2JP2A

Solution structure and resonance assignment of the n-terminal evh1 domain from the human spred2 protein (sprouty-related protein with evh1 domain isoform 2)
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
126
structure length
126
Chain Sequence
GSMTEETHPDDDSYIVRVKAVVMTRDDSSGGWFPQEGGGISRVGVCKVMHPEGNGRSGFLIHGERQKDKLVVLECYVRKDLVYTKANPTFHHWKVDNRKFGLTFQSPADARAFDRGVRKAIEDLIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords Sprouty-related, EVH1 domain-containing protein 2
publication title 1H, 13C and 15N resonance assignment of the human Spred2 EVH1 domain
pubmed doi rcsb
source organism Homo sapiens
total genus 27
structure length 126
sequence length 126
ec nomenclature
pdb deposition date 2007-04-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00568 WH1 WH1 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2jp2A00
4F7HA 2PZ1A 3NSUA 1XX0A 1WGUA 5DHFB 1WI1A 1Y19B 4GZUA 2EJ8A 1ZC4B 2GCLA 4NY0A 3T06A 1PMSA 2YS1A 1EGXA 2DKPA 2DYQA 4TYZA 1K5DB 1H4RA 3QWMA 1OQNA 2BCJA 2RNRB 2GS0A 4HB0B 4A6KA 5HE1A 4EMOA 2UZRA 1ZM0A 2LOXA 2JP2A 2MFQA 2W2XD 2VKIA 4HDQA 3KSYA 3ML4A 3RCPA 4MY6A 1FB8A 2HTHB 1X1FA 2KGXB 5J3YA 4KVGB 2L2IA 2N23A 1DDVA 3TVVA 2COAA 5DHAB 3WA0A 3G9WA 1GC7A 1K5GB 1TXDA 1XR0B 5D3VA 4EKUA 1GG3A 2Q13A 1PLSA 1NTYA 2J0KA 3F5RA 2AEHA 1U27A 2E2XA 1FGZA 2I1KA 1DYNA 2GCJA 4BBKA 1X05A 1UPQA 1V5MA 1UPRA 2M38A 2DTCA 1U5GA 5J3QA 1KI1B 5DI9B 5C5BA 3GYOA 5D3YA 3U8ZA 2MDXA 3LJUX 2KUPA 3FM8C 1FGYA 1P6SA 4C0AA 1XODA 2YS5A 4CYEA 1AWEA 2YSZA 1M7RA 4A6HA 3AU5A 2W2WA 2ADZA 4K81A 2K00A 3ULBA 2FJLA 3F0WA 4A6FB 4K2PA 5GOWB 2L1CA 4PQ0A 1W1HA 4HATB 4GPTB 4DXAB 1MKEA 2ROZB 3HQCA 3KRXA 3P6AA 4WVFB 1U5DA 3ZVRA 2LKOA 2DFKA 1WG7A 2RGNB 3TFMA 4KHAA 1UNRA 3MPXA 3QIJA 4IAPA 4HAWB 2YVCA 2R0DA 4GMXB 2H7DA 2D9ZA 1I2HA 1LB1A 4HAUB 3DXDA 2D4QA 2I5FA 3IVFA 1SHCA 1W1DA 2D2QA 2VSZA 1X86A 3V5WA 1XCGA 3CXBB 2D9YA 2J59M 1BTNA 1NI2A 3FEHA 1RRPB 5LONB 4P7IA 3ODWA 2Z0OA 2IFSA 4HB2B 2LOZA 1V61A 4KHBB 1N3HA 2UZSA 4HAYB 2HE7A 4ZRIA 2D10A 1DROA 3A8PA 2J0JA 1SGHA 3TO1A 5JLJB 3X23A 1DDMA 2D9VA 2CRFA 5JP4A 2LG1A 2YS3A 1BTKA 1Y5OA 2M14A 1UNPA 3KZ1A 4DBBA 1FHXA 2DHJA 3U7DA 4B6HA 5JHHA 5D27A 2V76A 2CY4A 5C16A 4H8SA 1ZC3B 2X18A 5HE0A 2DHIA 4GMVA 3SYXA 1MIZB 2MWNB 1MK7B 2DA0A 1EAZA 3AJ4A 4ZRJA 4CHJA 1WGQA 2OTXA 2ELAA 1M7EA 4WSFA 3PVLA 1Q67A 3PZDA 5HE3A 2ZPYA 1P3RA 4Z2MB 1X1GA 4KHOA 2DYNA 4HHVA 1IRSA 2P0DA 1ZVRA 3FSSA 2COFA 3HK0A 4GN1A 3ODOA 1Z87A 5C6RA 3HW2B 1RJ2A 3PVWA 1ISNA 1QQGA 2QKLA 1WJ1A 1MPHA 2LULA 1X11A 2G35A 1WVHA 2EMTA 4K17A 2R09A 2NZ8B 5KQ1A 3A98B 1I7AA 4DX90 2RLOA 5FI1A 2EMSA 4HDOA 4A6FA 5DH9B 1DDWA 2KCJA 1FAOA 2ROVA 3D8EA 2P8VA 5D3XA 1NU2A 1W1GA 2COCA 3PP2A 2DLWA 3PEGA 4HB3B 5KQ4A 4WJ7A 1V5UA 3KY9A 2AL6A 3VIAA 1MIXA 1U29A 1TJ6A 4ZRKA 1OY2A 4K2OA 2P0HA 1MK9B 5D3WA 2OQBA 2RVBB 1FHWA 2YT0A 4Z2NA 4A5KA 3TW1A 2K2UA 3D8DA 3BINA 4IOYX 2DKQA 2ELBA 3BJIA 4CHMA 1V5PA 2RSGA 2CY5A 5DIFB 4XWXA 1QC6A 3OANA 2Y7BA 