 3T06A 5J3QA 2CRFA 2YT0A 4ZRKA 2D11A 3D8EA 2MKRA 4IOYX 2DYNA 2ELBA 2M14A 1XD4A 2J0JA 1DROA 5GOWB 1EAZA 3A98B 2H7DA 2DKQA 3ODWA 2EC1A 2CY4A 2YS5A 1V89A 1ZC4B 3O96A 3SNHA 2LG1A 4IAPA 2JP2A 1DYNA 2HTHB 1J19A 3G9WA 3KZ1A 4GN1A 4Y94A 1NU2A 1K5GB 1WG7A 1FHXA 5D3WA 5DHFB 2DKPA 3TW1A 1XCGA 1TXDA 2I1KA 4HB0B 1QQGA 4KHBB 4DX90 1U5EA 5HE0A 1FGZA 4MT7A 5J3TA 2N0YA 2OTXA 3ODOA 2D9WA 3U8ZA 3SO6A 4GPTB 1WI1A 1I7AA 2RVBB 2DTCA 4EJNA 4NSWA 2CAYA 3TVVA 2LOZA 3P6AA 4K81A 1Y19B 1SHCA 2K2JA 1ZVRA 2P8VA 1BWNA 5CLQB 1MIXA 4HDQA 2VSZA 1FAOA 1MK9B 2HE7A 1AQCA 3ML4A 4EKUA 5CLLB 3FM8C 2COFA 5J3YA 2PZ1A 4GXBA 2J0MA 1M7EA 1XR0B 2DHKA 4ZRJA 2P0HA 2W2WA 5JHGA 5FI0A 4IFSA 4P7IA 3V5WA 1H4RA 2YS3A 1RRPB 1EGXA 2L1CA 4K17A 1J0WA 5D3YA 1P3RA 1AWEA 1V88A 2K2UA 3UZTA 1H10A 1LW3A 4DX8A 1U2BA 1V5MA 2YT1A 1WGQA 3HQCA 2ADZA 3HW2B 1UPQA 2I5FA 2R0DA 1OY2A 1DDVA 2DX1A 2YF0A 1MAIA 4PQ0A 2KUPA 5KQ4A 4HB2B 1TJ6A 1V5PA 5DHAB 4HAYB 2AEHA 4K2PA 4A6FB 3VIAA 2ELAA 3CXBB 1FHOA 1FB8A 2DHJA 2MDXA 3GYPA 3PSCA 4WJ7A 2N23A 2GCLA 4TYZA 1W1DA 1V61A 1K5DB 2M38A 1E5WA 3CIKA 4YL8A 3SYXA 3AU5A 2CY5A 2DA0A 4HAZB 1MPHA 3AU4A 5LOPB 4KHAA 3D8DA 2D10A 2J59M 5C6RA 2L2IA 3QWMA 2UZRA 1KZ7A 5FI1A 4HAUB 4BBKA 2YSZA 3KY9A 2COAA 4GZUA 2LULA 1GC6A 4F7HA 1RJ2A 1U27A 5HE3A 1ZC3B 2LYDA 3GYOA 2D4QA 3KRXA 2D9ZA 4A6FA 2J0KA 1B55A 3MPXA 3DXDA 2DFKA 3N7CA 3FSSA 2D9YA 3KSYA 1U5DA 1OQNA 2QKMA 3F5RA 2H7EA 1NI2A 1KI1B 4TKNA 1P5TA 4DXAB 5C79A 3MDBC 1BTKA 2EMTA 5LONB 3ULCA 5DH9B 1W1HA 4C0AA 2FJLA 4HAWB 2CODA 4WVFB 2YRYA 3OANA 2AL6A 3BJIA 3ODXA 2GS0A 1M7RA 5D27A 4MK0A 3PP2A 2ROVA 1WJ1A 2W2XD 1ISNA 5JHHA 3SUZA 1FGYA 3LJUX 5DIFB 1PFJA 1MIZB 1UNQA 3M1IB 2YS1A 4DBBA 3QBVB 3X23A 1X05A 3PZDA 3P7ZA 2ZPYA 2Y7BA 1X11A 1DDWA 3DXEA 3VOQA 2RUKB 5EFXA 3NSUA 1WGUA 5HE2A 2DYQA 4Z2NA 4WSFA 2COCA 5KCVA 1PMSA 4XWXA 4K2OA 4H8SA 2D2QA 3IVFA 1DDMA 2MFQA 5D3XA 4NY0A 5C5BB 4KHOA 4GMVA 3RCPA 2VKIA 2IYBA 4PNKA 1UEFA 1WVHA 2K00A 1ZM0A 4HAVB 2D9VA 3PVLA 4ZRIA 3FEHA 1DBHA 2MWNB 2OQBA 4D0NB 3WA0A 3PVUA 4KAXB 5D3VA 1IRSA 2Z0QA 2P0DA 1UNPA 3KRWA 4A6KA 5HE1A 2DHIA 5C16A 1WJMA 1UPRA 4HHVA 2RNRB 1XODA 2QKLA 2RLOA 1NTVA 1XKEA 2UVMA 3A8PA 1FOEA 4L6EA 2GJYA 2DX5A 2Z0OA 3WYFB 2NZ8B 3HK0A 2E2XA 1LB1A 4B6HA 1GG3A 1P6SA 3D8FA 2R09A 3ZVRA 3AJ4A 3F0WA
chains in the Genus database with same CATH superfamily
1ZYIA 3DXCA 2KCJA 1SGHA 1MI1A 5C5BA 2R2YA 2Y8GA 2I5CA 2P0FA 4HDOA 3PVWA 1X1FA 2D9XA 1OMWA 2DLWA 1V5UA 2X18A 4GMXB 4HSIA 2Y8FA 1NTYA 2ROZB 1PLSA 1X1GA 2RSGA 3BINA 1XX0A 3ZDTA 5KQ1A 1QC6A 4HB3B 4CHMA 2EMSA 3HSAA 2BCJA 3TCAA 1EF1A 2KR0A 1U5FA 3SV1A 1X86A 1MKEA 2Q13A 1EVHA 1W1GA 4EMOA 2NMBA 4Z2MB 1TQZA 1MK7B 2I1JA 1N3HA 1U5GA 4YONA 1ZSQA 4HB4B 2GCJA 2XQNM 2EJ8A 3ULBA 2GUMA 3QIJA 4F7GA 2YT2A 3A8QA 4F7UP 3PEGA 4KVGB 5L81A 1KZGA 2Z0PA 