2JP2A

Solution structure and resonance assignment of the n-terminal evh1 domain from the human spred2 protein (sprouty-related protein with evh1 domain isoform 2)
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
126
structure length
126
Chain Sequence
GSMTEETHPDDDSYIVRVKAVVMTRDDSSGGWFPQEGGGISRVGVCKVMHPEGNGRSGFLIHGERQKDKLVVLECYVRKDLVYTKANPTFHHWKVDNRKFGLTFQSPADARAFDRGVRKAIEDLIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Sprouty-related, EVH1 domain-containing protein 2
publication title 1H, 13C and 15N resonance assignment of the human Spred2 EVH1 domain
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 27
structure length 126
sequence length 126
ec nomenclature
pdb deposition date 2007-04-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00568 WH1 WH1 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2jp2A00
1V88A 2I1KA 4CHMA 2CY5A 1N3HA 2BCJA 1KZ7A 1AQCA 2J0JA 4K2OA 5HE2A 3HK0A 2LULA 5D27A 1TXDA 1M7RA 2L2IA 2YRYA 2MKRA 3PP2A 2YVCA 2RVBB 3AJ4A 1J0WA 5DIFB 1KI1B 3TVVA 4DX90 1WG7A 3LJUX 2HTHB 2OQBA 1OMWA 4HB3B 2XQNM 5JLJB 4HAXB 3M1IB 4TYZA 1W1DA 2DN6A 4MY6A 3KRWA 3RCPA 2AEHA 2D4QA 2QKMA 4HATB 4WJ7A 4EKUA 1AWEA 2IFSA 3P6AA 5JP4A 2FJLA 2VRWB 2DLWA 2P0FA 4HB2B 2LG1A 1QQGA 3SV1A 5KCVA 2YT1A 1FHWA 1U2BA 1V5UA 4GMVA 1WI1A 5J3QA 1V5PA 3AU4A 1P3RA 2KGXB 1H10A 2J0KA 5C5BA 1MAIA 2QKLA 3ODOA 5FI0A 5HE3A 4HAUB 1K5GB 3ULBA 5DHAB 3PEGA 1Q67A 2K00A 2LOZA 5FI1A 4F7UP 2D9WA 1MK9B 3V5WA 5C6RA 1FAOA 3PVWA 3PZDA 3DXCA 1E5WA 3GYPA 2Y8FA 4P7IA 2MDXA 2RSGA 2D9YA 2ROVA 1M7EA 1U5DA 5D3VA 1RJ2A 1DBHA 2EMTA 2CODA 2DKQA 3TW1A 4A5KA 4KHBB 2P0DA 4PQ0A 3A98B 4TKNA 1MIZB 3ZDTA 1UNQA 1K5DB 3SYXA 1LB1A 1DROA 2L1CA 1Z87A 2Z0OA 1P6SA 1QC6A 3KSYA 1X11A 1ZSQA 5D3XA 3PG7A 3WYFB 4BBKA 1WVHA 2EMSA 1XCGA 1I7AA 2ELBA 3QIJA 4YONA 4A6KA 1W1HA 2ROZB 2YS1A 1U29A 4K17A 5D3YA 5KQ1A 5L81A 5HE0A 1ISNA 2Z0PA 2IYBA 1IRSA 2D10A 2GJYA 2EJ8A 1NTVA 2YS5A 2PZ1A 4HAVB 3ZVRA 5LOPB 2X18A 2DKPA 4ZRKA 1V89A 4HAYB 1XODA 1WGUA 1U5FA 1X1GA 3G9WA 2Y7BA 3OANA 5C5BB 2M14A 4B6HA 1ZVRA 4GMXB 1DDMA 4A6HA 3KRXA 4K2PA 3FM8C 2NMBA 2VKIA 4H8SA 4CHJA 4Z2MB 4CYEA 1V61A 3NSUA 5D3WA 3D8FA 3X23A 2UZRA 5DH9B 3BINA 3F0WA 3P7ZA 4GPTB 2DTCA 1U27A 1WJ1A 4ZRJA 5J3TA 5C16A 2DA0A 3ODXA 1DDVA 2RNRB 2ELAA 3HQCA 4L6EA 4GZUA 1FHOA 2K2JA 1NI2A 2Z0QA 2CAYA 2D2QA 4HDOA 2J59M 1NTYA 2DHIA 2YS3A 4EJNA 3ML4A 1B55A 2VSZA 2Y8GA 2G35A 3DXEA 3KZ1A 5CLQB 1X86A 2DX1A 4IAPA 2H7DA 4MT7A 1KZGA 4D0NB 2ADZA 1W1GA 2W2WA 4ZRIA 2I5FA 1J19A 1X1FA 2UZSA 2Q13A 2R09A 2COCA 1OY2A 3GYOA 1MIXA 3DXDA 2GCLA 1SHCA 3A8PA 1Y5OA 2DFKA 1U5GA 3WA0A 3FSSA 3VOQA 4EMOA 2EC1A 3PVLA 1GG3A 1V5MA 3PVUA 5J3YA 2R0DA 4WVFB 4HB4B 4F7HA 2J0MA 2P0HA 3UZTA 2H7EA 2RUKB 1BTNA 1UPQA 1FOEA 4IOYX 1BAKA 3BJIA 2KUPA 1PMSA 2COAA 1UNPA 2DHJA 4KHOA 1U5EA 1ZM0A 4C0AA 1SGHA 2GS0A 2W2XD 3ULCA 3D8DA 1PLSA 1MK7B 2DHKA 2M38A 4HAWB 4HAZB 1GC6A 1EVHA 1EAZA 4IFSA 3TFMA 5CLLB 3T06A 5KQ4A 2MWNB 2D11A 2D9VA 1OQNA 