3TW1A

Structure of rtt106-ahn
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
232
structure length
222
Chain Sequence
b'TNTIFKLEGVSVLSPLRKKLDLVFYLSNVDGSPVITLLKGNDRELSIYQLNKNIKMASFLPVPEKPNLIYLFMTYTSCEDNKFSEPVVMTLNKENTLNQFKKLGLLDSNVTDFEKCVEYIRKQAILTGFKISNPFVKINSFHLQCHRGTKEGTLYFLPDHIIFGFKKPILLLDASDIESITYSSITRLTFNASLVTKDGEKYEFSMIDQTEYAKIDDYVKRK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone chaperone RTT106
publication title Structural basis for recognition of H3K56-acetylated histone H3-H4 by the chaperone Rtt106.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Chaperone
total genus 55
structure length 222
sequence length 232
ec nomenclature
pdb deposition date 2011-09-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 3tw1A02
2.30.29.120 Mainly Beta Roll PH-domain like PH-domain like 3tw1A01
3MPXA 2YVCA 4KHOA 1WGUA 2UVMA 4GZUA 5D3XA 2Z0QA 4MK0A 2L1CA 2M14A 3BJIA 4HB4B 4P7IA 3F5RA 3P7ZA 1OMWA 2D9ZA 2R0DA 4KVGB 3T06A 1MKEA 1DDMA 5DIFB 4MT7A 1V88A 5FI0A 1Q67A 2P8VA 2LOZA 4YL8A 2ELAA 1OQNA 2N23A 4HAVB 3V5WA 1U29A 5FI1A 5L81A 4K2PA 4EKUA 1UPQA 1W1GA 2XQNM 4C0AA 1U5EA 5JHHA 3A98B 1V5PA 1FAOA 2EMTA 1DYNA 2Q13A 2V76A 3AJ4A 5CLQB 4ZRIA 3CIKA 4HAWB 1KZ7A 4F7UP 4A5KA 4IFSA 1Y5OA 3ULCA 1EAZA 3LJUX 2G35A 2COAA 2DKQA 2PZ1A 3TW1A 2Y7BA 4DXAB 1TJ6A 5CLLB 3FSSA 4Y94A 2GCJA 1XODA 2EMSA 1UEFA 3SO6A 1RJ2A 1XR0B 3KRXA 5HE3A 1SHCA 3PVLA 4L6EA 4WJ7A 5KQ1A 2P0DA 1AWEA 2ELBA 5JLJB 3FEHA 1X86A 4HB3B 1PLSA 1U5FA 4K2OA 4GMVA 4NSWA 2CY5A 4HAUB 2J0MA 4IAPA 3M1IB 4HAYB 3IVFA 2MDXA 2GS0A 1V89A 2IFSA 4Z2MB 1GG3A 2I5FA 2RLOA 1W1DA 4B6HA 2K2UA 2YSZA 3HQCA 2J0KA 2KUPA 4YONA 3A8QA 4CHMA 2RSGA 3DXEA 3F0WA 2NZ8B 2UZRA 5DHFB 1ZSQA 4MY6A 3VIAA 1EGXA 1X1FA 3KY9A 1EVHA 4HAZB 4CYEA 1J19A 2LOXA 2CODA 1WJMA 3SV1A 4K17A 2DTCA 3HW2B 2ROVA 1MK7B 4KHAA 1NTYA 1QC6A 3ODXA 2OTXA 5C5BA 1KZGA 1H10A 5JP4A 2Y8FA 2DLWA 5HE0A 5JHGA 4XWXA 5GOWB 1I7AA 2DYNA 1NI2A 3PG7A 2CRFA 1TXDA 4DX8A 5C5BB 1W1HA 1WGQA 3VOQA 4HB2B 1RRPB 1WJ1A 2RNRB 4TKNA 3WA0A 2VKIA 2GJYA 1Z87A 3D8DA 4DBBA 1DBHA 3SNHA 2GCLA 3ULBA 2BCJA 2HE7A 3ML4A 1EF1A 5D27A 3SUZA 3MDBC 2DHIA 4PNKA 1NU2A 4HDQA 4A6FA 4K81A 1U5GA 1LB1A 2YT1A 1B55A 4F7HA 2M38A 3O96A 3ODOA 4HHVA 1U27A 2JP2A 2OQBA 2HTHB 4A6FB 4A6KA 2VRWB 5C79A 5J3TA 4GXBA 3KRWA 1I2HA 2YS1A 4HATB 2YT0A 2L2IA 3KZ1A 2D9WA 3U8ZA 5LONB 1PMSA 3TFMA 5D3VA 5C6RA 4F7GA 2KCJA 2ZPYA 3AU5A 2YS3A 2CY4A 4TYZA 5D3YA 2I5CA 1P3RA 2LYDA 2DA0A 1ZVRA 5J3YA 3OANA 2NMBA 1DDWA 1K5GB 4GMXB 2DHKA 1M7EA 4GN1A 3PVUA 2AL6A 3ZVRA 3PSCA 5D3WA 1FHXA 2D10A 1BAKA 1TQZA 2H7EA 1UNQA 4WVFB 5KQ4A 1FB8A 2W2WA 3A8PA 3DXDA 1SGHA 3ZDTA 3NSUA 5J3QA 3QBVB 1XKEA 2Y8GA 2YRYA 2R09A 4ZRJA 2I1KA 1N3HA 1X11A 1V5MA 1WVHA 1MK9B 1WG7A 1DROA 2DYQA 2ROZB 1X05A 1UPRA 5KCVA 2LKOA 1WI1A 1U5DA 2COFA 1MAIA 1PFJA 2YF0A 1QQGA 1H4RA 1KI1B 2DHJA 2E2XA 3CXBB 3KSYA 3WYFB 1XD4A 2Z0PA 1MIZB 4Z2NA 2DFKA 5EFXA 2YS5A 5LOPB 1K5DB 2QKMA 1UNPA 2P0HA 2N0YA 1M7RA 3X23A 1X1GA 1NTVA 2J59M 2D11A 4WSFA 1BTKA 1FHOA 1OY2A 4KAXB 4EMOA 3P6AA 3U7DA 5C16A 1GC6A 