3TW1A

Structure of rtt106-ahn
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
232
structure length
222
Chain Sequence
TNTIFKLEGVSVLSPLRKKLDLVFYLSNVDGSPVITLLKGNDRELSIYQLNKNIKMASFLPVPEKPNLIYLFMTYTSCEDNKFSEPVVMTLNKENTLNQFKKLGLLDSNVTDFEKCVEYIRKQAILTGFKISNPFVKINSFHLQCHRGTKEGTLYFLPDHIIFGFKKPILLLDASDIESITYSSITRLTFNASLVTKDGEKYEFSMIDQTEYAKIDDYVKRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone chaperone RTT106
publication title Structural basis for recognition of H3K56-acetylated histone H3-H4 by the chaperone Rtt106.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Chaperone
total genus 55
structure length 222
sequence length 232
ec nomenclature
pdb deposition date 2011-09-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 3tw1A02
2.30.29.120 Mainly Beta Roll PH-domain like PH-domain like 3tw1A01
1DROA 2ELBA 3PVLA 5LOPB 5FI1A 1M7RA 2DYNA 5HE0A 4K2OA 3BINA 4GMVA 3X23A 4HAVB 5DI9B 2RGNB 3G9WA 3QBVB 4HAXB 3ODWA 2P0HA 1ZSQA 2Z0PA 3AU4A 2YRYA 1TQZA 4XWXA 1E5WA 4MT7A 2GCJA 4HHVA 2DTCA 3AJ4A 2RSGA 2D10A 1MK9B 1N3HA 4HDOA 3F5RA 1WI1A 1J19A 1EGXA 1V88A 3A8QA 4Y94A 5EFXA 1X05A 5DIFB 2K2UA 3HK0A 4GXBA 1OQNA 2P0FA 4HATB 1GC6A 1X1FA 3D8DA 4A6FA 3ODXA 2CY5A 5HE3A 3KRWA 2FJLA 3U8ZA 4DX90 1LB1A 2D9VA 4F7HA 2P8VA 1B55A 3DXDA 1OMWA 4IFSA 1U5EA 1TJ6A 5KCVA 2DYQA 4KVGB 3U7DA 2DX5A 4HB2B 1XODA 2ZPYA 2Y8FA 3ML4A 4CHJA 2J59M 1XD4A 1H10A 3SO6A 3WYFB 2NZ8B 1X1GA 5C5BA 2MFQA 1FOEA 2J0JA 2KCJA 3WA0A 2R09A 3BJIA 4H8SA 1WVHA 1ZM0A 5D3VA 2UZRA 3SYXA 4BBKA 4HDQA 5JLJB 2LOZA 4A5KA 2NMBA 4EKUA 2X18A 4Z2MB 4D0NB 4YL8A 1P6SA 1Y5OA 3SNHA 4K17A 2DN6A 2Q13A 3QIJA 1XKEA 2Z0OA 3HQCA 5DHFB 1K5DB 2EMSA 1FHWA 2RNRB 2YVCA 2E2XA 1U5FA 4A6KA 1UEFA 4A6HA 2I1KA 5CLLB 2ADZA 1V5UA 3FM8C 4C0AA 1EF1A 4EJNA 1Y19B 4ZRKA 1EVHA 3TVVA 2G35A 3MPXA 2D2QA 1RRPB 1MPHA 2COAA 4P7IA 3AU5A 2L1CA 4IOYX 2W2XC 2XQNM 3N7CA 2EMTA 2YF0A 2J0KA 2W2XD 2K2JA 3MDBC 2RVBB 3ZVRA 3D8EA 4HAYB 4F7UP 1XR0B 1EAZA 2COFA 4GMXB 2KUPA 1KZGA 5D3XA 1KI1B 2COCA 2D9WA 1V61A 2V76A 2LG1A 1V89A 4NY0A 4EMOA 2JP2A 1XX0A 1GG3A 4HAWB 1ZVRA 1NI2A 3IVFA 2DKPA 5J3TA 3M1IB 3FEHA 3PVUA 2KGXB 1SHCA 1I2HA 5GOWB 4L6EA 1DBHA 2VRWB 2D9YA 3KSYA 3DXEA 2ROVA 3A98B 3RCPA 2OTXA 2H7EA 4PNKA 2ELAA 2P0DA 2DLWA 4IAPA 2YS5A 1MKEA 1W1HA 4MY6A 3SV1A 4TYZA 2UVMA 3P7ZA 1QC6A 1ZC3B 2DHKA 1BTNA 4GZUA 2H7DA 1U27A 1LW3A 2CY4A 5KQ4A 5J3QA 1V5MA 1WGQA 3HW2B 1X11A 3PVWA 3ODOA 1MK7B 1FGYA 2VKIA 5JP4A 1FHXA 5J3YA 1FB8A 2LULA 1DDVA 4YONA 3ULCA 4GPTB 4HAZB 2MWNB 3A8PA 1DYNA 1UNRA 1FHOA 5HE2A 5HE1A 4DXAB 2CODA 2J0MA 2HE7A 1H4RA 2GS0A 1MAIA 3QWMA 2LKOA 2N23A 2N0YA 3CXBB 3DXCA 3KY9A 1UPRA 2I5FA 4WVFB 2L2IA 3VOQA 3TW1A 3NSUA 1PLSA 2BCJA 2Z0QA 1KZ7A 1DDWA 2YT0A 2DHJA 2LOXA 1ZC4B 1XCGA 3GYOA 1NTYA 1WJMA 3ZDTA 2QKMA 1DDMA 4MK0A 3ULBA 3UZTA 2M38A 3GYPA 5JHHA 1U5GA 5FI0A 2PZ1A 2M14A 2QKLA 2YSZA 1V5PA 2CRFA 5DH9B 2IYBA 4DBBA 2YS1A 1AQCA 1U2BA 1W1DA 2DX1A 3T06A 2GJYA 2ROZB 1Q67A 1MIXA 2LYDA 4PQ0A 4DX8A 2D4QA 5C16A 1TXDA 4WSFA 1X86A 1WGUA 2IFSA 3O96A 4HB3B 3P6AA 4GN1A 2EJ8A 2Y7BA 3V5WA 