3TW1A

Structure of rtt106-ahn
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
232
structure length
222
Chain Sequence
TNTIFKLEGVSVLSPLRKKLDLVFYLSNVDGSPVITLLKGNDRELSIYQLNKNIKMASFLPVPEKPNLIYLFMTYTSCEDNKFSEPVVMTLNKENTLNQFKKLGLLDSNVTDFEKCVEYIRKQAILTGFKISNPFVKINSFHLQCHRGTKEGTLYFLPDHIIFGFKKPILLLDASDIESITYSSITRLTFNASLVTKDGEKYEFSMIDQTEYAKIDDYVKRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for recognition of H3K56-acetylated histone H3-H4 by the chaperone Rtt106.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Chaperone
molecule keywords Histone chaperone RTT106
total genus 55
structure length 222
sequence length 232
ec nomenclature
pdb deposition date 2011-09-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 3tw1A02
2.30.29.120 Mainly Beta Roll PH-domain like PH-domain like 3tw1A01
3AJ4A 2P0FA 1Y5OA 2CAYA 3SNHA 5DI9B 2MKRA 1FHOA 1FAOA 5FI0A 4EJNA 1SHCA 1K5DB 2K2UA 3IVFA 2D2QA 3WA0A 2MFQA 4ZRJA 1X1FA 1MIXA 2LG1A 1UNPA 1UNQA 1FHXA 1Q67A 2IYBA 1XCGA 5DIFB 5HE2A 5DH9B 1P3RA 5C5BB 2D9XA 3QBVB 5JP4A 3DXCA 4NSWA 4WVFB 1LB1A 1V5PA 2CY5A 2FJLA 5C79A 4A6KA 1P6SA 4A5KA 4EMOA 3KSYA 2DHJA 1DDWA 4P7IA 2RUKB 2DFKA 1FB8A 4Z2NA 2VSZA 3ODOA 1UPQA 2E2XA 1KZ7A 4GMXB 3PZDA 1FGZA 2DYQA 1NU2A 4XWXA 5DHAB 2AL6A 4DBBA 5C5BA 4KVGB 3SYXA 3T06A 1PFJA 1TXDA 2R0DA 3D8FA 4NY0A 4ZRIA 4MY6A 4KHBB 4WJ7A 1NI2A 1WJ1A 5D3WA 1J0WA 2DHIA 3TFMA 3U7DA 1MIZB 4IAPA 2QKMA 2Y8FA 1QC6A 2J0JA 4PNKA 2COAA 4F7GA 4HB0B 4B6HA 4Z2MB 2MDXA 1B55A 3WYFB 3ZDTA 1WVHA 5D3XA 1WG7A 2GJYA 3ML4A 3MPXA 1MKEA 4BBKA 3UZTA 1U5EA 2COFA 1V61A 1RJ2A 4GZUA 1W1DA 3TVVA 2ROZB 2DYNA 4DX90 4CYEA 2DA0A 4HAXB 1I7AA 2W2XC 1QQGA 1KI1B 5L81A 1AQCA 2BCJA 1M7EA 4HAUB 4HAWB 1EF1A 3QIJA 2ADZA 2DKQA 5J3QA 2GCLA 1MPHA 1U27A 2IFSA 1W1GA 1TQZA 3PVUA 3A8PA 3N7CA 4F7UP 1XODA 2D11A 2DHKA 2UZSA 2D9VA 1EVHA 2I1KA 3KY9A 4TKNA 3TCAA 1BWNA 1EGXA 5KQ1A 2D4QA 3MDBC 4KHAA 5J3YA 1E5WA 1I2HA 2LULA 2YSZA 1V5MA 3AU5A 3OANA 2YS5A 2QKLA 5HE1A 2G35A 3SUZA 1NTVA 2KCJA 4HDQA 2HTHB 3X23A 2J0MA 3FEHA 4MK0A 3GYOA 2N0YA 5J3TA 5CLQB 5JLJB 2YS3A 1UEFA 2YF0A 2D9WA 2OQBA 2NZ8B 2CRFA 2EMSA 2Y8GA 3PVLA 3ULCA 3P7ZA 2J59M 3O96A 3U8ZA 1GC6A 3HW2B 1ZSQA 1MK7B 2I1JA 2Z0QA 1TJ6A 2DTCA 5HE0A 2V76A 2CODA 5CLLB 2Z0PA 3V5WA 4HB2B 3F5RA 3PVWA 3SV1A 1PMSA 2EMTA 5LONB 3SO6A 2W2XD 3KZ1A 2D9ZA 4GN1A 1U5DA 5LOPB 3VIAA 1N3HA 1BTNA 4PQ0A 4HHVA 3LJUX 2GS0A 1IRSA 2ELAA 3PG7A 5D3VA 1EAZA 3KRXA 1V89A 1H10A 2COCA 3PSCA 3CXBB 4K81A 3HQCA 2LOZA 2YT0A 3D8EA 1H4RA 3ULBA 3A8QA 1WJMA 5C6RA 3AU4A 4DX8A 4A6FB 3A98B 4H8SA 2N23A 2D9YA 2DX1A 2L2IA 3RCPA 2YT1A 2YRYA 4WSFA 3CIKA 1K5GB 3ODWA 2H7DA 3BJIA 3FSSA 5C16A 4A6HA 2M38A 2JP2A 3TW1A 5JHHA 2UZRA 2P0HA 3D8DA 3DXDA 2KGXB 4HB3B 2RSGA 1FOEA 2OTXA 5HE3A 2EJ8A 4GMVA 1MK9B 4ZRKA 1FHWA 1OY2A 2I5FA 4C0AA 2DLWA 1UNRA 1AWEA 1ZC3B 4A6FA 2LOXA 1V88A 2AEHA 2LYDA 1MAIA 4EKUA 3M1IB 4Y94A 2R09A 2YS1A 2RNRB 4CHJA 3QWMA 1ZM0A 1ZVRA 3ODXA 1DBHA 3G9WA 5D27A 2P0DA 1P5TA 2VRWB 1PLSA 1WGUA 1WI1A 4KHOA 4DXAB 1GG3A 1U2BA 4HAYB 2ZPYA 4MT7A 5D3YA 2Z0OA 1X86A 