2KGXB 2IFSA 2DN6A 4A5KA 2RGNB 1UNRA 1BTNA 5JLJB 2V76A 1U29A 4HATB 4QJ3B 2W2XC 1GC7A 2UZSA 4OT1A 4MY6A 4A6HA 3U7DA 3PG7A 3TFMA 2Z13A 4D6WA 1Q67A 1I2HA 4CHJA 2LOXA 4HAXB 1BAKA 2VRWB 5DI9B 1Y5OA 2G35A 3TO1A 1Z87A 2LKOA 4CYEA 3NWAA 5JP4A 1FHWA 2YVCA 3T06A 2ZKMX 3NWDA 5J3QA 2CRFA 2YT0A 4ZRKA 2D11A 3D8EA 2MKRA 4GOUA 4IOYX 2DYNA 2ELBA 2M14A 2KIGA 1XD4A 2J0JA 1DROA 5GOWB 1EAZA 4GNKB 3A98B 2H7DA 2DKQA 3ODWA 2EC1A 2CY4A 2YS5A 1V89A 1ZC4B 3O96A 3SNHA 2LG1A 4IAPA 2JP2A 1DYNA 2HTHB 1J19A 3G9WA 3KZ1A 4GN1A 4Y94A 1NU2A 1K5GB 1WG7A 1FHXA 5D3WA 5DHFB 2DKPA 3TW1A 1XCGA 1TXDA 2Z4DA 2I1KA 4HB0B 1QQGA 4KHBB 4DX90 2KIEA 1U5EA 4QJ4B 5HE0A 1FGZA 4MT7A 5J3TA 2N0YA 2OTXA 5IRSA 3ODOA 2D9WA 3U8ZA 3SO6A 4GPTB 1WI1A 3NWFA 1I7AA 2RVBB 2DTCA 4EJNA 4NSWA 2FJUB 2CAYA 3TVVA 2LOZA 3P6AA 4K81A 1Y19B 1SHCA 2K2JA 1ZVRA 2P8VA 1BWNA 5CLQB 1MIXA 4HDQA 2VSZA 1FAOA 1MK9B 2HE7A 1AQCA 3ML4A 4EKUA 5CLLB 3B77A 3FM8C 2COFA 2Z14A 5J3YA 2PZ1A 4GXBA 2J0MA 1M7EA 1XR0B 2DHKA 4ZRJA 2P0HA 2W2WA 5JHGA 5FI0A 3U12A 4IFSA 4P7IA 3V5WA 1H4RA 2YS3A 1RRPB 1EGXA 1T77A 2L1CA 4K17A 1J0WA 5D3YA 1P3RA 1AWEA 1V88A 2K2UA 3UZTA 4KHBA 3OHMB 1H10A 1LW3A 4DX8A 1U2BA 1V5MA 2YT1A 1WGQA 3A58A 3HQCA 2ADZA 2KUQA 3HW2B 1UPQA 2I5FA 2R0DA 1OY2A 1DDVA 2DX1A 2YF0A 1MAIA 5I2SA 4PQ0A 4QXAB 2KUPA 5KQ4A 4HB2B 1TJ6A 1V5PA 5DHAB 4HAYB 2AEHA 4K2PA 4A6FB 3VIAA 2ELAA 3CXBB 1FHOA 1FB8A 2DHJA 2MDXA 4DIXA 3GYPA 3PSCA 4WJ7A 2N23A 2GCLA 4TYZA 1W1DA 1V61A 1K5DB 2M38A 1E5WA 3CIKA 4YL8A 3SYXA 3AU5A 2CY5A 2DA0A 4HAZB 1MPHA 3AU4A 5LOPB 4KHAA 3D8DA 2D10A 2J59M 5C6RA 2L2IA 3QWMA 2UZRA 1KZ7A 5FI1A 4HAUB 3DCXA 4BBKA 2YSZA 3KY9A 2COAA 4GZUA 3FVCA 2LULA 1GC6A 4F7HA 1RJ2A 1U27A 5HE3A 1ZC3B 2LYDA 3GYOA 2D4QA 2RRFA 3KRXA 2D9ZA 4A6FA 2J0KA 1B55A 3MPXA 3DXDA 2DFKA 3NW8A 3N7CA 3FSSA 2D9YA 3KSYA 1U5DA 1OQNA 2QKMA 3F5RA 2H7EA 1NI2A 1KI1B 4TKNA 2Z59A 1P5TA 4DXAB 5C79A 3MDBC 1BTKA 2EMTA 5LONB 3ULCA 5DH9B 1W1HA 4C0AA 2FJLA 4HAWB 2CODA 4WVFB 2YRYA 3OANA 2AL6A 3BJIA 3ODXA 2GS0A 1M7RA 5D27A 4MK0A 3PP2A 2ROVA 1WJ1A 2W2XD 1ISNA 5JHHA 3SUZA 1FGYA 3LJUX 5DIFB 1PFJA 1MIZB 1UNQA 3M1IB 2YS1A 4DBBA 3QBVB 3X23A 1X05A 3PZDA 5LG4B 3P7ZA 2ZPYA 2Y7BA 1X11A 1DDWA 3DXEA 3VOQA 2NBVA 2RUKB 5EFXA 3HIEA 1WGUA 3NSUA 5HE2A 2DYQA 4Z2NA 4WSFA 2COCA 5KCVA 4OSNA 1PMSA 4XWXA 4K2OA 4H8SA 2D2QA 3IVFA 1DDMA 2MFQA 5D3XA 4NY0A 5C5BB 4KHOA 4GMVA 3RCPA 2VKIA 2IYBA 4PNKA 1UEFA 1WVHA 2K00A 1ZM0A 4HAVB 2K49A 2D9VA 5I2MA 3PVLA 4ZRIA 3FEHA 1DBHA 2MWNB 2OQBA 4D0NB 2K8EA 3WA0A 3PVUA 4KAXB 5D3VA 1IRSA 2Z0QA 2P0DA 1UNPA 3KRWA 4A6KA 5HE1A 2DHIA 5C16A 1WJMA 1UPRA 4HHVA 4L1RA 2RNRB 1XODA 5M4YB 2QKLA 2RLOA 1NTVA 1XKEA 2UVMA 3A8PA 4CSQA 4QJ5B 1FOEA 4L6EA 2GJYA 2DX5A 2Z0OA 3WYFB 2NZ8B 3HK0A 2E2XA 1LB1A 4B6HA 1GG3A 1P6SA 3D8FA 2R09A 3ZVRA 3AJ4A 3F0WA
