3TW1A

Structure of rtt106-ahn
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
232
structure length
222
Chain Sequence
TNTIFKLEGVSVLSPLRKKLDLVFYLSNVDGSPVITLLKGNDRELSIYQLNKNIKMASFLPVPEKPNLIYLFMTYTSCEDNKFSEPVVMTLNKENTLNQFKKLGLLDSNVTDFEKCVEYIRKQAILTGFKISNPFVKINSFHLQCHRGTKEGTLYFLPDHIIFGFKKPILLLDASDIESITYSSITRLTFNASLVTKDGEKYEFSMIDQTEYAKIDDYVKRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Chaperone
molecule keywords Histone chaperone RTT106
publication title Structural basis for recognition of H3K56-acetylated histone H3-H4 by the chaperone Rtt106.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 55
structure length 222
sequence length 232
ec nomenclature
pdb deposition date 2011-09-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 3tw1A02
2.30.29.120 Mainly Beta Roll PH-domain like PH-domain like 3tw1A01
4XWXA 1I2HA 5CLQB 2G35A 2OQBA 1TXDA 1AQCA 1FAOA 2Z0OA 2EJ8A 1ZC3B 4MY6A 3QWMA 2IYBA 1K5DB 3MDBC 5HE1A 1UEFA 4Z2NA 1NU2A 1MPHA 1OQNA 2D9VA 2ROVA 1X86A 1MIZB 4KHAA 2YT0A 3SUZA 5DIFB 2ELAA 2COAA 3HK0A 3QBVB 3CIKA 4HDOA 1B55A 1W1GA 3P6AA 3BINA 3P7ZA 5LOPB 1V5PA 1RRPB 3U7DA 4DBBA 3ZDTA 1PMSA 3KZ1A 4DX90 1V88A 2ZPYA 3PVWA 1PFJA 5CLLB 4ZRKA 2L2IA 4GZUA 5DHAB 1DDMA 1U2BA 2MFQA 4DXAB 4KHBB 4HATB 3HQCA 5C5BA 1XKEA 1V89A 2YVCA 3PP2A 2DHKA 1AWEA 2RGNB 2BCJA 1XX0A 2D9XA 2K2UA 2DYNA 2CRFA 4HB0B 4CHJA 4K17A 1V5MA 3GYOA 1NI2A 2DHJA 2KUPA 4A6KA 1Q67A 5EFXA 5C16A 3O96A 4EJNA 1X1GA 1N3HA 1TJ6A 1RJ2A 3ODWA 1W1HA 4HB3B 1LB1A 2FJLA 4HAZB 4Z2MB 2NZ8B 1FHOA 1XCGA 3SO6A 5D3XA 2Z0PA 1IRSA 1J19A 1Y5OA 5D3VA 1FGZA 1NTVA 1BWNA 2D10A 2DA0A 3ODXA 3WA0A 1EVHA 1EGXA 2UZSA 5FI1A 1E5WA 5D3YA 3KRXA 1LW3A 3GYPA 2COFA 5HE3A 3SNHA 2I5CA 3SV1A 3V5WA 5JHGA 3N7CA 2DYQA 3VOQA 3ZVRA 4HAYB 2Y8GA 5J3QA 1BAKA 2P0DA 3ULBA 2CY4A 5J3TA 2D4QA 3CXBB 2CAYA 2ROZB 2D2QA 1OMWA 3KY9A 5HE2A 4KHOA 4GPTB 1U27A 5J3YA 4NY0A 2DLWA 2J0MA 5KQ1A 2ELBA 3D8DA 1I7AA 1OY2A 4HAXB 3KSYA 1M7RA 1U5DA 1DBHA 2N23A 4KAXB 1P5TA 2KCJA 4HB4B 4A6FA 3X23A 4MK0A 2M38A 4F7UP 5D3WA 2W2XC 4CYEA 1WJ1A 2H7DA 2W2WA 4GMVA 1GG3A 1V61A 3OANA 1EAZA 5JLJB 4WSFA 4HAVB 2DHIA 2HE7A 3UZTA 1GC6A 2ADZA 3T06A 3WYFB 2PZ1A 2LOZA 1J0WA 2YS3A 4K81A 2D11A 2MDXA 1QC6A 1SHCA 2GCJA 4MT7A 4WJ7A 2YSZA 2Z0QA 1DDWA 3D8FA 3KRWA 4HHVA 3TW1A 2KGXB 2X18A 4D0NB 4F7GA 2QKMA 1K5GB 3FM8C 2K00A 2YT1A 4HDQA 2DKQA 2JP2A 1FB8A 2XQNM 1KZ7A 3F0WA 1U5GA 3HW2B 2DTCA 1WJMA 2K2JA 1ZM0A 3DXEA 4TYZA 5DI9B 4BBKA 3M1IB 2N0YA 4KVGB 1SGHA 1FHWA 4K2OA 4HAUB 3LJUX 1MK7B 1X05A 3PSCA 4H8SA 1UNRA 4DX8A 4P7IA 1QQGA 2I1KA 2UZRA 2RSGA 2AL6A 2LOXA 1ISNA 1XODA 2D9WA 4A5KA 2RNRB 4B6HA 1FGYA 1PLSA 4EMOA 4GXBA 2D9YA 2YF0A 3PG7A 1MKEA 2Y8FA 4L6EA 1WGQA 3TCAA 4WVFB 4PQ0A 2DX1A 3SYXA 3MPXA 4IAPA 4GN1A 3F5RA 3ODOA 1M7EA 4IOYX 3DXDA 4A6FB 2GCLA 2VSZA 2R09A 4HAWB 1Y19B 1UPQA 5JHHA 5FI0A 3A8PA 1U29A 3D8EA 3FSSA 4EKUA 2D9ZA 4A6HA 5C6RA 2H7EA 5KCVA 1DROA 3TFMA 4F7HA 5HE0A 3DXCA 2J0KA 1XR0B 1H10A 2GJYA 2COCA 2YS5A 1V5UA 2LKOA 1EF1A 3U8ZA 3BJIA 2DFKA 4HB2B 2YS1A 1WI1A 5JP4A 1NTYA 4TKNA 5C5BB 5C79A 