2JP2A

Solution structure and resonance assignment of the n-terminal evh1 domain from the human spred2 protein (sprouty-related protein with evh1 domain isoform 2)
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
126
structure length
126
Chain Sequence
GSMTEETHPDDDSYIVRVKAVVMTRDDSSGGWFPQEGGGISRVGVCKVMHPEGNGRSGFLIHGERQKDKLVVLECYVRKDLVYTKANPTFHHWKVDNRKFGLTFQSPADARAFDRGVRKAIEDLIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title 1H, 13C and 15N resonance assignment of the human Spred2 EVH1 domain
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords Sprouty-related, EVH1 domain-containing protein 2
total genus 27
structure length 126
sequence length 126
ec nomenclature
pdb deposition date 2007-04-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00568 WH1 WH1 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2jp2A00
2Q13A 4HAVB 4IOYX 2MKRA 2YSZA 3X23A 4Y94A 2R09A 2RGNB 1MAIA 3GYPA 4GPTB 4H8SA 4ZRKA 1AQCA 1WJ1A 1X86A 4PQ0A 4NY0A 1DROA 4A6HA 5L81A 4XWXA 2W2WA 3BJIA 1X1GA 3F0WA 3A8QA 2AEHA 2YT0A 2ELBA 2YS1A 2NZ8B 5DHAB 3AJ4A 2Y8GA 2QKLA 1J19A 4HB2B 1AWEA 1WG7A 1XKEA 5JP4A 3D8FA 2ZPYA 2UZSA 2W2XD 2VRWB 3AU5A 2DHJA 2D9ZA 5DIFB 1Y19B 2LOXA 2L2IA 1E5WA 5HE0A 1EGXA 2YS3A 4TYZA 1K5DB 4GZUA 2CY5A 2P0FA 2LOZA 1P5TA 2EC1A 1MPHA 1MKEA 5CLLB 4A6KA 2K2UA 1DDWA 1DDVA 2EJ8A 2QKMA 2JP2A 2P8VA 2NMBA 1UPQA 3FEHA 2D2QA 2VSZA 1N3HA 4Z2NA 2CY4A 2DLWA 5HE3A 2Y8FA 3UZTA 1RRPB 2UZRA 2D4QA 5LOPB 2DFKA 1I2HA 2I1JA 5HE2A 3P7ZA 4HB3B 1WJMA 1FHXA 3A98B 1ZC3B 4DX90 4HAYB 5D3YA 1XD4A 1BAKA 5C5BA 2D9WA 4A6FB 1MIXA 5GOWB 1KZ7A 4BBKA 4F7UP 1PMSA 4A6FA 4TKNA 4DX8A 2H7DA 3FM8C 2LKOA 3P6AA 1FHOA 2P0HA 1W1GA 5JLJB 2E2XA 3MPXA 2J0KA 2J59M 1U5FA 2KCJA 2PZ1A 2LULA 1NTVA 4HB0B 4IFSA 2I5CA 4WSFA 1FHWA 2DYNA 5HE1A 2N23A 1UPRA 1P6SA 1IRSA 5LONB 4ZRJA 1I7AA 3DXDA 4GXBA 5D3VA 3AU4A 1WGQA 4B6HA 2RVBB 4KVGB 1U2BA 3D8DA 4EJNA 1UNPA 4Z2MB 4HAWB 4EMOA 1RJ2A 5FI1A 4YL8A 1UNRA 2DTCA 1XX0A 3PVWA 4HAZB 1V5PA 2UVMA 2YT1A 3HW2B 3VOQA 1V5MA 4WVFB 3GYOA 2BCJA 1J0WA 1GC7A 5J3QA 4HDOA 1QC6A 1DDMA 4KAXB 3OANA 3SUZA 1QQGA 1XCGA 3QBVB 2YVCA 4HATB 1FAOA 2ROVA 1PFJA 1ZM0A 2LG1A 1BWNA 2DHIA 5DHFB 3ODOA 2VKIA 3DXCA 2ADZA 2ELAA 4CHMA 4MY6A 2K00A 3O96A 2W2XC 2RSGA 2L1CA 2HE7A 2V76A 2X18A 2M14A 2GJYA 1UEFA 2G35A 4KHAA 1X05A 3M1IB 3ODWA 2KUPA 3LJUX 2J0JA 4L6EA 3KSYA 4F7GA 4MK0A 2MWNB 5JHHA 1ZC4B 1OMWA 2GCLA 1WVHA 1M7EA 2DX1A 2DN6A 3N7CA 5J3YA 1V88A 3DXEA 1TXDA 3PSCA 2D9YA 3A8PA 2XQNM 3ZDTA 4WJ7A 2AL6A 1Z87A 1DYNA 1SGHA 1K5GB 4GMVA 1U27A 2IYBA 3ZVRA 4HAXB 3SV1A 1WGUA 3PZDA 4K2PA 4HB4B 1X1FA 1XR0B 3ODXA 5FI0A 4K2OA 5C5BB 4YONA 1Y5OA 4CHJA 3MDBC 3WYFB 4CYEA 5DI9B 2COCA 5DH9B 1M7RA 2GS0A 5C6RA 2RUKB 4F7HA 3BINA 1NTYA 3TO1A 3T06A 2YF0A 4EKUA 1KZGA 4GN1A 3CIKA 3TW1A 4D0NB 3U7DA 1BTKA 1XODA 4DXAB 3D8EA 3VIAA 3KRWA 2EMSA 3PVUA 1FOEA 2Y7BA 1PLSA 3ML4A 2MDXA 2HTHB 1EF1A 5D27A 1U29A 2J0MA 3PP2A 1U5DA 2GCJA 4KHBB 4NSWA 1MK9B 1TQZA 2CAYA 