2CRFA

Solution structure of the ran_bp1 domain of ran-binding protein-3
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
150
structure length
150
Chain Sequence
GSSGSSGTARKCLLEKVEVITGEEAESNVLQMQCKLFVFDKTSQSWVERGRGLLRLNDMASTDDGTLQSRLVMRTQGSLRLILNTKLWAQMQIDKASEKSIHITAMDTEDQGVKVFLISASSKDTGQLYAALHHRILALRSRVESGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords RAN binding protein 3
publication title Solution structure of the Ran_BP1 domain of RAN-binding protein-3
rcsb
source organism Homo sapiens
total genus 17
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2005-05-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00638 Ran_BP1 RanBP1 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2crfA01
3PVWA 2EC1A 1M7EA 1I2HA 1UEFA 4CHMA 5HE1A 3HQCA 1SHCA 1AQCA 2YSZA 1XD4A 1FHWA 2QKMA 3A8QA 3NSUA 1DBHA 4HAWB 1BAKA 2DYNA 1H4RA 2W2XC 1BTKA 3P7ZA 2M14A 5KCVA 4IOYX 1E5WA 3PVLA 1DDVA 3CIKA 2Z0QA 3PEGA 2E2XA 2W2WA 2Y8GA 2COFA 3QBVB 5EFXA 1NU2A 1V61A 5CLLB 1ZC3B 3ODWA 5D27A 1KZ7A 1ZC4B 2PZ1A 1J0WA 4GZUA 4XWXA 1WGQA 1B55A 2R09A 1U5DA 3DXEA 3HK0A 4K2OA 2YS5A 1X86A 2DKQA 1V5UA 3FSSA 2DKPA 1H10A 4KHAA 2D11A 2LKOA 5CLQB 1U2BA 4KVGB 2RUKB 3KRXA 1DDWA 4GXBA 4P7IA 3OANA 2LOZA 2UZRA 2NMBA 2KGXB 2I5CA 4GPTB 3ZDTA 2L2IA 5HE0A 4F7GA 3AU5A 3ML4A 2V76A 2DN6A 2Q13A 3F0WA 2OQBA 4HB2B 2KCJA 3VOQA 1U27A 2CODA 1TXDA 2ELAA 3GYPA 2D9YA 4IFSA 3TW1A 3ULBA 2YF0A 4L6EA 2DLWA 2GJYA 2H7EA 3QWMA 1TJ6A 5DIFB 4EMOA 5JHGA 5DH9B 5JLJB 1EVHA 4NY0A 2D9XA 5FI1A 2CY4A 1DDMA 3KY9A 1X05A 5DHFB 1EGXA 2D9ZA 4HB4B 1V5PA 2NZ8B 2XQNM 1WJ1A 1X11A 3SO6A 3ZVRA 2LULA 1I7AA 2P8VA 5FI0A 2I5FA 4KHBB 2YT1A 4A6FA 1UPRA 5J3QA 2D10A 3D8FA 2IFSA 2DTCA 2JP2A 4ZRKA 1XODA 3LJUX 1MIXA 1P3RA 2DHIA 2COCA 4NSWA 1XX0A 3DXCA 2LG1A 