4F7GA 2Y8GA 1FAOA 3LJUX 1IRSA 2DHIA 2I1JA 1UPQA 1Z87A 4HB4B 4KHBB 3PSCA 1I7AA 2CAYA 3CIKA 2RUKB 4HB0B 4WJ7A 5KQ1A 1BTKA 1BAKA 2HTHB 1UNPA 3PG7A 4KHAA 3D8FA 2EC1A 1PFJA 3TCAA 2D9XA 5L81A 3KZ1A 2YT1A 1WG7A 3VIAA 3PEGA 1U5DA 2DA0A 4Z2NA 2I5CA 1NTVA 2UZSA 1W1GA 2YS3A 5D3YA 4TKNA 4CHMA 4A6FB 2VSZA 1U29A 3TFMA 3OANA 3PP2A 1ISNA 1K5GB 4KAXB 5DHAB 5C79A 1GC7A 4K81A 1PMSA 4HAUB 5JHGA 1WJ1A 3F0WA 4NSWA 2DKQA 3SUZA 1NU2A 2GCLA 2K00A 4B6HA 3KRXA 1RJ2A 1OY2A 1AWEA 1QQGA 2AL6A 3PZDA 1M7EA 4ZRIA 1UNQA 1P5TA 2RLOA 1SGHA 2AEHA 5C6RA 4K2PA 5D27A 2D9ZA 2DFKA 2MKRA 5C5BB 3FSSA 4CYEA 2D11A 2R0DA 1MIZB 3TO1A 4ZRJA 2MDXA 2W2WA 1BWNA 5LONB 5D3WA 4KHOA 5CLQB 1FGZA 2OQBA 1P3RA 1J0WA
chains in the Genus database with same CATH superfamily
1DROA 2ELBA 3PVLA 5LOPB 5FI1A 5LG4B 1M7RA 2DYNA 5HE0A 4K2OA 3BINA 4GMVA 3X23A 4HAVB 5DI9B 2RGNB 3G9WA 3QBVB 4HAXB 3ODWA 2P0HA 1ZSQA 2Z0PA 3AU4A 2YRYA 1TQZA 4XWXA 4KHBA 1E5WA 4QXAB 4MT7A 2GCJA 4HHVA 2DTCA 3AJ4A 2RSGA 2D10A 3HIEA 1MK9B 1N3HA 2ZKMX 4HDOA 3F5RA 4L1RA 1WI1A 1J19A 1EGXA 1V88A 3A8QA 4Y94A 2KIGA 5EFXA 1X05A 5DIFB 2K2UA 3HK0A 3FVCA 4GXBA 1OQNA 2P0FA 4HATB 1GC6A 1X1FA 3D8DA 4A6FA 3ODXA 2CY5A 5HE3A 3KRWA 2FJLA 3U8ZA 4DX90 1LB1A 2D9VA 4F7HA 2P8VA 1B55A 3DXDA 1OMWA 4IFSA 1U5EA 1TJ6A 5KCVA 2DYQA 4KVGB 3U7DA 2KIEA 2DX5A 4HB2B 1XODA 2ZPYA 2Y8FA 3ML4A 4CHJA 2J59M 1XD4A 1H10A 1MI1A 3SO6A 3WYFB 2NZ8B 1X1GA 5C5BA 2MFQA 1FOEA 2J0JA 2KCJA 3WA0A 2R09A 3BJIA 4H8SA 1WVHA 4GNKB 1ZM0A 5D3VA 2UZRA 2KUQA 3SYXA 4BBKA 4HDQA 5JLJB 2LOZA 4A5KA 2NMBA 4EKUA 2X18A 4Z2MB 4D0NB 4YL8A 4DIXA 1P6SA 1Y5OA 3SNHA 4K17A 2DN6A 2Q13A 3QIJA 1XKEA 2Z0OA 3HQCA 5DHFB 1K5DB 2EMSA 1FHWA 2RNRB 2YVCA 2E2XA 1U5FA 4A6KA 1UEFA 4A6HA 2I1KA 5CLLB 2ADZA 1V5UA 3FM8C 4C0AA 1EF1A 4EJNA 1Y19B 4ZRKA 4QJ5B 1EVHA 3TVVA 2G35A 3MPXA 2D2QA 1RRPB 1MPHA 2COAA 4P7IA 2FJUB 3AU5A 4OSNA 4OT1A 2L1CA 4HSIA 4IOYX 2W2XC 2XQNM 3N7CA 2EMTA 2YF0A 2J0KA 2W2XD 2K2JA 1ZYIA 3MDBC 2RVBB 3ZVRA 3D8EA 4HAYB 4F7UP 4CSQA 1XR0B 1EAZA 2COFA 4GMXB 2KUPA 1KZGA 5D3XA 1KI1B 2COCA 2D9WA 1V61A 2V76A 2LG1A 1V89A 4NY0A 4EMOA 2JP2A 1XX0A 1GG3A 4HAWB 1ZVRA 1NI2A 3IVFA 2DKPA 5J3TA 3M1IB 3FEHA 3PVUA 2KGXB 2Z59A 1SHCA 1I2HA 5GOWB 4L6EA 1DBHA 2VRWB 3NWFA 2D9YA 3KSYA 3DXEA 2ROVA 3A98B 3RCPA 2OTXA 2H7EA 4PNKA 2ELAA 2P0DA 2DLWA 4IAPA 3NWAA 2YS5A 1MKEA 1W1HA 4MY6A 3SV1A 4TYZA 2UVMA 3P7ZA 1QC6A 1ZC3B 3NW8A 2DHKA 2RRFA 1BTNA 4GZUA 2H7DA 2NBVA 1U27A 1LW3A 2CY4A 5KQ4A 5J3QA 1V5MA 1WGQA 3HW2B 4QJ3B 1X11A 3PVWA 3ODOA 1MK7B 1FGYA 2VKIA 5JP4A 1FHXA 5J3YA 1FB8A 2LULA 1DDVA 4YONA 3ULCA 4GPTB 4HAZB 3OHMB 2MWNB 3A8PA 1DYNA 1UNRA 1FHOA 5HE2A 5HE1A 4DXAB 2CODA 2J0MA 2HE7A 1H4RA 2GS0A 1MAIA 3QWMA 2LKOA 2YT2A 2N23A 2N0YA 3CXBB 3DXCA 3KY9A 1UPRA 2I5FA 4WVFB 2L2IA 4GOUA 3VOQA 3TW1A 3NSUA 1PLSA 2BCJA 2Z0QA 1KZ7A 1DDWA 2YT0A 2DHJA 2LOXA 2Z14A 1ZC4B 3A58A 1XCGA 3GYOA 1NTYA 1WJMA 5IRSA 3ZDTA 2QKMA 4QJ4B 1DDMA 2Z4DA 4MK0A 3ULBA 3HSAA 3UZTA 2M38A 4D6WA 3GYPA 5JHHA 1U5GA 5FI0A 2PZ1A 2M14A 2QKLA 2YSZA 5M4YB 3NWDA 1V5PA 2CRFA 5DH9B 2IYBA 4DBBA 2YS1A 1AQCA 1U2BA 1W1DA 