1FGYA 3PG7A 4C0AA 1EAZA 3KZ1A 3ULCA 1WI1A 3HQCA 2Z0QA 2P0DA 2D9VA 1Q67A 1P3RA 5C16A 5KQ4A 2DKQA 1H4RA 1ISNA 1OQNA 1H10A 2FJLA 3ULBA 2DA0A 3SNHA 4ZRIA 3IVFA 3U8ZA 2K2JA 1BTNA 2IFSA 1NU2A 2ROZB 3PVLA 4MT7A 5D3WA 3FSSA 4HHVA 1V61A 3KRXA 4DBBA 3NSUA 2YRYA 3KY9A 3G9WA 1SHCA 5KCVA 2MFQA 5D3XA 2COFA 2COAA 2DKPA 2DX5A 1FB8A 1TJ6A 2LYDA 2M38A 3CXBB 5KQ1A 1MIZB 1GC6A 5JHGA 2Z0PA 1NI2A 3QWMA 5CLQB 1MK7B 3F5RA 4IAPA 4P7IA 4PNKA 1X11A 4HAUB 4HDQA 1U5EA 3SO6A 1W1HA 1ZVRA 3QIJA 2D9XA 2OTXA 2YS5A 3TCAA 4K17A 1OY2A 4A5KA 2RLOA 2Z0OA 2KGXB 2OQBA 1V5UA 3TFMA 3TVVA 1FGZA 1LB1A 1EVHA 1U5GA 2I1KA 4GMXB 2D10A 5J3TA 2I5FA 5C79A 1B55A 4KHOA 1V89A 1KI1B 3HK0A 3RCPA 5EFXA 3SYXA 2H7EA 2DHKA 2CODA 2EMTA 3V5WA 1DBHA 1GG3A 1W1DA 2RNRB 2R0DA 1UNQA 1LW3A 2D11A 2DYQA 3PEGA 1ZSQA 3WA0A 2CRFA 2N0YA 4K81A
chains in the Genus database with same CATH superfamily
2Q13A 4HAVB 4IOYX 2MKRA 2YSZA 3X23A 4Y94A 2R09A 2RGNB 1MAIA 3GYPA 4GPTB 4H8SA 4ZRKA 1AQCA 1WJ1A 1X86A 4PQ0A 4NY0A 4DIXA 1DROA 4A6HA 5L81A 4XWXA 2W2WA 3BJIA 1X1GA 3F0WA 3A8QA 2AEHA 2YT0A 2YT2A 2ELBA 2YS1A 2NZ8B 5DHAB 3AJ4A 2Y8GA 2QKLA 1J19A 4HB2B 1AWEA 1WG7A 1XKEA 5JP4A 3D8FA 2ZPYA 2UZSA 2W2XD 2VRWB 3AU5A 2DHJA 2D9ZA 5DIFB 1Y19B 2LOXA 2L2IA 4KHBA 1E5WA 5HE0A 1EGXA 2YS3A 4TYZA 1K5DB 4GZUA 2Z14A 2CY5A 3NWFA 2P0FA 2LOZA 1P5TA 3A58A 2EC1A 1MPHA 1MKEA 5CLLB 4A6KA 2K2UA 1DDWA 1DDVA 2R2YA 2EJ8A 2QKMA 2JP2A 2P8VA 2NMBA 1UPQA 3FEHA 2D2QA 2VSZA 4OT1A 1N3HA 4Z2NA 2CY4A 2KIGA 3HSAA 4QXAB 2DLWA 5HE3A 2Y8FA 3UZTA 1RRPB 2UZRA 2D4QA 5LOPB 2DFKA 1I2HA 2I1JA 5HE2A 3P7ZA 4HB3B 1WJMA 1FHXA 3A98B 1ZC3B 4DX90 5LG4B 4HAYB 5D3YA 1XD4A 1BAKA 5C5BA 2D9WA 4A6FB 1MIXA 5GOWB 2KUQA 1KZ7A 4BBKA 4F7UP 1PMSA 4A6FA 3HIEA 2GUMA 2K49A 4TKNA 4DX8A 2H7DA 3FM8C 2LKOA 3P6AA 1FHOA 2P0HA 1W1GA 5JLJB 2E2XA 3MPXA 2J0KA 5I2SA 2J59M 1U5FA 2KCJA 2PZ1A 1MI1A 2LULA 1NTVA 4HB0B 4IFSA 2I5CA 4WSFA 1FHWA 2DYNA 5HE1A 2N23A 1UPRA 1P6SA 1IRSA 5LONB 4ZRJA 1I7AA 3DXDA 4GXBA 5D3VA 3AU4A 1WGQA 4B6HA 2RVBB 4KVGB 1U2BA 3D8DA 4EJNA 1UNPA 4Z2MB 4HAWB 4EMOA 1RJ2A 5FI1A 4YL8A 1UNRA 2DTCA 5M4YB 1XX0A 3PVWA 4HAZB 1V5PA 2UVMA 4GOUA 2YT1A 3HW2B 3VOQA 1V5MA 4WVFB 3GYOA 2BCJA 1J0WA 1GC7A 5J3QA 4HDOA 1QC6A 1DDMA 4KAXB 3OANA 3SUZA 1QQGA 1XCGA 3QBVB 2YVCA 4HATB 1FAOA 2ROVA 1PFJA 1ZM0A 2LG1A 1BWNA 2DHIA 5DHFB 3ODOA 2RRFA 2VKIA 3DXCA 2ADZA 2ELAA 4CHMA 4MY6A 2K00A 3O96A 2W2XC 2RSGA 2L1CA 2HE7A 2V76A 2X18A 2M14A 2GJYA 1UEFA 5I2MA 2G35A 4KHAA 1X05A 3M1IB 3ODWA 2KUPA 3LJUX 2J0JA 4L6EA 3KSYA 4F7GA 4MK0A 2MWNB 5JHHA 1ZC4B 1OMWA 2GCLA 1WVHA 1M7EA 2DX1A 2DN6A 3N7CA 5J3YA 1V88A 3DXEA 1TXDA 3PSCA 2D9YA 3A8PA 2XQNM 3ZDTA 4WJ7A 2FJUB 2AL6A 1Z87A 1DYNA 1SGHA 1K5GB 4D6WA 4GMVA 1U27A 2IYBA 3ZVRA 4HAXB 3SV1A 1WGUA 3PZDA 4HB4B 4K2PA 1X1FA 1XR0B 3ODXA 3NWDA 5FI0A 4K2OA 5C5BB 4YONA 1Y5OA 4CHJA 3MDBC 3WYFB 2K8EA 4CYEA 5DI9B 2COCA 5DH9B 1M7RA 2GS0A 5C6RA 2RUKB 4F7HA 3BINA 1NTYA 3TO1A 3T06A 2YF0A 4EKUA 1KZGA 4GN1A 3CIKA 3TW1A 4D0NB 3U7DA 1BTKA 1XODA 4DXAB 