2YT1A 2I5CA 1J0WA 3AU4A 4MT7A 3DXCA 1H10A 4HAVB 5HE2A 3SNHA 2QKMA 2NMBA 4YL8A 3DXEA 4F7UP 3A8QA 1XD4A 1TQZA 1LW3A 1MAIA 1DBHA 4PNKA 3D8FA 5JHGA 1UNQA 3SV1A 2D11A 4TKNA 2Z0PA 5KCVA 1BAKA 2XQNM 3ZDTA 1V88A 2LYDA 3SUZA 2VRWB 2YF0A 2I1JA 3PSCA 1E5WA 4HB4B 4GXBA 1B55A 3CIKA 3WYFB 1V89A 5C5BB 1KZGA 1ZSQA 3P7ZA 5J3TA 1BWNA 4Y94A 1FHOA 1XKEA 5L81A 3UZTA 1UEFA 4YONA 2D9WA 1KZ7A 1NTVA 4IFSA 2P0FA 2D9XA 1AQCA 2H7EA 2K2JA 2GJYA 1GC6A 5C79A 4HAXB 4EJNA 1EVHA 2CODA 2YRYA 4F7GA 5CLLB 2RUKB 2UVMA 4L6EA 4D0NB 1PFJA 3KRWA 2DN6A 2IYBA 3MDBC 3O96A 2DX1A 3M1IB 2W2XC 4NSWA 1J19A 2Y8FA 5FI0A 3N7CA 3VOQA 3GYPA 1FOEA 1OMWA 2EC1A 1WJMA 3ULCA 2DHKA 2Y8GA 2MKRA 4HAZB 3QBVB 5LOPB 4DX8A 1U5FA 1U5EA 2CAYA 2Z0QA 1EF1A 3PVUA 4MK0A 1U2BA 2N0YA 2J0MA 3ODXA 5EFXA 3SO6A 5CLQB 1P5TA 3TCAA 3PG7A 2DX5A 4KAXB
chains in the Genus database with same CATH superfamily
4F7HA 2PZ1A 3NSUA 1XX0A 1WGUA 5DHFB 1WI1A 5LG4B 1Y19B 4GZUA 2EJ8A 2KR0A 1ZC4B 2GCLA 4NY0A 3T06A 1PMSA 2YS1A 1EGXA 5IRSA 2DKPA 2DYQA 4TYZA 1K5DB 1H4RA 3QWMA 1OQNA 2BCJA 2RNRB 4CSQA 2GS0A 4HB0B 3NWAA 4A6KA 5HE1A 5I2MA 4OSNA 2Z59A 4EMOA 2UZRA 1ZM0A 2LOXA 2JP2A 2MFQA 2W2XD 2VKIA 4HDQA 3KSYA 4QJ3B 3ML4A 3RCPA 4MY6A 1FB8A 2HTHB 1X1FA 2KGXB 5J3YA 4KVGB 2L2IA 4DIXA 2N23A 1DDVA 3TVVA 2COAA 5DHAB 3WA0A 3G9WA 1GC7A 3NW8A 1K5GB 1TXDA 1XR0B 5D3VA 4EKUA 1GG3A 2Q13A 1PLSA 2R2YA 1NTYA 2J0KA 3F5RA 2AEHA 1U27A 2E2XA 1FGZA 2I1KA 1DYNA 2GCJA 4BBKA 1X05A 1UPQA 1V5MA 1UPRA 2M38A 2DTCA 1U5GA 5J3QA 1KI1B 5DI9B 5C5BA 3GYOA 5D3YA 3U8ZA 2MDXA 3LJUX 2KUPA 3FM8C 5I2SA 1FGYA 1P6SA 4C0AA 1XODA 2YS5A 4CYEA 1AWEA 2YSZA 1M7RA 4A6HA 3AU5A 2W2WA 2ADZA 4K81A 2K00A 3ULBA 2FJLA 3F0WA 4A6FB 4K2PA 5GOWB 2L1CA 4PQ0A 1W1HA 4HATB 2NBVA 4GPTB 4DXAB 1MKEA 2ROZB 2YT2A 3HQCA 3KRXA 3P6AA 4WVFB 1U5DA 3ZVRA 2LKOA 2FJUB 2DFKA 1WG7A 2RGNB 3TFMA 4KHAA 1UNRA 3MPXA 3QIJA 4IAPA 2K8EA 4HAWB 2YVCA 2R0DA 4GMXB 2H7DA 2D9ZA 1MI1A 1I2HA 1LB1A 4HAUB 3DXDA 2D4QA 2I5FA 3IVFA 4HSIA 1SHCA 1W1DA 2D2QA 2VSZA 1X86A 3V5WA 2Z14A 1XCGA 3CXBB 2D9YA 2J59M 1BTNA 3HIEA 1NI2A 3FEHA 1RRPB 5LONB 4P7IA 3ODWA 2Z0OA 2IFSA 4HB2B 2LOZA 1V61A 3HSAA 4KHBB 1N3HA 2UZSA 4HAYB 2HE7A 4ZRIA 2D10A 1DROA 3A8PA 2J0JA 1SGHA 3TO1A 5JLJB 3X23A 1DDMA 2D9VA 2CRFA 2KIGA 5JP4A 2LG1A 2YS3A 1BTKA 4GNKB 1Y5OA 2M14A 1UNPA 3KZ1A 4DBBA 1FHXA 2DHJA 3U7DA 4B6HA 5JHHA 5D27A 2V76A 2CY4A 5C16A 4H8SA 1ZC3B 2X18A 5HE0A 2DHIA 4GMVA 3SYXA 1MIZB 2MWNB 4GOUA 1MK7B 2DA0A 1EAZA 3AJ4A 4ZRJA 4D6WA 4CHJA 1WGQA 2OTXA 2ELAA 1M7EA 4WSFA 3PVLA 1Q67A 3PZDA 5HE3A 3U12A 2ZPYA 1P3RA 4Z2MB 1X1GA 4KHOA 2DYNA 4HHVA 1IRSA 2P0DA 1ZVRA 3FSSA 2COFA 3HK0A 4GN1A 3ODOA 1Z87A 5C6RA 3HW2B 1RJ2A 3PVWA 1ISNA 1QQGA 2RRFA 2QKLA 1WJ1A 1MPHA 2LULA 1X11A 2G35A 4OT1A 1WVHA 2EMTA 4K17A 2GUMA 4L1RA 2R09A 2NZ8B 5KQ1A 3A98B 1I7AA 4DX90 2RLOA 5FI1A 2EMSA 4HDOA 4A6FA 5DH9B 2K49A 1DDWA 2KCJA 1FAOA 2ROVA 3D8EA 2P8VA 5D3XA 1NU2A 1W1GA 2COCA 3PP2A 2DLWA 3PEGA 4HB3B 5KQ4A 4WJ7A 1V5UA 3KY9A 2AL6A 3VIAA 1T77A 1MIXA 