chains in the Genus database with same CATH topology
3DXCA 2KCJA 1SGHA 5C5BA 2Y8GA 2I5CA 2P0FA 4HDOA 3PVWA 1X1FA 2D9XA 1OMWA 2DLWA 1V5UA 2X18A 4GMXB 2Y8FA 1NTYA 2ROZB 1PLSA 1X1GA 2RSGA 3BINA 1XX0A 3ZDTA 5KQ1A 1QC6A 4HB3B 4CHMA 2EMSA 2BCJA 3TCAA 1EF1A 1U5FA 3SV1A 1X86A 1MKEA 2Q13A 1EVHA 1W1GA 4EMOA 2NMBA 4Z2MB 1TQZA 1MK7B 2I1JA 1N3HA 1U5GA 4YONA 1ZSQA 4HB4B 2GCJA 2XQNM 2EJ8A 3ULBA 3QIJA 4F7GA 3A8QA 4F7UP 3PEGA 4KVGB 5L81A 1KZGA 2Z0PA 2KGXB 2IFSA 2DN6A 4A5KA 2RGNB 1UNRA 1BTNA 5JLJB 2V76A 1U29A 4HATB 2W2XC 1GC7A 2UZSA 4MY6A 4A6HA 3U7DA 3PG7A 3TFMA 1Q67A 1I2HA 4CHJA 2LOXA 4HAXB 1BAKA 2VRWB 5DI9B 1Y5OA 2G35A 3TO1A 1Z87A 2LKOA 4CYEA 5JP4A 1FHWA 2YVCA 3T06A 5J3QA 2CRFA 2YT0A 4ZRKA 2D11A 3D8EA 2MKRA 4IOYX 2DYNA 2ELBA 2M14A 1XD4A 2J0JA 1DROA 5GOWB 1EAZA 3A98B 2H7DA 2DKQA 3ODWA 2EC1A 2CY4A 2YS5A 1V89A 1ZC4B 3O96A 3SNHA 2LG1A 4IAPA 2JP2A 1DYNA 2HTHB 1J19A 3G9WA 3KZ1A 4GN1A 4Y94A 1NU2A 1K5GB 1WG7A 1FHXA 5D3WA 5DHFB 2DKPA 3TW1A 1XCGA 1TXDA 2I1KA 4HB0B 1QQGA 4KHBB 4DX90 1U5EA 5HE0A 1FGZA 4MT7A 5J3TA 2N0YA 2OTXA 3ODOA 2D9WA 3U8ZA 3SO6A 4GPTB 1WI1A 1I7AA 2RVBB 2DTCA 4EJNA 4NSWA 2CAYA 3TVVA 2LOZA 3P6AA 4K81A 1Y19B 1SHCA 2K2JA 1ZVRA 2P8VA 1BWNA 5CLQB 1MIXA 4HDQA 2VSZA 1FAOA 1MK9B 2HE7A 1AQCA 3ML4A 4EKUA 5CLLB 3FM8C 2COFA 5J3YA 2PZ1A 4GXBA 2J0MA 1M7EA 1XR0B 2DHKA 4ZRJA 2P0HA 2W2WA 5JHGA 5FI0A 4IFSA 4P7IA 3V5WA 1H4RA 2YS3A 1RRPB 1EGXA 2L1CA 4K17A 1J0WA 5D3YA 1P3RA 1AWEA 1V88A 2K2UA 3UZTA 1H10A 1LW3A 4DX8A 1U2BA 1V5MA 2YT1A 1WGQA 3HQCA 2ADZA 3HW2B 1UPQA 2I5FA 2R0DA 1OY2A 1DDVA 2DX1A 2YF0A 1MAIA 4PQ0A 2KUPA 5KQ4A 4HB2B 1TJ6A 1V5PA 5DHAB 4HAYB 2AEHA 4K2PA 4A6FB 3VIAA 2ELAA 3CXBB 1FHOA 1FB8A 2DHJA 2MDXA 3GYPA 3PSCA 4WJ7A 2N23A 2GCLA 4TYZA 1W1DA 1V61A 1K5DB 2M38A 1E5WA 3CIKA 4YL8A 3SYXA 3AU5A 2CY5A 2DA0A 4HAZB 1MPHA 3AU4A 5LOPB 4KHAA 3D8DA 2D10A 2J59M 5C6RA 2L2IA 3QWMA 2UZRA 1KZ7A 5FI1A 4HAUB 4BBKA 2YSZA 3KY9A 2COAA 4GZUA 2LULA 1GC6A 4F7HA 1RJ2A 1U27A 5HE3A 1ZC3B 2LYDA 3GYOA 2D4QA 3KRXA 2D9ZA 4A6FA 2J0KA 1B55A 3MPXA 3DXDA 2DFKA 3N7CA 3FSSA 2D9YA 3KSYA 1U5DA 1OQNA 2QKMA 3F5RA 2H7EA 1NI2A 1KI1B 4TKNA 1P5TA 4DXAB 5C79A 3MDBC 1BTKA 2EMTA 5LONB 3ULCA 5DH9B 1W1HA 4C0AA 2FJLA 4HAWB 2CODA 4WVFB 2YRYA 3OANA 2AL6A 3BJIA 3ODXA 2GS0A 1M7RA 5D27A 4MK0A 3PP2A 2ROVA 1WJ1A 2W2XD 1ISNA 5JHHA 3SUZA 1FGYA 3LJUX 5DIFB 1PFJA 1MIZB 1UNQA 3M1IB 2YS1A 4DBBA 3QBVB 3X23A 1X05A 3PZDA 3P7ZA 2ZPYA 2Y7BA 1X11A 1DDWA 3DXEA 3VOQA 2RUKB 5EFXA 3NSUA 1WGUA 5HE2A 2DYQA 4Z2NA 4WSFA 2COCA 5KCVA 1PMSA 4XWXA 4K2OA 4H8SA 2D2QA 3IVFA 1DDMA 2MFQA 5D3XA 4NY0A 5C5BB 4KHOA 4GMVA 3RCPA 2VKIA 2IYBA 4PNKA 1UEFA 1WVHA 2K00A 1ZM0A 4HAVB 2D9VA 3PVLA 4ZRIA 3FEHA 1DBHA 2MWNB 2OQBA 4D0NB 3WA0A 3PVUA 4KAXB 5D3VA 1IRSA 2Z0QA 2P0DA 1UNPA 3KRWA 4A6KA 5HE1A 2DHIA 5C16A 1WJMA 1UPRA 4HHVA 2RNRB 