2Z59A 3D8EA 3VIAA 3KRWA 2EMSA 3PVUA 1FOEA 2Y7BA 1PLSA 3ML4A 2MDXA 2HTHB 1EF1A 5D27A 1U29A 2J0MA 3PP2A 1U5DA 2GCJA 4KHBB 4NSWA 1MK9B 1TQZA 2CAYA 1FGYA 3PG7A 4C0AA 1EAZA 3KZ1A 3ULCA 1WI1A 3NWAA 3HQCA 2Z0QA 3DCXA 4QJ5B 2P0DA 2D9VA 1Q67A 1ZYIA 4L1RA 1P3RA 5C16A 5KQ4A 4CSQA 2DKQA 1H4RA 1ISNA 1OQNA 1H10A 2FJLA 3ULBA 2DA0A 3SNHA 4ZRIA 3IVFA 3U8ZA 2NBVA 2K2JA 1BTNA 4QJ4B 2IFSA 1NU2A 2ROZB 3PVLA 4MT7A 5D3WA 3FSSA 4HHVA 1V61A 2Z4DA 3KRXA 4DBBA 3NSUA 2YRYA 3KY9A 3G9WA 1SHCA 5KCVA 2MFQA 5D3XA 2COFA 2COAA 2DKPA 2DX5A 1FB8A 1TJ6A 2LYDA 2M38A 3CXBB 5KQ1A 2Z13A 1MIZB 1GC6A 5JHGA 2Z0PA 5IRSA 1NI2A 3QWMA 5CLQB 2KIEA 4QJ3B 1MK7B 3F5RA 4IAPA 4P7IA 4PNKA 1X11A 4HAUB 4HDQA 2KR0A 3FVCA 1U5EA 3SO6A 1W1HA 1ZVRA 3QIJA 2D9XA 3B77A 2OTXA 2YS5A 3TCAA 4K17A 1OY2A 4A5KA 2RLOA 2Z0OA 2KGXB 2OQBA 1V5UA 3TFMA 1T77A 3TVVA 1FGZA 1LB1A 1EVHA 1U5GA 2I1KA 2D10A 4GMXB 5J3TA 2I5FA 2ZKMX 5C79A 1B55A 4KHOA 1V89A 1KI1B 3HK0A 3RCPA 5EFXA 3SYXA 3OHMB 4OSNA 2H7EA 3NW8A 2DHKA 2CODA 2EMTA 3V5WA 1DBHA 1GG3A 1W1DA 2RNRB 2R0DA 4GNKB 1UNQA 1LW3A 2D11A 2DYQA 3PEGA 3U12A 1ZSQA 3WA0A 4HSIA 2CRFA 2N0YA 4K81A
chains in the Genus database with same CATH topology
2Q13A 4HAVB 4IOYX 2MKRA 2YSZA 3X23A 4Y94A 2R09A 2RGNB 1MAIA 3GYPA 4GPTB 4H8SA 4ZRKA 1AQCA 1WJ1A 1X86A 4PQ0A 4NY0A 1DROA 4A6HA 5L81A 4XWXA 2W2WA 3BJIA 1X1GA 3F0WA 3A8QA 2AEHA 2YT0A 2ELBA 2YS1A 2NZ8B 5DHAB 3AJ4A 2Y8GA 2QKLA 1J19A 4HB2B 1AWEA 1WG7A 1XKEA 5JP4A 3D8FA 2ZPYA 2UZSA 2W2XD 2VRWB 3AU5A 2DHJA 2D9ZA 5DIFB 1Y19B 2LOXA 2L2IA 1E5WA 5HE0A 1EGXA 2YS3A 4TYZA 1K5DB 4GZUA 2CY5A 2P0FA 2LOZA 1P5TA 2EC1A 1MPHA 1MKEA 5CLLB 4A6KA 2K2UA 1DDWA 1DDVA 2EJ8A 2QKMA 2JP2A 2P8VA 2NMBA 1UPQA 3FEHA 2D2QA 2VSZA 1N3HA 4Z2NA 2CY4A 2DLWA 5HE3A 2Y8FA 3UZTA 1RRPB 2UZRA 2D4QA 5LOPB 2DFKA 1I2HA 2I1JA 5HE2A 3P7ZA 4HB3B 1WJMA 1FHXA 3A98B 1ZC3B 4DX90 4HAYB 5D3YA 1XD4A 1BAKA 5C5BA 2D9WA 4A6FB 1MIXA 5GOWB 1KZ7A 4BBKA 4F7UP 1PMSA 4A6FA 4TKNA 4DX8A 2H7DA 3FM8C 2LKOA 3P6AA 1FHOA 2P0HA 1W1GA 5JLJB 2E2XA 3MPXA 2J0KA 2J59M 1U5FA 2KCJA 2PZ1A 2LULA 1NTVA 4HB0B 4IFSA 2I5CA 4WSFA 1FHWA 2DYNA 5HE1A 2N23A 1UPRA 1P6SA 1IRSA 5LONB 4ZRJA 1I7AA 3DXDA 4GXBA 5D3VA 3AU4A 1WGQA 4B6HA 2RVBB 4KVGB 1U2BA 3D8DA 4EJNA 1UNPA 4Z2MB 4HAWB 4EMOA 1RJ2A 5FI1A 4YL8A 1UNRA 2DTCA 1XX0A 3PVWA 4HAZB 1V5PA 2UVMA 2YT1A 3HW2B 3VOQA 1V5MA 4WVFB 3GYOA 2BCJA 1J0WA 1GC7A 5J3QA 4HDOA 1QC6A 1DDMA 4KAXB 3OANA 3SUZA 1QQGA 1XCGA 3QBVB 2YVCA 4HATB 1FAOA 2ROVA 1PFJA 1ZM0A 2LG1A 1BWNA 2DHIA 5DHFB 3ODOA 2VKIA 3DXCA 2ADZA 2ELAA 4CHMA 4MY6A 2K00A 3O96A 2W2XC 2RSGA 2L1CA 2HE7A 2V76A 2X18A 2M14A 2GJYA 1UEFA 2G35A 4KHAA 1X05A 3M1IB 3ODWA 2KUPA 3LJUX 2J0JA 4L6EA 3KSYA 4F7GA 4MK0A 2MWNB 5JHHA 1ZC4B 1OMWA 2GCLA 1WVHA 1M7EA 2DX1A 2DN6A 3N7CA 5J3YA 1V88A 3DXEA 1TXDA 3PSCA 2D9YA 3A8PA 2XQNM 3ZDTA 4WJ7A 2AL6A 1Z87A 1DYNA 1SGHA 1K5GB 4GMVA 1U27A 2IYBA 3ZVRA 4HAXB 3SV1A 1WGUA 3PZDA 4K2PA 4HB4B 1X1FA 1XR0B 3ODXA 5FI0A 4K2OA 5C5BB 4YONA 1Y5OA 4CHJA 3MDBC 3WYFB 4CYEA 