2CY4A 1XKEA 2AL6A 2LOXA 1WJMA 4A6FA 1RRPB 3N7CA 1BTKA 5EFXA 1XX0A 1Y19B 2DYQA 3SNHA 2I5CA 4Z2NA 5JHGA 1UNRA 1P5TA 2COFA 5JHHA 3MPXA 1WGQA 1XR0B 3F5RA 3SO6A 1BWNA 4Y94A 3IVFA 2OTXA 2D9ZA 1UEFA 1UPRA 2N0YA 1H4RA 2JP2A 3KY9A 5DHFB 1ZC3B 4NSWA 2D9XA 1GC7A 2P8VA 4HDQA 1TJ6A 3U7DA 2GCJA 1ZC4B 5LONB 3D8EA 4GXBA 2CRFA 4KHAA 2K2UA 2N23A 4WSFA 4MK0A 1DDWA 2UVMA 3FEHA 1FGZA 4HHVA 4YL8A 4DXAB 1LW3A 3CIKA 1TQZA 2I1JA 2LYDA 1FB8A 2DYNA 3TCAA 1X05A 2V76A 3SUZA 5DI9B 4KAXB 1MKEA 5HE1A 1I2HA 1NU2A 3A8QA 3QWMA 1XD4A 3TO1A 4K81A 2HE7A 2MFQA 2RGNB 2YF0A 2KCJA 4XWXA 2YSZA 1EF1A 3U8ZA 3CXBB 3O96A 2RLOA 4F7GA 4KVGB 4A6FB 4PNKA 2LKOA 2ZPYA 5C79A 1EGXA 1DYNA 3MDBC 4GN1A 3VIAA 1FHXA 4DBBA 4HB0B 2NZ8B 3AU5A 2DX5A 1PFJA 3QBVB 1FGYA 4NY0A 2YT0A 5GOWB 4DX8A 2E2XA 1MPHA 2W2XC 3PSCA 3HW2B 3ODWA
chains in the Genus database with same CATH superfamily
1V88A 1T77A 2I1KA 4CHMA 5M4YB 2CY5A 1N3HA 2BCJA 1KZ7A 1AQCA 2J0JA 4K2OA 5HE2A 2K49A 3HK0A 2LULA 5D27A 1TXDA 1M7RA 2L2IA 2YRYA 2MKRA 3PP2A 2YVCA 2RVBB 3AJ4A 1J0WA 5DIFB 1KI1B 3DCXA 2Z13A 3TVVA 4DX90 1WG7A 3LJUX 2HTHB 2OQBA 1OMWA 4HB3B 4L1RA 2XQNM 5JLJB 4HAXB 3M1IB 4TYZA 1W1DA 2DN6A 4MY6A 3FVCA 3KRWA 3RCPA 2AEHA 2D4QA 2QKMA 4HATB 4WJ7A 4EKUA 1AWEA 2IFSA 3P6AA 5JP4A 2FJLA 2VRWB 2DLWA 2P0FA 4HB2B 2Z4DA 2LG1A 1QQGA 3SV1A 5KCVA 2YT1A 1FHWA 1U2BA 1V5UA 4GMVA 1WI1A 5J3QA 1V5PA 3AU4A 1P3RA 2KGXB 1H10A 2J0KA 5C5BA 1MAIA 2QKLA 3ODOA 5FI0A 5HE3A 4HAUB 1K5GB 3ULBA 5DHAB 3PEGA 1Q67A 2K00A 2LOZA 5FI1A 4F7UP 2D9WA 1MK9B 3V5WA 3NWFA 5C6RA 1FAOA 2Z14A 2NBVA 3PZDA 3DXCA 1E5WA 3GYPA 2Y8FA 3PVWA 4P7IA 2MDXA 2RSGA 2D9YA 2ROVA 1M7EA 1U5DA 5D3VA 1RJ2A 1DBHA 2EMTA 2CODA 2DKQA 3TW1A 4A5KA 4KHBB 2P0DA 4PQ0A 3A98B 4TKNA 1MIZB 3ZDTA 1UNQA 1K5DB 3SYXA 1LB1A 1DROA 2L1CA 1Z87A 2Z0OA 1P6SA 1QC6A 3KSYA 1X11A 1ZSQA 5D3XA 3PG7A 3WYFB 4BBKA 1WVHA 2EMSA 1XCGA 1I7AA 2ELBA 3NW8A 3QIJA 4YONA 4A6KA 1W1HA 2ROZB 2YS1A 1U29A 4K17A 5D3YA 5KQ1A 5L81A 5HE0A 1ISNA 2Z0PA 4QJ3B 2IYBA 1IRSA 2D10A 2GJYA 2EJ8A 1NTVA 2YS5A 2PZ1A 4HAVB 3ZVRA 5LOPB 3HSAA 2X18A 2DKPA 4ZRKA 1V89A 4HAYB 1XODA 1WGUA 1U5FA 1X1GA 2ZKMX 2KUQA 3G9WA 2Y7BA 3OANA 5C5BB 2M14A 4B6HA 3B77A 1ZVRA 4GMXB 2YT2A 1DDMA 4A6HA 3KRXA 4K2PA 3FM8C 2NMBA 2VKIA 4H8SA 4CHJA 2GUMA 4Z2MB 4GNKB 4CYEA 4OSNA 1V61A 3NSUA 5D3WA 3D8FA 3X23A 4DIXA 2UZRA 5DH9B 3BINA 3F0WA 3P7ZA 4GPTB 2Z59A 2DTCA 1U27A 1WJ1A 4ZRJA 5J3TA 3NWDA 5C16A 2DA0A 3ODXA 1DDVA 2RNRB 2ELAA 3HQCA 4L6EA 4GZUA 5I2MA 1FHOA 2K2JA 1NI2A 2Z0QA 2CAYA 2D2QA 4HDOA 2J59M 1NTYA 2DHIA 2YS3A 4EJNA 3NWAA 3ML4A 1B55A 2VSZA 2Y8GA 2R2YA 2RRFA 2G35A 3DXEA 3KZ1A 5CLQB 1X86A 2DX1A 4IAPA 2H7DA 4MT7A 1KZGA 4D0NB 2ADZA 5IRSA 1W1GA 2W2WA 4ZRIA 2I5FA 1J19A 1X1FA 2UZSA 2Q13A 2R09A 2COCA 1OY2A 3GYOA 1MIXA 3DXDA 2GCLA 1SHCA 3A8PA 1Y5OA 3HIEA 2DFKA 1U5GA 3WA0A 3FSSA 3VOQA 4EMOA 2EC1A 3PVLA 1GG3A 1V5MA 3PVUA 5J3YA 2R0DA 4WVFB 4HB4B 4F7HA 2J0MA 2P0HA 2KIGA 3UZTA 2H7EA 2RUKB 1BTNA 1UPQA 1FOEA 4IOYX 1BAKA 3BJIA 2KUPA 1PMSA 2COAA 