2NMBA 1MIXA 1U5EA 2AEHA 3A98B 2VKIA 2RUKB 5KQ4A 2LULA 4CHMA 2LG1A 3AU5A 2RVBB 2P8VA 3ML4A 3PVLA 2CODA 2MKRA 1W1DA 1BTKA 4GMXB 5GOWB 2E2XA 1X1FA 1DDVA 2RLOA 2DX5A 2P0FA 3PZDA 1WG7A 1ZSQA 1FOEA 1U5FA 2EMTA 3PVUA 1H4RA 3FEHA 4YONA 1BTNA 1UNQA 4ZRIA 2DKPA 2EMSA 2EC1A 1KI1B 5D27A 2Q13A 1WGUA 3VIAA 2I5FA 3TVVA 1UPRA 4ZRJA 2HTHB 1XD4A 2VRWB 2I1JA 1KZGA 4C0AA 1TQZA 2R0DA 1P6SA 2DN6A 3RCPA 1P3RA 1UNPA 3ULCA 1MK9B 3AJ4A 3A8QA 5LONB 2V76A 3QIJA 4K2PA 5L81A 3PEGA 4YL8A 2UVMA 3TO1A 3NSUA 1DYNA 2GS0A 1WVHA 2Y7BA 1ZC4B 2J59M 4PNKA 3AU4A 4Y94A 1Z87A 2P0HA 2IFSA 2L1CA 5DHFB 1GC7A 2MWNB 5DH9B 3G9WA 2OTXA 2LYDA 4NSWA 1MAIA 3IVFA 4IFSA 2CY5A 2YRYA 2J0JA 2QKLA 2W2XD 1X11A 2M14A 1FHXA 1ZVRA
chains in the Genus database with same CATH superfamily
4XWXA 1I2HA 5CLQB 3OHMB 2G35A 2OQBA 1TXDA 1AQCA 1FAOA 2Z0OA 2EJ8A 1ZC3B 4MY6A 3QWMA 2IYBA 1K5DB 3MDBC 5HE1A 1UEFA 4Z2NA 1NU2A 1MPHA 1OQNA 2D9VA 2ROVA 1X86A 1MIZB 4KHAA 2YT0A 3SUZA 5DIFB 2ELAA 2COAA 3HK0A 3QBVB 3CIKA 2KUQA 4HDOA 1B55A 3A58A 1W1GA 3P6AA 3BINA 3P7ZA 5LOPB 2KIEA 1V5PA 1RRPB 1T77A 3U7DA 3B77A 4DBBA 3ZDTA 1PMSA 3KZ1A 4DX90 1V88A 2ZPYA 3PVWA 1PFJA 5CLLB 4ZRKA 2L2IA 4GZUA 5DHAB 1DDMA 4QJ3B 1U2BA 2MFQA 4DXAB 4KHBB 4HATB 3HQCA 5C5BA 1XKEA 1V89A 2YVCA 3PP2A 2DHKA 1AWEA 2RGNB 2BCJA 1XX0A 2D9XA 2K2UA 2DYNA 2CRFA 4HB0B 4CHJA 4K17A 1V5MA 3GYOA 1NI2A 2DHJA 2KUPA 4A6KA 1Q67A 5EFXA 5C16A 3O96A 3NWDA 4EJNA 1X1GA 1N3HA 1TJ6A 1RJ2A 3ODWA 1W1HA 4HB3B 1LB1A 2FJLA 4HAZB 4Z2MB 2NZ8B 1FHOA 1XCGA 3SO6A 5D3XA 2Z0PA 1IRSA 1J19A 1Y5OA 5D3VA 1FGZA 1NTVA 1BWNA 2D10A 2DA0A 4QJ5B 3ODXA 3WA0A 1EVHA 1EGXA 2UZSA 5FI1A 1E5WA 5D3YA 3KRXA 1LW3A 3GYPA 2COFA 5HE3A 3SNHA 2I5CA 3SV1A 3V5WA 5JHGA 3N7CA 2DYQA 3VOQA 3ZVRA 4HAYB 2Y8GA 5J3QA 1ZYIA 1BAKA 2P0DA 3U12A 3ULBA 2CY4A 5J3TA 2D4QA 3CXBB 2CAYA 2ROZB 2D2QA 1OMWA 3KY9A 5HE2A 4KHOA 4GPTB 1U27A 5J3YA 4NY0A 2DLWA 2J0MA 5KQ1A 2ELBA 3D8DA 1I7AA 1OY2A 4HAXB 3KSYA 1M7RA 1U5DA 2NBVA 1DBHA 2N23A 4KAXB 2YT2A 1P5TA 2KCJA 4HB4B 4A6FA 3X23A 4MK0A 5M4YB 2M38A 4F7UP 5D3WA 2W2XC 4CYEA 1WJ1A 2H7DA 2W2WA 4GMVA 1GG3A 1V61A 3OANA 1EAZA 5JLJB 4WSFA 4HAVB 2DHIA 2HE7A 3UZTA 1MI1A 1GC6A 2ADZA 3T06A 3WYFB 2PZ1A 2LOZA 1J0WA 2K8EA 2YS3A 4K81A 2D11A 2MDXA 1QC6A 1SHCA 2GCJA 4MT7A 4WJ7A 2Z13A 2YSZA 2Z0QA 1DDWA 3D8FA 3KRWA 2Z14A 4HHVA 3TW1A 2KGXB 2X18A 4D0NB 4F7GA 2QKMA 1K5GB 3FM8C 2K00A 2YT1A 4HDQA 2DKQA 2JP2A 1FB8A 2XQNM 2KIGA 1KZ7A 3F0WA 1U5GA 3HW2B 2DTCA 1WJMA 2K2JA 2FJUB 1ZM0A 3DXEA 4TYZA 5DI9B 4BBKA 3M1IB 2N0YA 4KVGB 1SGHA 2GUMA 1FHWA 4K2OA 3HIEA 4HAUB 3LJUX 1MK7B 1X05A 5IRSA 3PSCA 4H8SA 1UNRA 4DX8A 4P7IA 1QQGA 2I1KA 2UZRA 2RSGA 2AL6A 2LOXA 1ISNA 1XODA 2D9WA 4A5KA 2RNRB 4B6HA 1FGYA 1PLSA 4EMOA 4GXBA 2D9YA 2YF0A 4DIXA 3PG7A 1MKEA 3NWFA 4QJ4B 2Y8FA 4CSQA 4L6EA 1WGQA 3TCAA 4WVFB 4PQ0A 2DX1A 3SYXA 3MPXA 4IAPA 4GN1A 3F5RA 3ODOA 1M7EA 4IOYX 3DXDA 4A6FB 2GCLA 2VSZA 2R09A 4HAWB 1Y19B 1UPQA 5JHHA 5FI0A 3A8PA 3HSAA 4GNKB 1U29A 3D8EA 3FSSA 4EKUA 3NW8A 2D9ZA 4A6HA 5C6RA 2H7EA 5KCVA 1DROA 3NWAA 3TFMA 4F7HA 2R2YA 5HE0A 3DXCA 2J0KA 1XR0B 1H10A 2GJYA 