2DX1A 3T06A 2GJYA 2ROZB 1Q67A 1MIXA 2LYDA 4PQ0A 4DX8A 2D4QA 5C16A 1TXDA 4WSFA 1X86A 1WGUA 2IFSA 3O96A 4HB3B 3P6AA 4GN1A 2EJ8A 2Y7BA 3V5WA 4F7GA 2Y8GA 1FAOA 3LJUX 1IRSA 2DHIA 2I1JA 1UPQA 1Z87A 1T77A 4HB4B 4KHBB 3PSCA 2GUMA 1I7AA 2CAYA 3CIKA 2RUKB 2KR0A 4HB0B 4WJ7A 5KQ1A 1BTKA 1BAKA 2HTHB 1UNPA 3PG7A 4KHAA 3D8FA 2EC1A 1PFJA 3TCAA 2D9XA 5L81A 3KZ1A 2YT1A 1WG7A 3VIAA 3PEGA 1U5DA 2DA0A 4Z2NA 2I5CA 1NTVA 2UZSA 1W1GA 2YS3A 5D3YA 4TKNA 4CHMA 4A6FB 2VSZA 1U29A 3TFMA 3U12A 3OANA 3PP2A 1ISNA 1K5GB 2K49A 4KAXB 5DHAB 5C79A 1GC7A 4K81A 1PMSA 4HAUB 5JHGA 1WJ1A 3F0WA 4NSWA 2DKQA 3SUZA 1NU2A 2GCLA 2K00A 2R2YA 5I2MA 4B6HA 3KRXA 3DCXA 1RJ2A 5I2SA 1OY2A 1AWEA 1QQGA 2AL6A 3PZDA 1M7EA 4ZRIA 2K8EA 1UNQA 1P5TA 2RLOA 3B77A 1SGHA 2AEHA 5C6RA 4K2PA 5D27A 2D9ZA 2DFKA 2MKRA 5C5BB 3FSSA 4CYEA 2D11A 2R0DA 1MIZB 3TO1A 4ZRJA 2MDXA 2W2WA 1BWNA 5LONB 2Z13A 5D3WA 4KHOA 5CLQB 1FGZA 2OQBA 1P3RA 1J0WA
chains in the Genus database with same CATH topology
1DROA 2ELBA 3PVLA 5LOPB 5FI1A 5LG4B 1M7RA 2DYNA 5HE0A 4K2OA 3BINA 4GMVA 3X23A 4HAVB 5DI9B 2RGNB 3G9WA 3QBVB 4HAXB 3ODWA 2P0HA 1ZSQA 2Z0PA 3AU4A 2YRYA 1TQZA 4XWXA 4KHBA 1E5WA 4QXAB 4MT7A 2GCJA 4HHVA 2DTCA 3AJ4A 2RSGA 2D10A 3HIEA 1MK9B 1N3HA 2ZKMX 4HDOA 3F5RA 4L1RA 1WI1A 1J19A 1EGXA 1V88A 3A8QA 4Y94A 2KIGA 5EFXA 1X05A 5DIFB 2K2UA 3HK0A 3FVCA 4GXBA 1OQNA 2P0FA 4HATB 1GC6A 1X1FA 3D8DA 4A6FA 3ODXA 2CY5A 5HE3A 3KRWA 2FJLA 3U8ZA 4DX90 1LB1A 2D9VA 4F7HA 2P8VA 1B55A 3DXDA 1OMWA 4IFSA 1U5EA 1TJ6A 5KCVA 2DYQA 4KVGB 3U7DA 2KIEA 2DX5A 4HB2B 1XODA 2ZPYA 2Y8FA 3ML4A 4CHJA 2J59M 1XD4A 1H10A 3SO6A 3WYFB 2NZ8B 1X1GA 5C5BA 2MFQA 1FOEA 2J0JA 2KCJA 3WA0A 2R09A 3BJIA 4H8SA 1WVHA 4GNKB 1ZM0A 5D3VA 2UZRA 2KUQA 3SYXA 4BBKA 4HDQA 5JLJB 2LOZA 4A5KA 2NMBA 4EKUA 2X18A 4Z2MB 4D0NB 4YL8A 4DIXA 1P6SA 1Y5OA 3SNHA 4K17A 2DN6A 2Q13A 3QIJA 1XKEA 2Z0OA 3HQCA 5DHFB 1K5DB 2EMSA 1FHWA 2RNRB 2YVCA 2E2XA 1U5FA 4A6KA 1UEFA 4A6HA 2I1KA 5CLLB 2ADZA 1V5UA 3FM8C 4C0AA 1EF1A 4EJNA 1Y19B 4ZRKA 4QJ5B 1EVHA 3TVVA 2G35A 3MPXA 2D2QA 1RRPB 1MPHA 2COAA 4P7IA 2FJUB 3AU5A 4OSNA 4OT1A 2L1CA 4HSIA 4IOYX 2W2XC 2XQNM 3N7CA 2EMTA 2YF0A 2J0KA 2W2XD 2K2JA 3MDBC 1ZYIA 2RVBB 3ZVRA 3D8EA 4HAYB 4F7UP 4CSQA 1XR0B 1EAZA 2COFA 4GMXB 2KUPA 1KZGA 5D3XA 1KI1B 2COCA 2D9WA 1V61A 2V76A 2LG1A 1V89A 4NY0A 4EMOA 2JP2A 1XX0A 1GG3A 4HAWB 1ZVRA 1NI2A 3IVFA 2DKPA 5J3TA 3M1IB 3FEHA 3PVUA 2KGXB 2Z59A 1SHCA 1I2HA 5GOWB 4L6EA 1DBHA 2VRWB 3NWFA 2D9YA 3KSYA 3DXEA 2ROVA 3A98B 3RCPA 2OTXA 2H7EA 4PNKA 2ELAA 2P0DA 2DLWA 4IAPA 3NWAA 2YS5A 1MKEA 1W1HA 4MY6A 3SV1A 4TYZA 2UVMA 3P7ZA 1QC6A 1ZC3B 3NW8A 2DHKA 2RRFA 1BTNA 4GZUA 2H7DA 2NBVA 1U27A 1LW3A 2CY4A 5KQ4A 5J3QA 1V5MA 1WGQA 3HW2B 4QJ3B 1X11A 3PVWA 3ODOA 1MK7B 1FGYA 2VKIA 5JP4A 1FHXA 5J3YA 1FB8A 2LULA 1DDVA 4YONA 3ULCA 4GPTB 4HAZB 3OHMB 2MWNB 3A8PA 1DYNA 1UNRA 1FHOA 5HE2A 5HE1A 4DXAB 2CODA 2J0MA 2HE7A 1H4RA 2GS0A 1MAIA 3QWMA 2LKOA 2YT2A 2N23A 2N0YA 3CXBB 3DXCA 3KY9A 1UPRA 2I5FA 4WVFB 2L2IA 4GOUA 3VOQA 3TW1A 3NSUA 1PLSA 2BCJA 2Z0QA 1KZ7A 1DDWA 2YT0A 2DHJA 2LOXA 2Z14A 1ZC4B 3A58A 1XCGA 