1UNPA 2DHJA 4GOUA 4KHOA 1U5EA 1ZM0A 4C0AA 1SGHA 2GS0A 2W2XD 3ULCA 3D8DA 1PLSA 1MK7B 2DHKA 2M38A 4HAWB 4HAZB 1GC6A 1EVHA 1EAZA 4IFSA 3TFMA 5CLLB 3T06A 5KQ4A 2MWNB 2D11A 2D9VA 4HSIA 1OQNA 2CY4A 1XKEA 4OT1A 2AL6A 2LOXA 1WJMA 4A6FA 1RRPB 3N7CA 2K8EA 1BTKA 5EFXA 1XX0A 1Y19B 2DYQA 3SNHA 2I5CA 4Z2NA 5JHGA 1UNRA 1P5TA 2COFA 5JHHA 3MPXA 1WGQA 1XR0B 3F5RA 3SO6A 1BWNA 4Y94A 3IVFA 2OTXA 2D9ZA 5LG4B 1UEFA 1UPRA 2N0YA 1H4RA 2JP2A 3KY9A 5DHFB 1ZC3B 4NSWA 2D9XA 1GC7A 2KIEA 2P8VA 1TJ6A 4HDQA 3U7DA 2GCJA 1ZC4B 5LONB 3D8EA 4GXBA 2CRFA 4KHAA 2K2UA 2N23A 4WSFA 4MK0A 5I2SA 1DDWA 1ZYIA 2UVMA 3FEHA 1FGZA 4HHVA 4YL8A 2KR0A 4DXAB 1LW3A 3CIKA 1TQZA 2I1JA 2LYDA 1FB8A 2DYNA 3TCAA 1X05A 2V76A 3SUZA 5DI9B 4KAXB 1MKEA 5HE1A 1I2HA 1NU2A 3A8QA 3QWMA 1XD4A 3TO1A 4K81A 3A58A 2HE7A 2MFQA 2RGNB 2YF0A 4D6WA 2KCJA 4XWXA 2YSZA 1EF1A 3U8ZA 3CXBB 3O96A 2RLOA 3U12A 4F7GA 4KVGB 4A6FB 4PNKA 4CSQA 2LKOA 2ZPYA 5C79A 1EGXA 1DYNA 3MDBC 4GN1A 3VIAA 1FHXA 2FJUB 4QXAB 4DBBA 4QJ5B 4HB0B 2NZ8B 3AU5A 3OHMB 2DX5A 1PFJA 3QBVB 4QJ4B 1FGYA 4NY0A 2YT0A 5GOWB 4DX8A 2E2XA 1MPHA 2W2XC 3PSCA 3HW2B 3ODWA 4KHBA 1MI1A
chains in the Genus database with same CATH topology
1V88A 2I1KA 4CHMA 2CY5A 1N3HA 2BCJA 1KZ7A 1AQCA 2J0JA 4K2OA 5HE2A 3HK0A 2LULA 5D27A 1TXDA 1M7RA 2L2IA 2YRYA 2MKRA 3PP2A 2YVCA 2RVBB 3AJ4A 1J0WA 5DIFB 1KI1B 3TVVA 4DX90 1WG7A 3LJUX 2HTHB 2OQBA 1OMWA 4HB3B 2XQNM 5JLJB 4HAXB 3M1IB 4TYZA 1W1DA 2DN6A 4MY6A 3KRWA 3RCPA 2AEHA 2D4QA 2QKMA 4HATB 4WJ7A 4EKUA 1AWEA 2IFSA 3P6AA 5JP4A 2FJLA 2VRWB 2DLWA 2P0FA 4HB2B 2LG1A 1QQGA 3SV1A 5KCVA 2YT1A 1FHWA 1U2BA 1V5UA 4GMVA 1WI1A 5J3QA 1V5PA 3AU4A 1P3RA 2KGXB 1H10A 2J0KA 5C5BA 1MAIA 2QKLA 3ODOA 5FI0A 5HE3A 4HAUB 1K5GB 3ULBA 5DHAB 3PEGA 1Q67A 2K00A 2LOZA 5FI1A 4F7UP 2D9WA 1MK9B 3V5WA 5C6RA 1FAOA 3PVWA 3PZDA 3DXCA 1E5WA 3GYPA 2Y8FA 4P7IA 2MDXA 2RSGA 2D9YA 2ROVA 1M7EA 1U5DA 5D3VA 1RJ2A 1DBHA 2EMTA 2CODA 2DKQA 3TW1A 4A5KA 4KHBB 2P0DA 4PQ0A 3A98B 4TKNA 1MIZB 3ZDTA 1UNQA 1K5DB 3SYXA 1LB1A 1DROA 2L1CA 1Z87A 2Z0OA 1P6SA 1QC6A 3KSYA 1X11A 1ZSQA 5D3XA 3PG7A 3WYFB 4BBKA 1WVHA 2EMSA 1XCGA 1I7AA 2ELBA 3QIJA 4YONA 4A6KA 1W1HA 2ROZB 2YS1A 1U29A 4K17A 5D3YA 5KQ1A 5L81A 5HE0A 1ISNA 2Z0PA 2IYBA 1IRSA 2D10A 2GJYA 2EJ8A 1NTVA 2YS5A 2PZ1A 4HAVB 3ZVRA 5LOPB 2X18A 2DKPA 4ZRKA 1V89A 4HAYB 1XODA 1WGUA 1U5FA 1X1GA 3G9WA 2Y7BA 3OANA 5C5BB 2M14A 4B6HA 1ZVRA 4GMXB 1DDMA 4A6HA 3KRXA 4K2PA 3FM8C 2NMBA 2VKIA 4H8SA 4CHJA 4Z2MB 4CYEA 1V61A 3NSUA 5D3WA 3D8FA 3X23A 2UZRA 5DH9B 3BINA 3F0WA 3P7ZA 4GPTB 2DTCA 1U27A 1WJ1A 4ZRJA 5J3TA 5C16A 2DA0A 3ODXA 1DDVA 2RNRB 2ELAA 3HQCA 4L6EA 4GZUA 1FHOA 2K2JA 1NI2A 2Z0QA 2CAYA 2D2QA 4HDOA 2J59M 1NTYA 2DHIA 2YS3A 4EJNA 3ML4A 1B55A 2VSZA 2Y8GA 2G35A 3DXEA 3KZ1A 5CLQB 1X86A 2DX1A 4IAPA 2H7DA 4MT7A 1KZGA 4D0NB 2ADZA 1W1GA 2W2WA 4ZRIA 2I5FA 1J19A 1X1FA 2UZSA 2Q13A 2R09A 2COCA 1OY2A 3GYOA 1MIXA 3DXDA 2GCLA 1SHCA 3A8PA 1Y5OA 2DFKA 1U5GA 3WA0A 3FSSA 3VOQA 4EMOA 2EC1A 3PVLA 1GG3A 1V5MA 3PVUA 5J3YA 2R0DA 