1XODA 2QKLA 2RLOA 1NTVA 1XKEA 2UVMA 3A8PA 1FOEA 4L6EA 2GJYA 2DX5A 2Z0OA 3WYFB 2NZ8B 3HK0A 2E2XA 1LB1A 4B6HA 1GG3A 1P6SA 3D8FA 2R09A 3ZVRA 3AJ4A 3F0WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DXC A;  2KCJ A;  1SGH A;  5C5B A;  2Y8G A;  2I5C A;  2P0F A;  4HDO A;  3PVW A;  1X1F A;  2D9X A;  1OMW A;  2DLW A;  1V5U A;  2X18 A;  4GMX B;  2Y8F A;  1NTY A;  2ROZ B;  1PLS A;  1X1G A;  2RSG A;  3BIN A;  1XX0 A;  3ZDT A;  5KQ1 A;  1QC6 A;  4HB3 B;  4CHM A;  2EMS A;  2BCJ A;  3TCA A;  1EF1 A;  1U5F A;  3SV1 A;  1X86 A;  1MKE A;  2Q13 A;  1EVH A;  1W1G A;  4EMO A;  2NMB A;  4Z2M B;  1TQZ A;  1MK7 B;  2I1J A;  1N3H A;  1U5G A;  4YON A;  1ZSQ A;  4HB4 B;  2GCJ A;  2XQN M;  2EJ8 A;  3ULB A;  3QIJ A;  4F7G A;  3A8Q A;  4F7U P;  3PEG A;  4KVG B;  5L81 A;  1KZG A;  2Z0P A;  2KGX B;  2IFS A;  2DN6 A;  4A5K A;  2RGN B;  1UNR A;  1BTN A;  5JLJ B;  2V76 A;  1U29 A;  4HAT B;  2W2X C;  1GC7 A;  2UZS A;  4MY6 A;  4A6H A;  3U7D A;  3PG7 A;  3TFM A;  1Q67 A;  1I2H A;  4CHJ A;  2LOX A;  4HAX B;  1BAK A;  2VRW B;  5DI9 B;  1Y5O A;  2G35 A;  3TO1 A;  1Z87 A;  2LKO A;  4CYE A;  5JP4 A;  1FHW A;  2YVC A;  3T06 A;  5J3Q A;  2CRF A;  2YT0 A;  4ZRK A;  2D11 A;  3D8E A;  2MKR A;  4IOY X;  2DYN A;  2ELB A;  2M14 A;  1XD4 A;  2J0J A;  1DRO A;  5GOW B;  1EAZ A;  3A98 B;  2H7D A;  2DKQ A;  3ODW A;  2EC1 A;  2CY4 A;  2YS5 A;  1V89 A;  1ZC4 B;  3O96 A;  3SNH A;  2LG1 A;  4IAP A;  2JP2 A;  1DYN A;  2HTH B;  1J19 A;  3G9W A;  3KZ1 A;  4GN1 A;  4Y94 A;  1NU2 A;  1K5G B;  1WG7 A;  1FHX A;  5D3W A;  5DHF B;  2DKP A;  3TW1 A;  1XCG A;  1TXD A;  2I1K A;  4HB0 B;  1QQG A;  4KHB B;  4DX9 0;  1U5E A;  5HE0 A;  1FGZ A;  4MT7 A;  5J3T A;  2N0Y A;  2OTX A;  3ODO A;  2D9W A;  3U8Z A;  3SO6 A;  4GPT B;  1WI1 A;  1I7A A;  2RVB B;  2DTC A;  4EJN A;  4NSW A;  2CAY A;  3TVV A;  2LOZ A;  3P6A A;  4K81 A;  1Y19 B;  1SHC A;  2K2J A;  1ZVR A;  2P8V A;  1BWN A;  5CLQ B;  1MIX A;  4HDQ A;  2VSZ A;  1FAO A;  1MK9 B;  2HE7 A;  1AQC A;  3ML4 A;  4EKU A;  5CLL B;  3FM8 C;  2COF A;  5J3Y A;  2PZ1 A;  4GXB A;  2J0M A;  1M7E A;  1XR0 B;  2DHK A;  4ZRJ A;  2P0H A;  2W2W A;  5JHG A;  5FI0 A;  4IFS A;  4P7I A;  3V5W A;  1H4R A;  2YS3 A;  1RRP B;  1EGX A;  2L1C A;  4K17 A;  1J0W A;  5D3Y A;  1P3R A;  1AWE A;  1V88 A;  2K2U A;  3UZT A;  1H10 A;  1LW3 A;  4DX8 A;  1U2B A;  1V5M A;  2YT1 A;  1WGQ A;  3HQC A;  2ADZ A;  3HW2 B;  1UPQ A;  2I5F A;  2R0D A;  1OY2 A;  1DDV A;  2DX1 A;  2YF0 A;  1MAI A;  4PQ0 A;  2KUP A;  5KQ4 A;  4HB2 B;  1TJ6 A;  1V5P A;  5DHA B;  4HAY B;  2AEH A;  4K2P A;  4A6F B;  3VIA A;  2ELA A;  3CXB B;  1FHO A;  1FB8 A;  2DHJ A;  2MDX A;  3GYP A;  3PSC A;  4WJ7 A;  2N23 A;  2GCL A;  4TYZ A;  1W1D A;  1V61 A;  1K5D B;  2M38 A;  1E5W A;  3CIK A;  4YL8 