2EJ8A 2P0FA 1AQCA 1XCGA 3GYOA 2UZSA 2I1JA 4D0NB 2D4QA 1ZC3B 2DN6A 2LULA 3D8FA 1P5TA 4IOYX 2CAYA 4HDOA 4EJNA 1IRSA 2ADZA 3D8EA 1FGZA 1DDVA 2K2JA 4DX90 5DHAB 2J0JA 3TCAA 5HE1A 2RGNB 1FHWA 3G9WA 3QIJA 2RUKB 3BINA 2DKPA 3FM8C 2D9VA 3RCPA 2W2XD 1U2BA 4H8SA 2KGXB 2H7DA 1P6SA 3PEGA 3DXCA 4CHJA 1MIXA 4A6HA 3PP2A 1Y19B 3GYPA 1ZC4B 2K00A 1BTNA 1XX0A 2MKRA 4HB0B 2COCA 1V5UA 2D2QA 1LW3A 2MFQA 2AEHA 4KHBB 1BWNA 1V61A 1E5WA 4ZRKA 4PQ0A 1ISNA 1FGYA 3HK0A 2W2XC 4GPTB 2D9YA 2DX5A 1GC7A 2QKLA 3UZTA 1J0WA 5DI9B 2X18A 5HE2A 3AU4A 1UNRA 2IYBA 3TVVA 2MWNB 2RVBB 3PZDA 3ODWA 3PVWA 2FJLA 2Z0OA 1FOEA 2EC1A 4HAXB 3TO1A 4BBKA 2DX1A 3SYXA 2LG1A 2VSZA 1MPHA 4NY0A 2D9XA 5DH9B 3N7CA 1ZM0A 3QWMA
chains in the Genus database with same CATH superfamily
3MPXA 2YVCA 4KHOA 1WGUA 2UVMA 4GZUA 5D3XA 2Z0QA 4MK0A 2L1CA 2M14A 3BJIA 4HB4B 4P7IA 3F5RA 3P7ZA 4GNKB 3HIEA 1OMWA 2D9ZA 2R0DA 4KVGB 3T06A 2KUQA 1MKEA 1DDMA 5DIFB 4MT7A 1V88A 5FI0A 1Q67A 2P8VA 2LOZA 4YL8A 2ELAA 1OQNA 2N23A 4HAVB 3V5WA 1U29A 5FI1A 5L81A 4K2PA 4EKUA 1UPQA 1W1GA 2XQNM 4C0AA 3NWDA 1U5EA 5JHHA 3A98B 1V5PA 1FAOA 5I2MA 2EMTA 1DYNA 2Q13A 2V76A 3AJ4A 5CLQB 4ZRIA 3CIKA 4HAWB 1KZ7A 4F7UP 4A5KA 4IFSA 1Y5OA 3ULCA 1EAZA 3LJUX 2G35A 2COAA 3OHMB 2DKQA 2PZ1A 3TW1A 2Y7BA 4DXAB 1TJ6A 5CLLB 2Z4DA 3FSSA 4Y94A 2GCJA 1XODA 2EMSA 2GUMA 1UEFA 4KHBA 5LG4B 3SO6A 1RJ2A 1XR0B 3KRXA 5HE3A 1SHCA 3PVLA 4L6EA 4WJ7A 5KQ1A 2P0DA 1AWEA 2ELBA 5JLJB 3FEHA 1X86A 3A58A 4HB3B 1PLSA 1U5FA 4K2OA 4GMVA 4NSWA 2CY5A 4HAUB 2J0MA 4IAPA 3M1IB 4HAYB 3IVFA 2MDXA 2GS0A 1V89A 4QJ3B 2IFSA 4Z2MB 1GG3A 2I5FA 2RLOA 1W1DA 4B6HA 2K2UA 2YSZA 3HQCA 2J0KA 2KUPA 4YONA 3A8QA 4CHMA 2RSGA 3DXEA 3F0WA 2NZ8B 2UZRA 5DHFB 1ZSQA 3NW8A 4MY6A 3VIAA 1EGXA 1X1FA 3KY9A 3NWFA 1EVHA 2NBVA 4HAZB 4CYEA 1J19A 2LOXA 2CODA 1WJMA 3SV1A 4K17A 2DTCA 3HW2B 2ROVA 1MK7B 2FJUB 4KHAA 1NTYA 1QC6A 3ODXA 2OTXA 5C5BA 4L1RA 1T77A 1KZGA 1H10A 5JP4A 2Y8FA 2DLWA 5HE0A 5JHGA 4XWXA 5GOWB 1I7AA 2DYNA 1NI2A 3PG7A 2CRFA 1TXDA 4DX8A 5C5BB 1W1HA 1WGQA 3VOQA 4HB2B 3NWAA 1RRPB 1WJ1A 2RNRB 4TKNA 3WA0A 2VKIA 2GJYA 1Z87A 3D8DA 4DBBA 1DBHA 3SNHA 2GCLA 3ULBA 2BCJA 2HE7A 3ML4A 1EF1A 3B77A 5D27A 3SUZA 3MDBC 2DHIA 4PNKA 1NU2A 4HDQA 4A6FA 4K81A 1U5GA 1LB1A 2YT1A 1B55A 4QJ4B 4F7HA 4QJ5B 2M38A 3O96A 3ODOA 4HHVA 1U27A 2JP2A 2OQBA 2HTHB 3DCXA 4A6FB 4A6KA 2VRWB 5C79A 5J3TA 4GXBA 3KRWA 1I2HA 2Z59A 2YS1A 4HATB 2YT0A 2L2IA 3KZ1A 2D9WA 3U8ZA 5LONB 1PMSA 3TFMA 5D3VA 5C6RA 4F7GA 2KCJA 2ZPYA 2ZKMX 3AU5A 2YS3A 4OT1A 2CY4A 4TYZA 5D3YA 2K49A 2I5CA 1P3RA 2LYDA 2DA0A 3FVCA 1ZVRA 5J3YA 3OANA 2NMBA 1DDWA 1K5GB 4GMXB 2DHKA 1M7EA 4GN1A 3PVUA 2AL6A 2RRFA 3ZVRA 3PSCA 5D3WA 1FHXA 2D10A 1BAKA 1TQZA 2H7EA 2KR0A 1UNQA 4WVFB 5KQ4A 1FB8A 2W2WA 3A8PA 3DXDA 1SGHA 3U12A 3ZDTA 4OSNA 3NSUA 5J3QA 2KIGA 1XKEA 3QBVB 2Y8GA 2YRYA 2R09A 4ZRJA 2I1KA 1N3HA 1X11A 5I2SA 2YT2A 1V5MA 1WVHA 1MK9B 1WG7A 1DROA 2DYQA 2ROZB 1X05A 1UPRA 5KCVA 2LKOA 1WI1A 1U5DA 2COFA 1MAIA 1PFJA 2YF0A 1QQGA 4GOUA 1H4RA 1KI1B 2DHJA 2E2XA 3CXBB 3KSYA 3HSAA 3WYFB 1XD4A 2Z0PA 1MIZB 4Z2NA 2DFKA 5EFXA 2YS5A 5LOPB 