3GYOA 1NTYA 1WJMA 5IRSA 3ZDTA 2QKMA 4QJ4B 1DDMA 2Z4DA 4MK0A 3ULBA 3UZTA 2M38A 4D6WA 3GYPA 5JHHA 1U5GA 5FI0A 2PZ1A 2M14A 2QKLA 2YSZA 5M4YB 3NWDA 1V5PA 2CRFA 5DH9B 2IYBA 4DBBA 2YS1A 1AQCA 1U2BA 1W1DA 2DX1A 3T06A 2GJYA 2ROZB 1Q67A 1MIXA 2LYDA 4PQ0A 4DX8A 2D4QA 5C16A 1TXDA 4WSFA 1X86A 1WGUA 2IFSA 3O96A 4HB3B 3P6AA 4GN1A 2EJ8A 2Y7BA 3V5WA 4F7GA 2Y8GA 1FAOA 3LJUX 1IRSA 2DHIA 2I1JA 1UPQA 1Z87A 4HB4B 4KHBB 3PSCA 2GUMA 1I7AA 2CAYA 3CIKA 2RUKB 4HB0B 4WJ7A 2KR0A 5KQ1A 1BTKA 1BAKA 2HTHB 1UNPA 3PG7A 4KHAA 3D8FA 2EC1A 1PFJA 3TCAA 2D9XA 5L81A 3KZ1A 2YT1A 1WG7A 3VIAA 3PEGA 1U5DA 2DA0A 4Z2NA 2I5CA 1NTVA 2UZSA 1W1GA 2YS3A 5D3YA 4TKNA 4CHMA 4A6FB 2VSZA 1U29A 3TFMA 3U12A 3OANA 3PP2A 1ISNA 1K5GB 4KAXB 2K49A 5DHAB 5C79A 1GC7A 4K81A 1PMSA 4HAUB 5JHGA 1WJ1A 3F0WA 4NSWA 2DKQA 3SUZA 1NU2A 2GCLA 2K00A 4B6HA 2R2YA 5I2MA 3KRXA 1RJ2A 5I2SA 1OY2A 1AWEA 1QQGA 2AL6A 3PZDA 1M7EA 4ZRIA 2K8EA 1UNQA 1P5TA 2RLOA 1SGHA 2AEHA 5C6RA 4K2PA 5D27A 2D9ZA 2DFKA 2MKRA 5C5BB 3FSSA 4CYEA 2D11A 2R0DA 1MIZB 3TO1A 4ZRJA 2MDXA 2W2WA 1BWNA 5LONB 2Z13A 5D3WA 4KHOA 5CLQB 1FGZA 2OQBA 1P3RA 1J0WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DRO A;  2ELB A;  3PVL A;  5LOP B;  5FI1 A;  1M7R A;  2DYN A;  5HE0 A;  4K2O A;  3BIN A;  4GMV A;  3X23 A;  4HAV B;  5DI9 B;  2RGN B;  3G9W A;  3QBV B;  4HAX B;  3ODW A;  2P0H A;  1ZSQ A;  2Z0P A;  3AU4 A;  2YRY A;  1TQZ A;  4XWX A;  1E5W A;  4MT7 A;  2GCJ A;  4HHV A;  2DTC A;  3AJ4 A;  2RSG A;  2D10 A;  1MK9 B;  1N3H A;  4HDO A;  3F5R A;  1WI1 A;  1J19 A;  1EGX A;  1V88 A;  3A8Q A;  4Y94 A;  5EFX A;  1X05 A;  5DIF B;  2K2U A;  3HK0 A;  4GXB A;  1OQN A;  2P0F A;  4HAT B;  1GC6 A;  1X1F A;  3D8D A;  4A6F A;  3ODX A;  2CY5 A;  5HE3 A;  3KRW A;  2FJL A;  3U8Z A;  4DX9 0;  1LB1 A;  2D9V A;  4F7H A;  2P8V A;  1B55 A;  3DXD A;  1OMW A;  4IFS A;  1U5E A;  1TJ6 A;  5KCV A;  2DYQ A;  4KVG B;  3U7D A;  2DX5 A;  4HB2 B;  1XOD A;  2ZPY A;  2Y8F A;  3ML4 A;  4CHJ A;  2J59 M;  1XD4 A;  1H10 A;  3SO6 A;  3WYF B;  2NZ8 B;  1X1G A;  5C5B A;  2MFQ A;  1FOE A;  2J0J A;  2KCJ A;  3WA0 A;  2R09 A;  3BJI A;  4H8S A;  1WVH A;  1ZM0 A;  5D3V A;  2UZR A;  3SYX A;  4BBK A;  4HDQ A;  5JLJ B;  2LOZ A;  4A5K A;  2NMB A;  4EKU A;  2X18 A;  4Z2M B;  4D0N B;  4YL8 A;  1P6S A;  1Y5O A;  3SNH A;  4K17 A;  2DN6 A;  2Q13 A;  3QIJ A;  1XKE A;  2Z0O A;  3HQC A;  5DHF B;  1K5D B;  2EMS A;  1FHW A;  2RNR B;  2YVC A;  2E2X A;  1U5F A;  4A6K A;  1UEF A;  4A6H A;  2I1K A;  5CLL B;  2ADZ A;  1V5U A;  3FM8 C;  4C0A A;  1EF1 A;  4EJN A;  1Y19 B;  4ZRK A;  1EVH A;  3TVV A;  2G35 A;  3MPX A;  2D2Q A;  1RRP B;  1MPH A;  2COA A;  4P7I A;  3AU5 A;  2L1C A;  4IOY X;  2W2X C;  2XQN M;  3N7C A;  2EMT A;  2YF0 A;  2J0K A;  2W2X D;  2K2J A;  3MDB C;  2RVB B;  3ZVR A;  3D8E A;  4HAY B;  4F7U P;  1XR0 B;  1EAZ A;  2COF A;  4GMX B;  2KUP A;  1KZG A;  5D3X A;  1KI1 B;  2COC A;  2D9W A;  1V61 A;  2V76 A;  2LG1 A;  1V89 A;  4NY0 A;  4EMO A;  2JP2 A;  1XX0 A;  1GG3 A;  4HAW B;  1ZVR A;  1NI2 A;  3IVF A;  2DKP A;  5J3T A;  3M1I B;  