A;  3SYX A;  3AU5 A;  2CY5 A;  2DA0 A;  4HAZ B;  1MPH A;  3AU4 A;  5LOP B;  4KHA A;  3D8D A;  2D10 A;  2J59 M;  5C6R A;  2L2I A;  3QWM A;  2UZR A;  1KZ7 A;  5FI1 A;  4HAU B;  4BBK A;  2YSZ A;  3KY9 A;  2COA A;  4GZU A;  2LUL A;  1GC6 A;  4F7H A;  1RJ2 A;  1U27 A;  5HE3 A;  1ZC3 B;  2LYD A;  3GYO A;  2D4Q A;  3KRX A;  2D9Z A;  4A6F A;  2J0K A;  1B55 A;  3MPX A;  3DXD A;  2DFK A;  3N7C A;  3FSS A;  2D9Y A;  3KSY A;  1U5D A;  1OQN A;  2QKM A;  3F5R A;  2H7E A;  1NI2 A;  1KI1 B;  4TKN A;  1P5T A;  4DXA B;  5C79 A;  3MDB C;  1BTK A;  2EMT A;  5LON B;  3ULC A;  5DH9 B;  1W1H A;  4C0A A;  2FJL A;  4HAW B;  2COD A;  4WVF B;  2YRY A;  3OAN A;  2AL6 A;  3BJI A;  3ODX A;  2GS0 A;  1M7R A;  5D27 A;  4MK0 A;  3PP2 A;  2ROV A;  1WJ1 A;  2W2X D;  1ISN A;  5JHH A;  3SUZ A;  1FGY A;  3LJU X;  5DIF B;  1PFJ A;  1MIZ B;  1UNQ A;  3M1I B;  2YS1 A;  4DBB A;  3QBV B;  3X23 A;  1X05 A;  3PZD A;  3P7Z A;  2ZPY A;  2Y7B A;  1X11 A;  1DDW A;  3DXE A;  3VOQ A;  2RUK B;  5EFX A;  3NSU A;  1WGU A;  5HE2 A;  2DYQ A;  4Z2N A;  4WSF A;  2COC A;  5KCV A;  1PMS A;  4XWX A;  4K2O A;  4H8S A;  2D2Q A;  3IVF A;  1DDM A;  2MFQ A;  5D3X A;  4NY0 A;  5C5B B;  4KHO A;  4GMV A;  3RCP A;  2VKI A;  2IYB A;  4PNK A;  1UEF A;  1WVH A;  2K00 A;  1ZM0 A;  4HAV B;  2D9V A;  3PVL A;  4ZRI A;  3FEH A;  1DBH A;  2MWN B;  2OQB A;  4D0N B;  3WA0 A;  3PVU A;  4KAX B;  5D3V A;  1IRS A;  2Z0Q A;  2P0D A;  1UNP A;  3KRW A;  4A6K A;  5HE1 A;  2DHI A;  5C16 A;  1WJM A;  1UPR A;  4HHV A;  2RNR B;  1XOD A;  2QKL A;  2RLO A;  1NTV A;  1XKE A;  2UVM A;  3A8P A;  1FOE A;  4L6E A;  2GJY A;  2DX5 A;  2Z0O A;  3WYF B;  2NZ8 B;  3HK0 A;  2E2X A;  1LB1 A;  4B6H A;  1GG3 A;  1P6S A;  3D8F A;  2R09 A;  3ZVR A;  3AJ4 A;  3F0W A; 
#chains in the Genus database with same CATH topology
 1ZYI A;  3DXC A;  2KCJ A;  1SGH A;  1MI1 A;  5C5B A;  2R2Y A;  2Y8G A;  2I5C A;  2P0F A;  4HDO A;  3PVW A;  1X1F A;  2D9X A;  1OMW A;  2DLW A;  1V5U A;  2X18 A;  4GMX B;  4HSI A;  2Y8F A;  1NTY A;  2ROZ B;  1PLS A;  1X1G A;  2RSG A;  3BIN A;  1XX0 A;  3ZDT A;  5KQ1 A;  1QC6 A;  4HB3 B;  4CHM A;  2EMS A;  3HSA A;  2BCJ A;  3TCA A;  1EF1 A;  2KR0 A;  1U5F A;  3SV1 A;  1X86 A;  1MKE A;  2Q13 A;  1EVH A;  1W1G A;  4EMO A;  2NMB A;  4Z2M B;  1TQZ A;  1MK7 B;  2I1J A;  1N3H A;  1U5G A;  4YON A;  1ZSQ A;  4HB4 B;  2GCJ A;  2XQN M;  2EJ8 A;  3ULB A;  2GUM A;  3QIJ A;  4F7G A;  2YT2 A;  3A8Q A;  4F7U P;  3PEG A;  4KVG B;  5L81 A;  1KZG A;  2Z0P A;  2KGX B;  2IFS A;  2DN6 A;  4A5K A;  2RGN B;  1UNR A;  1BTN A;  5JLJ B;  2V76 A;  1U29 A;  4HAT B;  4QJ3 B;  2W2X C;  1GC7 A;  2UZS A;  4OT1 A;  4MY6 A;  4A6H A;  3U7D A;  3PG7 A;  3TFM A;  2Z13 A;  4D6W A;  1Q67 A;  1I2H A;  4CHJ A;  2LOX A;  4HAX B;  