3VOQA 2EC1A 1U5FA 2Y7BA 2NMBA 3FM8C 2XQNM 4IFSA 2MWNB 3P6AA 3KRWA 3PEGA 2X18A 1V5UA 4HAZB 1ISNA 5KCVA 2RVBB 3NSUA 4K2OA 3F0WA 2D10A 2P8VA 4HDOA 1Y19B 2KUPA 3TO1A 4D0NB 2YVCA 2HE7A 3GYPA 1XD4A 1SGHA 5EFXA 2DKPA 2RGNB 4F7HA 1XR0B 4TYZA 4GPTB 4HATB 1X11A 1DDMA 5DHFB 4HB4B 1X05A 2ROVA 2RLOA 1ZC4B 1OMWA 2Q13A 1DDVA 2VKIA 4K17A 4K2PA 1FGYA 1J19A 5GOWB 1W1HA 1OQNA 1M7RA 4HAVB 1DROA 2I5CA 2K2JA 2LKOA 4YL8A 1BTKA 1BAKA 2J0KA 2PZ1A 3HK0A 4CHMA 1NTYA 1WGQA 1RRPB 2L1CA 1Z87A 2DN6A 1KZGA 2W2WA 2DX5A 4YONA 3BINA 4L6EA 2K00A 3PP2A 2GCJA 3DXEA 2ELBA 1GC7A 2UVMA 1LW3A 1X1GA 1UPRA 4KAXB 5FI1A 1XKEA 1DYNA 2H7EA 4IOYX 5JHGA 2CY4A 1U5GA 4GXBA 5KQ4A 1XX0A 3ZVRA 2M14A 1U29A
chains in the Genus database with same CATH superfamily
3AJ4A 2P0FA 4OSNA 1Y5OA 2CAYA 3SNHA 5DI9B 2MKRA 1FHOA 1FAOA 5FI0A 3A58A 4EJNA 1SHCA 1K5DB 2K2UA 3IVFA 2D2QA 2K49A 3WA0A 2MFQA 4ZRJA 1X1FA 1MIXA 2LG1A 3OHMB 1UNPA 1UNQA 1FHXA 1Q67A 2IYBA 1XCGA 5DIFB 5HE2A 5DH9B 1P3RA 5C5BB 2D9XA 3QBVB 5JP4A 3DXCA 4NSWA 4WVFB 1LB1A 1V5PA 2CY5A 2FJLA 5C79A 4A6KA 1P6SA 2Z59A 4A5KA 4EMOA 3KSYA 2DHJA 1DDWA 4P7IA 2RUKB 4CSQA 2DFKA 1FB8A 4Z2NA 2VSZA 3ODOA 1UPQA 2E2XA 1KZ7A 4GMXB 3PZDA 1FGZA 2DYQA 1NU2A 4XWXA 4DIXA 5DHAB 1T77A 2AL6A 4DBBA 5C5BA 4KVGB 3SYXA 3T06A 3NWDA 5IRSA 1PFJA 1TXDA 2R0DA 3D8FA 4NY0A 4ZRIA 2Z4DA 4MY6A 3HSAA 4KHBB 4WJ7A 1NI2A 1WJ1A 5D3WA 1J0WA 4L1RA 2DHIA 3TFMA 3U7DA 1ZYIA 1MIZB 2QKMA 4IAPA 2Y8FA 1QC6A 2J0JA 4PNKA 2COAA 4F7GA 2K8EA 4HB0B 4B6HA 4Z2MB 2YT2A 2MDXA 5M4YB 1B55A 3WYFB 3ZDTA 1WVHA 5D3XA 1WG7A 2GJYA 3ML4A 3MPXA 2Z13A 3DCXA 1MKEA 4BBKA 3UZTA 1U5EA 2COFA 1V61A 1RJ2A 4GZUA 1W1DA 3TVVA 4KHBA 2ROZB 2DYNA 4DX90 4CYEA 4GNKB 2DA0A 4HAXB 1I7AA 2W2XC 1QQGA 1KI1B 5L81A 1AQCA 2BCJA 1M7EA 4HAUB 4HAWB 1EF1A 3QIJA 2ADZA 2DKQA 5J3QA 4QJ4B 2GCLA 5I2MA 1MPHA 1U27A 2IFSA 1W1GA 3FVCA 1TQZA 3PVUA 2KIEA 3A8PA 3N7CA 4F7UP 1XODA 5LG4B 2D11A 2DHKA 2UZSA 2D9VA 1EVHA 2I1KA 3KY9A 4TKNA 3TCAA 3NW8A 1BWNA 4GOUA 1EGXA 5KQ1A 2D4QA 3MDBC 4KHAA 5J3YA 1E5WA 1I2HA 1MI1A 2LULA 2YSZA 1V5MA 3AU5A 3OANA 2YS5A 2QKLA 5HE1A 2G35A 3SUZA 1NTVA 2KCJA 4HDQA 2HTHB 3X23A 2J0MA 3FEHA 4MK0A 3GYOA 2N0YA 5J3TA 5CLQB 5JLJB 2YS3A 1UEFA 2YF0A 2D9WA 2OQBA 2FJUB 2NZ8B 2CRFA 2EMSA 2Y8GA 3PVLA 3ULCA 3P7ZA 2J59M 3O96A 3U8ZA 4QJ3B 1GC6A 3HW2B 1ZSQA 1MK7B 2I1JA 2Z0QA 2KUQA 1TJ6A 2DTCA 5HE0A 2V76A 2CODA 5CLLB 4QJ5B 2Z0PA 3V5WA 4HB2B 3F5RA 3PVWA 3SV1A 1PMSA 2EMTA 5LONB 3SO6A 2W2XD 3KZ1A 2D9ZA 4GN1A 1U5DA 5LOPB 3VIAA 1N3HA 1BTNA 4PQ0A 2KR0A 4HHVA 3LJUX 2GS0A 1IRSA 2ELAA 3PG7A 5D3VA 1EAZA 3KRXA 1V89A 1H10A 2COCA 3PSCA 3CXBB 4K81A 3HQCA 2LOZA 2YT0A 3D8EA 1H4RA 3ULBA 3A8QA 1WJMA 5C6RA 3AU4A 4DX8A 2KIGA 4A6FB 5I2SA 3A98B 4H8SA 2N23A 2D9YA 2DX1A 2L2IA 2RRFA 3RCPA 2YT1A 2YRYA 4WSFA 3CIKA 1K5GB 3ODWA 2H7DA 3BJIA 3FSSA 4OT1A 5C16A 4A6HA 2M38A 2JP2A 3TW1A 5JHHA 2UZRA 2P0HA 3D8DA 3DXDA 2KGXB 2ZKMX 4HB3B 2RSGA 1FOEA 2OTXA 5HE3A 2EJ8A 4GMVA 1MK9B 4ZRKA 1FHWA 1OY2A 2I5FA 4C0AA 2DLWA 1UNRA 1AWEA 1ZC3B 4A6FA 2LOXA 1V88A 2AEHA 2LYDA 1MAIA 4EKUA 3M1IB 4Y94A 2R09A 2YS1A 2RNRB 4CHJA 