2COCA 3DCXA 2YS5A 1V5UA 2LKOA 4HSIA 4QXAB 1EF1A 3U8ZA 3BJIA 2DFKA 4HB2B 2YS1A 1WI1A 5JP4A 1NTYA 4TKNA 5C5BB 5C79A 2NMBA 4D6WA 1MIXA 2K49A 1U5EA 2AEHA 3A98B 2VKIA 2RUKB 5KQ4A 2LULA 4CHMA 2LG1A 3AU5A 2KR0A 4OSNA 4GOUA 2RVBB 2P8VA 3ML4A 3PVLA 2CODA 2MKRA 1W1DA 1BTKA 4GMXB 5GOWB 2E2XA 5LG4B 1X1FA 1DDVA 2RLOA 2DX5A 3FVCA 2P0FA 3PZDA 1WG7A 1ZSQA 1FOEA 1U5FA 2EMTA 3PVUA 1H4RA 3FEHA 4YONA 1BTNA 1UNQA 4ZRIA 2RRFA 2DKPA 2EMSA 2EC1A 1KI1B 5D27A 2Q13A 4KHBA 1WGUA 3VIAA 2I5FA 3TVVA 1UPRA 4ZRJA 2HTHB 1XD4A 2VRWB 2I1JA 1KZGA 2Z59A 4C0AA 5I2MA 1TQZA 2R0DA 1P6SA 2DN6A 3RCPA 1P3RA 1UNPA 3ULCA 2ZKMX 1MK9B 4L1RA 3AJ4A 3A8QA 5LONB 2V76A 3QIJA 4K2PA 5L81A 3PEGA 4YL8A 2UVMA 3TO1A 2Z4DA 3NSUA 1DYNA 2GS0A 1WVHA 2Y7BA 1ZC4B 2J59M 4PNKA 3AU4A 4Y94A 1Z87A 2P0HA 2IFSA 2L1CA 5DHFB 1GC7A 2MWNB 5DH9B 5I2SA 3G9WA 4OT1A 2OTXA 2LYDA 4NSWA 1MAIA 3IVFA 4IFSA 2CY5A 2YRYA 2J0JA 2QKLA 2W2XD 1X11A 2M14A 1FHXA 1ZVRA
chains in the Genus database with same CATH topology
4XWXA 1I2HA 5CLQB 3OHMB 2G35A 2OQBA 1TXDA 1AQCA 1FAOA 2Z0OA 2EJ8A 1ZC3B 4MY6A 3QWMA 2IYBA 1K5DB 3MDBC 5HE1A 1UEFA 4Z2NA 1NU2A 1MPHA 1OQNA 2D9VA 2ROVA 1X86A 1MIZB 4KHAA 2YT0A 3SUZA 5DIFB 2ELAA 2COAA 3HK0A 3QBVB 3CIKA 2KUQA 4HDOA 1B55A 3A58A 1W1GA 3P6AA 3BINA 3P7ZA 5LOPB 2KIEA 1V5PA 1RRPB 3U7DA 4DBBA 3ZDTA 1PMSA 3KZ1A 4DX90 1V88A 2ZPYA 3PVWA 1PFJA 5CLLB 4ZRKA 2L2IA 4GZUA 5DHAB 1DDMA 4QJ3B 1U2BA 2MFQA 4DXAB 4KHBB 4HATB 3HQCA 5C5BA 1XKEA 1V89A 2YVCA 3PP2A 2DHKA 1AWEA 2RGNB 2BCJA 1XX0A 2D9XA 2K2UA 2DYNA 2CRFA 4HB0B 4CHJA 4K17A 1V5MA 3GYOA 1NI2A 2DHJA 2KUPA 4A6KA 1Q67A 5EFXA 5C16A 3O96A 3NWDA 4EJNA 1X1GA 1N3HA 1TJ6A 1RJ2A 3ODWA 1W1HA 4HB3B 1LB1A 2FJLA 4HAZB 4Z2MB 2NZ8B 1FHOA 1XCGA 3SO6A 5D3XA 2Z0PA 1IRSA 1J19A 1Y5OA 5D3VA 1FGZA 1NTVA 1BWNA 2D10A 2DA0A 4QJ5B 3ODXA 3WA0A 1EVHA 1EGXA 2UZSA 5FI1A 1E5WA 5D3YA 3KRXA 1LW3A 3GYPA 2COFA 5HE3A 3SNHA 2I5CA 3SV1A 3V5WA 5JHGA 3N7CA 2DYQA 3VOQA 3ZVRA 4HAYB 2Y8GA 5J3QA 1ZYIA 1BAKA 2P0DA 3U12A 3ULBA 2CY4A 5J3TA 2D4QA 3CXBB 2CAYA 2ROZB 2D2QA 1OMWA 3KY9A 5HE2A 4KHOA 4GPTB 1U27A 5J3YA 4NY0A 2DLWA 2J0MA 5KQ1A 2ELBA 3D8DA 1I7AA 1OY2A 4HAXB 3KSYA 1M7RA 1U5DA 2NBVA 1DBHA 2N23A 4KAXB 2YT2A 1P5TA 2KCJA 4HB4B 4A6FA 3X23A 4MK0A 5M4YB 2M38A 4F7UP 5D3WA 2W2XC 4CYEA 1WJ1A 2H7DA 2W2WA 4GMVA 1GG3A 1V61A 3OANA 1EAZA 5JLJB 4WSFA 4HAVB 2DHIA 2HE7A 3UZTA 1GC6A 2ADZA 3T06A 3WYFB 2PZ1A 2LOZA 1J0WA 2YS3A 4K81A 2K8EA 2D11A 2MDXA 1QC6A 1SHCA 2GCJA 4MT7A 4WJ7A 2Z13A 2YSZA 2Z0QA 1DDWA 3D8FA 3KRWA 2Z14A 4HHVA 3TW1A 2KGXB 2X18A 4D0NB 4F7GA 2QKMA 1K5GB 3FM8C 2K00A 2YT1A 4HDQA 2DKQA 2JP2A 1FB8A 2XQNM 2KIGA 1KZ7A 3F0WA 1U5GA 3HW2B 2DTCA 1WJMA 2K2JA 2FJUB 1ZM0A 3DXEA 4TYZA 5DI9B 4BBKA 3M1IB 2N0YA 4KVGB 1SGHA 2GUMA 1FHWA 4K2OA 3HIEA 4HAUB 3LJUX 1MK7B 1X05A 5IRSA 3PSCA 4H8SA 1UNRA 4DX8A 4P7IA 1QQGA 2I1KA 2UZRA 2RSGA 2AL6A 2LOXA 1ISNA 1XODA 2D9WA 4A5KA 2RNRB 4B6HA 1FGYA 1PLSA 4EMOA 4GXBA 2D9YA 2YF0A 4DIXA 3PG7A 1MKEA 3NWFA 4QJ4B 2Y8FA 4CSQA 4L6EA 1WGQA 3TCAA 4WVFB 4PQ0A 2DX1A 3SYXA 3MPXA 4IAPA 4GN1A 3F5RA 3ODOA 1M7EA 4IOYX 3DXDA 4A6FB 2GCLA 