1K5DB 2QKMA 1UNPA 2P0HA 2N0YA 1M7RA 3X23A 1X1GA 1NTVA 2J59M 2D11A 4WSFA 2R2YA 1BTKA 5M4YB 1FHOA 1OY2A 4KAXB 4EMOA 3P6AA 3U7DA 4HSIA 5C16A 1GC6A 2EJ8A 2P0FA 1AQCA 1XCGA 3GYOA 4D6WA 2UZSA 2I1JA 4D0NB 2D4QA 2Z13A 4DIXA 1ZC3B 2DN6A 2LULA 3D8FA 1P5TA 4IOYX 2CAYA 4HDOA 4EJNA 1MI1A 1IRSA 2ADZA 3D8EA 1FGZA 1DDVA 2K2JA 4DX90 5DHAB 2J0JA 3TCAA 5HE1A 2RGNB 1FHWA 3G9WA 3QIJA 2RUKB 3BINA 2KIEA 2DKPA 3FM8C 2D9VA 2Z14A 1ZYIA 3RCPA 2W2XD 1U2BA 4H8SA 2KGXB 2H7DA 4CSQA 1P6SA 3PEGA 3DXCA 4CHJA 1MIXA 4A6HA 3PP2A 1Y19B 3GYPA 1ZC4B 2K8EA 2K00A 1BTNA 1XX0A 2MKRA 4HB0B 2COCA 5IRSA 1V5UA 2D2QA 1LW3A 2MFQA 2AEHA 4KHBB 1BWNA 1V61A 1E5WA 4ZRKA 4PQ0A 1ISNA 1FGYA 3HK0A 2W2XC 4GPTB 2D9YA 2DX5A 1GC7A 2QKLA 3UZTA 1J0WA 5DI9B 2X18A 5HE2A 3AU4A 1UNRA 2IYBA 3TVVA 2MWNB 2RVBB 3PZDA 3ODWA 3PVWA 2FJLA 2Z0OA 1FOEA 2EC1A 4HAXB 3TO1A 4BBKA 2DX1A 3SYXA 4QXAB 2LG1A 2VSZA 1MPHA 4NY0A 2D9XA 5DH9B 3N7CA 1ZM0A 3QWMA
chains in the Genus database with same CATH topology
3MPXA 2YVCA 4KHOA 1WGUA 2UVMA 4GZUA 5D3XA 2Z0QA 4MK0A 2L1CA 2M14A 3BJIA 4HB4B 4P7IA 3F5RA 3P7ZA 4GNKB 3HIEA 1OMWA 2D9ZA 2R0DA 4KVGB 3T06A 2KUQA 1MKEA 1DDMA 5DIFB 4MT7A 1V88A 5FI0A 1Q67A 2P8VA 2LOZA 4YL8A 2ELAA 1OQNA 2N23A 4HAVB 3V5WA 1U29A 5FI1A 5L81A 4K2PA 4EKUA 1UPQA 1W1GA 2XQNM 4C0AA 3NWDA 1U5EA 5JHHA 3A98B 1V5PA 1FAOA 5I2MA 2EMTA 1DYNA 2Q13A 2V76A 3AJ4A 5CLQB 4ZRIA 3CIKA 4HAWB 1KZ7A 4F7UP 4A5KA 4IFSA 1Y5OA 3ULCA 1EAZA 3LJUX 2G35A 2COAA 3OHMB 2DKQA 2PZ1A 3TW1A 2Y7BA 4DXAB 1TJ6A 5CLLB 2Z4DA 3FSSA 4Y94A 2GCJA 1XODA 2EMSA 2GUMA 1UEFA 4KHBA 5LG4B 3SO6A 1RJ2A 1XR0B 3KRXA 5HE3A 1SHCA 3PVLA 4L6EA 4WJ7A 5KQ1A 2P0DA 1AWEA 2ELBA 5JLJB 3FEHA 1X86A 3A58A 4HB3B 1PLSA 1U5FA 4K2OA 4GMVA 4NSWA 2CY5A 4HAUB 2J0MA 4IAPA 3M1IB 4HAYB 3IVFA 2MDXA 2GS0A 1V89A 4QJ3B 2IFSA 4Z2MB 1GG3A 2I5FA 2RLOA 1W1DA 4B6HA 2K2UA 2YSZA 3HQCA 2J0KA 2KUPA 4YONA 3A8QA 4CHMA 2RSGA 3DXEA 3F0WA 2NZ8B 2UZRA 5DHFB 1ZSQA 3NW8A 4MY6A 3VIAA 1EGXA 1X1FA 3KY9A 3NWFA 1EVHA 2NBVA 4HAZB 4CYEA 1J19A 2LOXA 2CODA 1WJMA 3SV1A 4K17A 2DTCA 3HW2B 2ROVA 1MK7B 2FJUB 4KHAA 1NTYA 1QC6A 3ODXA 2OTXA 5C5BA 4L1RA 1KZGA 1H10A 5JP4A 2Y8FA 2DLWA 5HE0A 5JHGA 4XWXA 5GOWB 1I7AA 2DYNA 1NI2A 3PG7A 2CRFA 1TXDA 4DX8A 5C5BB 1W1HA 1WGQA 3VOQA 4HB2B 3NWAA 1RRPB 1WJ1A 2RNRB 4TKNA 3WA0A 2VKIA 2GJYA 1Z87A 3D8DA 4DBBA 1DBHA 3SNHA 2GCLA 3ULBA 2BCJA 2HE7A 3ML4A 1EF1A 5D27A 3SUZA 3MDBC 2DHIA 4PNKA 1NU2A 4HDQA 4A6FA 4K81A 1U5GA 1LB1A 2YT1A 1B55A 4QJ4B 4F7HA 4QJ5B 2M38A 3O96A 3ODOA 4HHVA 1U27A 2JP2A 2OQBA 2HTHB 4A6FB 4A6KA 2VRWB 5C79A 5J3TA 4GXBA 3KRWA 1I2HA 2Z59A 2YS1A 4HATB 2YT0A 2L2IA 3KZ1A 2D9WA 3U8ZA 5LONB 1PMSA 3TFMA 5D3VA 5C6RA 4F7GA 2KCJA 2ZPYA 3AU5A 2ZKMX 2YS3A 4OT1A 2CY4A 4TYZA 5D3YA 2K49A 2I5CA 1P3RA 2LYDA 2DA0A 3FVCA 1ZVRA 5J3YA 3OANA 2NMBA 1DDWA 1K5GB 4GMXB 2DHKA 1M7EA 4GN1A 3PVUA 2AL6A 2RRFA 3ZVRA 3PSCA 5D3WA 1FHXA 2D10A 1BAKA 1TQZA 2H7EA 2KR0A 1UNQA 4WVFB 5KQ4A 1FB8A 2W2WA 3A8PA 3DXDA 1SGHA 3U12A 3ZDTA 4OSNA 3NSUA 5J3QA 3QBVB 1XKEA 2KIGA 2Y8GA 2YRYA 2R09A 4ZRJA 2I1KA 1N3HA 1X11A 5I2SA 2YT2A 1V5MA 1WVHA 1MK9B 1WG7A 