5DI9B 2COCA 5DH9B 1M7RA 2GS0A 5C6RA 2RUKB 4F7HA 3BINA 1NTYA 3TO1A 3T06A 2YF0A 4EKUA 1KZGA 4GN1A 3CIKA 3TW1A 4D0NB 3U7DA 1BTKA 1XODA 4DXAB 3D8EA 3VIAA 3KRWA 2EMSA 3PVUA 1FOEA 2Y7BA 1PLSA 3ML4A 2MDXA 2HTHB 1EF1A 5D27A 1U29A 2J0MA 3PP2A 1U5DA 2GCJA 4KHBB 4NSWA 1MK9B 1TQZA 2CAYA 1FGYA 3PG7A 4C0AA 1EAZA 3KZ1A 3ULCA 1WI1A 3HQCA 2Z0QA 2P0DA 2D9VA 1Q67A 1P3RA 5C16A 5KQ4A 2DKQA 1H4RA 1ISNA 1OQNA 1H10A 2FJLA 3ULBA 2DA0A 3SNHA 4ZRIA 3IVFA 3U8ZA 2K2JA 1BTNA 2IFSA 1NU2A 2ROZB 3PVLA 4MT7A 5D3WA 3FSSA 4HHVA 1V61A 3KRXA 4DBBA 3NSUA 2YRYA 3KY9A 3G9WA 1SHCA 5KCVA 2MFQA 5D3XA 2COFA 2COAA 2DKPA 2DX5A 1FB8A 1TJ6A 2LYDA 2M38A 3CXBB 5KQ1A 1MIZB 1GC6A 5JHGA 2Z0PA 1NI2A 3QWMA 5CLQB 1MK7B 3F5RA 4IAPA 4P7IA 4PNKA 1X11A 4HAUB 4HDQA 1U5EA 3SO6A 1W1HA 1ZVRA 3QIJA 2D9XA 2OTXA 2YS5A 3TCAA 4K17A 1OY2A 4A5KA 2RLOA 2Z0OA 2KGXB 2OQBA 1V5UA 3TFMA 3TVVA 1FGZA 1LB1A 1EVHA 1U5GA 2I1KA 4GMXB 2D10A 5J3TA 2I5FA 5C79A 1B55A 4KHOA 1V89A 1KI1B 3HK0A 3RCPA 5EFXA 3SYXA 2H7EA 2DHKA 2CODA 2EMTA 3V5WA 1DBHA 1GG3A 1W1DA 2RNRB 2R0DA 1UNQA 1LW3A 2D11A 2DYQA 3PEGA 1ZSQA 3WA0A 2CRFA 2N0YA 4K81A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Q13 A;  4HAV B;  4IOY X;  2MKR A;  2YSZ A;  3X23 A;  4Y94 A;  2R09 A;  2RGN B;  1MAI A;  3GYP A;  4GPT B;  4H8S A;  4ZRK A;  1AQC A;  1WJ1 A;  1X86 A;  4PQ0 A;  4NY0 A;  1DRO A;  4A6H A;  5L81 A;  4XWX A;  2W2W A;  3BJI A;  1X1G A;  3F0W A;  3A8Q A;  2AEH A;  2YT0 A;  2ELB A;  2YS1 A;  2NZ8 B;  5DHA B;  3AJ4 A;  2Y8G A;  2QKL A;  1J19 A;  4HB2 B;  1AWE A;  1WG7 A;  1XKE A;  5JP4 A;  3D8F A;  2ZPY A;  2UZS A;  2W2X D;  2VRW B;  3AU5 A;  2DHJ A;  2D9Z A;  5DIF B;  1Y19 B;  2LOX A;  2L2I A;  1E5W A;  5HE0 A;  1EGX A;  2YS3 A;  4TYZ A;  1K5D B;  4GZU A;  2CY5 A;  2P0F A;  2LOZ A;  1P5T A;  2EC1 A;  1MPH A;  1MKE A;  5CLL B;  4A6K A;  2K2U A;  1DDW A;  1DDV A;  2EJ8 A;  2QKM A;  2JP2 A;  2P8V A;  2NMB A;  1UPQ A;  3FEH A;  2D2Q A;  2VSZ A;  1N3H A;  4Z2N A;  2CY4 A;  2DLW A;  5HE3 A;  2Y8F A;  3UZT A;  1RRP B;  2UZR A;  2D4Q A;  5LOP B;  2DFK A;  1I2H A;  2I1J A;  5HE2 A;  3P7Z A;  4HB3 B;  1WJM A;  1FHX A;  3A98 B;  1ZC3 B;  4DX9 0;  4HAY B;  5D3Y A;  1XD4 A;  1BAK A;  5C5B A;  2D9W A;  4A6F B;  1MIX A;  5GOW B;  1KZ7 A;  4BBK A;  4F7U P;  1PMS A;  4A6F A;  4TKN A;  4DX8 A;  2H7D A;  3FM8 C;  2LKO A;  3P6A A;  1FHO A;  2P0H A;  1W1G A;  5JLJ B;  2E2X A;  3MPX A;  2J0K A;  2J59 M;  1U5F A;  2KCJ A;  2PZ1 A;  2LUL A;  1NTV A;  4HB0 B;  4IFS A;  2I5C A;  4WSF A;  1FHW A;  2DYN A;  5HE1 A;  2N23 A;  1UPR A;  1P6S A;  1IRS A;  5LON B;  4ZRJ A;  1I7A A;  3DXD A;  4GXB A;  5D3V A;  3AU4 A;  1WGQ A;  4B6H A;  2RVB B;  4KVG B;  1U2B A;  3D8D A;  4EJN A;  1UNP A;  4Z2M B;  4HAW B;  4EMO A;  1RJ2 A;  5FI1 A;  4YL8 A;  1UNR A;  2DTC A;  1XX0 A;  3PVW A;  4HAZ B;  1V5P A;  2UVM A;  2YT1 A;  3HW2 B;  3VOQ A;  1V5M A;  4WVF B;  3GYO A;  2BCJ A;  1J0W A;  1GC7 A;  5J3Q A;  4HDO A;  1QC6 A;  1DDM A;  4KAX B;  