2VSZA 2R09A 4HAWB 1Y19B 1UPQA 5JHHA 5FI0A 3A8PA 4GNKB 1U29A 3D8EA 3FSSA 4EKUA 3NW8A 2D9ZA 4A6HA 5C6RA 2H7EA 5KCVA 1DROA 3NWAA 3TFMA 4F7HA 2R2YA 5HE0A 3DXCA 2J0KA 1XR0B 1H10A 2GJYA 2COCA 2YS5A 1V5UA 2LKOA 4HSIA 4QXAB 1EF1A 3U8ZA 3BJIA 2DFKA 4HB2B 2YS1A 1WI1A 5JP4A 1NTYA 4TKNA 5C5BB 5C79A 2NMBA 4D6WA 1MIXA 2K49A 1U5EA 2AEHA 3A98B 2VKIA 2RUKB 5KQ4A 2LULA 4CHMA 2LG1A 3AU5A 2KR0A 4OSNA 4GOUA 2RVBB 2P8VA 3ML4A 3PVLA 2CODA 2MKRA 1W1DA 1BTKA 4GMXB 5GOWB 2E2XA 5LG4B 1X1FA 1DDVA 2RLOA 2DX5A 3FVCA 2P0FA 3PZDA 1WG7A 1ZSQA 1FOEA 1U5FA 2EMTA 3PVUA 1H4RA 3FEHA 4YONA 1BTNA 1UNQA 4ZRIA 2RRFA 2DKPA 2EMSA 2EC1A 1KI1B 5D27A 2Q13A 4KHBA 1WGUA 3VIAA 2I5FA 3TVVA 1UPRA 4ZRJA 2HTHB 1XD4A 2VRWB 2I1JA 1KZGA 4C0AA 2Z59A 5I2MA 1TQZA 2R0DA 1P6SA 2DN6A 3RCPA 1P3RA 1UNPA 3ULCA 2ZKMX 1MK9B 4L1RA 3AJ4A 3A8QA 5LONB 2V76A 3QIJA 4K2PA 5L81A 3PEGA 4YL8A 2UVMA 3TO1A 3NSUA 2Z4DA 1DYNA 2GS0A 1WVHA 2Y7BA 1ZC4B 2J59M 4PNKA 3AU4A 4Y94A 1Z87A 2P0HA 2IFSA 2L1CA 5DHFB 1GC7A 2MWNB 5DH9B 5I2SA 3G9WA 4OT1A 2OTXA 2LYDA 4NSWA 1MAIA 3IVFA 4IFSA 2CY5A 2YRYA 2J0JA 2QKLA 2W2XD 1X11A 2M14A 1FHXA 1ZVRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XWX A;  1I2H A;  5CLQ B;  2G35 A;  2OQB A;  1TXD A;  1AQC A;  1FAO A;  2Z0O A;  2EJ8 A;  1ZC3 B;  4MY6 A;  3QWM A;  2IYB A;  1K5D B;  3MDB C;  5HE1 A;  1UEF A;  4Z2N A;  1NU2 A;  1MPH A;  1OQN A;  2D9V A;  2ROV A;  1X86 A;  1MIZ B;  4KHA A;  2YT0 A;  3SUZ A;  5DIF B;  2ELA A;  2COA A;  3HK0 A;  3QBV B;  3CIK A;  4HDO A;  1B55 A;  1W1G A;  3P6A A;  3BIN A;  3P7Z A;  5LOP B;  1V5P A;  1RRP B;  3U7D A;  4DBB A;  3ZDT A;  1PMS A;  3KZ1 A;  4DX9 0;  1V88 A;  2ZPY A;  3PVW A;  1PFJ A;  5CLL B;  4ZRK A;  2L2I A;  4GZU A;  5DHA B;  1DDM A;  1U2B A;  2MFQ A;  4DXA B;  4KHB B;  4HAT B;  3HQC A;  5C5B A;  1XKE A;  1V89 A;  2YVC A;  3PP2 A;  2DHK A;  1AWE A;  2RGN B;  2BCJ A;  1XX0 A;  2D9X A;  2K2U A;  2DYN A;  2CRF A;  4HB0 B;  4CHJ A;  4K17 A;  1V5M A;  3GYO A;  1NI2 A;  2DHJ A;  2KUP A;  4A6K A;  1Q67 A;  5EFX A;  5C16 A;  3O96 A;  4EJN A;  1X1G A;  1N3H A;  1TJ6 A;  1RJ2 A;  3ODW A;  1W1H A;  4HB3 B;  1LB1 A;  2FJL A;  4HAZ B;  4Z2M B;  2NZ8 B;  1FHO A;  1XCG A;  3SO6 A;  5D3X A;  2Z0P A;  1IRS A;  1J19 A;  1Y5O A;  5D3V A;  1FGZ A;  1NTV A;  1BWN A;  2D10 A;  2DA0 A;  3ODX A;  3WA0 A;  1EVH A;  1EGX A;  2UZS A;  5FI1 A;  1E5W A;  5D3Y A;  3KRX A;  1LW3 A;  3GYP A;  2COF A;  5HE3 A;  3SNH A;  2I5C A;  3SV1 A;  3V5W A;  5JHG A;  3N7C A;  2DYQ A;  3VOQ A;  3ZVR A;  4HAY B;  2Y8G A;  5J3Q A;  1BAK A;  2P0D A;  3ULB A;  2CY4 A;  5J3T A;  2D4Q A;  3CXB B;  2CAY A;  2ROZ B;  2D2Q A;  1OMW A;  3KY9 A;  5HE2 A;  4KHO A;  4GPT B;  1U27 A;  5J3Y A;  4NY0 A;  2DLW A;  2J0M A;  5KQ1 A;  2ELB A;  3D8D A;  1I7A A;  1OY2 A;  4HAX B;  3KSY A;  1M7R A;  1U5D A;  1DBH A;  2N23 A;  4KAX B;  1P5T A;  2KCJ A;  4HB4 B;  4A6F A;  3X23 A;  4MK0 A;  2M38 A;  4F7U P;  5D3W A;  2W2X C;  4CYE A;  1WJ1 A;  2H7D A;  2W2W A;  4GMV A;  1GG3 A;  1V61 A;  3OAN A;  1EAZ A;  5JLJ B;  4WSF A;  4HAV B;  2DHI