1BAK A;  2VRW B;  5DI9 B;  1Y5O A;  2G35 A;  3TO1 A;  1Z87 A;  2LKO A;  4CYE A;  3NWA A;  5JP4 A;  1FHW A;  2YVC A;  3T06 A;  2ZKM X;  3NWD A;  5J3Q A;  2CRF A;  2YT0 A;  4ZRK A;  2D11 A;  3D8E A;  2MKR A;  4GOU A;  4IOY X;  2DYN A;  2ELB A;  2M14 A;  2KIG A;  1XD4 A;  2J0J A;  1DRO A;  5GOW B;  1EAZ A;  4GNK B;  3A98 B;  2H7D A;  2DKQ A;  3ODW A;  2EC1 A;  2CY4 A;  2YS5 A;  1V89 A;  1ZC4 B;  3O96 A;  3SNH A;  2LG1 A;  4IAP A;  2JP2 A;  1DYN A;  2HTH B;  1J19 A;  3G9W A;  3KZ1 A;  4GN1 A;  4Y94 A;  1NU2 A;  1K5G B;  1WG7 A;  1FHX A;  5D3W A;  5DHF B;  2DKP A;  3TW1 A;  1XCG A;  1TXD A;  2Z4D A;  2I1K A;  4HB0 B;  1QQG A;  4KHB B;  4DX9 0;  2KIE A;  1U5E A;  4QJ4 B;  5HE0 A;  1FGZ A;  4MT7 A;  5J3T A;  2N0Y A;  2OTX A;  5IRS A;  3ODO A;  2D9W A;  3U8Z A;  3SO6 A;  4GPT B;  1WI1 A;  3NWF A;  1I7A A;  2RVB B;  2DTC A;  4EJN A;  4NSW A;  2FJU B;  2CAY A;  3TVV A;  2LOZ A;  3P6A A;  4K81 A;  1Y19 B;  1SHC A;  2K2J A;  1ZVR A;  2P8V A;  1BWN A;  5CLQ B;  1MIX A;  4HDQ A;  2VSZ A;  1FAO A;  1MK9 B;  2HE7 A;  1AQC A;  3ML4 A;  4EKU A;  5CLL B;  3B77 A;  3FM8 C;  2COF A;  2Z14 A;  5J3Y A;  2PZ1 A;  4GXB A;  2J0M A;  1M7E A;  1XR0 B;  2DHK A;  4ZRJ A;  2P0H A;  2W2W A;  5JHG A;  5FI0 A;  3U12 A;  4IFS A;  4P7I A;  3V5W A;  1H4R A;  2YS3 A;  1RRP B;  1EGX A;  1T77 A;  2L1C A;  4K17 A;  1J0W A;  5D3Y A;  1P3R A;  1AWE A;  1V88 A;  2K2U A;  3UZT A;  4KHB A;  3OHM B;  1H10 A;  1LW3 A;  4DX8 A;  1U2B A;  1V5M A;  2YT1 A;  1WGQ A;  3A58 A;  3HQC A;  2ADZ A;  2KUQ A;  3HW2 B;  1UPQ A;  2I5F A;  2R0D A;  1OY2 A;  1DDV A;  2DX1 A;  2YF0 A;  1MAI A;  5I2S A;  4PQ0 A;  4QXA B;  2KUP A;  5KQ4 A;  4HB2 B;  1TJ6 A;  1V5P A;  5DHA B;  4HAY B;  2AEH A;  4K2P A;  4A6F B;  3VIA A;  2ELA A;  3CXB B;  1FHO A;  1FB8 A;  2DHJ A;  2MDX A;  4DIX A;  3GYP A;  3PSC A;  4WJ7 A;  2N23 A;  2GCL A;  4TYZ A;  1W1D A;  1V61 A;  1K5D B;  2M38 A;  1E5W A;  3CIK A;  4YL8 A;  3SYX A;  3AU5 A;  2CY5 A;  2DA0 A;  4HAZ B;  1MPH A;  3AU4 A;  5LOP B;  4KHA A;  3D8D A;  2D10 A;  2J59 M;  5C6R A;  2L2I A;  3QWM A;  2UZR A;  1KZ7 A;  5FI1 A;  4HAU B;  3DCX A;  4BBK A;  2YSZ A;  3KY9 A;  2COA A;  4GZU A;  3FVC A;  2LUL A;  1GC6 A;  4F7H A;  1RJ2 A;  1U27 A;  5HE3 A;  1ZC3 B;  2LYD A;  3GYO A;  2D4Q A;  2RRF A;  3KRX A;  2D9Z A;  4A6F A;  2J0K A;  1B55 A;  3MPX A;  3DXD A;  2DFK A;  3NW8 A;  3N7C A;  3FSS A;  2D9Y A;  3KSY A;  1U5D A;  1OQN A;  2QKM A;  3F5R A;  2H7E A;  1NI2 A;  1KI1 B;  4TKN A;  2Z59 A;  1P5T A;  4DXA B;  5C79 A;  3MDB C;  1BTK A;  2EMT A;  5LON B;  3ULC A;  5DH9 B;  1W1H A;  4C0A A;  2FJL A;  4HAW B;  2COD A;  4WVF B;  2YRY A;  3OAN A;  2AL6 A;  3BJI A;  3ODX A;  2GS0 A;  1M7R A;  5D27 A;  4MK0 A;  3PP2 A;  2ROV A;  1WJ1 A;  2W2X