4WVFB 4HB4B 4F7HA 2J0MA 2P0HA 3UZTA 2H7EA 2RUKB 1BTNA 1UPQA 1FOEA 4IOYX 1BAKA 3BJIA 2KUPA 1PMSA 2COAA 1UNPA 2DHJA 4KHOA 1U5EA 1ZM0A 4C0AA 1SGHA 2GS0A 2W2XD 3ULCA 3D8DA 1PLSA 1MK7B 2DHKA 2M38A 4HAWB 4HAZB 1GC6A 1EVHA 1EAZA 4IFSA 3TFMA 5CLLB 3T06A 5KQ4A 2MWNB 2D11A 2D9VA 1OQNA 2CY4A 1XKEA 2AL6A 2LOXA 1WJMA 4A6FA 1RRPB 3N7CA 1BTKA 5EFXA 1XX0A 1Y19B 2DYQA 3SNHA 2I5CA 4Z2NA 5JHGA 1UNRA 1P5TA 2COFA 5JHHA 3MPXA 1WGQA 1XR0B 3F5RA 3SO6A 1BWNA 4Y94A 3IVFA 2OTXA 2D9ZA 1UEFA 1UPRA 2N0YA 1H4RA 2JP2A 3KY9A 5DHFB 1ZC3B 4NSWA 2D9XA 1GC7A 2P8VA 4HDQA 1TJ6A 3U7DA 2GCJA 1ZC4B 5LONB 3D8EA 4GXBA 2CRFA 4KHAA 2K2UA 2N23A 4WSFA 4MK0A 1DDWA 2UVMA 3FEHA 1FGZA 4HHVA 4YL8A 4DXAB 1LW3A 3CIKA 1TQZA 2I1JA 2LYDA 1FB8A 2DYNA 3TCAA 1X05A 2V76A 3SUZA 5DI9B 4KAXB 1MKEA 5HE1A 1I2HA 1NU2A 3A8QA 3QWMA 1XD4A 3TO1A 4K81A 2HE7A 2MFQA 2RGNB 2YF0A 2KCJA 4XWXA 2YSZA 1EF1A 3U8ZA 3CXBB 3O96A 2RLOA 4F7GA 4KVGB 4A6FB 4PNKA 2LKOA 2ZPYA 5C79A 1EGXA 1DYNA 3MDBC 4GN1A 3VIAA 1FHXA 4DBBA 4HB0B 2NZ8B 3AU5A 2DX5A 1PFJA 3QBVB 1FGYA 4NY0A 2YT0A 5GOWB 4DX8A 2E2XA 1MPHA 2W2XC 3PSCA 3HW2B 3ODWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1V88 A;  2I1K A;  4CHM A;  2CY5 A;  1N3H A;  2BCJ A;  1KZ7 A;  1AQC A;  2J0J A;  4K2O A;  5HE2 A;  3HK0 A;  2LUL A;  5D27 A;  1TXD A;  1M7R A;  2L2I A;  2YRY A;  2MKR A;  3PP2 A;  2YVC A;  2RVB B;  3AJ4 A;  1J0W A;  5DIF B;  1KI1 B;  3TVV A;  4DX9 0;  1WG7 A;  3LJU X;  2HTH B;  2OQB A;  1OMW A;  4HB3 B;  2XQN M;  5JLJ B;  4HAX B;  3M1I B;  4TYZ A;  1W1D A;  2DN6 A;  4MY6 A;  3KRW A;  3RCP A;  2AEH A;  2D4Q A;  2QKM A;  4HAT B;  4WJ7 A;  4EKU A;  1AWE A;  2IFS A;  3P6A A;  5JP4 A;  2FJL A;  2VRW B;  2DLW A;  2P0F A;  4HB2 B;  2LG1 A;  1QQG A;  3SV1 A;  5KCV A;  2YT1 A;  1FHW A;  1U2B A;  1V5U A;  4GMV A;  1WI1 A;  5J3Q A;  1V5P A;  3AU4 A;  1P3R A;  2KGX B;  1H10 A;  2J0K A;  5C5B A;  1MAI A;  2QKL A;  3ODO A;  5FI0 A;  5HE3 A;  4HAU B;  1K5G B;  3ULB A;  5DHA B;  3PEG A;  1Q67 A;  2K00 A;  2LOZ A;  5FI1 A;  4F7U P;  2D9W A;  1MK9 B;  3V5W A;  5C6R A;  1FAO A;  3PVW A;  3PZD A;  3DXC A;  1E5W A;  3GYP A;  2Y8F A;  4P7I A;  2MDX A;  2RSG A;  2D9Y A;  2ROV A;  1M7E A;  1U5D A;  5D3V A;  1RJ2 A;  1DBH A;  2EMT A;  2COD A;  2DKQ A;  3TW1 A;  4A5K A;  4KHB B;  2P0D A;  4PQ0 A;  3A98 B;  4TKN A;  1MIZ B;  3ZDT A;  1UNQ A;  1K5D B;  3SYX A;  1LB1 A;  1DRO A;  2L1C A;  1Z87 A;  2Z0O A;  1P6S A;  1QC6 A;  3KSY A;  1X11 A;  1ZSQ A;  5D3X A;  3PG7 A;  3WYF B;  4BBK A;  1WVH A;  2EMS A;  1XCG A;  1I7A A;  2ELB A;  3QIJ A;  4YON A;  4A6K A;  1W1H A;  2ROZ B;  2YS1 A;  1U29 A;  4K17 A;  5D3Y A;  5KQ1 A;  5L81 A;  5HE0 A;  1ISN A;  2Z0P A;  2IYB A;  1IRS A;  2D10 A;  2GJY A;  2EJ8 A;  1NTV A;  2YS5 A;  2PZ1 A;  4HAV B;  3ZVR A;  5LOP B;  2X18 A;  2DKP A;  4ZRK A;  1V89 A;  4HAY B;  1XOD A;  1WGU A;  1U5F A;  1X1G A;  3G9W A;  2Y7B A;  3OAN A;  5C5B B;  2M14 A;  4B6H A;  1ZVR A;  4GMX B;  1DDM A;  4A6H A;  