1U29A 1TJ6A 4ZRKA 3DCXA 1OY2A 4K2OA 2P0HA 1MK9B 5D3WA 2OQBA 2RVBB 1FHWA 2YT0A 4Z2NA 4A5KA 3TW1A 3FVCA 2K2UA 3D8DA 3A58A 3BINA 4IOYX 2DKQA 2ELBA 3BJIA 4CHMA 4KHBA 1V5PA 2RSGA 2CY5A 3B77A 5DIFB 4XWXA 1QC6A 3OANA 2Y7BA 2YT1A 2I5CA 1J0WA 3AU4A 4MT7A 3DXCA 1H10A 4HAVB 5HE2A 3SNHA 4QJ5B 2QKMA 2NMBA 4YL8A 3DXEA 4F7UP 2KIEA 3A8QA 1XD4A 1TQZA 1LW3A 1MAIA 1DBHA 4PNKA 3D8FA 5JHGA 1UNQA 3SV1A 2D11A 4TKNA 2Z0PA 5KCVA 1BAKA 2XQNM 4QXAB 3ZDTA 1V88A 2LYDA 3SUZA 2VRWB 2YF0A 3NWDA 2I1JA 3PSCA 1E5WA 4HB4B 4GXBA 1B55A 3CIKA 3WYFB 1V89A 5C5BB 1KZGA 1ZYIA 1ZSQA 3P7ZA 5M4YB 5J3TA 1BWNA 4Y94A 1FHOA 1XKEA 5L81A 3UZTA 1UEFA 4YONA 2D9WA 1KZ7A 1NTVA 4IFSA 2P0FA 2D9XA 1AQCA 2H7EA 2K2JA 2GJYA 1GC6A 3OHMB 5C79A 4HAXB 4EJNA 1EVHA 2CODA 2YRYA 4F7GA 5CLLB 2RUKB 2UVMA 4L6EA 4D0NB 1PFJA 3KRWA 2DN6A 2IYBA 3MDBC 3NWFA 3O96A 2DX1A 3M1IB 2W2XC 4NSWA 1J19A 2Y8FA 5FI0A 4QJ4B 3N7CA 3VOQA 3GYPA 1FOEA 1OMWA 2EC1A 1WJMA 3ULCA 2DHKA 2Y8GA 2MKRA 4HAZB 3QBVB 5LOPB 4DX8A 1U5FA 1U5EA 2CAYA 2Z13A 2Z0QA 2ZKMX 1EF1A 3PVUA 4MK0A 1U2BA 2KUQA 2Z4DA 2N0YA 2J0MA 3ODXA 5EFXA 3SO6A 5CLQB 1P5TA 3TCAA 3PG7A 2DX5A 4KAXB
chains in the Genus database with same CATH topology
4F7HA 2PZ1A 3NSUA 1XX0A 1WGUA 5DHFB 1WI1A 1Y19B 4GZUA 2EJ8A 1ZC4B 2GCLA 4NY0A 3T06A 1PMSA 2YS1A 1EGXA 2DKPA 2DYQA 4TYZA 1K5DB 1H4RA 3QWMA 1OQNA 2BCJA 2RNRB 2GS0A 4HB0B 4A6KA 5HE1A 4EMOA 2UZRA 1ZM0A 2LOXA 2JP2A 2MFQA 2W2XD 2VKIA 4HDQA 3KSYA 3ML4A 3RCPA 4MY6A 1FB8A 2HTHB 1X1FA 2KGXB 5J3YA 4KVGB 2L2IA 2N23A 1DDVA 3TVVA 2COAA 5DHAB 3WA0A 3G9WA 1GC7A 1K5GB 1TXDA 1XR0B 5D3VA 4EKUA 1GG3A 2Q13A 1PLSA 1NTYA 2J0KA 3F5RA 2AEHA 1U27A 2E2XA 1FGZA 2I1KA 1DYNA 2GCJA 4BBKA 1X05A 1UPQA 1V5MA 1UPRA 2M38A 2DTCA 1U5GA 5J3QA 1KI1B 5DI9B 5C5BA 3GYOA 5D3YA 3U8ZA 2MDXA 3LJUX 2KUPA 3FM8C 1FGYA 1P6SA 4C0AA 1XODA 2YS5A 4CYEA 1AWEA 2YSZA 1M7RA 4A6HA 3AU5A 2W2WA 2ADZA 4K81A 2K00A 3ULBA 2FJLA 3F0WA 4A6FB 4K2PA 5GOWB 2L1CA 4PQ0A 1W1HA 4HATB 4GPTB 4DXAB 1MKEA 2ROZB 3HQCA 3KRXA 3P6AA 4WVFB 1U5DA 3ZVRA 2LKOA 2DFKA 1WG7A 2RGNB 3TFMA 4KHAA 1UNRA 3MPXA 3QIJA 4IAPA 4HAWB 2YVCA 2R0DA 4GMXB 2H7DA 2D9ZA 1I2HA 1LB1A 4HAUB 3DXDA 2D4QA 2I5FA 3IVFA 1SHCA 1W1DA 2D2QA 2VSZA 1X86A 3V5WA 1XCGA 3CXBB 2D9YA 2J59M 1BTNA 1NI2A 3FEHA 1RRPB 5LONB 4P7IA 3ODWA 2Z0OA 2IFSA 4HB2B 2LOZA 1V61A 4KHBB 1N3HA 2UZSA 4HAYB 2HE7A 4ZRIA 2D10A 1DROA 3A8PA 2J0JA 1SGHA 3TO1A 5JLJB 3X23A 1DDMA 2D9VA 2CRFA 5JP4A 2LG1A 2YS3A 1BTKA 1Y5OA 2M14A 1UNPA 3KZ1A 4DBBA 1FHXA 2DHJA 3U7DA 4B6HA 5JHHA 5D27A 2V76A 2CY4A 5C16A 4H8SA 1ZC3B 2X18A 5HE0A 2DHIA 4GMVA 3SYXA 1MIZB 2MWNB 1MK7B 2DA0A 1EAZA 3AJ4A 4ZRJA 4CHJA 1WGQA 2OTXA 2ELAA 1M7EA 4WSFA 3PVLA 1Q67A 3PZDA 5HE3A 2ZPYA 1P3RA 4Z2MB 1X1GA 4KHOA 2DYNA 4HHVA 1IRSA 2P0DA 1ZVRA 3FSSA 2COFA 3HK0A 4GN1A 3ODOA 1Z87A 5C6RA 3HW2B 1RJ2A 3PVWA 1ISNA 1QQGA 2QKLA 1WJ1A 1MPHA 2LULA 1X11A 2G35A 1WVHA 2EMTA 4K17A 2R09A 2NZ8B 5KQ1A 3A98B 1I7AA 4DX90 2RLOA 5FI1A 2EMSA 4HDOA 4A6FA 5DH9B 1DDWA 2KCJA 1FAOA 2ROVA 3D8EA 2P8VA 