3QWMA 1ZM0A 1ZVRA 3ODXA 1DBHA 3G9WA 5D27A 2P0DA 1P5TA 2VRWB 1PLSA 1WGUA 1WI1A 4KHOA 4DXAB 1GG3A 1U2BA 2GUMA 4HAYB 2ZPYA 3B77A 4HSIA 4MT7A 5D3YA 4D6WA 2Z0OA 1X86A 3VOQA 2EC1A 1U5FA 2Y7BA 2NMBA 3FM8C 2XQNM 4IFSA 2MWNB 3P6AA 3KRWA 3PEGA 2X18A 1V5UA 2NBVA 3NWAA 4HAZB 1ISNA 5KCVA 2RVBB 3NSUA 4K2OA 3NWFA 3F0WA 2D10A 2P8VA 4HDOA 1Y19B 2KUPA 3TO1A 4D0NB 2YVCA 2HE7A 3GYPA 4QXAB 1XD4A 3U12A 1SGHA 5EFXA 3HIEA 2DKPA 2RGNB 4F7HA 1XR0B 4TYZA 2Z14A 4GPTB 4HATB 1X11A 1DDMA 5DHFB 4HB4B 1X05A 2ROVA 2RLOA 1ZC4B 1OMWA 2Q13A 1DDVA 2VKIA 4K17A 4K2PA 1FGYA 1J19A 5GOWB 1W1HA 1OQNA 1M7RA 4HAVB 1DROA 2I5CA 2K2JA 2LKOA 4YL8A 1BTKA 1BAKA 2J0KA 2PZ1A 3HK0A 4CHMA 1NTYA 2R2YA 1WGQA 1RRPB 2L1CA 1Z87A 2DN6A 1KZGA 2W2WA 2DX5A 4YONA 3BINA 4L6EA 2K00A 3PP2A 2GCJA 3DXEA 2ELBA 1GC7A 2UVMA 1LW3A 1X1GA 1UPRA 4KAXB 5FI1A 1XKEA 1DYNA 2H7EA 4IOYX 5JHGA 2CY4A 1U5GA 4GXBA 5KQ4A 1XX0A 3ZVRA 2M14A 1U29A
chains in the Genus database with same CATH topology
3AJ4A 2P0FA 4OSNA 1Y5OA 2CAYA 3SNHA 5DI9B 2MKRA 1FHOA 1FAOA 5FI0A 3A58A 4EJNA 1SHCA 1K5DB 2K2UA 3IVFA 2D2QA 2K49A 3WA0A 2MFQA 4ZRJA 1X1FA 1MIXA 2LG1A 3OHMB 1UNPA 1UNQA 1FHXA 1Q67A 2IYBA 1XCGA 5DIFB 5HE2A 5DH9B 1P3RA 5C5BB 2D9XA 3QBVB 5JP4A 3DXCA 4NSWA 4WVFB 1LB1A 1V5PA 2CY5A 2FJLA 5C79A 4A6KA 1P6SA 4A5KA 4EMOA 2Z59A 3KSYA 2DHJA 1DDWA 4P7IA 2RUKB 4CSQA 2DFKA 1FB8A 4Z2NA 2VSZA 3ODOA 1UPQA 2E2XA 1KZ7A 4GMXB 3PZDA 1FGZA 2DYQA 1NU2A 4XWXA 4DIXA 5DHAB 2AL6A 4DBBA 5C5BA 4KVGB 3SYXA 3T06A 3NWDA 5IRSA 1PFJA 1TXDA 2R0DA 3D8FA 4NY0A 4ZRIA 2Z4DA 4MY6A 4KHBB 4WJ7A 1NI2A 1WJ1A 5D3WA 1J0WA 4L1RA 2DHIA 3TFMA 3U7DA 1ZYIA 1MIZB 4IAPA 2QKMA 2Y8FA 1QC6A 2J0JA 4PNKA 2COAA 4F7GA 2K8EA 4HB0B 4B6HA 4Z2MB 2YT2A 2MDXA 5M4YB 1B55A 3WYFB 3ZDTA 1WVHA 5D3XA 1WG7A 2GJYA 3ML4A 3MPXA 2Z13A 1MKEA 4BBKA 3UZTA 1U5EA 2COFA 1V61A 1RJ2A 4GZUA 1W1DA 3TVVA 4KHBA 2ROZB 2DYNA 4DX90 4CYEA 4GNKB 2DA0A 4HAXB 1I7AA 2W2XC 1QQGA 1KI1B 5L81A 1AQCA 2BCJA 1M7EA 4HAUB 4HAWB 1EF1A 3QIJA 2ADZA 2DKQA 5J3QA 4QJ4B 2GCLA 5I2MA 1MPHA 1U27A 2IFSA 1W1GA 3FVCA 1TQZA 3PVUA 2KIEA 3A8PA 3N7CA 4F7UP 1XODA 5LG4B 2D11A 2DHKA 2UZSA 2D9VA 1EVHA 2I1KA 3KY9A 4TKNA 3TCAA 3NW8A 1BWNA 4GOUA 1EGXA 5KQ1A 2D4QA 3MDBC 4KHAA 5J3YA 1E5WA 1I2HA 2LULA 2YSZA 1V5MA 3AU5A 3OANA 2YS5A 2QKLA 5HE1A 2G35A 3SUZA 1NTVA 2KCJA 4HDQA 2HTHB 3X23A 2J0MA 3FEHA 4MK0A 3GYOA 2N0YA 5J3TA 5CLQB 5JLJB 2YS3A 1UEFA 2YF0A 2D9WA 2OQBA 2FJUB 2NZ8B 2CRFA 2EMSA 2Y8GA 3PVLA 3ULCA 3P7ZA 2J59M 3O96A 3U8ZA 4QJ3B 1GC6A 3HW2B 1ZSQA 1MK7B 2I1JA 2Z0QA 2KUQA 1TJ6A 2DTCA 5HE0A 2V76A 2CODA 5CLLB 4QJ5B 2Z0PA 3V5WA 4HB2B 3F5RA 3PVWA 3SV1A 1PMSA 2EMTA 5LONB 3SO6A 2W2XD 3KZ1A 2D9ZA 4GN1A 1U5DA 5LOPB 3VIAA 1N3HA 1BTNA 4PQ0A 4HHVA 2KR0A 3LJUX 2GS0A 1IRSA 2ELAA 3PG7A 5D3VA 1EAZA 3KRXA 1V89A 1H10A 2COCA 3PSCA 3CXBB 4K81A 3HQCA 2LOZA 2YT0A 3D8EA 1H4RA 3ULBA 3A8QA 1WJMA 5C6RA 3AU4A 4DX8A 2KIGA 4A6FB 5I2SA 3A98B 4H8SA 2N23A 2D9YA 2DX1A 2L2IA 3RCPA 2RRFA 2YT1A 2YRYA 4WSFA 3CIKA 1K5GB 3ODWA 2H7DA 3BJIA 3FSSA 5C16A 4OT1A 4A6HA 2M38A 2JP2A 3TW1A 5JHHA 2UZRA 2P0HA 3D8DA 3DXDA 2KGXB 2ZKMX 