3KRX A;  4K2P A;  3FM8 C;  2NMB A;  2VKI A;  4H8S A;  4CHJ A;  4Z2M B;  4CYE A;  1V61 A;  3NSU A;  5D3W A;  3D8F A;  3X23 A;  2UZR A;  5DH9 B;  3BIN A;  3F0W A;  3P7Z A;  4GPT B;  2DTC A;  1U27 A;  1WJ1 A;  4ZRJ A;  5J3T A;  5C16 A;  2DA0 A;  3ODX A;  1DDV A;  2RNR B;  2ELA A;  3HQC A;  4L6E A;  4GZU A;  1FHO A;  2K2J A;  1NI2 A;  2Z0Q A;  2CAY A;  2D2Q A;  4HDO A;  2J59 M;  1NTY A;  2DHI A;  2YS3 A;  4EJN A;  3ML4 A;  1B55 A;  2VSZ A;  2Y8G A;  2G35 A;  3DXE A;  3KZ1 A;  5CLQ B;  1X86 A;  2DX1 A;  4IAP A;  2H7D A;  4MT7 A;  1KZG A;  4D0N B;  2ADZ A;  1W1G A;  2W2W A;  4ZRI A;  2I5F A;  1J19 A;  1X1F A;  2UZS A;  2Q13 A;  2R09 A;  2COC A;  1OY2 A;  3GYO A;  1MIX A;  3DXD A;  2GCL A;  1SHC A;  3A8P A;  1Y5O A;  2DFK A;  1U5G A;  3WA0 A;  3FSS A;  3VOQ A;  4EMO A;  2EC1 A;  3PVL A;  1GG3 A;  1V5M A;  3PVU A;  5J3Y A;  2R0D A;  4WVF B;  4HB4 B;  4F7H A;  2J0M A;  2P0H A;  3UZT A;  2H7E A;  2RUK B;  1BTN A;  1UPQ A;  1FOE A;  4IOY X;  1BAK A;  3BJI A;  2KUP A;  1PMS A;  2COA A;  1UNP A;  2DHJ A;  4KHO A;  1U5E A;  1ZM0 A;  4C0A A;  1SGH A;  2GS0 A;  2W2X D;  3ULC A;  3D8D A;  1PLS A;  1MK7 B;  2DHK A;  2M38 A;  4HAW B;  4HAZ B;  1GC6 A;  1EVH A;  1EAZ A;  4IFS A;  3TFM A;  5CLL B;  3T06 A;  5KQ4 A;  2MWN B;  2D11 A;  2D9V A;  1OQN A;  2CY4 A;  1XKE A;  2AL6 A;  2LOX A;  1WJM A;  4A6F A;  1RRP B;  3N7C A;  1BTK A;  5EFX A;  1XX0 A;  1Y19 B;  2DYQ A;  3SNH A;  2I5C A;  4Z2N A;  5JHG A;  1UNR A;  1P5T A;  2COF A;  5JHH A;  3MPX A;  1WGQ A;  1XR0 B;  3F5R A;  3SO6 A;  1BWN A;  4Y94 A;  3IVF A;  2OTX A;  2D9Z A;  1UEF A;  1UPR A;  2N0Y A;  1H4R A;  2JP2 A;  3KY9 A;  5DHF B;  1ZC3 B;  4NSW A;  2D9X A;  1GC7 A;  2P8V A;  4HDQ A;  1TJ6 A;  3U7D A;  2GCJ A;  1ZC4 B;  5LON B;  3D8E A;  4GXB A;  2CRF A;  4KHA A;  2K2U A;  2N23 A;  4WSF A;  4MK0 A;  1DDW A;  2UVM A;  3FEH A;  1FGZ A;  4HHV A;  4YL8 A;  4DXA B;  1LW3 A;  3CIK A;  1TQZ A;  2I1J A;  2LYD A;  1FB8 A;  2DYN A;  3TCA A;  1X05 A;  2V76 A;  3SUZ A;  5DI9 B;  4KAX B;  1MKE A;  5HE1 A;  1I2H A;  1NU2 A;  3A8Q A;  3QWM A;  1XD4 A;  3TO1 A;  4K81 A;  2HE7 A;  2MFQ A;  2RGN B;  2YF0 A;  2KCJ A;  4XWX A;  2YSZ A;  1EF1 A;  3U8Z A;  3CXB B;  3O96 A;  2RLO A;  4F7G A;  4KVG B;  4A6F B;  4PNK A;  2LKO A;  2ZPY A;  5C79 A;  1EGX A;  1DYN A;  3MDB C;  4GN1 A;  3VIA A;  1FHX A;  4DBB A;  4HB0 B;  2NZ8 B;  3AU5 A;  2DX5 A;  1PFJ A;  3QBV B;  1FGY A;  4NY0 A;  2YT0 A;  5GOW B;  4DX8 A;  2E2X A;  1MPH A;  2W2X C;  3PSC A;  3HW2 B;  3ODW A; 
#chains in the Genus database with same CATH topology