3FEH A;  3PVU A;  2KGX B;  1SHC A;  1I2H A;  5GOW B;  4L6E A;  1DBH A;  2VRW B;  2D9Y A;  3KSY A;  3DXE A;  2ROV A;  3A98 B;  3RCP A;  2OTX A;  2H7E A;  4PNK A;  2ELA A;  2P0D A;  2DLW A;  4IAP A;  2YS5 A;  1MKE A;  1W1H A;  4MY6 A;  3SV1 A;  4TYZ A;  2UVM A;  3P7Z A;  1QC6 A;  1ZC3 B;  2DHK A;  1BTN A;  4GZU A;  2H7D A;  1U27 A;  1LW3 A;  2CY4 A;  5KQ4 A;  5J3Q A;  1V5M A;  1WGQ A;  3HW2 B;  1X11 A;  3PVW A;  3ODO A;  1MK7 B;  1FGY A;  2VKI A;  5JP4 A;  1FHX A;  5J3Y A;  1FB8 A;  2LUL A;  1DDV A;  4YON A;  3ULC A;  4GPT B;  4HAZ B;  2MWN B;  3A8P A;  1DYN A;  1UNR A;  1FHO A;  5HE2 A;  5HE1 A;  4DXA B;  2COD A;  2J0M A;  2HE7 A;  1H4R A;  2GS0 A;  1MAI A;  3QWM A;  2LKO A;  2N23 A;  2N0Y A;  3CXB B;  3DXC A;  3KY9 A;  1UPR A;  2I5F A;  4WVF B;  2L2I A;  3VOQ A;  3TW1 A;  3NSU A;  1PLS A;  2BCJ A;  2Z0Q A;  1KZ7 A;  1DDW A;  2YT0 A;  2DHJ A;  2LOX A;  1ZC4 B;  1XCG A;  3GYO A;  1NTY A;  1WJM A;  3ZDT A;  2QKM A;  1DDM A;  4MK0 A;  3ULB A;  3UZT A;  2M38 A;  3GYP A;  5JHH A;  1U5G A;  5FI0 A;  2PZ1 A;  2M14 A;  2QKL A;  2YSZ A;  1V5P A;  2CRF A;  5DH9 B;  2IYB A;  4DBB A;  2YS1 A;  1AQC A;  1U2B A;  1W1D A;  2DX1 A;  3T06 A;  2GJY A;  2ROZ B;  1Q67 A;  1MIX A;  2LYD A;  4PQ0 A;  4DX8 A;  2D4Q A;  5C16 A;  1TXD A;  4WSF A;  1X86 A;  1WGU A;  2IFS A;  3O96 A;  4HB3 B;  3P6A A;  4GN1 A;  2EJ8 A;  2Y7B A;  3V5W A;  4F7G A;  2Y8G A;  1FAO A;  3LJU X;  1IRS A;  2DHI A;  2I1J A;  1UPQ A;  1Z87 A;  4HB4 B;  4KHB B;  3PSC A;  1I7A A;  2CAY A;  3CIK A;  2RUK B;  4HB0 B;  4WJ7 A;  5KQ1 A;  1BTK A;  1BAK A;  2HTH B;  1UNP A;  3PG7 A;  4KHA A;  3D8F A;  2EC1 A;  1PFJ A;  3TCA A;  2D9X A;  5L81 A;  3KZ1 A;  2YT1 A;  1WG7 A;  3VIA A;  3PEG A;  1U5D A;  2DA0 A;  4Z2N A;  2I5C A;  1NTV A;  2UZS A;  1W1G A;  2YS3 A;  5D3Y A;  4TKN A;  4CHM A;  4A6F B;  2VSZ A;  1U29 A;  3TFM A;  3OAN A;  3PP2 A;  1ISN A;  1K5G B;  4KAX B;  5DHA B;  5C79 A;  1GC7 A;  4K81 A;  1PMS A;  4HAU B;  5JHG A;  1WJ1 A;  3F0W A;  4NSW A;  2DKQ A;  3SUZ A;  1NU2 A;  2GCL A;  2K00 A;  4B6H A;  3KRX A;  1RJ2 A;  1OY2 A;  1AWE A;  1QQG A;  2AL6 A;  3PZD A;  1M7E A;  4ZRI A;  1UNQ A;  1P5T A;  2RLO A;  1SGH A;  2AEH A;  5C6R A;  4K2P A;  5D27 A;  2D9Z A;  2DFK A;  2MKR A;  5C5B B;  3FSS A;  4CYE A;  2D11 A;  2R0D A;  1MIZ B;  3TO1 A;  4ZRJ A;  2MDX A;  2W2W A;  1BWN A;  5LON B;  5D3W A;  4KHO A;  5CLQ B;  1FGZ A;  2OQB A;  1P3R A;  1J0W A; 
#chains in the Genus database with same CATH topology
 1DRO A;  2ELB A;  3PVL A;  5LOP B;  5FI1 A;  5LG4 B;  1M7R A;  2DYN A;  5HE0 A;  4K2O A;  3BIN A;  4GMV A;  3X23 A;  4HAV B;  5DI9 B;  2RGN B;  3G9W A;  3QBV B;  4HAX B;  3ODW A;  2P0H A;  1ZSQ A;  2Z0P A;  3AU4 A;  2YRY A;  1TQZ A;  4XWX A;  4KHB A;  1E5W A;  4QXA B;  4MT7 A;  2GCJ A;  4HHV A;  2DTC A;  3AJ4 A;  2RSG A;  2D10 A;  3HIE A;  1MK9 B;  1N3H A;  2ZKM X;  4HDO A;  3F5R A;  4L1R A;  1WI1 A;  1J19 A;  1EGX A;  1V88 A;  3A8Q A;  4Y94 A;  2KIG A;  5EFX A;  1X05 A;  5DIF B;  2K2U A;  3HK0 A;  3FVC A;  4GXB A;  