4HB3B 2RSGA 1FOEA 2OTXA 5HE3A 2EJ8A 4GMVA 1MK9B 4ZRKA 1FHWA 1OY2A 2I5FA 4C0AA 2DLWA 1UNRA 1AWEA 1ZC3B 4A6FA 2LOXA 1V88A 2AEHA 2LYDA 1MAIA 4EKUA 3M1IB 4Y94A 2R09A 2YS1A 2RNRB 4CHJA 3QWMA 1ZM0A 1ZVRA 3ODXA 1DBHA 3G9WA 5D27A 2P0DA 1P5TA 2VRWB 1PLSA 1WGUA 1WI1A 4KHOA 4DXAB 1GG3A 1U2BA 4HAYB 2GUMA 2ZPYA 4HSIA 4MT7A 5D3YA 4D6WA 2Z0OA 1X86A 3VOQA 2EC1A 1U5FA 2Y7BA 2NMBA 3FM8C 2XQNM 4IFSA 2MWNB 3P6AA 3KRWA 3PEGA 2X18A 1V5UA 2NBVA 3NWAA 4HAZB 1ISNA 5KCVA 2RVBB 3NSUA 4K2OA 3NWFA 3F0WA 2D10A 2P8VA 4HDOA 1Y19B 2KUPA 3TO1A 4D0NB 2YVCA 2HE7A 3GYPA 4QXAB 1XD4A 3U12A 1SGHA 5EFXA 3HIEA 2DKPA 2RGNB 4F7HA 1XR0B 4TYZA 2Z14A 4GPTB 4HATB 1X11A 1DDMA 5DHFB 4HB4B 1X05A 2ROVA 2RLOA 1ZC4B 1OMWA 2Q13A 1DDVA 2VKIA 4K17A 4K2PA 1FGYA 1J19A 5GOWB 1W1HA 1OQNA 1M7RA 4HAVB 1DROA 2I5CA 2K2JA 2LKOA 4YL8A 1BTKA 1BAKA 2J0KA 2PZ1A 3HK0A 4CHMA 1NTYA 2R2YA 1WGQA 1RRPB 2L1CA 1Z87A 2DN6A 1KZGA 2W2WA 2DX5A 4YONA 3BINA 4L6EA 2K00A 3PP2A 2GCJA 3DXEA 2ELBA 1GC7A 2UVMA 1LW3A 1X1GA 1UPRA 4KAXB 5FI1A 1XKEA 1DYNA 2H7EA 4IOYX 5JHGA 2CY4A 1U5GA 4GXBA 5KQ4A 1XX0A 3ZVRA 2M14A 1U29A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AJ4 A;  2P0F A;  1Y5O A;  2CAY A;  3SNH A;  5DI9 B;  2MKR A;  1FHO A;  1FAO A;  5FI0 A;  4EJN A;  1SHC A;  1K5D B;  2K2U A;  3IVF A;  2D2Q A;  3WA0 A;  2MFQ A;  4ZRJ A;  1X1F A;  1MIX A;  2LG1 A;  1UNP A;  1UNQ A;  1FHX A;  1Q67 A;  2IYB A;  1XCG A;  5DIF B;  5HE2 A;  5DH9 B;  1P3R A;  5C5B B;  2D9X A;  3QBV B;  5JP4 A;  3DXC A;  4NSW A;  4WVF B;  1LB1 A;  1V5P A;  2CY5 A;  2FJL A;  5C79 A;  4A6K A;  1P6S A;  4A5K A;  4EMO A;  3KSY A;  2DHJ A;  1DDW A;  4P7I A;  2RUK B;  2DFK A;  1FB8 A;  4Z2N A;  2VSZ A;  3ODO A;  1UPQ A;  2E2X A;  1KZ7 A;  4GMX B;  3PZD A;  1FGZ A;  2DYQ A;  1NU2 A;  4XWX A;  5DHA B;  2AL6 A;  4DBB A;  5C5B A;  4KVG B;  3SYX A;  3T06 A;  1PFJ A;  1TXD A;  2R0D A;  3D8F A;  4NY0 A;  4ZRI A;  4MY6 A;  4KHB B;  4WJ7 A;  1NI2 A;  1WJ1 A;  5D3W A;  1J0W A;  2DHI A;  3TFM A;  3U7D A;  1MIZ B;  4IAP A;  2QKM A;  2Y8F A;  1QC6 A;  2J0J A;  4PNK A;  2COA A;  4F7G A;  4HB0 B;  4B6H A;  4Z2M B;  2MDX A;  1B55 A;  3WYF B;  3ZDT A;  1WVH A;  5D3X A;  1WG7 A;  2GJY A;  3ML4 A;  3MPX A;  1MKE A;  4BBK A;  3UZT A;  1U5E A;  2COF A;  1V61 A;  1RJ2 A;  4GZU A;  1W1D A;  3TVV A;  2ROZ B;  2DYN A;  4DX9 0;  4CYE A;  2DA0 A;  4HAX B;  1I7A A;  2W2X C;  1QQG A;  1KI1 B;  5L81 A;  1AQC A;  2BCJ A;  1M7E A;  4HAU B;  4HAW B;  1EF1 A;  3QIJ A;  2ADZ A;  2DKQ A;  5J3Q A;  2GCL A;  1MPH A;  1U27 A;  2IFS A;  1W1G A;  1TQZ A;  3PVU A;  3A8P A;  3N7C A;  4F7U P;  1XOD A;  2D11 A;  2DHK A;  2UZS A;  2D9V A;  1EVH A;  2I1K A;  3KY9 A;  4TKN A;  3TCA A;  1BWN A;  1EGX A;  5KQ1 A;  2D4Q A;  3MDB C;  4KHA A;  5J3Y A;  1E5W A;  1I2H A;  2LUL A;  2YSZ A;  1V5M A;  3AU5 A;  3OAN A;  2YS5 A;  2QKL A;  5HE1 A;  2G35 A;  3SUZ A;  1NTV A;  2KCJ A;  4HDQ A;  2HTH B;  3X23 A;  2J0M A;  3FEH A;  4MK0 A;  3GYO A;  2N0Y A;  5J3T A;  5CLQ B;  5JLJ B;  2YS3 A;  1UEF A;  2YF0 A;  2D9W A;  2OQB A;  2NZ8 B;  