2AL6A 2VKIA 2W2XD 3DXDA 1QC6A 1J19A 1FAOA 2RGNB 1UNRA 1ZVRA 3PP2A 2AEHA 2J0JA 1GC6A 2ROZB 2N23A 5D3VA 4KAXB 4ZRJA 4DXAB 3P6AA 4HAXB 1Z87A 1BWNA 3A98B 1Y5OA 2J0KA 1WG7A 3PVUA 2GCLA 4TYZA 3N7CA 1MK7B 1X1GA 2ROVA 4MY6A 2DFKA 4GMXB 2MFQA 1MPHA 1WGUA 2CAYA 4H8SA 4PQ0A 2N0YA 3O96A 2DX1A 4WJ7A 4BBKA 1QQGA 4F7UP 2VSZA 5GOWB 4IAPA 2RNRB 4Y94A 1SGHA 2QKLA 4MT7A 3AJ4A 1XR0B 5HE2A 2G35A 3PZDA 4B6HA 1V5MA 2I1JA 2K00A 1XKEA 4CYEA 4HAVB 3TFMA 1Q67A 2HE7A 2UZSA 1W1HA 5C5BA 4HAUB 3V5WA 3T06A 5C79A 2COAA 1WVHA 2D2QA 3D8EA 1RRPB 2BCJA 2P0DA 3VIAA 4HATB 5D3XA 1RJ2A 3FEHA 5DHAB 1UPQA 1FHXA 3D8DA 2CRFA 4MK0A 2R0DA 3SYXA 2ADZA 3TCAA 5JP4A 2VRWB 3KZ1A 3WYFB 4ZRIA 1M7RA 3GYOA 5J3TA 5D3WA 2MKRA 2YVCA 2IYBA 5L81A 1OMWA 2EJ8A 2HTHB 2RLOA 4A5KA 2DYQA 3HW2B 3WA0A 2YRYA 2M38A 2CY5A 1U5GA 1MKEA 4KHOA 3BJIA 2I1KA 2KUPA 1GG3A 2K2JA 2GS0A 3MPXA 4GMVA 3TVVA 3KRWA 2YS3A 2D4QA 2MWNB 3RCPA 1UNQA 4PNKA 3QIJA 1V88A 1W1GA 1DYNA 4D0NB 1WI1A 4GN1A 2J0MA 1PFJA 1AWEA 4A6KA 1GC7A 1NTVA 2DHKA 2D9WA 5C6RA 4HHVA 1WJMA 2LOXA 2Y7BA 2ELBA 1EAZA 4DX8A 2J59M 3A8PA 2EMSA 2UVMA 1MAIA 1DROA 1BTNA 2FJLA 1FGYA 3MDBC 2Z0PA 1MK9B 4DX90 5KQ4A 5HE3A 1ZM0A 2Y8FA 2DHJA 1ISNA 1TQZA 2K2UA 4HAYB 4YL8A 1MIZB 1OY2A 3FM8C 1K5DB 2ZPYA 3SV1A 3PG7A 5J3YA 3U8ZA 5C16A 3IVFA 1LW3A 5C5BB 2Z0OA 3G9WA 3SUZA 2P0HA 5DI9B 2P0FA 2GCJA 1KI1B 1U29A 3F5RA 4K2PA 5JHHA 3UZTA 1FHOA 1PLSA 2RSGA 4Z2NA 4CHJA 3ODXA 3M1IB 1OQNA 4Z2MB 4WSFA 1XCGA 3CXBB 5D3YA 4YONA 3SNHA 2X18A 1IRSA 4HDOA 2MDXA 3ODOA 4K17A 2OTXA 1EF1A 1PMSA 1W1DA 4EJNA 4DBBA 4EKUA 1FGZA 3U7DA 4HB3B 4HDQA 3AU4A 1FOEA 3KSYA 4TKNA 1NI2A 2EMTA 2YS1A 5KQ1A 2YT0A 1UNPA 1KZGA 4A6FB 2H7DA 1Y19B 3ULCA 1FB8A 1K5GB 3X23A 1X1FA 4HAZB 4A6HA 1LB1A 1NTYA 2D9VA 2DA0A 4K81A 2DX5A 1U5EA 4WVFB 3BINA 4C0AA 3TO1A 1P5TA 2L1CA 5LONB 3PSCA 4HB0B 1V89A 4F7HA 1ZSQA 1U5FA 2LYDA 1P6SA 5LOPB 1N3HA 2RVBB