3OAN A;  3SUZ A;  1QQG A;  1XCG A;  3QBV B;  2YVC A;  4HAT B;  1FAO A;  2ROV A;  1PFJ A;  1ZM0 A;  2LG1 A;  1BWN A;  2DHI A;  5DHF B;  3ODO A;  2VKI A;  3DXC A;  2ADZ A;  2ELA A;  4CHM A;  4MY6 A;  2K00 A;  3O96 A;  2W2X C;  2RSG A;  2L1C A;  2HE7 A;  2V76 A;  2X18 A;  2M14 A;  2GJY A;  1UEF A;  2G35 A;  4KHA A;  1X05 A;  3M1I B;  3ODW A;  2KUP A;  3LJU X;  2J0J A;  4L6E A;  3KSY A;  4F7G A;  4MK0 A;  2MWN B;  5JHH A;  1ZC4 B;  1OMW A;  2GCL A;  1WVH A;  1M7E A;  2DX1 A;  2DN6 A;  3N7C A;  5J3Y A;  1V88 A;  3DXE A;  1TXD A;  3PSC A;  2D9Y A;  3A8P A;  2XQN M;  3ZDT A;  4WJ7 A;  2AL6 A;  1Z87 A;  1DYN A;  1SGH A;  1K5G B;  4GMV A;  1U27 A;  2IYB A;  3ZVR A;  4HAX B;  3SV1 A;  1WGU A;  3PZD A;  4K2P A;  4HB4 B;  1X1F A;  1XR0 B;  3ODX A;  5FI0 A;  4K2O A;  5C5B B;  4YON A;  1Y5O A;  4CHJ A;  3MDB C;  3WYF B;  4CYE A;  5DI9 B;  2COC A;  5DH9 B;  1M7R A;  2GS0 A;  5C6R A;  2RUK B;  4F7H A;  3BIN A;  1NTY A;  3TO1 A;  3T06 A;  2YF0 A;  4EKU A;  1KZG A;  4GN1 A;  3CIK A;  3TW1 A;  4D0N B;  3U7D A;  1BTK A;  1XOD A;  4DXA B;  3D8E A;  3VIA A;  3KRW A;  2EMS A;  3PVU A;  1FOE A;  2Y7B A;  1PLS A;  3ML4 A;  2MDX A;  2HTH B;  1EF1 A;  5D27 A;  1U29 A;  2J0M A;  3PP2 A;  1U5D A;  2GCJ A;  4KHB B;  4NSW A;  1MK9 B;  1TQZ A;  2CAY A;  1FGY A;  3PG7 A;  4C0A A;  1EAZ A;  3KZ1 A;  3ULC A;  1WI1 A;  3HQC A;  2Z0Q A;  2P0D A;  2D9V A;  1Q67 A;  1P3R A;  5C16 A;  5KQ4 A;  2DKQ A;  1H4R A;  1ISN A;  1OQN A;  1H10 A;  2FJL A;  3ULB A;  2DA0 A;  3SNH A;  4ZRI A;  3IVF A;  3U8Z A;  2K2J A;  1BTN A;  2IFS A;  1NU2 A;  2ROZ B;  3PVL A;  4MT7 A;  5D3W A;  3FSS A;  4HHV A;  1V61 A;  3KRX A;  4DBB A;  3NSU A;  2YRY A;  3KY9 A;  3G9W A;  1SHC A;  5KCV A;  2MFQ A;  5D3X A;  2COF A;  2COA A;  2DKP A;  2DX5 A;  1FB8 A;  1TJ6 A;  2LYD A;  2M38 A;  3CXB B;  5KQ1 A;  1MIZ B;  1GC6 A;  5JHG A;  2Z0P A;  1NI2 A;  3QWM A;  5CLQ B;  1MK7 B;  3F5R A;  4IAP A;  4P7I A;  4PNK A;  1X11 A;  4HAU B;  4HDQ A;  1U5E A;  3SO6 A;  1W1H A;  1ZVR A;  3QIJ A;  2D9X A;  2OTX A;  2YS5 A;  3TCA A;  4K17 A;  1OY2 A;  4A5K A;  2RLO A;  2Z0O A;  2KGX B;  2OQB A;  1V5U A;  3TFM A;  3TVV A;  1FGZ A;  1LB1 A;  1EVH A;  1U5G A;  2I1K A;  4GMX B;  2D10 A;  5J3T A;  2I5F A;  5C79 A;  1B55 A;  4KHO A;  1V89 A;  1KI1 B;  3HK0 A;  3RCP A;  5EFX A;  3SYX A;  2H7E A;  2DHK A;  2COD A;  2EMT A;  3V5W A;  1DBH A;  1GG3 A;  1W1D A;  2RNR B;  2R0D A;  1UNQ A;  1LW3 A;  2D11 A;  2DYQ A;  3PEG A;  1ZSQ A;  3WA0 A;  2CRF A;  2N0Y A;  4K81 A; 
#chains in the Genus database with same CATH topology