1DROA 2DYQA 2ROZB 1X05A 1UPRA 5KCVA 2LKOA 1WI1A 1U5DA 2COFA 1MAIA 1PFJA 2YF0A 1QQGA 4GOUA 1H4RA 1KI1B 2DHJA 2E2XA 3CXBB 3KSYA 3WYFB 1XD4A 2Z0PA 1MIZB 4Z2NA 2DFKA 5EFXA 2YS5A 5LOPB 1K5DB 2QKMA 1UNPA 2P0HA 2N0YA 1M7RA 3X23A 1X1GA 1NTVA 2J59M 2D11A 4WSFA 2R2YA 1BTKA 5M4YB 1FHOA 1OY2A 4KAXB 4EMOA 3P6AA 3U7DA 4HSIA 5C16A 1GC6A 2EJ8A 2P0FA 1AQCA 1XCGA 3GYOA 4D6WA 2UZSA 2I1JA 4D0NB 2D4QA 2Z13A 4DIXA 1ZC3B 2DN6A 2LULA 3D8FA 1P5TA 4IOYX 2CAYA 4HDOA 4EJNA 1IRSA 2ADZA 3D8EA 1FGZA 1DDVA 2K2JA 4DX90 5DHAB 2J0JA 3TCAA 5HE1A 2RGNB 1FHWA 3G9WA 3QIJA 2RUKB 3BINA 2KIEA 2DKPA 3FM8C 2D9VA 2Z14A 3RCPA 1ZYIA 2W2XD 1U2BA 4H8SA 2KGXB 2H7DA 4CSQA 1P6SA 3PEGA 3DXCA 4CHJA 1MIXA 4A6HA 3PP2A 1Y19B 3GYPA 1ZC4B 2K8EA 2K00A 1BTNA 1XX0A 2MKRA 4HB0B 2COCA 5IRSA 1V5UA 2D2QA 1LW3A 2MFQA 2AEHA 4KHBB 1BWNA 1V61A 1E5WA 4ZRKA 4PQ0A 1ISNA 1FGYA 3HK0A 2W2XC 4GPTB 2D9YA 2DX5A 1GC7A 2QKLA 3UZTA 1J0WA 5DI9B 2X18A 5HE2A 3AU4A 1UNRA 2IYBA 3TVVA 2MWNB 2RVBB 3PZDA 3ODWA 3PVWA 2FJLA 2Z0OA 1FOEA 2EC1A 4HAXB 3TO1A 4BBKA 2DX1A 3SYXA 4QXAB 2LG1A 2VSZA 1MPHA 4NY0A 2D9XA 5DH9B 3N7CA 1ZM0A 3QWMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MPX A;  2YVC A;  4KHO A;  1WGU A;  2UVM A;  4GZU A;  5D3X A;  2Z0Q A;  4MK0 A;  2L1C A;  2M14 A;  3BJI A;  4HB4 B;  4P7I A;  3F5R A;  3P7Z A;  1OMW A;  2D9Z A;  2R0D A;  4KVG B;  3T06 A;  1MKE A;  1DDM A;  5DIF B;  4MT7 A;  1V88 A;  5FI0 A;  1Q67 A;  2P8V A;  2LOZ A;  4YL8 A;  2ELA A;  1OQN A;  2N23 A;  4HAV B;  3V5W A;  1U29 A;  5FI1 A;  5L81 A;  4K2P A;  4EKU A;  1UPQ A;  1W1G A;  2XQN M;  4C0A A;  1U5E A;  5JHH A;  3A98 B;  1V5P A;  1FAO A;  2EMT A;  1DYN A;  2Q13 A;  2V76 A;  3AJ4 A;  5CLQ B;  4ZRI A;  3CIK A;  4HAW B;  1KZ7 A;  4F7U P;  4A5K A;  4IFS A;  1Y5O A;  3ULC A;  1EAZ A;  3LJU X;  2G35 A;  2COA A;  2DKQ A;  2PZ1 A;  3TW1 A;  2Y7B A;  4DXA B;  1TJ6 A;  5CLL B;  3FSS A;  4Y94 A;  2GCJ A;  1XOD A;  2EMS A;  1UEF A;  3SO6 A;  1RJ2 A;  1XR0 B;  3KRX A;  5HE3 A;  1SHC A;  3PVL A;  4L6E A;  4WJ7 A;  5KQ1 A;  2P0D A;  1AWE A;  2ELB A;  5JLJ B;  3FEH A;  1X86 A;  4HB3 B;  1PLS A;  1U5F A;  4K2O A;  4GMV A;  4NSW A;  2CY5 A;  4HAU B;  2J0M A;  4IAP A;  3M1I B;  4HAY B;  3IVF A;  2MDX A;  2GS0 A;  1V89 A;  2IFS A;  4Z2M B;  1GG3 A;  2I5F A;  2RLO A;  1W1D A;  4B6H A;  2K2U A;  2YSZ A;  3HQC A;  2J0K A;  2KUP A;  4YON A;  3A8Q A;  4CHM A;  2RSG A;  3DXE A;  3F0W A;  2NZ8 B;  2UZR A;  5DHF B;  1ZSQ A;  4MY6 A;  3VIA A;  1EGX A;  1X1F A;  3KY9 A;  1EVH A;  4HAZ B;  4CYE A;  1J19 A;  2LOX A;  2COD A;  1WJM A;  3SV1 A;  4K17 A;  2DTC A;  3HW2 B;  2ROV A;  1MK7 B;  4KHA A;  1NTY A;  1QC6 A;  3ODX A;  2OTX A;  5C5B A;  1KZG A;  1H10 A;  5JP4 A;  2Y8F A;  2DLW A;  5HE0 A;  5JHG A;  4XWX A;  5GOW B;  1I7A A;  2DYN A;  1NI2 A;  3PG7 A;  2CRF A;  1TXD A;  4DX8 A;  5C5B B;  1W1H A;  1WGQ A;  3VOQ A;  4HB2 B;  1RRP B;  1WJ1 A;  2RNR B;  4TKN A;  3WA0 A;  2VKI A;  2GJY A;  1Z87 A;  3D8D A;  4DBB A;  1DBH A;  3SNH A;  2GCL A;  3ULB A;  2BCJ A;  2HE7 A;  3ML4 A;  1EF1 A;  5D27 A;  