 1V88 A;  1T77 A;  2I1K A;  4CHM A;  5M4Y B;  2CY5 A;  1N3H A;  2BCJ A;  1KZ7 A;  1AQC A;  2J0J A;  4K2O A;  5HE2 A;  2K49 A;  3HK0 A;  2LUL A;  5D27 A;  1TXD A;  1M7R A;  2L2I A;  2YRY A;  2MKR A;  3PP2 A;  2YVC A;  2RVB B;  3AJ4 A;  1J0W A;  5DIF B;  1KI1 B;  3DCX A;  2Z13 A;  3TVV A;  4DX9 0;  1WG7 A;  3LJU X;  2HTH B;  2OQB A;  1OMW A;  4HB3 B;  4L1R A;  2XQN M;  5JLJ B;  4HAX B;  3M1I B;  4TYZ A;  1W1D A;  2DN6 A;  4MY6 A;  3FVC A;  3KRW A;  3RCP A;  2AEH A;  2D4Q A;  2QKM A;  4HAT B;  4WJ7 A;  4EKU A;  1AWE A;  2IFS A;  3P6A A;  5JP4 A;  2FJL A;  2VRW B;  2DLW A;  2P0F A;  4HB2 B;  2Z4D A;  2LG1 A;  1QQG A;  3SV1 A;  5KCV A;  2YT1 A;  1FHW A;  1U2B A;  1V5U A;  4GMV A;  1WI1 A;  5J3Q A;  1V5P A;  3AU4 A;  1P3R A;  2KGX B;  1H10 A;  2J0K A;  5C5B A;  1MAI A;  2QKL A;  3ODO A;  5FI0 A;  5HE3 A;  4HAU B;  1K5G B;  3ULB A;  5DHA B;  3PEG A;  1Q67 A;  2K00 A;  2LOZ A;  5FI1 A;  4F7U P;  2D9W A;  1MK9 B;  3V5W A;  3NWF A;  5C6R A;  1FAO A;  2Z14 A;  2NBV A;  3PZD A;  3DXC A;  1E5W A;  3GYP A;  2Y8F A;  3PVW A;  4P7I A;  2MDX A;  2RSG A;  2D9Y A;  2ROV A;  1M7E A;  1U5D A;  5D3V A;  1RJ2 A;  1DBH A;  2EMT A;  2COD A;  2DKQ A;  3TW1 A;  4A5K A;  4KHB B;  2P0D A;  4PQ0 A;  3A98 B;  4TKN A;  1MIZ B;  3ZDT A;  1UNQ A;  1K5D B;  3SYX A;  1LB1 A;  1DRO A;  2L1C A;  1Z87 A;  2Z0O A;  1P6S A;  1QC6 A;  3KSY A;  1X11 A;  1ZSQ A;  5D3X A;  3PG7 A;  3WYF B;  4BBK A;  1WVH A;  2EMS A;  1XCG A;  1I7A A;  2ELB A;  3NW8 A;  3QIJ A;  4YON A;  4A6K A;  1W1H A;  2ROZ B;  2YS1 A;  1U29 A;  4K17 A;  5D3Y A;  5KQ1 A;  5L81 A;  5HE0 A;  1ISN A;  2Z0P A;  4QJ3 B;  2IYB A;  1IRS A;  2D10 A;  2GJY A;  2EJ8 A;  1NTV A;  2YS5 A;  2PZ1 A;  4HAV B;  3ZVR A;  5LOP B;  3HSA A;  2X18 A;  2DKP A;  4ZRK A;  1V89 A;  4HAY B;  1XOD A;  1WGU A;  1U5F A;  1X1G A;  2ZKM X;  2KUQ A;  3G9W A;  2Y7B A;  3OAN A;  5C5B B;  2M14 A;  4B6H A;  3B77 A;  1ZVR A;  4GMX B;  2YT2 A;  1DDM A;  4A6H A;  3KRX A;  4K2P A;  3FM8 C;  2NMB A;  2VKI A;  4H8S A;  4CHJ A;  2GUM A;  4Z2M B;  4GNK B;  4CYE A;  4OSN A;  1V61 A;  3NSU A;  5D3W A;  3D8F A;  3X23 A;  4DIX A;  2UZR A;  5DH9 B;  3BIN A;  3F0W A;  3P7Z A;  4GPT B;  2Z59 A;  2DTC A;  1U27 A;  1WJ1 A;  4ZRJ A;  5J3T A;  3NWD A;  5C16 A;  2DA0 A;  3ODX A;  1DDV A;  2RNR B;  2ELA A;  3HQC A;  4L6E A;  4GZU A;  5I2M A;  1FHO A;  2K2J A;  1NI2 A;  2Z0Q A;  2CAY A;  2D2Q A;  4HDO A;  2J59 M;  1NTY A;  2DHI A;  2YS3 A;  4EJN A;  3NWA A;  3ML4 A;  1B55 A;  2VSZ A;  2Y8G A;  2R2Y A;  2RRF A;  2G35 A;  3DXE A;  3KZ1 A;  5CLQ B;  1X86 A;  2DX1 A;  4IAP A;  2H7D A;  4MT7 A;  1KZG A;  4D0N B;  2ADZ A;  5IRS A;  1W1G A;  2W2W A;  4ZRI A;  2I5F A;  1J19 A;  1X1F A;  2UZS A;  2Q13 A;  2R09 A;  2COC A;  1OY2 A;  3GYO A;  1MIX A;  3DXD A;  2GCL A;  1SHC A;  3A8P A;  1Y5O A;  3HIE A;  2DFK A;  1U5G A;  3WA0 A;  3FSS A;  3VOQ A;  4EMO A;  2EC1 A;  3PVL A;  1GG3 A;  1V5M A;  3PVU A;  5J3Y A;  2R0D A;  4WVF B;  4HB4 B;  4F7H A;  2J0M A;  2P0H A;  2KIG A;  3UZT A;  2H7E A;  2RUK B;  1BTN A;  1UPQ A;  1FOE A;  4IOY X;  1BAK A;  3BJI A;  2KUP A;  1PMS A;  2COA A;  1UNP A;  2DHJ A;  4GOU A;  4KHO A;  1U5E A;  1ZM0 A;  4C0A A;  1SGH A;  2GS0 A;  2W2X D;  3ULC A;  3D8D A;  1PLS A;  1MK7 B;  2DHK A;  2M38 A;  4HAW B;  4HAZ B;  1GC6 A;  1EVH A;  1EAZ A;  4IFS