chains in the Genus database with same CATH superfamily
3PVWA 2EC1A 1M7EA 1I2HA 1UEFA 4CHMA 5HE1A 3HQCA 1SHCA 1AQCA 2YSZA 1XD4A 1FHWA 2QKMA 3A8QA 3NSUA 1DBHA 4HAWB 1BAKA 2DYNA 1H4RA 2W2XC 1BTKA 3NWFA 3P7ZA 2M14A 2Z14A 5KCVA 4IOYX 1E5WA 3NW8A 4GOUA 3PVLA 1DDVA 3CIKA 2Z0QA 3PEGA 2E2XA 2W2WA 3U12A 2Y8GA 2COFA 3QBVB 5EFXA 1NU2A 2RRFA 1V61A 5CLLB 1ZC3B 3ODWA 5D27A 1KZ7A 1ZC4B 2PZ1A 1J0WA 4GZUA 4XWXA 1WGQA 1ZYIA 1B55A 2R09A 1U5DA 3DXEA 3HK0A 4K2OA 2YS5A 1X86A 2DKQA 1V5UA 3FSSA 2DKPA 1H10A 4KHAA 2D11A 2LKOA 5CLQB 1U2BA 4KVGB 2RUKB 3KRXA 4HSIA 1DDWA 4GXBA 4P7IA 3OANA 4GNKB 2LOZA 2K49A 4OSNA 2UZRA 2NMBA 2KGXB 2I5CA 4GPTB 3ZDTA 2L2IA 5HE0A 4F7GA 3AU5A 3FVCA 3ML4A 2V76A 2Z4DA 2DN6A 4CSQA 4D6WA 2Q13A 3F0WA 2OQBA 4HB2B 2Z13A 2KCJA 2GUMA 3VOQA 1U27A 2CODA 1TXDA 2ELAA 3GYPA 2D9YA 4IFSA 3TW1A 3ULBA 2YF0A 3DCXA 4L6EA 1MI1A 2DLWA 5I2MA 2GJYA 2H7EA 3QWMA 1TJ6A 5DIFB 4EMOA 5JHGA 5DH9B 2KUQA 5JLJB 1EVHA 4L1RA 4NY0A 2D9XA 5FI1A 2CY4A 2K8EA 1DDMA 3KY9A 1X05A 5DHFB 1EGXA 2D9ZA 4HB4B 4QJ3B 1V5PA 2NZ8B 2XQNM 1WJ1A 1X11A 3SO6A 3ZVRA 2LULA 1I7AA 2P8VA 5FI0A 2I5FA 4KHBB 2YT1A 4A6FA 1UPRA 5J3QA 2D10A 3D8FA 2IFSA 2DTCA 2JP2A 4ZRKA 1XODA 3LJUX 1MIXA 1P3RA 2DHIA 2COCA 4NSWA 1XX0A 3DXCA 2LG1A 2AL6A 2VKIA 2W2XD 3DXDA 1QC6A 1J19A 1FAOA 2RGNB 1UNRA 1ZVRA 3PP2A 2AEHA 2J0JA 1GC6A 2ROZB 2N23A 5D3VA 3A58A 4KAXB 4ZRJA 4DXAB 3P6AA 4HAXB 1Z87A 1BWNA 3A98B 1Y5OA 3NWAA 5M4YB 2J0KA 1WG7A 2Z59A 3PVUA 2GCLA 4TYZA 3N7CA 1MK7B 1X1GA 2KIGA 2ROVA 4MY6A 2DFKA 4GMXB 2MFQA 1MPHA 1WGUA 2CAYA 4H8SA 4PQ0A 2N0YA 3O96A 2DX1A 4WJ7A 4BBKA 1QQGA 4F7UP 2VSZA 5GOWB 4IAPA 2RNRB 4Y94A 1SGHA 2KR0A 2QKLA 4MT7A 3AJ4A 1XR0B 5HE2A 2G35A 3PZDA 4B6HA 1T77A 1V5MA 2I1JA 2K00A 