3SUZ A;  3MDB C;  2DHI A;  4PNK A;  1NU2 A;  4HDQ A;  4A6F A;  4K81 A;  1U5G A;  1LB1 A;  2YT1 A;  1B55 A;  4F7H A;  2M38 A;  3O96 A;  3ODO A;  4HHV A;  1U27 A;  2JP2 A;  2OQB A;  2HTH B;  4A6F B;  4A6K A;  2VRW B;  5C79 A;  5J3T A;  4GXB A;  3KRW A;  1I2H A;  2YS1 A;  4HAT B;  2YT0 A;  2L2I A;  3KZ1 A;  2D9W A;  3U8Z A;  5LON B;  1PMS A;  3TFM A;  5D3V A;  5C6R A;  4F7G A;  2KCJ A;  2ZPY A;  3AU5 A;  2YS3 A;  2CY4 A;  4TYZ A;  5D3Y A;  2I5C A;  1P3R A;  2LYD A;  2DA0 A;  1ZVR A;  5J3Y A;  3OAN A;  2NMB A;  1DDW A;  1K5G B;  4GMX B;  2DHK A;  1M7E A;  4GN1 A;  3PVU A;  2AL6 A;  3ZVR A;  3PSC A;  5D3W A;  1FHX A;  2D10 A;  1BAK A;  1TQZ A;  2H7E A;  1UNQ A;  4WVF B;  5KQ4 A;  1FB8 A;  2W2W A;  3A8P A;  3DXD A;  1SGH A;  3ZDT A;  3NSU A;  5J3Q A;  3QBV B;  1XKE A;  2Y8G A;  2YRY A;  2R09 A;  4ZRJ A;  2I1K A;  1N3H A;  1X11 A;  1V5M A;  1WVH A;  1MK9 B;  1WG7 A;  1DRO A;  2DYQ A;  2ROZ B;  1X05 A;  1UPR A;  5KCV A;  2LKO A;  1WI1 A;  1U5D A;  2COF A;  1MAI A;  1PFJ A;  2YF0 A;  1QQG A;  1H4R A;  1KI1 B;  2DHJ A;  2E2X A;  3CXB B;  3KSY A;  3WYF B;  1XD4 A;  2Z0P A;  1MIZ B;  4Z2N A;  2DFK A;  5EFX A;  2YS5 A;  5LOP B;  1K5D B;  2QKM A;  1UNP A;  2P0H A;  2N0Y A;  1M7R A;  3X23 A;  1X1G A;  1NTV A;  2J59 M;  2D11 A;  4WSF A;  1BTK A;  1FHO A;  1OY2 A;  4KAX B;  4EMO A;  3P6A A;  3U7D A;  5C16 A;  1GC6 A;  2EJ8 A;  2P0F A;  1AQC A;  1XCG A;  3GYO A;  2UZS A;  2I1J A;  4D0N B;  2D4Q A;  1ZC3 B;  2DN6 A;  2LUL A;  3D8F A;  1P5T A;  4IOY X;  2CAY A;  4HDO A;  4EJN A;  1IRS A;  2ADZ A;  3D8E A;  1FGZ A;  1DDV A;  2K2J A;  4DX9 0;  5DHA B;  2J0J A;  3TCA A;  5HE1 A;  2RGN B;  1FHW A;  3G9W A;  3QIJ A;  2RUK B;  3BIN A;  2DKP A;  3FM8 C;  2D9V A;  3RCP A;  2W2X D;  1U2B A;  4H8S A;  2KGX B;  2H7D A;  1P6S A;  3PEG A;  3DXC A;  4CHJ A;  1MIX A;  4A6H A;  3PP2 A;  1Y19 B;  3GYP A;  1ZC4 B;  2K00 A;  1BTN A;  1XX0 A;  2MKR A;  4HB0 B;  2COC A;  1V5U A;  2D2Q A;  1LW3 A;  2MFQ A;  2AEH A;  4KHB B;  1BWN A;  1V61 A;  1E5W A;  4ZRK A;  4PQ0 A;  1ISN A;  1FGY A;  3HK0 A;  2W2X C;  4GPT B;  2D9Y A;  2DX5 A;  1GC7 A;  2QKL A;  3UZT A;  1J0W A;  5DI9 B;  2X18 A;  5HE2 A;  3AU4 A;  1UNR A;  2IYB A;  3TVV A;  2MWN B;  2RVB B;  3PZD A;  3ODW A;  3PVW A;  2FJL A;  2Z0O A;  1FOE A;  2EC1 A;  4HAX B;  3TO1 A;  4BBK A;  2DX1 A;  3SYX A;  2LG1 A;  2VSZ A;  1MPH A;  4NY0 A;  2D9X A;  5DH9 B;  3N7C A;  1ZM0 A;  3QWM A; 
#chains in the Genus database with same CATH topology
 3MPX A;  2YVC A;  4KHO A;  1WGU A;  2UVM A;  4GZU A;  5D3X A;  2Z0Q A;  4MK0 A;  2L1C A;  2M14 A;  3BJI A;  4HB4 B;  4P7I A;  3F5R A;  3P7Z A;  4GNK B;  3HIE A;  1OMW A;  2D9Z A;  2R0D A;  4KVG B;  3T06 A;  2KUQ A;  1MKE A;  1DDM A;  5DIF B;  4MT7 A;  1V88 A;  5FI0 A;  1Q67 A;  2P8V A;  2LOZ A;  4YL8 A;  2ELA A;  1OQN A;  2N23 A;  4HAV B;  3V5W A;  1U29 A;  5FI1 A;  5L81 A;  4K2P A;  4EKU A;  1UPQ A;  1W1G A;  2XQN M;  4C0A A;  3NWD A;  1U5E A;  5JHH A;  3A98 B;  1V5P A;  1FAO A;  5I2M A;  2EMT A;  1DYN A;  2Q13 A;  