1OQN A;  2P0F A;  4HAT B;  1GC6 A;  1X1F A;  3D8D A;  4A6F A;  3ODX A;  2CY5 A;  5HE3 A;  3KRW A;  2FJL A;  3U8Z A;  4DX9 0;  1LB1 A;  2D9V A;  4F7H A;  2P8V A;  1B55 A;  3DXD A;  1OMW A;  4IFS A;  1U5E A;  1TJ6 A;  5KCV A;  2DYQ A;  4KVG B;  3U7D A;  2KIE A;  2DX5 A;  4HB2 B;  1XOD A;  2ZPY A;  2Y8F A;  3ML4 A;  4CHJ A;  2J59 M;  1XD4 A;  1H10 A;  1MI1 A;  3SO6 A;  3WYF B;  2NZ8 B;  1X1G A;  5C5B A;  2MFQ A;  1FOE A;  2J0J A;  2KCJ A;  3WA0 A;  2R09 A;  3BJI A;  4H8S A;  1WVH A;  4GNK B;  1ZM0 A;  5D3V A;  2UZR A;  2KUQ A;  3SYX A;  4BBK A;  4HDQ A;  5JLJ B;  2LOZ A;  4A5K A;  2NMB A;  4EKU A;  2X18 A;  4Z2M B;  4D0N B;  4YL8 A;  4DIX A;  1P6S A;  1Y5O A;  3SNH A;  4K17 A;  2DN6 A;  2Q13 A;  3QIJ A;  1XKE A;  2Z0O A;  3HQC A;  5DHF B;  1K5D B;  2EMS A;  1FHW A;  2RNR B;  2YVC A;  2E2X A;  1U5F A;  4A6K A;  1UEF A;  4A6H A;  2I1K A;  5CLL B;  2ADZ A;  1V5U A;  3FM8 C;  4C0A A;  1EF1 A;  4EJN A;  1Y19 B;  4ZRK A;  4QJ5 B;  1EVH A;  3TVV A;  2G35 A;  3MPX A;  2D2Q A;  1RRP B;  1MPH A;  2COA A;  4P7I A;  2FJU B;  3AU5 A;  4OSN A;  4OT1 A;  2L1C A;  4HSI A;  4IOY X;  2W2X C;  2XQN M;  3N7C A;  2EMT A;  2YF0 A;  2J0K A;  2W2X D;  2K2J A;  1ZYI A;  3MDB C;  2RVB B;  3ZVR A;  3D8E A;  4HAY B;  4F7U P;  4CSQ A;  1XR0 B;  1EAZ A;  2COF A;  4GMX B;  2KUP A;  1KZG A;  5D3X A;  1KI1 B;  2COC A;  2D9W A;  1V61 A;  2V76 A;  2LG1 A;  1V89 A;  4NY0 A;  4EMO A;  2JP2 A;  1XX0 A;  1GG3 A;  4HAW B;  1ZVR A;  1NI2 A;  3IVF A;  2DKP A;  5J3T A;  3M1I B;  3FEH A;  3PVU A;  2KGX B;  2Z59 A;  1SHC A;  1I2H A;  5GOW B;  4L6E A;  1DBH A;  2VRW B;  3NWF A;  2D9Y A;  3KSY A;  3DXE A;  2ROV A;  3A98 B;  3RCP A;  2OTX A;  2H7E A;  4PNK A;  2ELA A;  2P0D A;  2DLW A;  4IAP A;  3NWA A;  2YS5 A;  1MKE A;  1W1H A;  4MY6 A;  3SV1 A;  4TYZ A;  2UVM A;  3P7Z A;  1QC6 A;  1ZC3 B;  3NW8 A;  2DHK A;  2RRF A;  1BTN A;  4GZU A;  2H7D A;  2NBV A;  1U27 A;  1LW3 A;  2CY4 A;  5KQ4 A;  5J3Q A;  1V5M A;  1WGQ A;  3HW2 B;  4QJ3 B;  1X11 A;  3PVW A;  3ODO A;  1MK7 B;  1FGY A;  2VKI A;  5JP4 A;  1FHX A;  5J3Y A;  1FB8 A;  2LUL A;  1DDV A;  4YON A;  3ULC A;  4GPT B;  4HAZ B;  3OHM B;  2MWN B;  3A8P A;  1DYN A;  1UNR A;  1FHO A;  5HE2 A;  5HE1 A;  4DXA B;  2COD A;  2J0M A;  2HE7 A;  1H4R A;  2GS0 A;  1MAI A;  3QWM A;  2LKO A;  2YT2 A;  2N23 A;  2N0Y A;  3CXB B;  3DXC A;  3KY9 A;  1UPR A;  2I5F A;  4WVF B;  2L2I A;  4GOU A;  3VOQ A;  3TW1 A;  3NSU A;  1PLS A;  2BCJ A;  2Z0Q A;  1KZ7 A;  1DDW A;  2YT0 A;  2DHJ A;  2LOX A;  2Z14 A;  1ZC4 B;  3A58 A;  1XCG A;  3GYO A;  1NTY A;  1WJM A;  5IRS A;  3ZDT A;  2QKM A;  4QJ4 B;  1DDM A;  2Z4D A;  4MK0 A;  3ULB A;  3HSA A;  3UZT A;  2M38 A;  4D6W A;  3GYP A;  5JHH A;  1U5G A;  5FI0 A;  2PZ1 A;  2M14 A;  2QKL A;  2YSZ A;  5M4Y B;  3NWD A;  1V5P A;  2CRF A;  5DH9 B;  2IYB A;  4DBB A;  2YS1 A;  1AQC A;  1U2B A;  1W1D A;  2DX1 A;  3T06 A;  2GJY A;  2ROZ B;  1Q67 A;  1MIX A;  2LYD A;  4PQ0 A;  4DX8 A;  2D4Q A;  5C16 A;  1TXD A;  4WSF A;  1X86 A;  1WGU A;  2IFS A;  3O96 A;  