1XKEA 4CYEA 4HAVB 4OT1A 3TFMA 1Q67A 2HE7A 2UZSA 1W1HA 5C5BA 4HAUB 3NWDA 3V5WA 2KIEA 3T06A 5C79A 2COAA 1WVHA 2D2QA 3D8EA 1RRPB 2BCJA 2P0DA 3VIAA 4HATB 5D3XA 1RJ2A 3FEHA 5DHAB 1UPQA 1FHXA 3D8DA 2CRFA 4MK0A 2R0DA 3SYXA 2NBVA 2ADZA 3TCAA 5JP4A 2VRWB 3KZ1A 3WYFB 4ZRIA 1M7RA 3OHMB 3GYOA 5J3TA 5D3WA 2MKRA 2YVCA 2IYBA 5L81A 1OMWA 2EJ8A 2HTHB 2RLOA 4A5KA 2DYQA 3HW2B 2R2YA 3WA0A 2YRYA 2M38A 2CY5A 1U5GA 1MKEA 4KHOA 3BJIA 2I1KA 2KUPA 1GG3A 2K2JA 2GS0A 3MPXA 4GMVA 3TVVA 3KRWA 2YS3A 2D4QA 2MWNB 4DIXA 3RCPA 1UNQA 4PNKA 3QIJA 1V88A 1W1GA 1DYNA 4D0NB 1WI1A 4GN1A 2J0MA 1PFJA 1AWEA 4A6KA 1GC7A 1NTVA 2DHKA 2D9WA 5C6RA 4QJ5B 4HHVA 5LG4B 1WJMA 2LOXA 2Y7BA 2ELBA 4KHBA 1EAZA 4DX8A 2J59M 3A8PA 2EMSA 2UVMA 1MAIA 1DROA 1BTNA 2FJLA 1FGYA 3MDBC 2Z0PA 1MK9B 4DX90 5KQ4A 2YT2A 5HE3A 1ZM0A 2Y8FA 2DHJA 1ISNA 1TQZA 2K2UA 4HAYB 4YL8A 1MIZB 1OY2A 3FM8C 1K5DB 2ZPYA 3SV1A 3PG7A 5J3YA 3U8ZA 5C16A 3IVFA 1LW3A 5C5BB 2Z0OA 4QXAB 3G9WA 3SUZA 2P0HA 5DI9B 2P0FA 2GCJA 1KI1B 1U29A 3F5RA 5I2SA 4K2PA 5JHHA 3UZTA 1FHOA 1PLSA 3B77A 2RSGA 4Z2NA 4CHJA 3ODXA 3M1IB 1OQNA 4Z2MB 3HIEA 4WSFA 1XCGA 2ZKMX 3CXBB 5D3YA 4YONA 3SNHA 2X18A 1IRSA 4HDOA 2MDXA 3ODOA 5IRSA 4K17A 2OTXA 1EF1A 1PMSA 1W1DA 4EJNA 4DBBA 4EKUA 1FGZA 2FJUB 3U7DA 4HB3B 4QJ4B 4HDQA 3AU4A 1FOEA 3KSYA 4TKNA 1NI2A 2EMTA 2YS1A 5KQ1A 2YT0A 1UNPA 1KZGA 4A6FB 2H7DA 1Y19B 3ULCA 1FB8A 1K5GB 3X23A 1X1FA 4HAZB 4A6HA 1LB1A 1NTYA 2D9VA 2DA0A 4K81A 2DX5A 1U5EA 4WVFB 3BINA 4C0AA 3TO1A 1P5TA 2L1CA 5LONB 3PSCA 4HB0B 3HSAA 1V89A 4F7HA 1ZSQA 1U5FA 2LYDA 1P6SA 5LOPB 1N3HA 2RVBB
chains in the Genus database with same CATH topology