A;  3TFM A;  5CLL B;  3T06 A;  5KQ4 A;  2MWN B;  2D11 A;  2D9V A;  4HSI A;  1OQN A;  2CY4 A;  1XKE A;  4OT1 A;  2AL6 A;  2LOX A;  1WJM A;  4A6F A;  1RRP B;  3N7C A;  2K8E A;  1BTK A;  5EFX A;  1XX0 A;  1Y19 B;  2DYQ A;  3SNH A;  2I5C A;  4Z2N A;  5JHG A;  1UNR A;  1P5T A;  2COF A;  5JHH A;  3MPX A;  1WGQ A;  1XR0 B;  3F5R A;  3SO6 A;  1BWN A;  4Y94 A;  3IVF A;  2OTX A;  2D9Z A;  5LG4 B;  1UEF A;  1UPR A;  2N0Y A;  1H4R A;  2JP2 A;  3KY9 A;  5DHF B;  1ZC3 B;  4NSW A;  2D9X A;  1GC7 A;  2KIE A;  2P8V A;  1TJ6 A;  4HDQ A;  3U7D A;  2GCJ A;  1ZC4 B;  5LON B;  3D8E A;  4GXB A;  2CRF A;  4KHA A;  2K2U A;  2N23 A;  4WSF A;  4MK0 A;  5I2S A;  1DDW A;  1ZYI A;  2UVM A;  3FEH A;  1FGZ A;  4HHV A;  4YL8 A;  2KR0 A;  4DXA B;  1LW3 A;  3CIK A;  1TQZ A;  2I1J A;  2LYD A;  1FB8 A;  2DYN A;  3TCA A;  1X05 A;  2V76 A;  3SUZ A;  5DI9 B;  4KAX B;  1MKE A;  5HE1 A;  1I2H A;  1NU2 A;  3A8Q A;  3QWM A;  1XD4 A;  3TO1 A;  4K81 A;  3A58 A;  2HE7 A;  2MFQ A;  2RGN B;  2YF0 A;  4D6W A;  2KCJ A;  4XWX A;  2YSZ A;  1EF1 A;  3U8Z A;  3CXB B;  3O96 A;  2RLO A;  3U12 A;  4F7G A;  4KVG B;  4A6F B;  4PNK A;  4CSQ A;  2LKO A;  2ZPY A;  5C79 A;  1EGX A;  1DYN A;  3MDB C;  4GN1 A;  3VIA A;  1FHX A;  2FJU B;  4QXA B;  4DBB A;  4QJ5 B;  4HB0 B;  2NZ8 B;  3AU5 A;  3OHM B;  2DX5 A;  1PFJ A;  3QBV B;  4QJ4 B;  1FGY A;  4NY0 A;  2YT0 A;  5GOW B;  4DX8 A;  2E2X A;  1MPH A;  2W2X C;  3PSC A;  3HW2 B;  3ODW A;  4KHB A;  1MI1 A; 
#chains in the Genus database with same CATH homology
 1V88 A;  2I1K A;  4CHM A;  2CY5 A;  1N3H A;  2BCJ A;  1KZ7 A;  1AQC A;  2J0J A;  4K2O A;  5HE2 A;  3HK0 A;  2LUL A;  5D27 A;  1TXD A;  1M7R A;  2L2I A;  2YRY A;  2MKR A;  3PP2 A;  2YVC A;  2RVB B;  3AJ4 A;  1J0W A;  5DIF B;  1KI1 B;  3TVV A;  4DX9 0;  1WG7 A;  3LJU X;  2HTH B;  2OQB A;  1OMW A;  4HB3 B;  2XQN M;  5JLJ B;  4HAX B;  3M1I B;  4TYZ A;  1W1D A;  2DN6 A;  4MY6 A;  3KRW A;  3RCP A;  2AEH A;  2D4Q A;  2QKM A;  4HAT B;  4WJ7 A;  4EKU A;  1AWE A;  2IFS A;  3P6A A;  5JP4 A;  2FJL A;  2VRW B;  2DLW A;  2P0F A;  4HB2 B;  2LG1 A;  1QQG A;  3SV1 A;  5KCV A;  2YT1 A;  1FHW A;  1U2B A;  1V5U A;  4GMV A;  1WI1 A;  5J3Q A;  1V5P A;  3AU4 A;  1P3R A;  2KGX B;  1H10 A;  2J0K A;  5C5B A;  1MAI A;  2QKL A;  3ODO A;  5FI0 A;  5HE3 A;  4HAU B;  1K5G B;  3ULB A;  5DHA B;  3PEG A;  1Q67 A;  2K00 A;  2LOZ A;  5FI1 A;  4F7U P;  2D9W A;  1MK9 B;  3V5W A;  5C6R A;  1FAO A;  3PVW A;  3PZD A;  3DXC A;  1E5W A;  3GYP A;  2Y8F A;  4P7I A;  2MDX A;  2RSG A;  2D9Y A;  2ROV A;  1M7E A;  1U5D A;  5D3V A;  1RJ2 A;  1DBH A;  2EMT A;  2COD A;  2DKQ A;  3TW1 A;  4A5K A;  4KHB B;  2P0D A;  4PQ0 A;  3A98 B;  4TKN A;  1MIZ B;  3ZDT A;  1UNQ A;  1K5D B;  3SYX A;  1LB1 A;  1DRO A;  2L1C A;  1Z87 A;  2Z0O A;  1P6S A;  1QC6 A;  3KSY A;  1X11 A;  1ZSQ A;  5D3X A;  3PG7 A;  3WYF B;  4BBK A;  1WVH A;  2EMS A;  1XCG A;  1I7A A;  2ELB A;  3QIJ A;  4YON A;  4A6K A;  1W1H A;  