 2Q13 A;  4HAV B;  4IOY X;  2MKR A;  2YSZ A;  3X23 A;  4Y94 A;  2R09 A;  2RGN B;  1MAI A;  3GYP A;  4GPT B;  4H8S A;  4ZRK A;  1AQC A;  1WJ1 A;  1X86 A;  4PQ0 A;  4NY0 A;  4DIX A;  1DRO A;  4A6H A;  5L81 A;  4XWX A;  2W2W A;  3BJI A;  1X1G A;  3F0W A;  3A8Q A;  2AEH A;  2YT0 A;  2YT2 A;  2ELB A;  2YS1 A;  2NZ8 B;  5DHA B;  3AJ4 A;  2Y8G A;  2QKL A;  1J19 A;  4HB2 B;  1AWE A;  1WG7 A;  1XKE A;  5JP4 A;  3D8F A;  2ZPY A;  2UZS A;  2W2X D;  2VRW B;  3AU5 A;  2DHJ A;  2D9Z A;  5DIF B;  1Y19 B;  2LOX A;  2L2I A;  4KHB A;  1E5W A;  5HE0 A;  1EGX A;  2YS3 A;  4TYZ A;  1K5D B;  4GZU A;  2Z14 A;  2CY5 A;  3NWF A;  2P0F A;  2LOZ A;  1P5T A;  3A58 A;  2EC1 A;  1MPH A;  1MKE A;  5CLL B;  4A6K A;  2K2U A;  1DDW A;  1DDV A;  2R2Y A;  2EJ8 A;  2QKM A;  2JP2 A;  2P8V A;  2NMB A;  1UPQ A;  3FEH A;  2D2Q A;  2VSZ A;  4OT1 A;  1N3H A;  4Z2N A;  2CY4 A;  2KIG A;  3HSA A;  4QXA B;  2DLW A;  5HE3 A;  2Y8F A;  3UZT A;  1RRP B;  2UZR A;  2D4Q A;  5LOP B;  2DFK A;  1I2H A;  2I1J A;  5HE2 A;  3P7Z A;  4HB3 B;  1WJM A;  1FHX A;  3A98 B;  1ZC3 B;  4DX9 0;  5LG4 B;  4HAY B;  5D3Y A;  1XD4 A;  1BAK A;  5C5B A;  2D9W A;  4A6F B;  1MIX A;  5GOW B;  2KUQ A;  1KZ7 A;  4BBK A;  4F7U P;  1PMS A;  4A6F A;  3HIE A;  2GUM A;  2K49 A;  4TKN A;  4DX8 A;  2H7D A;  3FM8 C;  2LKO A;  3P6A A;  1FHO A;  2P0H A;  1W1G A;  5JLJ B;  2E2X A;  3MPX A;  2J0K A;  5I2S A;  2J59 M;  1U5F A;  2KCJ A;  2PZ1 A;  1MI1 A;  2LUL A;  1NTV A;  4HB0 B;  4IFS A;  2I5C A;  4WSF A;  1FHW A;  2DYN A;  5HE1 A;  2N23 A;  1UPR A;  1P6S A;  1IRS A;  5LON B;  4ZRJ A;  1I7A A;  3DXD A;  4GXB A;  5D3V A;  3AU4 A;  1WGQ A;  4B6H A;  2RVB B;  4KVG B;  1U2B A;  3D8D A;  4EJN A;  1UNP A;  4Z2M B;  4HAW B;  4EMO A;  1RJ2 A;  5FI1 A;  4YL8 A;  1UNR A;  2DTC A;  5M4Y B;  1XX0 A;  3PVW A;  4HAZ B;  1V5P A;  2UVM A;  4GOU A;  2YT1 A;  3HW2 B;  3VOQ A;  1V5M A;  4WVF B;  3GYO A;  2BCJ A;  1J0W A;  1GC7 A;  5J3Q A;  4HDO A;  1QC6 A;  1DDM A;  4KAX B;  3OAN A;  3SUZ A;  1QQG A;  1XCG A;  3QBV B;  2YVC A;  4HAT B;  1FAO A;  2ROV A;  1PFJ A;  1ZM0 A;  2LG1 A;  1BWN A;  2DHI A;  5DHF B;  3ODO A;  2RRF A;  2VKI A;  3DXC A;  2ADZ A;  2ELA A;  4CHM A;  4MY6 A;  2K00 A;  3O96 A;  2W2X C;  2RSG A;  2L1C A;  2HE7 A;  2V76 A;  2X18 A;  2M14 A;  2GJY A;  1UEF A;  5I2M A;  2G35 A;  4KHA A;  1X05 A;  3M1I B;  3ODW A;  2KUP A;  3LJU X;  2J0J A;  4L6E A;  3KSY A;  4F7G A;  4MK0 A;  2MWN B;  5JHH A;  1ZC4 B;  1OMW A;  2GCL A;  1WVH A;  1M7E A;  2DX1 A;  2DN6 A;  3N7C A;  5J3Y A;  1V88 A;  3DXE A;  1TXD A;  3PSC A;  2D9Y A;  3A8P A;  2XQN M;  3ZDT A;  4WJ7 A;  2FJU B;  2AL6 A;  1Z87 A;  1DYN A;  1SGH A;  1K5G B;  4D6W A;  4GMV A;  1U27 A;  2IYB A;  3ZVR A;  4HAX B;  3SV1 A;  1WGU A;  3PZD A;  4HB4 B;  4K2P A;  1X1F A;  1XR0 B;  3ODX A;  3NWD A;  5FI0 A;  4K2O A;  5C5B B;  4YON A;  1Y5O A;  4CHJ A;  3MDB C;  3WYF B;  2K8E A;  4CYE A;  5DI9 B;  2COC A;  5DH9 B;  1M7R A;  2GS0 A;  5C6R A;  2RUK B;  4F7H A;  3BIN A;  1NTY A;  3TO1 A;  3T06 A;  2YF0 A;  4EKU A;  1KZG A;  4GN1 A;  3CIK A;  3TW1 A;  4D0N B;  3U7D A;  1BTK A;  1XOD A;  4DXA B;  2Z59 A;  3D8E A;  3VIA A;  3KRW A;  2EMS A;  3PVU A;  1FOE A;  2Y7B A;  1PLS A;  3ML4 A;  2MDX A;  2HTH B;  1EF1 A;  5D27 A;  1U29 A;  2J0M A;  3PP2 A;  1U5D A;  2GCJ A;  4KHB B;  4NSW A;  1MK9 