2CRF A;  2EMS A;  2Y8G A;  3PVL A;  3ULC A;  3P7Z A;  2J59 M;  3O96 A;  3U8Z A;  1GC6 A;  3HW2 B;  1ZSQ A;  1MK7 B;  2I1J A;  2Z0Q A;  1TJ6 A;  2DTC A;  5HE0 A;  2V76 A;  2COD A;  5CLL B;  2Z0P A;  3V5W A;  4HB2 B;  3F5R A;  3PVW A;  3SV1 A;  1PMS A;  2EMT A;  5LON B;  3SO6 A;  2W2X D;  3KZ1 A;  2D9Z A;  4GN1 A;  1U5D A;  5LOP B;  3VIA A;  1N3H A;  1BTN A;  4PQ0 A;  4HHV A;  3LJU X;  2GS0 A;  1IRS A;  2ELA A;  3PG7 A;  5D3V A;  1EAZ A;  3KRX A;  1V89 A;  1H10 A;  2COC A;  3PSC A;  3CXB B;  4K81 A;  3HQC A;  2LOZ A;  2YT0 A;  3D8E A;  1H4R A;  3ULB A;  3A8Q A;  1WJM A;  5C6R A;  3AU4 A;  4DX8 A;  4A6F B;  3A98 B;  4H8S A;  2N23 A;  2D9Y A;  2DX1 A;  2L2I A;  3RCP A;  2YT1 A;  2YRY A;  4WSF A;  3CIK A;  1K5G B;  3ODW A;  2H7D A;  3BJI A;  3FSS A;  5C16 A;  4A6H A;  2M38 A;  2JP2 A;  3TW1 A;  5JHH A;  2UZR A;  2P0H A;  3D8D A;  3DXD A;  2KGX B;  4HB3 B;  2RSG A;  1FOE A;  2OTX A;  5HE3 A;  2EJ8 A;  4GMV A;  1MK9 B;  4ZRK A;  1FHW A;  1OY2 A;  2I5F A;  4C0A A;  2DLW A;  1UNR A;  1AWE A;  1ZC3 B;  4A6F A;  2LOX A;  1V88 A;  2AEH A;  2LYD A;  1MAI A;  4EKU A;  3M1I B;  4Y94 A;  2R09 A;  2YS1 A;  2RNR B;  4CHJ A;  3QWM A;  1ZM0 A;  1ZVR A;  3ODX A;  1DBH A;  3G9W A;  5D27 A;  2P0D A;  1P5T A;  2VRW B;  1PLS A;  1WGU A;  1WI1 A;  4KHO A;  4DXA B;  1GG3 A;  1U2B A;  4HAY B;  2ZPY A;  4MT7 A;  5D3Y A;  2Z0O A;  1X86 A;  3VOQ A;  2EC1 A;  1U5F A;  2Y7B A;  2NMB A;  3FM8 C;  2XQN M;  4IFS A;  2MWN B;  3P6A A;  3KRW A;  3PEG A;  2X18 A;  1V5U A;  4HAZ B;  1ISN A;  5KCV A;  2RVB B;  3NSU A;  4K2O A;  3F0W A;  2D10 A;  2P8V A;  4HDO A;  1Y19 B;  2KUP A;  3TO1 A;  4D0N B;  2YVC A;  2HE7 A;  3GYP A;  1XD4 A;  1SGH A;  5EFX A;  2DKP A;  2RGN B;  4F7H A;  1XR0 B;  4TYZ A;  4GPT B;  4HAT B;  1X11 A;  1DDM A;  5DHF B;  4HB4 B;  1X05 A;  2ROV A;  2RLO A;  1ZC4 B;  1OMW A;  2Q13 A;  1DDV A;  2VKI A;  4K17 A;  4K2P A;  1FGY A;  1J19 A;  5GOW B;  1W1H A;  1OQN A;  1M7R A;  4HAV B;  1DRO A;  2I5C A;  2K2J A;  2LKO A;  4YL8 A;  1BTK A;  1BAK A;  2J0K A;  2PZ1 A;  3HK0 A;  4CHM A;  1NTY A;  1WGQ A;  1RRP B;  2L1C A;  1Z87 A;  2DN6 A;  1KZG A;  2W2W A;  2DX5 A;  4YON A;  3BIN A;  4L6E A;  2K00 A;  3PP2 A;  2GCJ A;  3DXE A;  2ELB A;  1GC7 A;  2UVM A;  1LW3 A;  1X1G A;  1UPR A;  4KAX B;  5FI1 A;  1XKE A;  1DYN A;  2H7E A;  4IOY X;  5JHG A;  2CY4 A;  1U5G A;  4GXB A;  5KQ4 A;  1XX0 A;  3ZVR A;  2M14 A;  1U29 A; 
#chains in the Genus database with same CATH topology
 3AJ4 A;  2P0F A;  4OSN A;  1Y5O A;  2CAY A;  3SNH A;  5DI9 B;  2MKR A;  1FHO A;  1FAO A;  5FI0 A;  3A58 A;  4EJN A;  1SHC A;  1K5D B;  2K2U A;  3IVF A;  2D2Q A;  2K49 A;  3WA0 A;  2MFQ A;  4ZRJ A;  1X1F A;  1MIX A;  2LG1 A;  3OHM B;  1UNP A;  1UNQ A;  1FHX A;  1Q67 A;  2IYB A;  1XCG A;  5DIF B;  5HE2 A;  5DH9 B;  1P3R A;  5C5B B;  2D9X A;  3QBV B;  5JP4 A;  3DXC A;  4NSW A;  4WVF B;  1LB1 A;  1V5P A;  2CY5 A;  2FJL A;  5C79 A;  4A6K A;  1P6S A;  2Z59 A;  4A5K A;  4EMO A;  3KSY A;  2DHJ A;  1DDW A;  4P7I A;  2RUK B;  4CSQ A;  2DFK A;  1FB8 A;  4Z2N A;  2VSZ A;  3ODO A;  1UPQ A;  2E2X A;  1KZ7 A;  4GMX B;  3PZD A;  1FGZ A;  2DYQ A;  1NU2 A;  4XWX A;  4DIX A;  5DHA B;  1T77 A;  2AL6 A;  4DBB A;  5C5B A;  4KVG B;  3SYX A;  3T06 A;  3NWD A;  5IRS A;  1PFJ A;  1TXD A;  2R0D A;  3D8F A;  4NY0 A;  4ZRI A;  2Z4D A;  4MY6 A;  3HSA A;  4KHB B;  4WJ7 A;  1NI2 A;  1WJ1 A;  5D3W A;  1J0W A;  4L1R A;  2DHI A;  3TFM A;  3U7D A;  1ZYI A;  1MIZ B;  2QKM A;  4IAP A;  2Y8F A;  1QC6 A;  2J0J A;  4PNK A;  2COA A;  4F7G A;  2K8E A;  4HB0 B;  4B6H A;  4Z2M B;  2YT2 A;  2MDX A;  5M4Y B;  1B55 A;  3WYF B;  3ZDT A;  1WVH A;  5D3X A;  1WG7 A;  2GJY A;  3ML4 A;  3MPX A;  2Z13 A;  3DCX A;  1MKE A;  4BBK A;  3UZT A;  1U5E A;  2COF A;  1V61 A;  1RJ2 A;  4GZU A;  1W1D A;  3TVV A;  4KHB A;  2ROZ B;  2DYN A;  4DX9 0;  4CYE A;  4GNK B;  2DA0 A;  4HAX B;  1I7A A;  2W2X C;  1QQG A;  1KI1 B;  5L81 A;  1AQC A;  2BCJ A;  1M7E A;  4HAU B;  4HAW B;  1EF1 A;  3QIJ A;  2ADZ A;  2DKQ A;  5J3Q A;  4QJ4 B;  2GCL A;  5I2M A;  1MPH A;  1U27 A;  2IFS A;  1W1G A;  3FVC A;  1TQZ A;  3PVU A;  2KIE A;  3A8P A;  3N7C A;  4F7U P;  1XOD A;  5LG4 B;  2D11 A;  2DHK A;  2UZS A;  2D9V A;  1EVH A;  2I1K A;  3KY9 A;  4TKN A;  3TCA A;  3NW8 A;  1BWN A;  4GOU A;  1EGX A;  5KQ1 A;  2D4Q A;  3MDB C;  4KHA A;  5J3Y A;  1E5W A;  1I2H A;  1MI1 A;  2LUL A;  2YSZ A;  1V5M A;  3AU5 A;  3OAN A;  2YS5 A;  2QKL A;  5HE1 A;  2G35 A;  3SUZ A;  1NTV A;  2KCJ A;  4HDQ A;  2HTH B;  3X23 A;  2J0M A;  3FEH A;  4MK0 A;  3GYO A;  2N0Y A;  5J3T A;  5CLQ B;  5JLJ B;  2YS3 A;  1UEF A;  2YF0 A;  2D9W A;  2OQB A;  2FJU B;  2NZ8 B;  2CRF A;  2EMS A;  2Y8G A;  3PVL A;  3ULC A;  3P7Z A;  2J59 M;  3O96 A;  3U8Z A;  4QJ3 B;  1GC6 A;  3HW2 B;  1ZSQ A;  1MK7 B;  2I1J A;  2Z0Q A;  2KUQ A;  1TJ6 A;  2DTC A;  5HE0 A;  2V76 A;  2COD A;  5CLL B;  4QJ5 B;  2Z0P A;  3V5W A;  4HB2 B;  3F5R A;  3PVW A;  3SV1 A;  1PMS A;  2EMT A;  5LON B;  3SO6 A;  2W2X D;  3KZ1 A;  2D9Z A;  4GN1 A;  1U5D A;  5LOP B;  3VIA A;  1N3H A;  1BTN A;  4PQ0 A;  2KR0 A;  4HHV A;  3LJU X;  2GS0 A;  1IRS A;  2ELA A;  3PG7 A;  5D3V A;  1EAZ A;  3KRX A;  1V89 A;  1H10 A;  2COC A;  3PSC A;  3CXB B;  4K81 A;  3HQC A;  2LOZ A;  2YT0 A;  3D8E A;  1H4R A;  3ULB A;  3A8Q A;  1WJM A;  5C6R A;  3AU4 A;  4DX8 A;  2KIG A;  4A6F B;  5I2S A;  3A98 B;  4H8S A;  2N23 A;  2D9Y A;  2DX1 A;  2L2I A;  2RRF A;  3RCP A;  2YT1 A;  2YRY A;  4WSF A;  3CIK A;  1K5G B;  3ODW A;  2H7D A;  3BJI A;  3FSS A;  4OT1 A;  5C16 A;  4A6H A;  2M38 A;  2JP2 A;  3TW1 A;  5JHH A;  2UZR A;  2P0H A;  3D8D A;  3DXD A;  2KGX B;  2ZKM X;  4HB3 B;  2RSG A;  1FOE A;  2OTX A;  5HE3 A;  2EJ8 A;  4GMV A;  1MK9 B;  4ZRK A;  1FHW A;  1OY2 A;  2I5F A;  4C0A A;  2DLW A;  1UNR A;  1AWE A;  1ZC3 B;  4A6F A;  2LOX A;  1V88 A;  2AEH A;  2LYD A;  1MAI A;  4EKU A;  3M1I B;  4Y94 A;  2R09 A;  2YS1 A;  2RNR B;  4CHJ A;  3QWM A;  1ZM0 A;  1ZVR A;  3ODX A;  1DBH A;  3G9W A;  5D27 A;  2P0D A;  1P5T A;  2VRW B;  1PLS A;  1WGU A;  1WI1 A;  4KHO A;  4DXA B;  1GG3 A;  1U2B