2ROZ B;  2YS1 A;  1U29 A;  4K17 A;  5D3Y A;  5KQ1 A;  5L81 A;  5HE0 A;  1ISN A;  2Z0P A;  2IYB A;  1IRS A;  2D10 A;  2GJY A;  2EJ8 A;  1NTV A;  2YS5 A;  2PZ1 A;  4HAV B;  3ZVR A;  5LOP B;  2X18 A;  2DKP A;  4ZRK A;  1V89 A;  4HAY B;  1XOD A;  1WGU A;  1U5F A;  1X1G A;  3G9W A;  2Y7B A;  3OAN A;  5C5B B;  2M14 A;  4B6H A;  1ZVR A;  4GMX B;  1DDM A;  4A6H A;  3KRX A;  4K2P A;  3FM8 C;  2NMB A;  2VKI A;  4H8S A;  4CHJ A;  4Z2M B;  4CYE A;  1V61 A;  3NSU A;  5D3W A;  3D8F A;  3X23 A;  2UZR A;  5DH9 B;  3BIN A;  3F0W A;  3P7Z A;  4GPT B;  2DTC A;  1U27 A;  1WJ1 A;  4ZRJ A;  5J3T A;  5C16 A;  2DA0 A;  3ODX A;  1DDV A;  2RNR B;  2ELA A;  3HQC A;  4L6E A;  4GZU A;  1FHO A;  2K2J A;  1NI2 A;  2Z0Q A;  2CAY A;  2D2Q A;  4HDO A;  2J59 M;  1NTY A;  2DHI A;  2YS3 A;  4EJN A;  3ML4 A;  1B55 A;  2VSZ A;  2Y8G A;  2G35 A;  3DXE A;  3KZ1 A;  5CLQ B;  1X86 A;  2DX1 A;  4IAP A;  2H7D A;  4MT7 A;  1KZG A;  4D0N B;  2ADZ A;  1W1G A;  2W2W A;  4ZRI A;  2I5F A;  1J19 A;  1X1F A;  2UZS A;  2Q13 A;  2R09 A;  2COC A;  1OY2 A;  3GYO A;  1MIX A;  3DXD A;  2GCL A;  1SHC A;  3A8P A;  1Y5O A;  2DFK A;  1U5G A;  3WA0 A;  3FSS A;  3VOQ A;  4EMO A;  2EC1 A;  3PVL A;  1GG3 A;  1V5M A;  3PVU A;  5J3Y A;  2R0D A;  4WVF B;  4HB4 B;  4F7H A;  2J0M A;  2P0H A;  3UZT A;  2H7E A;  2RUK B;  1BTN A;  1UPQ A;  1FOE A;  4IOY X;  1BAK A;  3BJI A;  2KUP A;  1PMS A;  2COA A;  1UNP A;  2DHJ A;  4KHO A;  1U5E A;  1ZM0 A;  4C0A A;  1SGH A;  2GS0 A;  2W2X D;  3ULC A;  3D8D A;  1PLS A;  1MK7 B;  2DHK A;  2M38 A;  4HAW B;  4HAZ B;  1GC6 A;  1EVH A;  1EAZ A;  4IFS A;  3TFM A;  5CLL B;  3T06 A;  5KQ4 A;  2MWN B;  2D11 A;  2D9V A;  1OQN A;  2CY4 A;  1XKE A;  2AL6 A;  2LOX A;  1WJM A;  4A6F A;  1RRP B;  3N7C A;  1BTK A;  5EFX A;  1XX0 A;  1Y19 B;  2DYQ A;  3SNH A;  2I5C A;  4Z2N A;  5JHG A;  1UNR A;  1P5T A;  2COF A;  5JHH A;  3MPX A;  1WGQ A;  1XR0 B;  3F5R A;  3SO6 A;  1BWN A;  4Y94 A;  3IVF A;  2OTX A;  2D9Z A;  1UEF A;  1UPR A;  2N0Y A;  1H4R A;  2JP2 A;  3KY9 A;  5DHF B;  1ZC3 B;  4NSW A;  2D9X A;  1GC7 A;  2P8V A;  4HDQ A;  1TJ6 A;  3U7D A;  2GCJ A;  1ZC4 B;  5LON B;  3D8E A;  4GXB A;  2CRF A;  4KHA A;  2K2U A;  2N23 A;  4WSF A;  4MK0 A;  1DDW A;  2UVM A;  3FEH A;  1FGZ A;  4HHV A;  4YL8 A;  4DXA B;  1LW3 A;  3CIK A;  1TQZ A;  2I1J A;  2LYD A;  1FB8 A;  2DYN A;  3TCA A;  1X05 A;  2V76 A;  3SUZ A;  5DI9 B;  4KAX B;  1MKE A;  5HE1 A;  1I2H A;  1NU2 A;  3A8Q A;  3QWM A;  1XD4 A;  3TO1 A;  4K81 A;  2HE7 A;  2MFQ A;  2RGN B;  2YF0 A;  2KCJ A;  4XWX A;  2YSZ A;  1EF1 A;  3U8Z A;  3CXB B;  3O96 A;  2RLO A;  4F7G A;  4KVG B;  4A6F B;  4PNK A;  2LKO A;  2ZPY A;  5C79 A;  1EGX A;  1DYN A;  3MDB C;  4GN1 A;  3VIA A;  1FHX A;  4DBB A;  4HB0 B;  2NZ8 B;  3AU5 A;  2DX5 A;  1PFJ A;  3QBV B;  1FGY A;  4NY0 A;  2YT0 A;  5GOW B;  4DX8 A;  2E2X A;  1MPH A;  2W2X C;  3PSC A;  3HW2 B;  3ODW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...