5D3XA 1NU2A 1W1GA 2COCA 3PP2A 2DLWA 3PEGA 4HB3B 5KQ4A 4WJ7A 1V5UA 3KY9A 2AL6A 3VIAA 1MIXA 1U29A 1TJ6A 4ZRKA 1OY2A 4K2OA 2P0HA 1MK9B 5D3WA 2OQBA 2RVBB 1FHWA 2YT0A 4Z2NA 4A5KA 3TW1A 2K2UA 3D8DA 3BINA 4IOYX 2DKQA 2ELBA 3BJIA 4CHMA 1V5PA 2RSGA 2CY5A 5DIFB 4XWXA 1QC6A 3OANA 2Y7BA 2YT1A 2I5CA 1J0WA 3AU4A 4MT7A 3DXCA 1H10A 4HAVB 5HE2A 3SNHA 2QKMA 2NMBA 4YL8A 3DXEA 4F7UP 3A8QA 1XD4A 1TQZA 1LW3A 1MAIA 1DBHA 4PNKA 3D8FA 5JHGA 1UNQA 3SV1A 2D11A 4TKNA 2Z0PA 5KCVA 1BAKA 2XQNM 3ZDTA 1V88A 2LYDA 3SUZA 2VRWB 2YF0A 2I1JA 3PSCA 1E5WA 4HB4B 4GXBA 1B55A 3CIKA 3WYFB 1V89A 5C5BB 1KZGA 1ZSQA 3P7ZA 5J3TA 1BWNA 4Y94A 1FHOA 1XKEA 5L81A 3UZTA 1UEFA 4YONA 2D9WA 1KZ7A 1NTVA 4IFSA 2P0FA 2D9XA 1AQCA 2H7EA 2K2JA 2GJYA 1GC6A 5C79A 4HAXB 4EJNA 1EVHA 2CODA 2YRYA 4F7GA 5CLLB 2RUKB 2UVMA 4L6EA 4D0NB 1PFJA 3KRWA 2DN6A 2IYBA 3MDBC 3O96A 2DX1A 3M1IB 2W2XC 4NSWA 1J19A 2Y8FA 5FI0A 3N7CA 3VOQA 3GYPA 1FOEA 1OMWA 2EC1A 1WJMA 3ULCA 2DHKA 2Y8GA 2MKRA 4HAZB 3QBVB 5LOPB 4DX8A 1U5FA 1U5EA 2CAYA 2Z0QA 1EF1A 3PVUA 4MK0A 1U2BA 2N0YA 2J0MA 3ODXA 5EFXA 3SO6A 5CLQB 1P5TA 3TCAA 3PG7A 2DX5A 4KAXB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4F7H A;  2PZ1 A;  3NSU A;  1XX0 A;  1WGU A;  5DHF B;  1WI1 A;  1Y19 B;  4GZU A;  2EJ8 A;  1ZC4 B;  2GCL A;  4NY0 A;  3T06 A;  1PMS A;  2YS1 A;  1EGX A;  2DKP A;  2DYQ A;  4TYZ A;  1K5D B;  1H4R A;  3QWM A;  1OQN A;  2BCJ A;  2RNR B;  2GS0 A;  4HB0 B;  4A6K A;  5HE1 A;  4EMO A;  2UZR A;  1ZM0 A;  2LOX A;  2JP2 A;  2MFQ A;  2W2X D;  2VKI A;  4HDQ A;  3KSY A;  3ML4 A;  3RCP A;  4MY6 A;  1FB8 A;  2HTH B;  1X1F A;  2KGX B;  5J3Y A;  4KVG B;  2L2I A;  2N23 A;  1DDV A;  3TVV A;  2COA A;  5DHA B;  3WA0 A;  3G9W A;  1GC7 A;  1K5G B;  1TXD A;  1XR0 B;  5D3V A;  4EKU A;  1GG3 A;  2Q13 A;  1PLS A;  1NTY A;  2J0K A;  3F5R A;  2AEH A;  1U27 A;  2E2X A;  1FGZ A;  2I1K A;  1DYN A;  2GCJ A;  4BBK A;  1X05 A;  1UPQ A;  1V5M A;  1UPR A;  2M38 A;  2DTC A;  1U5G A;  5J3Q A;  1KI1 B;  5DI9 B;  5C5B A;  3GYO A;  5D3Y A;  3U8Z A;  2MDX A;  3LJU X;  2KUP A;  3FM8 C;  1FGY A;  1P6S A;  4C0A A;  1XOD A;  2YS5 A;  4CYE A;  1AWE A;  2YSZ A;  1M7R A;  4A6H A;  3AU5 A;  2W2W A;  2ADZ A;  4K81 A;  2K00 A;  3ULB A;  2FJL A;  3F0W A;  4A6F B;  4K2P A;  5GOW B;  2L1C A;  4PQ0 A;  1W1H A;  4HAT B;  4GPT B;  4DXA B;  1MKE A;  2ROZ B;  3HQC A;  3KRX A;  3P6A A;  4WVF B;  1U5D A;  3ZVR A;  2LKO A;  2DFK A;  1WG7 A;  2RGN B;  3TFM A;  4KHA A;  1UNR A;  3MPX A;  3QIJ A;  4IAP A;  4HAW B;  2YVC A;  2R0D A;  4GMX B;  2H7D A;  2D9Z A;  1I2H A;  1LB1 A;  4HAU B;  3DXD A;  2D4Q A;  2I5F A;  3IVF A;  1SHC A;  1W1D A;  2D2Q A;  2VSZ A;  1X86 A;  3V5W A;  1XCG A;  3CXB B;  2D9Y A;  2J59 M;  1BTN A;  1NI2 A;  3FEH A;  1RRP B;  5LON B;  4P7I A;  3ODW A;  2Z0O A;  2IFS A;  4HB2 B;  2LOZ A;  1V61 A;  4KHB B;  1N3H A;  2UZS A;  4HAY B;  2HE7 A;  4ZRI A;  2D10 A;  1DRO A;  3A8P A;  2J0J A;  1SGH A;  3TO1 A;  5JLJ B;  3X23 A;  1DDM A;  2D9V A;  