D;  1ISN A;  5JHH A;  3SUZ A;  1FGY A;  3LJU X;  5DIF B;  1PFJ A;  1MIZ B;  1UNQ A;  3M1I B;  2YS1 A;  4DBB A;  3QBV B;  3X23 A;  1X05 A;  3PZD A;  5LG4 B;  3P7Z A;  2ZPY A;  2Y7B A;  1X11 A;  1DDW A;  3DXE A;  3VOQ A;  2NBV A;  2RUK B;  5EFX A;  3HIE A;  1WGU A;  3NSU A;  5HE2 A;  2DYQ A;  4Z2N A;  4WSF A;  2COC A;  5KCV A;  4OSN A;  1PMS A;  4XWX A;  4K2O A;  4H8S A;  2D2Q A;  3IVF A;  1DDM A;  2MFQ A;  5D3X A;  4NY0 A;  5C5B B;  4KHO A;  4GMV A;  3RCP A;  2VKI A;  2IYB A;  4PNK A;  1UEF A;  1WVH A;  2K00 A;  1ZM0 A;  4HAV B;  2K49 A;  2D9V A;  5I2M A;  3PVL A;  4ZRI A;  3FEH A;  1DBH A;  2MWN B;  2OQB A;  4D0N B;  2K8E A;  3WA0 A;  3PVU A;  4KAX B;  5D3V A;  1IRS A;  2Z0Q A;  2P0D A;  1UNP A;  3KRW A;  4A6K A;  5HE1 A;  2DHI A;  5C16 A;  1WJM A;  1UPR A;  4HHV A;  4L1R A;  2RNR B;  1XOD A;  5M4Y B;  2QKL A;  2RLO A;  1NTV A;  1XKE A;  2UVM A;  3A8P A;  4CSQ A;  4QJ5 B;  1FOE A;  4L6E A;  2GJY A;  2DX5 A;  2Z0O A;  3WYF B;  2NZ8 B;  3HK0 A;  2E2X A;  1LB1 A;  4B6H A;  1GG3 A;  1P6S A;  3D8F A;  2R09 A;  3ZVR A;  3AJ4 A;  3F0W A; 
#chains in the Genus database with same CATH homology
 3DXC A;  2KCJ A;  1SGH A;  5C5B A;  2Y8G A;  2I5C A;  2P0F A;  4HDO A;  3PVW A;  1X1F A;  2D9X A;  1OMW A;  2DLW A;  1V5U A;  2X18 A;  4GMX B;  2Y8F A;  1NTY A;  2ROZ B;  1PLS A;  1X1G A;  2RSG A;  3BIN A;  1XX0 A;  3ZDT A;  5KQ1 A;  1QC6 A;  4HB3 B;  4CHM A;  2EMS A;  2BCJ A;  3TCA A;  1EF1 A;  1U5F A;  3SV1 A;  1X86 A;  1MKE A;  2Q13 A;  1EVH A;  1W1G A;  4EMO A;  2NMB A;  4Z2M B;  1TQZ A;  1MK7 B;  2I1J A;  1N3H A;  1U5G A;  4YON A;  1ZSQ A;  4HB4 B;  2GCJ A;  2XQN M;  2EJ8 A;  3ULB A;  3QIJ A;  4F7G A;  3A8Q A;  4F7U P;  3PEG A;  4KVG B;  5L81 A;  1KZG A;  2Z0P A;  2KGX B;  2IFS A;  2DN6 A;  4A5K A;  2RGN B;  1UNR A;  1BTN A;  5JLJ B;  2V76 A;  1U29 A;  4HAT B;  2W2X C;  1GC7 A;  2UZS A;  4MY6 A;  4A6H A;  3U7D A;  3PG7 A;  3TFM A;  1Q67 A;  1I2H A;  4CHJ A;  2LOX A;  4HAX B;  1BAK A;  2VRW B;  5DI9 B;  1Y5O A;  2G35 A;  3TO1 A;  1Z87 A;  2LKO A;  4CYE A;  5JP4 A;  1FHW A;  2YVC A;  3T06 A;  5J3Q A;  2CRF A;  2YT0 A;  4ZRK A;  2D11 A;  3D8E A;  2MKR A;  4IOY X;  2DYN A;  2ELB A;  2M14 A;  1XD4 A;  2J0J A;  1DRO A;  5GOW B;  1EAZ A;  3A98 B;  2H7D A;  2DKQ A;  3ODW A;  2EC1 A;  2CY4 A;  2YS5 A;  1V89 A;  1ZC4 B;  3O96 A;  3SNH A;  2LG1 A;  4IAP A;  2JP2 A;  1DYN A;  2HTH B;  1J19 A;  3G9W A;  3KZ1 A;  4GN1 A;  4Y94 A;  1NU2 A;  1K5G B;  1WG7 A;  1FHX A;  5D3W A;  5DHF B;  2DKP A;  3TW1 A;  1XCG A;  1TXD A;  2I1K A;  4HB0 B;  1QQG A;  4KHB B;  4DX9 0;  1U5E A;  5HE0 A;  1FGZ A;  4MT7 A;  5J3T A;  2N0Y A;  2OTX A;  3ODO A;  2D9W A;  3U8Z A;  3SO6 A;  4GPT B;  1WI1 A;  1I7A A;  2RVB B;  2DTC A;  4EJN A;  4NSW A;  