2V76 A;  3AJ4 A;  5CLQ B;  4ZRI A;  3CIK A;  4HAW B;  1KZ7 A;  4F7U P;  4A5K A;  4IFS A;  1Y5O A;  3ULC A;  1EAZ A;  3LJU X;  2G35 A;  2COA A;  3OHM B;  2DKQ A;  2PZ1 A;  3TW1 A;  2Y7B A;  4DXA B;  1TJ6 A;  5CLL B;  2Z4D A;  3FSS A;  4Y94 A;  2GCJ A;  1XOD A;  2EMS A;  2GUM A;  1UEF A;  4KHB A;  5LG4 B;  3SO6 A;  1RJ2 A;  1XR0 B;  3KRX A;  5HE3 A;  1SHC A;  3PVL A;  4L6E A;  4WJ7 A;  5KQ1 A;  2P0D A;  1AWE A;  2ELB A;  5JLJ B;  3FEH A;  1X86 A;  3A58 A;  4HB3 B;  1PLS A;  1U5F A;  4K2O A;  4GMV A;  4NSW A;  2CY5 A;  4HAU B;  2J0M A;  4IAP A;  3M1I B;  4HAY B;  3IVF A;  2MDX A;  2GS0 A;  1V89 A;  4QJ3 B;  2IFS A;  4Z2M B;  1GG3 A;  2I5F A;  2RLO A;  1W1D A;  4B6H A;  2K2U A;  2YSZ A;  3HQC A;  2J0K A;  2KUP A;  4YON A;  3A8Q A;  4CHM A;  2RSG A;  3DXE A;  3F0W A;  2NZ8 B;  2UZR A;  5DHF B;  1ZSQ A;  3NW8 A;  4MY6 A;  3VIA A;  1EGX A;  1X1F A;  3KY9 A;  3NWF A;  1EVH A;  2NBV A;  4HAZ B;  4CYE A;  1J19 A;  2LOX A;  2COD A;  1WJM A;  3SV1 A;  4K17 A;  2DTC A;  3HW2 B;  2ROV A;  1MK7 B;  2FJU B;  4KHA A;  1NTY A;  1QC6 A;  3ODX A;  2OTX A;  5C5B A;  4L1R A;  1T77 A;  1KZG A;  1H10 A;  5JP4 A;  2Y8F A;  2DLW A;  5HE0 A;  5JHG A;  4XWX A;  5GOW B;  1I7A A;  2DYN A;  1NI2 A;  3PG7 A;  2CRF A;  1TXD A;  4DX8 A;  5C5B B;  1W1H A;  1WGQ A;  3VOQ A;  4HB2 B;  3NWA A;  1RRP B;  1WJ1 A;  2RNR B;  4TKN A;  3WA0 A;  2VKI A;  2GJY A;  1Z87 A;  3D8D A;  4DBB A;  1DBH A;  3SNH A;  2GCL A;  3ULB A;  2BCJ A;  2HE7 A;  3ML4 A;  1EF1 A;  3B77 A;  5D27 A;  3SUZ A;  3MDB C;  2DHI A;  4PNK A;  1NU2 A;  4HDQ A;  4A6F A;  4K81 A;  1U5G A;  1LB1 A;  2YT1 A;  1B55 A;  4QJ4 B;  4F7H A;  4QJ5 B;  2M38 A;  3O96 A;  3ODO A;  4HHV A;  1U27 A;  2JP2 A;  2OQB A;  2HTH B;  3DCX A;  4A6F B;  4A6K A;  2VRW B;  5C79 A;  5J3T A;  4GXB A;  3KRW A;  1I2H A;  2Z59 A;  2YS1 A;  4HAT B;  2YT0 A;  2L2I A;  3KZ1 A;  2D9W A;  3U8Z A;  5LON B;  1PMS A;  3TFM A;  5D3V A;  5C6R A;  4F7G A;  2KCJ A;  2ZPY A;  2ZKM X;  3AU5 A;  2YS3 A;  4OT1 A;  2CY4 A;  4TYZ A;  5D3Y A;  2K49 A;  2I5C A;  1P3R A;  2LYD A;  2DA0 A;  3FVC A;  1ZVR A;  5J3Y A;  3OAN A;  2NMB A;  1DDW A;  1K5G B;  4GMX B;  2DHK A;  1M7E A;  4GN1 A;  3PVU A;  2AL6 A;  2RRF A;  3ZVR A;  3PSC A;  5D3W A;  1FHX A;  2D10 A;  1BAK A;  1TQZ A;  2H7E A;  2KR0 A;  1UNQ A;  4WVF B;  5KQ4 A;  1FB8 A;  2W2W A;  3A8P A;  3DXD A;  1SGH A;  3U12 A;  3ZDT A;  4OSN A;  3NSU A;  5J3Q A;  2KIG A;  1XKE A;  3QBV B;  2Y8G A;  2YRY A;  2R09 A;  4ZRJ A;  2I1K A;  1N3H A;  1X11 A;  5I2S A;  2YT2 A;  1V5M A;  1WVH A;  1MK9 B;  1WG7 A;  1DRO A;  2DYQ A;  2ROZ B;  1X05 A;  1UPR A;  5KCV A;  2LKO A;  1WI1 A;  1U5D A;  2COF A;  1MAI A;  1PFJ A;  2YF0 A;  1QQG A;  4GOU A;  1H4R A;  1KI1 B;  2DHJ A;  2E2X A;  3CXB B;  3KSY A;  3HSA A;  3WYF B;  1XD4 A;  2Z0P A;  1MIZ B;  4Z2N A;  2DFK A;  5EFX A;  2YS5 A;  5LOP B;  1K5D B;  2QKM A;  1UNP A;  2P0H A;  2N0Y A;  1M7R A;  3X23 A;  1X1G A;  1NTV A;  2J59 M;  2D11 A;  4WSF A;  2R2Y A;  1BTK A;  5M4Y B;  1FHO A;  1OY2 A;  4KAX B;  