2CRF A;  5JP4 A;  2LG1 A;  2YS3 A;  1BTK A;  1Y5O A;  2M14 A;  1UNP A;  3KZ1 A;  4DBB A;  1FHX A;  2DHJ A;  3U7D A;  4B6H A;  5JHH A;  5D27 A;  2V76 A;  2CY4 A;  5C16 A;  4H8S A;  1ZC3 B;  2X18 A;  5HE0 A;  2DHI A;  4GMV A;  3SYX A;  1MIZ B;  2MWN B;  1MK7 B;  2DA0 A;  1EAZ A;  3AJ4 A;  4ZRJ A;  4CHJ A;  1WGQ A;  2OTX A;  2ELA A;  1M7E A;  4WSF A;  3PVL A;  1Q67 A;  3PZD A;  5HE3 A;  2ZPY A;  1P3R A;  4Z2M B;  1X1G A;  4KHO A;  2DYN A;  4HHV A;  1IRS A;  2P0D A;  1ZVR A;  3FSS A;  2COF A;  3HK0 A;  4GN1 A;  3ODO A;  1Z87 A;  5C6R A;  3HW2 B;  1RJ2 A;  3PVW A;  1ISN A;  1QQG A;  2QKL A;  1WJ1 A;  1MPH A;  2LUL A;  1X11 A;  2G35 A;  1WVH A;  2EMT A;  4K17 A;  2R09 A;  2NZ8 B;  5KQ1 A;  3A98 B;  1I7A A;  4DX9 0;  2RLO A;  5FI1 A;  2EMS A;  4HDO A;  4A6F A;  5DH9 B;  1DDW A;  2KCJ A;  1FAO A;  2ROV A;  3D8E A;  2P8V A;  5D3X A;  1NU2 A;  1W1G A;  2COC A;  3PP2 A;  2DLW A;  3PEG A;  4HB3 B;  5KQ4 A;  4WJ7 A;  1V5U A;  3KY9 A;  2AL6 A;  3VIA A;  1MIX A;  1U29 A;  1TJ6 A;  4ZRK A;  1OY2 A;  4K2O A;  2P0H A;  1MK9 B;  5D3W A;  2OQB A;  2RVB B;  1FHW A;  2YT0 A;  4Z2N A;  4A5K A;  3TW1 A;  2K2U A;  3D8D A;  3BIN A;  4IOY X;  2DKQ A;  2ELB A;  3BJI A;  4CHM A;  1V5P A;  2RSG A;  2CY5 A;  5DIF B;  4XWX A;  1QC6 A;  3OAN A;  2Y7B A;  2YT1 A;  2I5C A;  1J0W A;  3AU4 A;  4MT7 A;  3DXC A;  1H10 A;  4HAV B;  5HE2 A;  3SNH A;  2QKM A;  2NMB A;  4YL8 A;  3DXE A;  4F7U P;  3A8Q A;  1XD4 A;  1TQZ A;  1LW3 A;  1MAI A;  1DBH A;  4PNK A;  3D8F A;  5JHG A;  1UNQ A;  3SV1 A;  2D11 A;  4TKN A;  2Z0P A;  5KCV A;  1BAK A;  2XQN M;  3ZDT A;  1V88 A;  2LYD A;  3SUZ A;  2VRW B;  2YF0 A;  2I1J A;  3PSC A;  1E5W A;  4HB4 B;  4GXB A;  1B55 A;  3CIK A;  3WYF B;  1V89 A;  5C5B B;  1KZG A;  1ZSQ A;  3P7Z A;  5J3T A;  1BWN A;  4Y94 A;  1FHO A;  1XKE A;  5L81 A;  3UZT A;  1UEF A;  4YON A;  2D9W A;  1KZ7 A;  1NTV A;  4IFS A;  2P0F A;  2D9X A;  1AQC A;  2H7E A;  2K2J A;  2GJY A;  1GC6 A;  5C79 A;  4HAX B;  4EJN A;  1EVH A;  2COD A;  2YRY A;  4F7G A;  5CLL B;  2RUK B;  2UVM A;  4L6E A;  4D0N B;  1PFJ A;  3KRW A;  2DN6 A;  2IYB A;  3MDB C;  3O96 A;  2DX1 A;  3M1I B;  2W2X C;  4NSW A;  1J19 A;  2Y8F A;  5FI0 A;  3N7C A;  3VOQ A;  3GYP A;  1FOE A;  1OMW A;  2EC1 A;  1WJM A;  3ULC A;  2DHK A;  2Y8G A;  2MKR A;  4HAZ B;  3QBV B;  5LOP B;  4DX8 A;  1U5F A;  1U5E A;  2CAY A;  2Z0Q A;  1EF1 A;  3PVU A;  4MK0 A;  1U2B A;  2N0Y A;  2J0M A;  3ODX A;  5EFX A;  3SO6 A;  5CLQ B;  1P5T A;  3TCA A;  3PG7 A;  2DX5 A;  4KAX B; 
#chains in the Genus database with same CATH topology
 4F7H A;  2PZ1 A;  3NSU A;  1XX0 A;  1WGU A;  5DHF B;  1WI1 A;  5LG4 B;  1Y19 B;  4GZU A;  2EJ8 A;  2KR0 A;  1ZC4 B;  2GCL A;  4NY0 A;  3T06 A;  1PMS A;  2YS1 A;  1EGX A;  5IRS A;  2DKP A;  2DYQ A;  4TYZ A;  1K5D B;  1H4R A;  3QWM A;  1OQN A;  2BCJ A;  2RNR B;  4CSQ A;  2GS0 A;  4HB0 B;  3NWA A;  4A6K A;  5HE1 A;  5I2M A;  4OSN A;  2Z59 A;  4EMO A;  2UZR A;  1ZM0 A;  2LOX A;  2JP2 A;  2MFQ A;  2W2X D;  2VKI A;  4HDQ A;  3KSY A;  4QJ3 B;  3ML4 A;  3RCP A;  4MY6 A;  1FB8 A;  2HTH B;  1X1F A;  2KGX B;  5J3Y A;  4KVG B;  2L2I A;  4DIX A;  2N23 A;  1DDV A;  3TVV A;  2COA A;  5DHA B;  3WA0 A;  3G9W A;  1GC7 A;  3NW8 A;  1K5G B;  1TXD A;  1XR0 B;  5D3V A;  4EKU A;  1GG3 A;  2Q13 A;  1PLS A;  2R2Y A;  1NTY A;  2J0K A;  3F5R A;  2AEH A;  1U27 A;  2E2X A;  1FGZ A;  2I1K A;  1DYN A;  2GCJ A;  4BBK A;  1X05 A;  1UPQ A;  1V5M A;  1UPR A;  2M38 A;  2DTC A;  1U5G A;  5J3Q A;  1KI1 B;  5DI9 B;  5C5B A;  3GYO A;  5D3Y A;  3U8Z A;  2MDX A;  3LJU X;  2KUP A;  3FM8 C;  5I2S A;  1FGY A;  1P6S A;  4C0A A;  1XOD A;  2YS5 A;  4CYE A;  1AWE A;  2YSZ A;  1M7R A;  4A6H A;  3AU5 A;  2W2W A;  2ADZ A;  4K81 A;  2K00 A;  3ULB A;  2FJL A;  3F0W A;  4A6F B;  4K2P A;  5GOW B;  2L1C A;  4PQ0 A;  1W1H A;  4HAT B;  2NBV A;  4GPT B;  4DXA B;  1MKE A;  2ROZ B;  2YT2 A;  3HQC A;  3KRX A;  3P6A A;  4WVF B;  1U5D A;  3ZVR A;  2LKO A;  2FJU B;  2DFK A;  1WG7 A;  2RGN B;  3TFM A;  4KHA A;  1UNR A;  3MPX A;  3QIJ A;  4IAP A;  2K8E A;  4HAW B;  2YVC A;  2R0D A;  4GMX B;  2H7D A;  2D9Z A;  1MI1 A;  1I2H A;  1LB1 A;  4HAU B;  3DXD A;  2D4Q A;  2I5F A;  3IVF A;  4HSI A;  1SHC A;  1W1D A;  2D2Q A;  2VSZ A;  1X86 A;  3V5W A;  2Z14 A;  1XCG A;  3CXB B;  2D9Y A;  2J59 M;  1BTN A;  3HIE A;  1NI2 A;  3FEH A;  1RRP B;  5LON B;  4P7I A;  3ODW A;  2Z0O A;  2IFS A;  4HB2 B;  2LOZ A;  1V61 A;  3HSA A;  4KHB B;  1N3H A;  2UZS A;  4HAY B;  2HE7 A;  4ZRI A;  2D10 A;  1DRO A;  3A8P A;  2J0J A;  1SGH A;  3TO1 A;  5JLJ B;  3X23 A;  1DDM A;  2D9V A;  2CRF A;  2KIG A;  5JP4 A;  2LG1 A;  2YS3 A;  1BTK A;  4GNK B;  1Y5O A;  2M14 A;  1UNP A;  3KZ1 A;  4DBB A;  1FHX A;  2DHJ A;  3U7D A;  4B6H A;  5JHH A;  5D27 A;  2V76 A;  2CY4 A;  5C16 A;  4H8S A;  1ZC3 B;  2X18 A;  5HE0 A;  2DHI A;  4GMV A;  3SYX A;  1MIZ B;  2MWN B;  4GOU A;  1MK7 B;  2DA0 A;  1EAZ A;  3AJ4 A;  4ZRJ A;  4D6W A;  4CHJ A;  1WGQ A;  2OTX A;  2ELA A;  1M7E A;  4WSF A;  3PVL A;  1Q67 A;  3PZD A;  5HE3 A;  3U12 A;  2ZPY A;  1P3R A;  4Z2M B;  1X1G A;  4KHO A;  2DYN A;  4HHV A;  1IRS A;  2P0D A;  1ZVR A;  3FSS A;  2COF A;  3HK0 A;  4GN1 A;  3ODO A;  1Z87 A;  5C6R A;  3HW2 B;  1RJ2 A;  3PVW A;  1ISN A;  1QQG A;  2RRF A;  2QKL A;  1WJ1 A;  1MPH A;  2LUL A;  1X11 A;  2G35 A;  4OT1 A;  1WVH A;  2EMT A;  4K17 A;  2GUM A;  4L1R A;  2R09 A;  2NZ8 B;  5KQ1 A;  3A98 B;  1I7A A;  4DX9 0;  2RLO A;  5FI1 A;  2EMS A;  4HDO A;  4A6F A;  5DH9 B;  2K49 A;  1DDW A;  2KCJ A;  1FAO A;  2ROV A;  3D8E A;  2P8V A;  5D3X A;  1NU2 A;  1W1G A;  2COC A;  3PP2 A;  2DLW A;  3PEG A;  4HB3 B;  5KQ4 A;  4WJ7 A;  1V5U A;  3KY9 A;  2AL6 A;  3VIA A;  1T77 A;  1MIX A;  1U29 A;  1TJ6 A;  4ZRK A;  3DCX A;  1OY2 A;  4K2O A;  2P0H A;  1MK9 B;  5D3W A;  2OQB A;  2RVB B;  1FHW A;  2YT0 A;  4Z2N A;  4A5K A;  3TW1 A;  3FVC A;  2K2U A;  3D8D A;  3A58 A;  3BIN A;  4IOY X;  2DKQ A;  2ELB A;  3BJI A;  4CHM A;  4KHB A;  1V5P A;  2RSG A;  2CY5 A;  3B77 A;  5DIF B;  4XWX A;  1QC6 A;  3OAN A;  2Y7B A;  2YT1 A;  2I5C A;  1J0W A;  3AU4 A;  4MT7 A;  3DXC A;  1H10 A;  4HAV B;  5HE2 A;  3SNH A;  4QJ5 B;  2QKM A;  2NMB A;  4YL8 A;  3DXE A;  4F7U P;  2KIE A;  3A8Q A;  1XD4 A;  1TQZ A;  1LW3 A;  1MAI A;  1DBH A;  4PNK A;  3D8F A;  5JHG A;  1UNQ A;  3SV1 A;  2D11 A;  4TKN A;  2Z0P A;  5KCV A;  1BAK A;  2XQN M;  4QXA B;  3ZDT A;  1V88 A;  2LYD A;  3SUZ A;  2VRW B;  2YF0 A;  3NWD A;  2I1J A;  3PSC A;  1E5W A;  4HB4 B;  4GXB A;  1B55 A;  3CIK A;  3WYF B;  1V89 A;  5C5B B;  1KZG A;  1ZYI A;  1ZSQ A;  3P7Z A;  5M4Y B;  5J3T A;  1BWN A;  4Y94 A;  1FHO A;  1XKE A;  5L81 A;  3UZT A;  1UEF A;  4YON A;  2D9W A;  1KZ7 A;  1NTV A;  4IFS A;  2P0F A;  2D9X A;  1AQC A;  2H7E A;  2K2J A;  2GJY A;  1GC6 A;  3OHM B;  5C79 A;  4HAX B;  4EJN A;  1EVH A;  2COD A;  2YRY A;  4F7G A;  5CLL B;  2RUK B;  2UVM A;  4L6E A;  4D0N B;  1PFJ A;  3KRW A;  2DN6 A;  2IYB A;  3MDB C;  3NWF A;  3O96 A;  2DX1 A;  3M1I B;  2W2X C;  4NSW A;  1J19 A;  2Y8F A;  5FI0 A;  4QJ4 B;  3N7C A;  3VOQ A;  3GYP A;  1FOE A;  1OMW A;  2EC1 A;  1WJM A;  3ULC A;  2DHK A;  2Y8G A;  2MKR A;  4HAZ B;  3QBV B;  5LOP B;  4DX8 A;  1U5F A;  1U5E A;  2CAY A;  2Z13 A;  2Z0Q A;  2ZKM X;  1EF1 A;  3PVU A;  4MK0 A;  1U2B A;  2KUQ A;  2Z4D A;  2N0Y A;  2J0M A;  3ODX A;  5EFX A;  3SO6 A;  5CLQ B;  1P5T A;  3TCA A;  3PG7 A;  2DX5 A;  4KAX B; 
#chains in the Genus database with same CATH homology
 4F7H A;  2PZ1 A;  3NSU A;  1XX0 A;  1WGU A;  5DHF B;  1WI1 A;  1Y19 B;  4GZU A;  2EJ8 A;  1ZC4 B;  2GCL A;  4NY0 A;  3T06 A;  1PMS A;  2YS1 A;  1EGX A;  2DKP A;  2DYQ A;  4TYZ A;  1K5D B;  1H4R A;  3QWM A;  1OQN A;  2BCJ A;  2RNR B;  2GS0 A;  4HB0 B;  4A6K A;  5HE1 A;  4EMO A;  2UZR A;  1ZM0 A;  2LOX A;  2JP2 A;  2MFQ A;  2W2X D;  2VKI A;  4HDQ A;  3KSY A;  3ML4 A;  3RCP A;  4MY6 A;  1FB8 A;  2HTH B;  1X1F A;  2KGX B;  5J3Y A;  4KVG B;  2L2I A;  2N23 A;  1DDV A;  3TVV A;  2COA A;  5DHA B;  3WA0 A;  3G9W A;  1GC7 A;  1K5G B;  1TXD A;  1XR0 B;  5D3V A;  4EKU A;  1GG3 A;  2Q13 A;  1PLS A;  1NTY A;  2J0K A;  3F5R A;  2AEH A;  1U27 A;  2E2X A;  1FGZ A;  2I1K A;  1DYN A;  2GCJ A;  4BBK A;  1X05 A;  1UPQ A;  1V5M A;  1UPR A;  2M38 A;  2DTC A;  1U5G A;  5J3Q A;  1KI1 B;  5DI9 B;  5C5B A;  3GYO A;  5D3Y A;  3U8Z A;  2MDX A;  3LJU X;  2KUP A;  3FM8 C;  1FGY A;  1P6S A;  4C0A A;  1XOD A;  2YS5 A;  4CYE A;  1AWE A;  2YSZ A;  1M7R A;  4A6H A;  3AU5 A;  2W2W A;  2ADZ A;  4K81 A;  2K00 A;  3ULB A;  2FJL A;  3F0W A;  4A6F B;  4K2P A;  5GOW B;  2L1C A;  4PQ0 A;  1W1H A;  4HAT B;  4GPT B;  4DXA B;  1MKE A;  2ROZ B;  3HQC A;  3KRX A;  3P6A A;  4WVF B;  1U5D A;  3ZVR A;  2LKO A;  2DFK A;  1WG7 A;  2RGN B;  3TFM A;  4KHA A;  1UNR A;  3MPX A;  3QIJ A;  4IAP A;  4HAW B;  2YVC A;  2R0D A;  4GMX B;  2H7D A;  2D9Z A;  1I2H A;  1LB1 A;  4HAU B;  3DXD A;  2D4Q A;  