B;  1TQZ A;  2CAY A;  1FGY A;  3PG7 A;  4C0A A;  1EAZ A;  3KZ1 A;  3ULC A;  1WI1 A;  3NWA A;  3HQC A;  2Z0Q A;  3DCX A;  4QJ5 B;  2P0D A;  2D9V A;  1Q67 A;  1ZYI A;  4L1R A;  1P3R A;  5C16 A;  5KQ4 A;  4CSQ A;  2DKQ A;  1H4R A;  1ISN A;  1OQN A;  1H10 A;  2FJL A;  3ULB A;  2DA0 A;  3SNH A;  4ZRI A;  3IVF A;  3U8Z A;  2NBV A;  2K2J A;  1BTN A;  4QJ4 B;  2IFS A;  1NU2 A;  2ROZ B;  3PVL A;  4MT7 A;  5D3W A;  3FSS A;  4HHV A;  1V61 A;  2Z4D A;  3KRX A;  4DBB A;  3NSU A;  2YRY A;  3KY9 A;  3G9W A;  1SHC A;  5KCV A;  2MFQ A;  5D3X A;  2COF A;  2COA A;  2DKP A;  2DX5 A;  1FB8 A;  1TJ6 A;  2LYD A;  2M38 A;  3CXB B;  5KQ1 A;  2Z13 A;  1MIZ B;  1GC6 A;  5JHG A;  2Z0P A;  5IRS A;  1NI2 A;  3QWM A;  5CLQ B;  2KIE A;  4QJ3 B;  1MK7 B;  3F5R A;  4IAP A;  4P7I A;  4PNK A;  1X11 A;  4HAU B;  4HDQ A;  2KR0 A;  3FVC A;  1U5E A;  3SO6 A;  1W1H A;  1ZVR A;  3QIJ A;  2D9X A;  3B77 A;  2OTX A;  2YS5 A;  3TCA A;  4K17 A;  1OY2 A;  4A5K A;  2RLO A;  2Z0O A;  2KGX B;  2OQB A;  1V5U A;  3TFM A;  1T77 A;  3TVV A;  1FGZ A;  1LB1 A;  1EVH A;  1U5G A;  2I1K A;  2D10 A;  4GMX B;  5J3T A;  2I5F A;  2ZKM X;  5C79 A;  1B55 A;  4KHO A;  1V89 A;  1KI1 B;  3HK0 A;  3RCP A;  5EFX A;  3SYX A;  3OHM B;  4OSN A;  2H7E A;  3NW8 A;  2DHK A;  2COD A;  2EMT A;  3V5W A;  1DBH A;  1GG3 A;  1W1D A;  2RNR B;  2R0D A;  4GNK B;  1UNQ A;  1LW3 A;  2D11 A;  2DYQ A;  3PEG A;  3U12 A;  1ZSQ A;  3WA0 A;  4HSI A;  2CRF A;  2N0Y A;  4K81 A; 
#chains in the Genus database with same CATH homology
 2Q13 A;  4HAV B;  4IOY X;  2MKR A;  2YSZ A;  3X23 A;  4Y94 A;  2R09 A;  2RGN B;  1MAI A;  3GYP A;  4GPT B;  4H8S A;  4ZRK A;  1AQC A;  1WJ1 A;  1X86 A;  4PQ0 A;  4NY0 A;  1DRO A;  4A6H A;  5L81 A;  4XWX A;  2W2W A;  3BJI A;  1X1G A;  3F0W A;  3A8Q A;  2AEH A;  2YT0 A;  2ELB A;  2YS1 A;  2NZ8 B;  5DHA B;  3AJ4 A;  2Y8G A;  2QKL A;  1J19 A;  4HB2 B;  1AWE A;  1WG7 A;  1XKE A;  5JP4 A;  3D8F A;  2ZPY A;  2UZS A;  2W2X D;  2VRW B;  3AU5 A;  2DHJ A;  2D9Z A;  5DIF B;  1Y19 B;  2LOX A;  2L2I A;  1E5W A;  5HE0 A;  1EGX A;  2YS3 A;  4TYZ A;  1K5D B;  4GZU A;  2CY5 A;  2P0F A;  2LOZ A;  1P5T A;  2EC1 A;  1MPH A;  1MKE A;  5CLL B;  4A6K A;  2K2U A;  1DDW A;  1DDV A;  2EJ8 A;  2QKM A;  2JP2 A;  2P8V A;  2NMB A;  1UPQ A;  3FEH A;  2D2Q A;  2VSZ A;  1N3H A;  4Z2N A;  2CY4 A;  2DLW A;  5HE3 A;  2Y8F A;  3UZT A;  1RRP B;  2UZR A;  2D4Q A;  5LOP B;  2DFK A;  1I2H A;  2I1J A;  5HE2 A;  3P7Z A;  4HB3 B;  1WJM A;  1FHX A;  3A98 B;  1ZC3 B;  4DX9 0;  4HAY B;  5D3Y A;  1XD4 A;  1BAK A;  5C5B A;  2D9W A;  4A6F B;  1MIX A;  5GOW B;  1KZ7 A;  4BBK A;  4F7U P;  1PMS A;  4A6F A;  4TKN A;  4DX8 A;  2H7D A;  3FM8 C;  2LKO A;  3P6A A;  1FHO A;  2P0H A;  1W1G A;  5JLJ B;  2E2X A;  3MPX A;  2J0K A;  2J59 M;  1U5F A;  2KCJ A;  2PZ1 A;  2LUL A;  1NTV A;  4HB0 B;  4IFS A;  2I5C A;  4WSF A;  1FHW A;  2DYN A;  5HE1 A;  2N23 A;  1UPR A;  1P6S A;  1IRS A;  5LON B;  4ZRJ A;  