4EMO A;  3P6A A;  3U7D A;  4HSI A;  5C16 A;  1GC6 A;  2EJ8 A;  2P0F A;  1AQC A;  1XCG A;  3GYO A;  4D6W A;  2UZS A;  2I1J A;  4D0N B;  2D4Q A;  2Z13 A;  4DIX A;  1ZC3 B;  2DN6 A;  2LUL A;  3D8F A;  1P5T A;  4IOY X;  2CAY A;  4HDO A;  4EJN A;  1MI1 A;  1IRS A;  2ADZ A;  3D8E A;  1FGZ A;  1DDV A;  2K2J A;  4DX9 0;  5DHA B;  2J0J A;  3TCA A;  5HE1 A;  2RGN B;  1FHW A;  3G9W A;  3QIJ A;  2RUK B;  3BIN A;  2KIE A;  2DKP A;  3FM8 C;  2D9V A;  2Z14 A;  1ZYI A;  3RCP A;  2W2X D;  1U2B A;  4H8S A;  2KGX B;  2H7D A;  4CSQ A;  1P6S A;  3PEG A;  3DXC A;  4CHJ A;  1MIX A;  4A6H A;  3PP2 A;  1Y19 B;  3GYP A;  1ZC4 B;  2K8E A;  2K00 A;  1BTN A;  1XX0 A;  2MKR A;  4HB0 B;  2COC A;  5IRS A;  1V5U A;  2D2Q A;  1LW3 A;  2MFQ A;  2AEH A;  4KHB B;  1BWN A;  1V61 A;  1E5W A;  4ZRK A;  4PQ0 A;  1ISN A;  1FGY A;  3HK0 A;  2W2X C;  4GPT B;  2D9Y A;  2DX5 A;  1GC7 A;  2QKL A;  3UZT A;  1J0W A;  5DI9 B;  2X18 A;  5HE2 A;  3AU4 A;  1UNR A;  2IYB A;  3TVV A;  2MWN B;  2RVB B;  3PZD A;  3ODW A;  3PVW A;  2FJL A;  2Z0O A;  1FOE A;  2EC1 A;  4HAX B;  3TO1 A;  4BBK A;  2DX1 A;  3SYX A;  4QXA B;  2LG1 A;  2VSZ A;  1MPH A;  4NY0 A;  2D9X A;  5DH9 B;  3N7C A;  1ZM0 A;  3QWM A; 
#chains in the Genus database with same CATH homology
 3MPX A;  2YVC A;  4KHO A;  1WGU A;  2UVM A;  4GZU A;  5D3X A;  2Z0Q A;  4MK0 A;  2L1C A;  2M14 A;  3BJI A;  4HB4 B;  4P7I A;  3F5R A;  3P7Z A;  4GNK B;  3HIE A;  1OMW A;  2D9Z A;  2R0D A;  4KVG B;  3T06 A;  2KUQ A;  1MKE A;  1DDM A;  5DIF B;  4MT7 A;  1V88 A;  5FI0 A;  1Q67 A;  2P8V A;  2LOZ A;  4YL8 A;  2ELA A;  1OQN A;  2N23 A;  4HAV B;  3V5W A;  1U29 A;  5FI1 A;  5L81 A;  4K2P A;  4EKU A;  1UPQ A;  1W1G A;  2XQN M;  4C0A A;  3NWD A;  1U5E A;  5JHH A;  3A98 B;  1V5P A;  1FAO A;  5I2M A;  2EMT A;  1DYN A;  2Q13 A;  2V76 A;  3AJ4 A;  5CLQ B;  4ZRI A;  3CIK A;  4HAW B;  1KZ7 A;  4F7U P;  4A5K A;  4IFS A;  1Y5O A;  3ULC A;  1EAZ A;  3LJU X;  2G35 A;  2COA A;  3OHM B;  2DKQ A;  2PZ1 A;  3TW1 A;  2Y7B A;  4DXA B;  1TJ6 A;  5CLL B;  2Z4D A;  3FSS A;  4Y94 A;  2GCJ A;  1XOD A;  2EMS A;  2GUM A;  1UEF A;  4KHB A;  5LG4 B;  3SO6 A;  1RJ2 A;  1XR0 B;  3KRX A;  5HE3 A;  1SHC A;  3PVL A;  4L6E A;  4WJ7 A;  5KQ1 A;  2P0D A;  1AWE A;  2ELB A;  5JLJ B;  3FEH A;  1X86 A;  3A58 A;  4HB3 B;  1PLS A;  1U5F A;  4K2O A;  4GMV A;  4NSW A;  2CY5 A;  4HAU B;  2J0M A;  4IAP A;  3M1I B;  4HAY B;  3IVF A;  2MDX A;  2GS0 A;  1V89 A;  4QJ3 B;  2IFS A;  4Z2M B;  1GG3 A;  2I5F A;  2RLO A;  1W1D A;  4B6H A;  2K2U A;  2YSZ A;  3HQC A;  2J0K A;  2KUP A;  4YON A;  3A8Q A;  4CHM A;  2RSG A;  3DXE A;  3F0W A;  2NZ8 B;  2UZR A;  5DHF B;  1ZSQ A;  3NW8 A;  4MY6 A;  3VIA A;  1EGX A;  1X1F A;  3KY9 A;  3NWF A;  1EVH A;  2NBV A;  4HAZ B;  4CYE A;  1J19 A;  2LOX A;  2COD A;  1WJM A;  3SV1 A;  4K17 A;  2DTC A;  3HW2 B;  2ROV A;  1MK7 B;  2FJU B;  4KHA A;  1NTY A;  1QC6 A;  3ODX A;  2OTX A;  5C5B A;  4L1R A;  1KZG A;  1H10 A;  5JP4 A;  2Y8F A;  2DLW A;  5HE0 A;  5JHG A;  4XWX A;  5GOW B;  1I7A A;  2DYN