2I5F A;  3IVF A;  1SHC A;  1W1D A;  2D2Q A;  2VSZ A;  1X86 A;  3V5W A;  1XCG A;  3CXB B;  2D9Y A;  2J59 M;  1BTN A;  1NI2 A;  3FEH A;  1RRP B;  5LON B;  4P7I A;  3ODW A;  2Z0O A;  2IFS A;  4HB2 B;  2LOZ A;  1V61 A;  4KHB B;  1N3H A;  2UZS A;  4HAY B;  2HE7 A;  4ZRI A;  2D10 A;  1DRO A;  3A8P A;  2J0J A;  1SGH A;  3TO1 A;  5JLJ B;  3X23 A;  1DDM A;  2D9V A;  2CRF A;  5JP4 A;  2LG1 A;  2YS3 A;  1BTK A;  1Y5O A;  2M14 A;  1UNP A;  3KZ1 A;  4DBB A;  1FHX A;  2DHJ A;  3U7D A;  4B6H A;  5JHH A;  5D27 A;  2V76 A;  2CY4 A;  5C16 A;  4H8S A;  1ZC3 B;  2X18 A;  5HE0 A;  2DHI A;  4GMV A;  3SYX A;  1MIZ B;  2MWN B;  1MK7 B;  2DA0 A;  1EAZ A;  3AJ4 A;  4ZRJ A;  4CHJ A;  1WGQ A;  2OTX A;  2ELA A;  1M7E A;  4WSF A;  3PVL A;  1Q67 A;  3PZD A;  5HE3 A;  2ZPY A;  1P3R A;  4Z2M B;  1X1G A;  4KHO A;  2DYN A;  4HHV A;  1IRS A;  2P0D A;  1ZVR A;  3FSS A;  2COF A;  3HK0 A;  4GN1 A;  3ODO A;  1Z87 A;  5C6R A;  3HW2 B;  1RJ2 A;  3PVW A;  1ISN A;  1QQG A;  2QKL A;  1WJ1 A;  1MPH A;  2LUL A;  1X11 A;  2G35 A;  1WVH A;  2EMT A;  4K17 A;  2R09 A;  2NZ8 B;  5KQ1 A;  3A98 B;  1I7A A;  4DX9 0;  2RLO A;  5FI1 A;  2EMS A;  4HDO A;  4A6F A;  5DH9 B;  1DDW A;  2KCJ A;  1FAO A;  2ROV A;  3D8E A;  2P8V A;  5D3X A;  1NU2 A;  1W1G A;  2COC A;  3PP2 A;  2DLW A;  3PEG A;  4HB3 B;  5KQ4 A;  4WJ7 A;  1V5U A;  3KY9 A;  2AL6 A;  3VIA A;  1MIX A;  1U29 A;  1TJ6 A;  4ZRK A;  1OY2 A;  4K2O A;  2P0H A;  1MK9 B;  5D3W A;  2OQB A;  2RVB B;  1FHW A;  2YT0 A;  4Z2N A;  4A5K A;  3TW1 A;  2K2U A;  3D8D A;  3BIN A;  4IOY X;  2DKQ A;  2ELB A;  3BJI A;  4CHM A;  1V5P A;  2RSG A;  2CY5 A;  5DIF B;  4XWX A;  1QC6 A;  3OAN A;  2Y7B A;  2YT1 A;  2I5C A;  1J0W A;  3AU4 A;  4MT7 A;  3DXC A;  1H10 A;  4HAV B;  5HE2 A;  3SNH A;  2QKM A;  2NMB A;  4YL8 A;  3DXE A;  4F7U P;  3A8Q A;  1XD4 A;  1TQZ A;  1LW3 A;  1MAI A;  1DBH A;  4PNK A;  3D8F A;  5JHG A;  1UNQ A;  3SV1 A;  2D11 A;  4TKN A;  2Z0P A;  5KCV A;  1BAK A;  2XQN M;  3ZDT A;  1V88 A;  2LYD A;  3SUZ A;  2VRW B;  2YF0 A;  2I1J A;  3PSC A;  1E5W A;  4HB4 B;  4GXB A;  1B55 A;  3CIK A;  3WYF B;  1V89 A;  5C5B B;  1KZG A;  1ZSQ A;  3P7Z A;  5J3T A;  1BWN A;  4Y94 A;  1FHO A;  1XKE A;  5L81 A;  3UZT A;  1UEF A;  4YON A;  2D9W A;  1KZ7 A;  1NTV A;  4IFS A;  2P0F A;  2D9X A;  1AQC A;  2H7E A;  2K2J A;  2GJY A;  1GC6 A;  5C79 A;  4HAX B;  4EJN A;  1EVH A;  2COD A;  2YRY A;  4F7G A;  5CLL B;  2RUK B;  2UVM A;  4L6E A;  4D0N B;  1PFJ A;  3KRW A;  2DN6 A;  2IYB A;  3MDB C;  3O96 A;  2DX1 A;  3M1I B;  2W2X C;  4NSW A;  1J19 A;  2Y8F A;  5FI0 A;  3N7C A;  3VOQ A;  3GYP A;  1FOE A;  1OMW A;  2EC1 A;  1WJM A;  3ULC A;  2DHK A;  2Y8G A;  2MKR A;  4HAZ B;  3QBV B;  5LOP B;  4DX8 A;  1U5F A;  1U5E A;  2CAY A;  2Z0Q A;  1EF1 A;  3PVU A;  4MK0 A;  1U2B A;  2N0Y A;  2J0M A;  3ODX A;  5EFX A;  3SO6 A;  5CLQ B;  1P5T A;  3TCA A;  3PG7 A;  2DX5 A;  4KAX B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...