A;  2HE7 A;  3UZT A;  1GC6 A;  2ADZ A;  3T06 A;  3WYF B;  2PZ1 A;  2LOZ A;  1J0W A;  2YS3 A;  4K81 A;  2D11 A;  2MDX A;  1QC6 A;  1SHC A;  2GCJ A;  4MT7 A;  4WJ7 A;  2YSZ A;  2Z0Q A;  1DDW A;  3D8F A;  3KRW A;  4HHV A;  3TW1 A;  2KGX B;  2X18 A;  4D0N B;  4F7G A;  2QKM A;  1K5G B;  3FM8 C;  2K00 A;  2YT1 A;  4HDQ A;  2DKQ A;  2JP2 A;  1FB8 A;  2XQN M;  1KZ7 A;  3F0W A;  1U5G A;  3HW2 B;  2DTC A;  1WJM A;  2K2J A;  1ZM0 A;  3DXE A;  4TYZ A;  5DI9 B;  4BBK A;  3M1I B;  2N0Y A;  4KVG B;  1SGH A;  1FHW A;  4K2O A;  4HAU B;  3LJU X;  1MK7 B;  1X05 A;  3PSC A;  4H8S A;  1UNR A;  4DX8 A;  4P7I A;  1QQG A;  2I1K A;  2UZR A;  2RSG A;  2AL6 A;  2LOX A;  1ISN A;  1XOD A;  2D9W A;  4A5K A;  2RNR B;  4B6H A;  1FGY A;  1PLS A;  4EMO A;  4GXB A;  2D9Y A;  2YF0 A;  3PG7 A;  1MKE A;  2Y8F A;  4L6E A;  1WGQ A;  3TCA A;  4WVF B;  4PQ0 A;  2DX1 A;  3SYX A;  3MPX A;  4IAP A;  4GN1 A;  3F5R A;  3ODO A;  1M7E A;  4IOY X;  3DXD A;  4A6F B;  2GCL A;  2VSZ A;  2R09 A;  4HAW B;  1Y19 B;  1UPQ A;  5JHH A;  5FI0 A;  3A8P A;  1U29 A;  3D8E A;  3FSS A;  4EKU A;  2D9Z A;  4A6H A;  5C6R A;  2H7E A;  5KCV A;  1DRO A;  3TFM A;  4F7H A;  5HE0 A;  3DXC A;  2J0K A;  1XR0 B;  1H10 A;  2GJY A;  2COC A;  2YS5 A;  1V5U A;  2LKO A;  1EF1 A;  3U8Z A;  3BJI A;  2DFK A;  4HB2 B;  2YS1 A;  1WI1 A;  5JP4 A;  1NTY A;  4TKN A;  5C5B B;  5C79 A;  2NMB A;  1MIX A;  1U5E A;  2AEH A;  3A98 B;  2VKI A;  2RUK B;  5KQ4 A;  2LUL A;  4CHM A;  2LG1 A;  3AU5 A;  2RVB B;  2P8V A;  3ML4 A;  3PVL A;  2COD A;  2MKR A;  1W1D A;  1BTK A;  4GMX B;  5GOW B;  2E2X A;  1X1F A;  1DDV A;  2RLO A;  2DX5 A;  2P0F A;  3PZD A;  1WG7 A;  1ZSQ A;  1FOE A;  1U5F A;  2EMT A;  3PVU A;  1H4R A;  3FEH A;  4YON A;  1BTN A;  1UNQ A;  4ZRI A;  2DKP A;  2EMS A;  2EC1 A;  1KI1 B;  5D27 A;  2Q13 A;  1WGU A;  3VIA A;  2I5F A;  3TVV A;  1UPR A;  4ZRJ A;  2HTH B;  1XD4 A;  2VRW B;  2I1J A;  1KZG A;  4C0A A;  1TQZ A;  2R0D A;  1P6S A;  2DN6 A;  3RCP A;  1P3R A;  1UNP A;  3ULC A;  1MK9 B;  3AJ4 A;  3A8Q A;  5LON B;  2V76 A;  3QIJ A;  4K2P A;  5L81 A;  3PEG A;  4YL8 A;  2UVM A;  3TO1 A;  3NSU A;  1DYN A;  2GS0 A;  1WVH A;  2Y7B A;  1ZC4 B;  2J59 M;  4PNK A;  3AU4 A;  4Y94 A;  1Z87 A;  2P0H A;  2IFS A;  2L1C A;  5DHF B;  1GC7 A;  2MWN B;  5DH9 B;  3G9W A;  2OTX A;  2LYD A;  4NSW A;  1MAI A;  3IVF A;  4IFS A;  2CY5 A;  2YRY A;  2J0J A;  2QKL A;  2W2X D;  1X11 A;  2M14 A;  1FHX A;  1ZVR A; 
#chains in the Genus database with same CATH topology
 4XWX A;  1I2H A;  5CLQ B;  3OHM B;  2G35 A;  2OQB A;  1TXD A;  1AQC A;  1FAO A;  2Z0O A;  2EJ8 A;  1ZC3 B;  4MY6 A;  3QWM A;  2IYB A;  1K5D B;  3MDB C;  5HE1 A;  1UEF A;  4Z2N A;  1NU2 A;  1MPH A;  1OQN A;  2D9V A;  2ROV A;  1X86 A;  1MIZ B;  4KHA A;  2YT0 A;  3SUZ A;  5DIF B;  2ELA A;  2COA A;  3HK0 A;  3QBV B;  3CIK A;  2KUQ A;  4HDO A;  1B55 A;  3A58 A;  1W1G A;  3P6A A;  3BIN A;  3P7Z A;  5LOP B;  2KIE A;  1V5P A;  1RRP B;  1T77 A;  3U7D A;  3B77 A;  4DBB A;  3ZDT A;  1PMS A;  3KZ1 A;  4DX9 0;  1V88 A;  2ZPY