A;  2GUM A;  4HAY B;  2ZPY A;  3B77 A;  4HSI A;  4MT7 A;  5D3Y A;  4D6W A;  2Z0O A;  1X86 A;  3VOQ A;  2EC1 A;  1U5F A;  2Y7B A;  2NMB A;  3FM8 C;  2XQN M;  4IFS A;  2MWN B;  3P6A A;  3KRW A;  3PEG A;  2X18 A;  1V5U A;  2NBV A;  3NWA A;  4HAZ B;  1ISN A;  5KCV A;  2RVB B;  3NSU A;  4K2O A;  3NWF A;  3F0W A;  2D10 A;  2P8V A;  4HDO A;  1Y19 B;  2KUP A;  3TO1 A;  4D0N B;  2YVC A;  2HE7 A;  3GYP A;  4QXA B;  1XD4 A;  3U12 A;  1SGH A;  5EFX A;  3HIE A;  2DKP A;  2RGN B;  4F7H A;  1XR0 B;  4TYZ A;  2Z14 A;  4GPT B;  4HAT B;  1X11 A;  1DDM A;  5DHF B;  4HB4 B;  1X05 A;  2ROV A;  2RLO A;  1ZC4 B;  1OMW A;  2Q13 A;  1DDV A;  2VKI A;  4K17 A;  4K2P A;  1FGY A;  1J19 A;  5GOW B;  1W1H A;  1OQN A;  1M7R A;  4HAV B;  1DRO A;  2I5C A;  2K2J A;  2LKO A;  4YL8 A;  1BTK A;  1BAK A;  2J0K A;  2PZ1 A;  3HK0 A;  4CHM A;  1NTY A;  2R2Y A;  1WGQ A;  1RRP B;  2L1C A;  1Z87 A;  2DN6 A;  1KZG A;  2W2W A;  2DX5 A;  4YON A;  3BIN A;  4L6E A;  2K00 A;  3PP2 A;  2GCJ A;  3DXE A;  2ELB A;  1GC7 A;  2UVM A;  1LW3 A;  1X1G A;  1UPR A;  4KAX B;  5FI1 A;  1XKE A;  1DYN A;  2H7E A;  4IOY X;  5JHG A;  2CY4 A;  1U5G A;  4GXB A;  5KQ4 A;  1XX0 A;  3ZVR A;  2M14 A;  1U29 A; 
#chains in the Genus database with same CATH homology
 3AJ4 A;  2P0F A;  4OSN A;  1Y5O A;  2CAY A;  3SNH A;  5DI9 B;  2MKR A;  1FHO A;  1FAO A;  5FI0 A;  3A58 A;  4EJN A;  1SHC A;  1K5D B;  2K2U A;  3IVF A;  2D2Q A;  2K49 A;  3WA0 A;  2MFQ A;  4ZRJ A;  1X1F A;  1MIX A;  2LG1 A;  3OHM B;  1UNP A;  1UNQ A;  1FHX A;  1Q67 A;  2IYB A;  1XCG A;  5DIF B;  5HE2 A;  5DH9 B;  1P3R A;  5C5B B;  2D9X A;  3QBV B;  5JP4 A;  3DXC A;  4NSW A;  4WVF B;  1LB1 A;  1V5P A;  2CY5 A;  2FJL A;  5C79 A;  4A6K A;  1P6S A;  4A5K A;  4EMO A;  2Z59 A;  3KSY A;  2DHJ A;  1DDW A;  4P7I A;  2RUK B;  4CSQ A;  2DFK A;  1FB8 A;  4Z2N A;  2VSZ A;  3ODO A;  1UPQ A;  2E2X A;  1KZ7 A;  4GMX B;  3PZD A;  1FGZ A;  2DYQ A;  1NU2 A;  4XWX A;  4DIX A;  5DHA B;  2AL6 A;  4DBB A;  5C5B A;  4KVG B;  3SYX A;  3T06 A;  3NWD A;  5IRS A;  1PFJ A;  1TXD A;  2R0D A;  3D8F A;  4NY0 A;  4ZRI A;  2Z4D A;  4MY6 A;  4KHB B;  4WJ7 A;  1NI2 A;  1WJ1 A;  5D3W A;  1J0W A;  4L1R A;  2DHI A;  3TFM A;  3U7D A;  1ZYI A;  1MIZ B;  4IAP A;  2QKM A;  2Y8F A;  1QC6 A;  2J0J A;  4PNK A;  2COA A;  4F7G A;  2K8E A;  4HB0 B;  4B6H A;  4Z2M B;  2YT2 A;  2MDX A;  5M4Y B;  1B55 A;  3WYF B;  3ZDT A;  1WVH A;  5D3X A;  1WG7 A;  2GJY A;  3ML4 A;  3MPX A;  2Z13 A;  1MKE A;  4BBK A;  3UZT A;  1U5E A;  2COF A;  1V61 A;  1RJ2 A;  4GZU A;  1W1D A;  3TVV A;  4KHB A;  2ROZ B;  2DYN A;  4DX9 0;  4CYE A;  4GNK B;  2DA0 A;  4HAX B;  1I7A A;  2W2X C;  1QQG A;  1KI1 B;  5L81 A;  1AQC A;  2BCJ A;  1M7E A;  4HAU B;  4HAW B;  1EF1 A;  3QIJ A;  2ADZ A;  2DKQ A;  5J3Q A;  4QJ4 B;  2GCL A;  5I2M A;  1MPH A;  1U27 A;  2IFS A;  1W1G A;  3FVC A;  1TQZ A;  3PVU A;  2KIE A;  3A8P A;  3N7C A;  4F7U P;  1XOD A;  5LG4 B;  2D11 A;  2DHK A;  2UZS A;  2D9V A;  1EVH A;  2I1K A;  3KY9 A;  4TKN A;  3TCA A;  3NW8 A;  1BWN A;  