4HB3 B;  3P6A A;  4GN1 A;  2EJ8 A;  2Y7B A;  3V5W A;  4F7G A;  2Y8G A;  1FAO A;  3LJU X;  1IRS A;  2DHI A;  2I1J A;  1UPQ A;  1Z87 A;  1T77 A;  4HB4 B;  4KHB B;  3PSC A;  2GUM A;  1I7A A;  2CAY A;  3CIK A;  2RUK B;  2KR0 A;  4HB0 B;  4WJ7 A;  5KQ1 A;  1BTK A;  1BAK A;  2HTH B;  1UNP A;  3PG7 A;  4KHA A;  3D8F A;  2EC1 A;  1PFJ A;  3TCA A;  2D9X A;  5L81 A;  3KZ1 A;  2YT1 A;  1WG7 A;  3VIA A;  3PEG A;  1U5D A;  2DA0 A;  4Z2N A;  2I5C A;  1NTV A;  2UZS A;  1W1G A;  2YS3 A;  5D3Y A;  4TKN A;  4CHM A;  4A6F B;  2VSZ A;  1U29 A;  3TFM A;  3U12 A;  3OAN A;  3PP2 A;  1ISN A;  1K5G B;  2K49 A;  4KAX B;  5DHA B;  5C79 A;  1GC7 A;  4K81 A;  1PMS A;  4HAU B;  5JHG A;  1WJ1 A;  3F0W A;  4NSW A;  2DKQ A;  3SUZ A;  1NU2 A;  2GCL A;  2K00 A;  2R2Y A;  5I2M A;  4B6H A;  3KRX A;  3DCX A;  1RJ2 A;  5I2S A;  1OY2 A;  1AWE A;  1QQG A;  2AL6 A;  3PZD A;  1M7E A;  4ZRI A;  2K8E A;  1UNQ A;  1P5T A;  2RLO A;  3B77 A;  1SGH A;  2AEH A;  5C6R A;  4K2P A;  5D27 A;  2D9Z A;  2DFK A;  2MKR A;  5C5B B;  3FSS A;  4CYE A;  2D11 A;  2R0D A;  1MIZ B;  3TO1 A;  4ZRJ A;  2MDX A;  2W2W A;  1BWN A;  5LON B;  2Z13 A;  5D3W A;  4KHO A;  5CLQ B;  1FGZ A;  2OQB A;  1P3R A;  1J0W A; 
#chains in the Genus database with same CATH homology
 1DRO A;  2ELB A;  3PVL A;  5LOP B;  5FI1 A;  5LG4 B;  1M7R A;  2DYN A;  5HE0 A;  4K2O A;  3BIN A;  4GMV A;  3X23 A;  4HAV B;  5DI9 B;  2RGN B;  3G9W A;  3QBV B;  4HAX B;  3ODW A;  2P0H A;  1ZSQ A;  2Z0P A;  3AU4 A;  2YRY A;  1TQZ A;  4XWX A;  4KHB A;  1E5W A;  4QXA B;  4MT7 A;  2GCJ A;  4HHV A;  2DTC A;  3AJ4 A;  2RSG A;  2D10 A;  3HIE A;  1MK9 B;  1N3H A;  2ZKM X;  4HDO A;  3F5R A;  4L1R A;  1WI1 A;  1J19 A;  1EGX A;  1V88 A;  3A8Q A;  4Y94 A;  2KIG A;  5EFX A;  1X05 A;  5DIF B;  2K2U A;  3HK0 A;  3FVC A;  4GXB A;  1OQN A;  2P0F A;  4HAT B;  1GC6 A;  1X1F A;  3D8D A;  4A6F A;  3ODX A;  2CY5 A;  5HE3 A;  3KRW A;  2FJL A;  3U8Z A;  4DX9 0;  1LB1 A;  2D9V A;  4F7H A;  2P8V A;  1B55 A;  3DXD A;  1OMW A;  4IFS A;  1U5E A;  1TJ6 A;  5KCV A;  2DYQ A;  4KVG B;  3U7D A;  2KIE A;  2DX5 A;  4HB2 B;  1XOD A;  2ZPY A;  2Y8F A;  3ML4 A;  4CHJ A;  2J59 M;  1XD4 A;  1H10 A;  3SO6 A;  3WYF B;  2NZ8 B;  1X1G A;  5C5B A;  2MFQ A;  1FOE A;  2J0J A;  2KCJ A;  3WA0 A;  2R09 A;  3BJI A;  4H8S A;  1WVH A;  4GNK B;  1ZM0 A;  5D3V A;  2UZR A;  2KUQ A;  3SYX A;  4BBK A;  4HDQ A;  5JLJ B;  2LOZ A;  4A5K A;  2NMB A;  4EKU A;  2X18 A;  4Z2M B;  4D0N B;  4YL8 A;  4DIX A;  1P6S A;  1Y5O A;  3SNH A;  4K17 A;  2DN6 A;  2Q13 A;  3QIJ A;  1XKE A;  2Z0O A;  3HQC A;  5DHF B;  1K5D B;  2EMS A;  1FHW A;  2RNR B;  2YVC A;  2E2X A;  1U5F A;  4A6K A;  1UEF A;  4A6H A;  2I1K A;  5CLL B;  2ADZ A;  1V5U A;  3FM8 C;  4C0A A;  1EF1 A;  4EJN A;  1Y19 B;  4ZRK A;  4QJ5 B;  1EVH A;  3TVV A;  2G35 A;  3MPX A;  2D2Q A;  1RRP B;  1MPH A;  2COA A;  4P7I A;  2FJU B;  3AU5 A;  4OSN A;  4OT1 A;  2L1C A;  4HSI A;  4IOY X;  2W2X C;  2XQN M;  3N7C A;  2EMT A;  2YF0 A;  2J0K A;  2W2X D;  2K2J A;  3MDB C;  1ZYI A;  2RVB B;  3ZVR A;  3D8E A;  4HAY B;  4F7U P;  4CSQ A;  1XR0 B;  1EAZ A;  2COF A;  4GMX B;  2KUP A;  1KZG A;  5D3X A;  1KI1 B;  2COC A;  2D9W A;  1V61 A;  2V76 A;  2LG1 A;  1V89 A;  4NY0 A;  4EMO A;  2JP2 A;  1XX0 A;  1GG3 A;  4HAW B;  1ZVR A;  1NI2 A;  3IVF A;  2DKP A;  5J3T A;  3M1I B;  3FEH A;  3PVU A;  2KGX B;  2Z59 A;  1SHC A;  1I2H A;  5GOW B;  4L6E A;  1DBH A;  2VRW B;  3NWF A;  2D9Y A;  3KSY A;  3DXE A;  2ROV A;  3A98 B;  3RCP A;  2OTX A;  2H7E A;  4PNK A;  2ELA A;  2P0D A;  2DLW A;  4IAP A;  3NWA A;  2YS5 A;  1MKE A;  1W1H A;  4MY6 A;  3SV1 A;  4TYZ A;  2UVM A;  3P7Z A;  1QC6 A;  1ZC3 B;  3NW8 A;  2DHK A;  2RRF A;  1BTN A;  4GZU A;  2H7D A;  2NBV A;  1U27 A;  1LW3 A;  2CY4 A;  5KQ4 A;  5J3Q A;  1V5M A;  1WGQ A;  3HW2 B;  4QJ3 B;  1X11 A;  3PVW A;  3ODO A;  1MK7 B;  1FGY A;  2VKI A;  5JP4 A;  1FHX A;  5J3Y A;  1FB8 A;  2LUL A;  1DDV A;  4YON A;  3ULC A;  4GPT B;  4HAZ B;  3OHM B;  2MWN B;  3A8P A;  1DYN A;  1UNR A;  1FHO A;  5HE2 A;  5HE1 A;  4DXA B;  2COD A;  2J0M A;  2HE7 A;  1H4R A;  2GS0 A;  1MAI A;  3QWM A;  2LKO A;  2YT2 A;  2N23 A;  2N0Y A;  3CXB B;  3DXC A;  3KY9 A;  1UPR A;  2I5F A;  4WVF B;  2L2I A;  4GOU A;  3VOQ A;  3TW1 A;  3NSU A;  1PLS A;  2BCJ A;  2Z0Q A;  1KZ7 A;  1DDW A;  2YT0 A;  2DHJ A;  2LOX A;  2Z14 A;  1ZC4 B;  3A58 A;  1XCG A;  3GYO A;  1NTY A;  1WJM A;  5IRS A;  3ZDT A;  2QKM A;  4QJ4 B;  1DDM A;  2Z4D A;  4MK0 A;  3ULB A;  3UZT A;  2M38 A;  4D6W A;  3GYP A;  5JHH A;  1U5G A;  5FI0 A;  2PZ1 A;  2M14 A;  2QKL A;  2YSZ A;  5M4Y B;  3NWD A;  1V5P A;  2CRF A;  5DH9 B;  2IYB A;  4DBB A;  2YS1 A;  1AQC A;  1U2B A;  1W1D A;  2DX1 A;  3T06 A;  2GJY A;  2ROZ B;  1Q67 A;  1MIX A;  2LYD A;  4PQ0 A;  4DX8 A;  2D4Q A;  5C16 A;  1TXD A;  4WSF A;  1X86 A;  1WGU A;  2IFS A;  3O96 A;  4HB3 B;  3P6A A;  4GN1 A;  2EJ8 A;  2Y7B A;  3V5W A;  4F7G A;  2Y8G A;  1FAO A;  3LJU X;  1IRS A;  2DHI A;  2I1J A;  1UPQ A;  1Z87 A;  4HB4 B;  4KHB B;  3PSC A;  2GUM A;  1I7A A;  2CAY A;  3CIK A;  2RUK B;  4HB0 B;  4WJ7 A;  2KR0 A;  5KQ1 A;  1BTK A;  1BAK A;  2HTH B;  1UNP A;  3PG7 A;  4KHA A;  3D8F A;  2EC1 A;  1PFJ A;  3TCA A;  2D9X A;  5L81 A;  3KZ1 A;  2YT1 A;  1WG7 A;  3VIA A;  3PEG A;  1U5D A;  2DA0 A;  4Z2N A;  2I5C A;  1NTV A;  2UZS A;  1W1G A;  2YS3 A;  5D3Y A;  4TKN A;  4CHM A;  4A6F B;  2VSZ A;  1U29 A;  3TFM A;  3U12 A;  3OAN A;  3PP2 A;  1ISN A;  1K5G B;  4KAX B;  2K49 A;  5DHA B;  5C79 A;  1GC7 A;  4K81 A;  1PMS A;  4HAU B;  5JHG A;  1WJ1 A;  3F0W A;  4NSW A;  2DKQ A;  3SUZ A;  1NU2 A;  2GCL A;  2K00 A;  4B6H A;  2R2Y A;  5I2M A;  3KRX A;  1RJ2 A;  5I2S A;  1OY2 A;  1AWE A;  1QQG A;  2AL6 A;  3PZD A;  1M7E A;  4ZRI A;  2K8E A;  1UNQ A;  1P5T A;  2RLO A;  1SGH A;  2AEH A;  5C6R A;  4K2P A;  5D27 A;  2D9Z A;  2DFK A;  2MKR A;  5C5B B;  3FSS A;  4CYE A;  2D11 A;  2R0D A;  1MIZ B;  3TO1 A;  4ZRJ A;  2MDX A;  2W2W A;  1BWN A;  5LON B;  2Z13 A;  5D3W A;  4KHO A;  5CLQ B;  1FGZ A;  2OQB A;  1P3R A;  1J0W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...