A;  3PVW A;  1PFJ A;  5CLL B;  4ZRK A;  2L2I A;  4GZU A;  5DHA B;  1DDM A;  4QJ3 B;  1U2B A;  2MFQ A;  4DXA B;  4KHB B;  4HAT B;  3HQC A;  5C5B A;  1XKE A;  1V89 A;  2YVC A;  3PP2 A;  2DHK A;  1AWE A;  2RGN B;  2BCJ A;  1XX0 A;  2D9X A;  2K2U A;  2DYN A;  2CRF A;  4HB0 B;  4CHJ A;  4K17 A;  1V5M A;  3GYO A;  1NI2 A;  2DHJ A;  2KUP A;  4A6K A;  1Q67 A;  5EFX A;  5C16 A;  3O96 A;  3NWD A;  4EJN A;  1X1G A;  1N3H A;  1TJ6 A;  1RJ2 A;  3ODW A;  1W1H A;  4HB3 B;  1LB1 A;  2FJL A;  4HAZ B;  4Z2M B;  2NZ8 B;  1FHO A;  1XCG A;  3SO6 A;  5D3X A;  2Z0P A;  1IRS A;  1J19 A;  1Y5O A;  5D3V A;  1FGZ A;  1NTV A;  1BWN A;  2D10 A;  2DA0 A;  4QJ5 B;  3ODX A;  3WA0 A;  1EVH A;  1EGX A;  2UZS A;  5FI1 A;  1E5W A;  5D3Y A;  3KRX A;  1LW3 A;  3GYP A;  2COF A;  5HE3 A;  3SNH A;  2I5C A;  3SV1 A;  3V5W A;  5JHG A;  3N7C A;  2DYQ A;  3VOQ A;  3ZVR A;  4HAY B;  2Y8G A;  5J3Q A;  1ZYI A;  1BAK A;  2P0D A;  3U12 A;  3ULB A;  2CY4 A;  5J3T A;  2D4Q A;  3CXB B;  2CAY A;  2ROZ B;  2D2Q A;  1OMW A;  3KY9 A;  5HE2 A;  4KHO A;  4GPT B;  1U27 A;  5J3Y A;  4NY0 A;  2DLW A;  2J0M A;  5KQ1 A;  2ELB A;  3D8D A;  1I7A A;  1OY2 A;  4HAX B;  3KSY A;  1M7R A;  1U5D A;  2NBV A;  1DBH A;  2N23 A;  4KAX B;  2YT2 A;  1P5T A;  2KCJ A;  4HB4 B;  4A6F A;  3X23 A;  4MK0 A;  5M4Y B;  2M38 A;  4F7U P;  5D3W A;  2W2X C;  4CYE A;  1WJ1 A;  2H7D A;  2W2W A;  4GMV A;  1GG3 A;  1V61 A;  3OAN A;  1EAZ A;  5JLJ B;  4WSF A;  4HAV B;  2DHI A;  2HE7 A;  3UZT A;  1MI1 A;  1GC6 A;  2ADZ A;  3T06 A;  3WYF B;  2PZ1 A;  2LOZ A;  1J0W A;  2K8E A;  2YS3 A;  4K81 A;  2D11 A;  2MDX A;  1QC6 A;  1SHC A;  2GCJ A;  4MT7 A;  4WJ7 A;  2Z13 A;  2YSZ A;  2Z0Q A;  1DDW A;  3D8F A;  3KRW A;  2Z14 A;  4HHV A;  3TW1 A;  2KGX B;  2X18 A;  4D0N B;  4F7G A;  2QKM A;  1K5G B;  3FM8 C;  2K00 A;  2YT1 A;  4HDQ A;  2DKQ A;  2JP2 A;  1FB8 A;  2XQN M;  2KIG A;  1KZ7 A;  3F0W A;  1U5G A;  3HW2 B;  2DTC A;  1WJM A;  2K2J A;  2FJU B;  1ZM0 A;  3DXE A;  4TYZ A;  5DI9 B;  4BBK A;  3M1I B;  2N0Y A;  4KVG B;  1SGH A;  2GUM A;  1FHW A;  4K2O A;  3HIE A;  4HAU B;  3LJU X;  1MK7 B;  1X05 A;  5IRS A;  3PSC A;  4H8S A;  1UNR A;  4DX8 A;  4P7I A;  1QQG A;  2I1K A;  2UZR A;  2RSG A;  2AL6 A;  2LOX A;  1ISN A;  1XOD A;  2D9W A;  4A5K A;  2RNR B;  4B6H A;  1FGY A;  1PLS A;  4EMO A;  4GXB A;  2D9Y A;  2YF0 A;  4DIX A;  3PG7 A;  1MKE A;  3NWF A;  4QJ4 B;  2Y8F A;  4CSQ A;  4L6E A;  1WGQ A;  3TCA A;  4WVF B;  4PQ0 A;  2DX1 A;  3SYX A;  3MPX A;  4IAP A;  4GN1 A;  3F5R A;  3ODO A;  1M7E A;  4IOY X;  3DXD A;  4A6F B;  2GCL A;  2VSZ A;  2R09 A;  4HAW B;  1Y19 B;  1UPQ A;  5JHH A;  5FI0 A;  3A8P A;  3HSA A;  4GNK B;  1U29 A;  3D8E A;  3FSS A;  4EKU A;  3NW8 A;  2D9Z A;  4A6H A;  5C6R A;  2H7E A;  5KCV A;  1DRO A;  3NWA A;  3TFM A;  4F7H A;  2R2Y A;  5HE0 A;  3DXC A;  2J0K A;  1XR0 B;  1H10 A;  2GJY A;  2COC A;  3DCX A;  2YS5 A;  1V5U A;  2LKO A;  4HSI A;  4QXA B;  1EF1 A;  3U8Z A;  3BJI A;  2DFK A;  4HB2 B;  2YS1 A;  1WI1 A;  5JP4 A;  1NTY A;  4TKN A;  5C5B B;  5C79 