4GOU A;  1EGX A;  5KQ1 A;  2D4Q A;  3MDB C;  4KHA A;  5J3Y A;  1E5W A;  1I2H A;  2LUL A;  2YSZ A;  1V5M A;  3AU5 A;  3OAN A;  2YS5 A;  2QKL A;  5HE1 A;  2G35 A;  3SUZ A;  1NTV A;  2KCJ A;  4HDQ A;  2HTH B;  3X23 A;  2J0M A;  3FEH A;  4MK0 A;  3GYO A;  2N0Y A;  5J3T A;  5CLQ B;  5JLJ B;  2YS3 A;  1UEF A;  2YF0 A;  2D9W A;  2OQB A;  2FJU B;  2NZ8 B;  2CRF A;  2EMS A;  2Y8G A;  3PVL A;  3ULC A;  3P7Z A;  2J59 M;  3O96 A;  3U8Z A;  4QJ3 B;  1GC6 A;  3HW2 B;  1ZSQ A;  1MK7 B;  2I1J A;  2Z0Q A;  2KUQ A;  1TJ6 A;  2DTC A;  5HE0 A;  2V76 A;  2COD A;  5CLL B;  4QJ5 B;  2Z0P A;  3V5W A;  4HB2 B;  3F5R A;  3PVW A;  3SV1 A;  1PMS A;  2EMT A;  5LON B;  3SO6 A;  2W2X D;  3KZ1 A;  2D9Z A;  4GN1 A;  1U5D A;  5LOP B;  3VIA A;  1N3H A;  1BTN A;  4PQ0 A;  4HHV A;  2KR0 A;  3LJU X;  2GS0 A;  1IRS A;  2ELA A;  3PG7 A;  5D3V A;  1EAZ A;  3KRX A;  1V89 A;  1H10 A;  2COC A;  3PSC A;  3CXB B;  4K81 A;  3HQC A;  2LOZ A;  2YT0 A;  3D8E A;  1H4R A;  3ULB A;  3A8Q A;  1WJM A;  5C6R A;  3AU4 A;  4DX8 A;  2KIG A;  4A6F B;  5I2S A;  3A98 B;  4H8S A;  2N23 A;  2D9Y A;  2DX1 A;  2L2I A;  3RCP A;  2RRF A;  2YT1 A;  2YRY A;  4WSF A;  3CIK A;  1K5G B;  3ODW A;  2H7D A;  3BJI A;  3FSS A;  5C16 A;  4OT1 A;  4A6H A;  2M38 A;  2JP2 A;  3TW1 A;  5JHH A;  2UZR A;  2P0H A;  3D8D A;  3DXD A;  2KGX B;  2ZKM X;  4HB3 B;  2RSG A;  1FOE A;  2OTX A;  5HE3 A;  2EJ8 A;  4GMV A;  1MK9 B;  4ZRK A;  1FHW A;  1OY2 A;  2I5F A;  4C0A A;  2DLW A;  1UNR A;  1AWE A;  1ZC3 B;  4A6F A;  2LOX A;  1V88 A;  2AEH A;  2LYD A;  1MAI A;  4EKU A;  3M1I B;  4Y94 A;  2R09 A;  2YS1 A;  2RNR B;  4CHJ A;  3QWM A;  1ZM0 A;  1ZVR A;  3ODX A;  1DBH A;  3G9W A;  5D27 A;  2P0D A;  1P5T A;  2VRW B;  1PLS A;  1WGU A;  1WI1 A;  4KHO A;  4DXA B;  1GG3 A;  1U2B A;  4HAY B;  2GUM A;  2ZPY A;  4HSI A;  4MT7 A;  5D3Y A;  4D6W A;  2Z0O A;  1X86 A;  3VOQ A;  2EC1 A;  1U5F A;  2Y7B A;  2NMB A;  3FM8 C;  2XQN M;  4IFS A;  2MWN B;  3P6A A;  3KRW A;  3PEG A;  2X18 A;  1V5U A;  2NBV A;  3NWA A;  4HAZ B;  1ISN A;  5KCV A;  2RVB B;  3NSU A;  4K2O A;  3NWF A;  3F0W A;  2D10 A;  2P8V A;  4HDO A;  1Y19 B;  2KUP A;  3TO1 A;  4D0N B;  2YVC A;  2HE7 A;  3GYP A;  4QXA B;  1XD4 A;  3U12 A;  1SGH A;  5EFX A;  3HIE A;  2DKP A;  2RGN B;  4F7H A;  1XR0 B;  4TYZ A;  2Z14 A;  4GPT B;  4HAT B;  1X11 A;  1DDM A;  5DHF B;  4HB4 B;  1X05 A;  2ROV A;  2RLO A;  1ZC4 B;  1OMW A;  2Q13 A;  1DDV A;  2VKI A;  4K17 A;  4K2P A;  1FGY A;  1J19 A;  5GOW B;  1W1H A;  1OQN A;  1M7R A;  4HAV B;  1DRO A;  2I5C A;  2K2J A;  2LKO A;  4YL8 A;  1BTK A;  1BAK A;  2J0K A;  2PZ1 A;  3HK0 A;  4CHM A;  1NTY A;  2R2Y A;  1WGQ A;  1RRP B;  2L1C A;  1Z87 A;  2DN6 A;  1KZG A;  2W2W A;  2DX5 A;  4YON A;  3BIN A;  4L6E A;  2K00 A;  3PP2 A;  2GCJ A;  3DXE A;  2ELB A;  1GC7 A;  2UVM A;  1LW3 A;  1X1G A;  1UPR A;  4KAX B;  5FI1 A;  1XKE A;  1DYN A;  2H7E A;  4IOY X;  5JHG A;  2CY4 A;  1U5G A;  4GXB A;  5KQ4 A;  1XX0 A;  3ZVR A;  2M14 A;  1U29 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...