1I7A A;  3DXD A;  4GXB A;  5D3V A;  3AU4 A;  1WGQ A;  4B6H A;  2RVB B;  4KVG B;  1U2B A;  3D8D A;  4EJN A;  1UNP A;  4Z2M B;  4HAW B;  4EMO A;  1RJ2 A;  5FI1 A;  4YL8 A;  1UNR A;  2DTC A;  1XX0 A;  3PVW A;  4HAZ B;  1V5P A;  2UVM A;  2YT1 A;  3HW2 B;  3VOQ A;  1V5M A;  4WVF B;  3GYO A;  2BCJ A;  1J0W A;  1GC7 A;  5J3Q A;  4HDO A;  1QC6 A;  1DDM A;  4KAX B;  3OAN A;  3SUZ A;  1QQG A;  1XCG A;  3QBV B;  2YVC A;  4HAT B;  1FAO A;  2ROV A;  1PFJ A;  1ZM0 A;  2LG1 A;  1BWN A;  2DHI A;  5DHF B;  3ODO A;  2VKI A;  3DXC A;  2ADZ A;  2ELA A;  4CHM A;  4MY6 A;  2K00 A;  3O96 A;  2W2X C;  2RSG A;  2L1C A;  2HE7 A;  2V76 A;  2X18 A;  2M14 A;  2GJY A;  1UEF A;  2G35 A;  4KHA A;  1X05 A;  3M1I B;  3ODW A;  2KUP A;  3LJU X;  2J0J A;  4L6E A;  3KSY A;  4F7G A;  4MK0 A;  2MWN B;  5JHH A;  1ZC4 B;  1OMW A;  2GCL A;  1WVH A;  1M7E A;  2DX1 A;  2DN6 A;  3N7C A;  5J3Y A;  1V88 A;  3DXE A;  1TXD A;  3PSC A;  2D9Y A;  3A8P A;  2XQN M;  3ZDT A;  4WJ7 A;  2AL6 A;  1Z87 A;  1DYN A;  1SGH A;  1K5G B;  4GMV A;  1U27 A;  2IYB A;  3ZVR A;  4HAX B;  3SV1 A;  1WGU A;  3PZD A;  4K2P A;  4HB4 B;  1X1F A;  1XR0 B;  3ODX A;  5FI0 A;  4K2O A;  5C5B B;  4YON A;  1Y5O A;  4CHJ A;  3MDB C;  3WYF B;  4CYE A;  5DI9 B;  2COC A;  5DH9 B;  1M7R A;  2GS0 A;  5C6R A;  2RUK B;  4F7H A;  3BIN A;  1NTY A;  3TO1 A;  3T06 A;  2YF0 A;  4EKU A;  1KZG A;  4GN1 A;  3CIK A;  3TW1 A;  4D0N B;  3U7D A;  1BTK A;  1XOD A;  4DXA B;  3D8E A;  3VIA A;  3KRW A;  2EMS A;  3PVU A;  1FOE A;  2Y7B A;  1PLS A;  3ML4 A;  2MDX A;  2HTH B;  1EF1 A;  5D27 A;  1U29 A;  2J0M A;  3PP2 A;  1U5D A;  2GCJ A;  4KHB B;  4NSW A;  1MK9 B;  1TQZ A;  2CAY A;  1FGY A;  3PG7 A;  4C0A A;  1EAZ A;  3KZ1 A;  3ULC A;  1WI1 A;  3HQC A;  2Z0Q A;  2P0D A;  2D9V A;  1Q67 A;  1P3R A;  5C16 A;  5KQ4 A;  2DKQ A;  1H4R A;  1ISN A;  1OQN A;  1H10 A;  2FJL A;  3ULB A;  2DA0 A;  3SNH A;  4ZRI A;  3IVF A;  3U8Z A;  2K2J A;  1BTN A;  2IFS A;  1NU2 A;  2ROZ B;  3PVL A;  4MT7 A;  5D3W A;  3FSS A;  4HHV A;  1V61 A;  3KRX A;  4DBB A;  3NSU A;  2YRY A;  3KY9 A;  3G9W A;  1SHC A;  5KCV A;  2MFQ A;  5D3X A;  2COF A;  2COA A;  2DKP A;  2DX5 A;  1FB8 A;  1TJ6 A;  2LYD A;  2M38 A;  3CXB B;  5KQ1 A;  1MIZ B;  1GC6 A;  5JHG A;  2Z0P A;  1NI2 A;  3QWM A;  5CLQ B;  1MK7 B;  3F5R A;  4IAP A;  4P7I A;  4PNK A;  1X11 A;  4HAU B;  4HDQ A;  1U5E A;  3SO6 A;  1W1H A;  1ZVR A;  3QIJ A;  2D9X A;  2OTX A;  2YS5 A;  3TCA A;  4K17 A;  1OY2 A;  4A5K A;  2RLO A;  2Z0O A;  2KGX B;  2OQB A;  1V5U A;  3TFM A;  3TVV A;  1FGZ A;  1LB1 A;  1EVH A;  1U5G A;  2I1K A;  4GMX B;  2D10 A;  5J3T A;  2I5F A;  5C79 A;  1B55 A;  4KHO A;  1V89 A;  1KI1 B;  3HK0 A;  3RCP A;  5EFX A;  3SYX A;  2H7E A;  2DHK A;  2COD A;  2EMT A;  3V5W A;  1DBH A;  1GG3 A;  1W1D A;  2RNR B;  2R0D A;  1UNQ A;  1LW3 A;  2D11 A;  2DYQ A;  3PEG A;  1ZSQ A;  3WA0 A;  2CRF A;  2N0Y A;  4K81 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...