A;  1NI2 A;  3PG7 A;  2CRF A;  1TXD A;  4DX8 A;  5C5B B;  1W1H A;  1WGQ A;  3VOQ A;  4HB2 B;  3NWA A;  1RRP B;  1WJ1 A;  2RNR B;  4TKN A;  3WA0 A;  2VKI A;  2GJY A;  1Z87 A;  3D8D A;  4DBB A;  1DBH A;  3SNH A;  2GCL A;  3ULB A;  2BCJ A;  2HE7 A;  3ML4 A;  1EF1 A;  5D27 A;  3SUZ A;  3MDB C;  2DHI A;  4PNK A;  1NU2 A;  4HDQ A;  4A6F A;  4K81 A;  1U5G A;  1LB1 A;  2YT1 A;  1B55 A;  4QJ4 B;  4F7H A;  4QJ5 B;  2M38 A;  3O96 A;  3ODO A;  4HHV A;  1U27 A;  2JP2 A;  2OQB A;  2HTH B;  4A6F B;  4A6K A;  2VRW B;  5C79 A;  5J3T A;  4GXB A;  3KRW A;  1I2H A;  2Z59 A;  2YS1 A;  4HAT B;  2YT0 A;  2L2I A;  3KZ1 A;  2D9W A;  3U8Z A;  5LON B;  1PMS A;  3TFM A;  5D3V A;  5C6R A;  4F7G A;  2KCJ A;  2ZPY A;  3AU5 A;  2ZKM X;  2YS3 A;  4OT1 A;  2CY4 A;  4TYZ A;  5D3Y A;  2K49 A;  2I5C A;  1P3R A;  2LYD A;  2DA0 A;  3FVC A;  1ZVR A;  5J3Y A;  3OAN A;  2NMB A;  1DDW A;  1K5G B;  4GMX B;  2DHK A;  1M7E A;  4GN1 A;  3PVU A;  2AL6 A;  2RRF A;  3ZVR A;  3PSC A;  5D3W A;  1FHX A;  2D10 A;  1BAK A;  1TQZ A;  2H7E A;  2KR0 A;  1UNQ A;  4WVF B;  5KQ4 A;  1FB8 A;  2W2W A;  3A8P A;  3DXD A;  1SGH A;  3U12 A;  3ZDT A;  4OSN A;  3NSU A;  5J3Q A;  3QBV B;  1XKE A;  2KIG A;  2Y8G A;  2YRY A;  2R09 A;  4ZRJ A;  2I1K A;  1N3H A;  1X11 A;  5I2S A;  2YT2 A;  1V5M A;  1WVH A;  1MK9 B;  1WG7 A;  1DRO A;  2DYQ A;  2ROZ B;  1X05 A;  1UPR A;  5KCV A;  2LKO A;  1WI1 A;  1U5D A;  2COF A;  1MAI A;  1PFJ A;  2YF0 A;  1QQG A;  4GOU A;  1H4R A;  1KI1 B;  2DHJ A;  2E2X A;  3CXB B;  3KSY A;  3WYF B;  1XD4 A;  2Z0P A;  1MIZ B;  4Z2N A;  2DFK A;  5EFX A;  2YS5 A;  5LOP B;  1K5D B;  2QKM A;  1UNP A;  2P0H A;  2N0Y A;  1M7R A;  3X23 A;  1X1G A;  1NTV A;  2J59 M;  2D11 A;  4WSF A;  2R2Y A;  1BTK A;  5M4Y B;  1FHO A;  1OY2 A;  4KAX B;  4EMO A;  3P6A A;  3U7D A;  4HSI A;  5C16 A;  1GC6 A;  2EJ8 A;  2P0F A;  1AQC A;  1XCG A;  3GYO A;  4D6W A;  2UZS A;  2I1J A;  4D0N B;  2D4Q A;  2Z13 A;  4DIX A;  1ZC3 B;  2DN6 A;  2LUL A;  3D8F A;  1P5T A;  4IOY X;  2CAY A;  4HDO A;  4EJN A;  1IRS A;  2ADZ A;  3D8E A;  1FGZ A;  1DDV A;  2K2J A;  4DX9 0;  5DHA B;  2J0J A;  3TCA A;  5HE1 A;  2RGN B;  1FHW A;  3G9W A;  3QIJ A;  2RUK B;  3BIN A;  2KIE A;  2DKP A;  3FM8 C;  2D9V A;  2Z14 A;  3RCP A;  1ZYI A;  2W2X D;  1U2B A;  4H8S A;  2KGX B;  2H7D A;  4CSQ A;  1P6S A;  3PEG A;  3DXC A;  4CHJ A;  1MIX A;  4A6H A;  3PP2 A;  1Y19 B;  3GYP A;  1ZC4 B;  2K8E A;  2K00 A;  1BTN A;  1XX0 A;  2MKR A;  4HB0 B;  2COC A;  5IRS A;  1V5U A;  2D2Q A;  1LW3 A;  2MFQ A;  2AEH A;  4KHB B;  1BWN A;  1V61 A;  1E5W A;  4ZRK A;  4PQ0 A;  1ISN A;  1FGY A;  3HK0 A;  2W2X C;  4GPT B;  2D9Y A;  2DX5 A;  1GC7 A;  2QKL A;  3UZT A;  1J0W A;  5DI9 B;  2X18 A;  5HE2 A;  3AU4 A;  1UNR A;  2IYB A;  3TVV A;  2MWN B;  2RVB B;  3PZD A;  3ODW A;  3PVW A;  2FJL A;  2Z0O A;  1FOE A;  2EC1 A;  4HAX B;  3TO1 A;  4BBK A;  2DX1 A;  3SYX A;  4QXA B;  2LG1 A;  2VSZ A;  1MPH A;  4NY0 A;  2D9X A;  5DH9 B;  3N7C A;  1ZM0 A;  3QWM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...