A;  2NMB A;  4D6W A;  1MIX A;  2K49 A;  1U5E A;  2AEH A;  3A98 B;  2VKI A;  2RUK B;  5KQ4 A;  2LUL A;  4CHM A;  2LG1 A;  3AU5 A;  2KR0 A;  4OSN A;  4GOU A;  2RVB B;  2P8V A;  3ML4 A;  3PVL A;  2COD A;  2MKR A;  1W1D A;  1BTK A;  4GMX B;  5GOW B;  2E2X A;  5LG4 B;  1X1F A;  1DDV A;  2RLO A;  2DX5 A;  3FVC A;  2P0F A;  3PZD A;  1WG7 A;  1ZSQ A;  1FOE A;  1U5F A;  2EMT A;  3PVU A;  1H4R A;  3FEH A;  4YON A;  1BTN A;  1UNQ A;  4ZRI A;  2RRF A;  2DKP A;  2EMS A;  2EC1 A;  1KI1 B;  5D27 A;  2Q13 A;  4KHB A;  1WGU A;  3VIA A;  2I5F A;  3TVV A;  1UPR A;  4ZRJ A;  2HTH B;  1XD4 A;  2VRW B;  2I1J A;  1KZG A;  2Z59 A;  4C0A A;  5I2M A;  1TQZ A;  2R0D A;  1P6S A;  2DN6 A;  3RCP A;  1P3R A;  1UNP A;  3ULC A;  2ZKM X;  1MK9 B;  4L1R A;  3AJ4 A;  3A8Q A;  5LON B;  2V76 A;  3QIJ A;  4K2P A;  5L81 A;  3PEG A;  4YL8 A;  2UVM A;  3TO1 A;  2Z4D A;  3NSU A;  1DYN A;  2GS0 A;  1WVH A;  2Y7B A;  1ZC4 B;  2J59 M;  4PNK A;  3AU4 A;  4Y94 A;  1Z87 A;  2P0H A;  2IFS A;  2L1C A;  5DHF B;  1GC7 A;  2MWN B;  5DH9 B;  5I2S A;  3G9W A;  4OT1 A;  2OTX A;  2LYD A;  4NSW A;  1MAI A;  3IVF A;  4IFS A;  2CY5 A;  2YRY A;  2J0J A;  2QKL A;  2W2X D;  1X11 A;  2M14 A;  1FHX A;  1ZVR A; 
#chains in the Genus database with same CATH homology
 4XWX A;  1I2H A;  5CLQ B;  3OHM B;  2G35 A;  2OQB A;  1TXD A;  1AQC A;  1FAO A;  2Z0O A;  2EJ8 A;  1ZC3 B;  4MY6 A;  3QWM A;  2IYB A;  1K5D B;  3MDB C;  5HE1 A;  1UEF A;  4Z2N A;  1NU2 A;  1MPH A;  1OQN A;  2D9V A;  2ROV A;  1X86 A;  1MIZ B;  4KHA A;  2YT0 A;  3SUZ A;  5DIF B;  2ELA A;  2COA A;  3HK0 A;  3QBV B;  3CIK A;  2KUQ A;  4HDO A;  1B55 A;  3A58 A;  1W1G A;  3P6A A;  3BIN A;  3P7Z A;  5LOP B;  2KIE A;  1V5P A;  1RRP B;  3U7D A;  4DBB A;  3ZDT A;  1PMS A;  3KZ1 A;  4DX9 0;  1V88 A;  2ZPY A;  3PVW A;  1PFJ A;  5CLL B;  4ZRK A;  2L2I A;  4GZU A;  5DHA B;  1DDM A;  4QJ3 B;  1U2B A;  2MFQ A;  4DXA B;  4KHB B;  4HAT B;  3HQC A;  5C5B A;  1XKE A;  1V89 A;  2YVC A;  3PP2 A;  2DHK A;  1AWE A;  2RGN B;  2BCJ A;  1XX0 A;  2D9X A;  2K2U A;  2DYN A;  2CRF A;  4HB0 B;  4CHJ A;  4K17 A;  1V5M A;  3GYO A;  1NI2 A;  2DHJ A;  2KUP A;  4A6K A;  1Q67 A;  5EFX A;  5C16 A;  3O96 A;  3NWD A;  4EJN A;  1X1G A;  1N3H A;  1TJ6 A;  1RJ2 A;  3ODW A;  1W1H A;  4HB3 B;  1LB1 A;  2FJL A;  4HAZ B;  4Z2M B;  2NZ8 B;  1FHO A;  1XCG A;  3SO6 A;  5D3X A;  2Z0P A;  1IRS A;  1J19 A;  1Y5O A;  5D3V A;  1FGZ A;  1NTV A;  1BWN A;  2D10 A;  2DA0 A;  4QJ5 B;  3ODX A;  3WA0 A;  1EVH A;  1EGX A;  2UZS A;  5FI1 A;  1E5W A;  5D3Y A;  3KRX A;  1LW3 A;  3GYP A;  2COF A;  5HE3 A;  3SNH A;  2I5C A;  3SV1 A;  3V5W A;  5JHG A;  3N7C A;  2DYQ A;  3VOQ A;  3ZVR A;  4HAY B;  2Y8G A;  5J3Q A;  1ZYI A;  1BAK A;  2P0D A;  3U12 A;  3ULB A;  2CY4 A;  5J3T A;  2D4Q A;  3CXB B;  2CAY A;  2ROZ B;  2D2Q A;  1OMW A;  3KY9 A;  5HE2 A;  4KHO A;  4GPT B;  1U27 A;  5J3Y A;  4NY0 A;  2DLW A;  2J0M A;  5KQ1 A;  2ELB A;  3D8D A;  1I7A A;  1OY2 A;  4HAX B;  3KSY A;  1M7R A;  1U5D A;  2NBV A;  1DBH A;  2N23 A;  4KAX B;  2YT2 