2CAY A;  3TVV A;  2LOZ A;  3P6A A;  4K81 A;  1Y19 B;  1SHC A;  2K2J A;  1ZVR A;  2P8V A;  1BWN A;  5CLQ B;  1MIX A;  4HDQ A;  2VSZ A;  1FAO A;  1MK9 B;  2HE7 A;  1AQC A;  3ML4 A;  4EKU A;  5CLL B;  3FM8 C;  2COF A;  5J3Y A;  2PZ1 A;  4GXB A;  2J0M A;  1M7E A;  1XR0 B;  2DHK A;  4ZRJ A;  2P0H A;  2W2W A;  5JHG A;  5FI0 A;  4IFS A;  4P7I A;  3V5W A;  1H4R A;  2YS3 A;  1RRP B;  1EGX A;  2L1C A;  4K17 A;  1J0W A;  5D3Y A;  1P3R A;  1AWE A;  1V88 A;  2K2U A;  3UZT A;  1H10 A;  1LW3 A;  4DX8 A;  1U2B A;  1V5M A;  2YT1 A;  1WGQ A;  3HQC A;  2ADZ A;  3HW2 B;  1UPQ A;  2I5F A;  2R0D A;  1OY2 A;  1DDV A;  2DX1 A;  2YF0 A;  1MAI A;  4PQ0 A;  2KUP A;  5KQ4 A;  4HB2 B;  1TJ6 A;  1V5P A;  5DHA B;  4HAY B;  2AEH A;  4K2P A;  4A6F B;  3VIA A;  2ELA A;  3CXB B;  1FHO A;  1FB8 A;  2DHJ A;  2MDX A;  3GYP A;  3PSC A;  4WJ7 A;  2N23 A;  2GCL A;  4TYZ A;  1W1D A;  1V61 A;  1K5D B;  2M38 A;  1E5W A;  3CIK A;  4YL8 A;  3SYX A;  3AU5 A;  2CY5 A;  2DA0 A;  4HAZ B;  1MPH A;  3AU4 A;  5LOP B;  4KHA A;  3D8D A;  2D10 A;  2J59 M;  5C6R A;  2L2I A;  3QWM A;  2UZR A;  1KZ7 A;  5FI1 A;  4HAU B;  4BBK A;  2YSZ A;  3KY9 A;  2COA A;  4GZU A;  2LUL A;  1GC6 A;  4F7H A;  1RJ2 A;  1U27 A;  5HE3 A;  1ZC3 B;  2LYD A;  3GYO A;  2D4Q A;  3KRX A;  2D9Z A;  4A6F A;  2J0K A;  1B55 A;  3MPX A;  3DXD A;  2DFK A;  3N7C A;  3FSS A;  2D9Y A;  3KSY A;  1U5D A;  1OQN A;  2QKM A;  3F5R A;  2H7E A;  1NI2 A;  1KI1 B;  4TKN A;  1P5T A;  4DXA B;  5C79 A;  3MDB C;  1BTK A;  2EMT A;  5LON B;  3ULC A;  5DH9 B;  1W1H A;  4C0A A;  2FJL A;  4HAW B;  2COD A;  4WVF B;  2YRY A;  3OAN A;  2AL6 A;  3BJI A;  3ODX A;  2GS0 A;  1M7R A;  5D27 A;  4MK0 A;  3PP2 A;  2ROV A;  1WJ1 A;  2W2X D;  1ISN A;  5JHH A;  3SUZ A;  1FGY A;  3LJU X;  5DIF B;  1PFJ A;  1MIZ B;  1UNQ A;  3M1I B;  2YS1 A;  4DBB A;  3QBV B;  3X23 A;  1X05 A;  3PZD A;  3P7Z A;  2ZPY A;  2Y7B A;  1X11 A;  1DDW A;  3DXE A;  3VOQ A;  2RUK B;  5EFX A;  3NSU A;  1WGU A;  5HE2 A;  2DYQ A;  4Z2N A;  4WSF A;  2COC A;  5KCV A;  1PMS A;  4XWX A;  4K2O A;  4H8S A;  2D2Q A;  3IVF A;  1DDM A;  2MFQ A;  5D3X A;  4NY0 A;  5C5B B;  4KHO A;  4GMV A;  3RCP A;  2VKI A;  2IYB A;  4PNK A;  1UEF A;  1WVH A;  2K00 A;  1ZM0 A;  4HAV B;  2D9V A;  3PVL A;  4ZRI A;  3FEH A;  1DBH A;  2MWN B;  2OQB A;  4D0N B;  3WA0 A;  3PVU A;  4KAX B;  5D3V A;  1IRS A;  2Z0Q A;  2P0D A;  1UNP A;  3KRW A;  4A6K A;  5HE1 A;  2DHI A;  5C16 A;  1WJM A;  1UPR A;  4HHV A;  2RNR B;  1XOD A;  2QKL A;  2RLO A;  1NTV A;  1XKE A;  2UVM A;  3A8P A;  1FOE A;  4L6E A;  2GJY A;  2DX5 A;  2Z0O A;  3WYF B;  2NZ8 B;  3HK0 A;  2E2X A;  1LB1 A;  4B6H A;  1GG3 A;  1P6S A;  3D8F A;  2R09 A;  3ZVR A;  3AJ4 A;  3F0W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...