A;  1P5T A;  2KCJ A;  4HB4 B;  4A6F A;  3X23 A;  4MK0 A;  5M4Y B;  2M38 A;  4F7U P;  5D3W A;  2W2X C;  4CYE A;  1WJ1 A;  2H7D A;  2W2W A;  4GMV A;  1GG3 A;  1V61 A;  3OAN A;  1EAZ A;  5JLJ B;  4WSF A;  4HAV B;  2DHI A;  2HE7 A;  3UZT A;  1GC6 A;  2ADZ A;  3T06 A;  3WYF B;  2PZ1 A;  2LOZ A;  1J0W A;  2YS3 A;  4K81 A;  2K8E A;  2D11 A;  2MDX A;  1QC6 A;  1SHC A;  2GCJ A;  4MT7 A;  4WJ7 A;  2Z13 A;  2YSZ A;  2Z0Q A;  1DDW A;  3D8F A;  3KRW A;  2Z14 A;  4HHV A;  3TW1 A;  2KGX B;  2X18 A;  4D0N B;  4F7G A;  2QKM A;  1K5G B;  3FM8 C;  2K00 A;  2YT1 A;  4HDQ A;  2DKQ A;  2JP2 A;  1FB8 A;  2XQN M;  2KIG A;  1KZ7 A;  3F0W A;  1U5G A;  3HW2 B;  2DTC A;  1WJM A;  2K2J A;  2FJU B;  1ZM0 A;  3DXE A;  4TYZ A;  5DI9 B;  4BBK A;  3M1I B;  2N0Y A;  4KVG B;  1SGH A;  2GUM A;  1FHW A;  4K2O A;  3HIE A;  4HAU B;  3LJU X;  1MK7 B;  1X05 A;  5IRS A;  3PSC A;  4H8S A;  1UNR A;  4DX8 A;  4P7I A;  1QQG A;  2I1K A;  2UZR A;  2RSG A;  2AL6 A;  2LOX A;  1ISN A;  1XOD A;  2D9W A;  4A5K A;  2RNR B;  4B6H A;  1FGY A;  1PLS A;  4EMO A;  4GXB A;  2D9Y A;  2YF0 A;  4DIX A;  3PG7 A;  1MKE A;  3NWF A;  4QJ4 B;  2Y8F A;  4CSQ A;  4L6E A;  1WGQ A;  3TCA A;  4WVF B;  4PQ0 A;  2DX1 A;  3SYX A;  3MPX A;  4IAP A;  4GN1 A;  3F5R A;  3ODO A;  1M7E A;  4IOY X;  3DXD A;  4A6F B;  2GCL A;  2VSZ A;  2R09 A;  4HAW B;  1Y19 B;  1UPQ A;  5JHH A;  5FI0 A;  3A8P A;  4GNK B;  1U29 A;  3D8E A;  3FSS A;  4EKU A;  3NW8 A;  2D9Z A;  4A6H A;  5C6R A;  2H7E A;  5KCV A;  1DRO A;  3NWA A;  3TFM A;  4F7H A;  2R2Y A;  5HE0 A;  3DXC A;  2J0K A;  1XR0 B;  1H10 A;  2GJY A;  2COC A;  2YS5 A;  1V5U A;  2LKO A;  4HSI A;  4QXA B;  1EF1 A;  3U8Z A;  3BJI A;  2DFK A;  4HB2 B;  2YS1 A;  1WI1 A;  5JP4 A;  1NTY A;  4TKN A;  5C5B B;  5C79 A;  2NMB A;  4D6W A;  1MIX A;  2K49 A;  1U5E A;  2AEH A;  3A98 B;  2VKI A;  2RUK B;  5KQ4 A;  2LUL A;  4CHM A;  2LG1 A;  3AU5 A;  2KR0 A;  4OSN A;  4GOU A;  2RVB B;  2P8V A;  3ML4 A;  3PVL A;  2COD A;  2MKR A;  1W1D A;  1BTK A;  4GMX B;  5GOW B;  2E2X A;  5LG4 B;  1X1F A;  1DDV A;  2RLO A;  2DX5 A;  3FVC A;  2P0F A;  3PZD A;  1WG7 A;  1ZSQ A;  1FOE A;  1U5F A;  2EMT A;  3PVU A;  1H4R A;  3FEH A;  4YON A;  1BTN A;  1UNQ A;  4ZRI A;  2RRF A;  2DKP A;  2EMS A;  2EC1 A;  1KI1 B;  5D27 A;  2Q13 A;  4KHB A;  1WGU A;  3VIA A;  2I5F A;  3TVV A;  1UPR A;  4ZRJ A;  2HTH B;  1XD4 A;  2VRW B;  2I1J A;  1KZG A;  4C0A A;  2Z59 A;  5I2M A;  1TQZ A;  2R0D A;  1P6S A;  2DN6 A;  3RCP A;  1P3R A;  1UNP A;  3ULC A;  2ZKM X;  1MK9 B;  4L1R A;  3AJ4 A;  3A8Q A;  5LON B;  2V76 A;  3QIJ A;  4K2P A;  5L81 A;  3PEG A;  4YL8 A;  2UVM A;  3TO1 A;  3NSU A;  2Z4D A;  1DYN A;  2GS0 A;  1WVH A;  2Y7B A;  1ZC4 B;  2J59 M;  4PNK A;  3AU4 A;  4Y94 A;  1Z87 A;  2P0H A;  2IFS A;  2L1C A;  5DHF B;  1GC7 A;  2MWN B;  5DH9 B;  5I2S A;  3G9W A;  4OT1 A;  2OTX A;  2LYD A;  4NSW A;  1MAI A;  3IVF A;  4IFS A;  2CY5 A;  2YRY A;  2J0J A;  2QKL A;  2W2X D;  1X11 A;  2M14 A;  1FHX A;  1ZVR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...