3PVWA 2EC1A 1M7EA 1I2HA 1UEFA 4CHMA 5HE1A 3HQCA 1SHCA 1AQCA 2YSZA 1XD4A 1FHWA 2QKMA 3A8QA 3NSUA 1DBHA 4HAWB 1BAKA 2DYNA 1H4RA 2W2XC 1BTKA 3P7ZA 2M14A 5KCVA 4IOYX 1E5WA 3PVLA 1DDVA 3CIKA 2Z0QA 3PEGA 2E2XA 2W2WA 2Y8GA 2COFA 3QBVB 5EFXA 1NU2A 1V61A 5CLLB 1ZC3B 3ODWA 5D27A 1KZ7A 1ZC4B 2PZ1A 1J0WA 4GZUA 4XWXA 1WGQA 1B55A 2R09A 1U5DA 3DXEA 3HK0A 4K2OA 2YS5A 1X86A 2DKQA 1V5UA 3FSSA 2DKPA 1H10A 4KHAA 2D11A 2LKOA 5CLQB 1U2BA 4KVGB 2RUKB 3KRXA 1DDWA 4GXBA 4P7IA 3OANA 2LOZA 2UZRA 2NMBA 2KGXB 2I5CA 4GPTB 3ZDTA 2L2IA 5HE0A 4F7GA 3AU5A 3ML4A 2V76A 2DN6A 2Q13A 3F0WA 2OQBA 4HB2B 2KCJA 3VOQA 1U27A 2CODA 1TXDA 2ELAA 3GYPA 2D9YA 4IFSA 3TW1A 3ULBA 2YF0A 4L6EA 2DLWA 2GJYA 2H7EA 3QWMA 1TJ6A 5DIFB 4EMOA 5JHGA 5DH9B 5JLJB 1EVHA 4NY0A 2D9XA 5FI1A 2CY4A 1DDMA 3KY9A 1X05A 5DHFB 1EGXA 2D9ZA 4HB4B 1V5PA 2NZ8B 2XQNM 1WJ1A 1X11A 3SO6A 3ZVRA 2LULA 1I7AA 2P8VA 5FI0A 2I5FA 4KHBB 2YT1A 4A6FA 1UPRA 5J3QA 2D10A 3D8FA 2IFSA 2DTCA 2JP2A 4ZRKA 1XODA 3LJUX 1MIXA 1P3RA 2DHIA 2COCA 4NSWA 1XX0A 3DXCA 2LG1A 2AL6A 2VKIA 2W2XD 3DXDA 1QC6A 1J19A 1FAOA 2RGNB 1UNRA 1ZVRA 3PP2A 2AEHA 2J0JA 1GC6A 2ROZB 2N23A 5D3VA 4KAXB 4ZRJA 4DXAB 3P6AA 4HAXB 1Z87A 1BWNA 3A98B 1Y5OA 2J0KA 1WG7A 3PVUA 2GCLA 4TYZA 3N7CA 1MK7B 1X1GA 2ROVA 4MY6A 2DFKA 4GMXB 2MFQA 1MPHA 1WGUA 2CAYA 4H8SA 4PQ0A 2N0YA 3O96A 2DX1A 4WJ7A 4BBKA 1QQGA 4F7UP 2VSZA 5GOWB 4IAPA 2RNRB 4Y94A 1SGHA 2QKLA 4MT7A 3AJ4A 1XR0B 5HE2A 2G35A 3PZDA 4B6HA 1V5MA 2I1JA 2K00A 1XKEA 4CYEA 4HAVB 3TFMA 1Q67A 2HE7A 2UZSA 1W1HA 5C5BA 4HAUB 3V5WA 3T06A 5C79A 2COAA 1WVHA 2D2QA 3D8EA 1RRPB 2BCJA 2P0DA 3VIAA 4HATB 5D3XA 1RJ2A 3FEHA 5DHAB 1UPQA 1FHXA 3D8DA 2CRFA 4MK0A 2R0DA 3SYXA 2ADZA 3TCAA 5JP4A 2VRWB 3KZ1A 3WYFB 4ZRIA 1M7RA 3GYOA 5J3TA 5D3WA 2MKRA 2YVCA 2IYBA 5L81A 1OMWA 2EJ8A 2HTHB 2RLOA 4A5KA 2DYQA 3HW2B 3WA0A 2YRYA 2M38A 2CY5A 1U5GA 1MKEA 4KHOA 3BJIA 2I1KA 2KUPA 1GG3A 2K2JA 2GS0A 3MPXA 4GMVA 3TVVA 3KRWA 2YS3A 2D4QA 2MWNB 3RCPA 1UNQA 4PNKA 3QIJA 1V88A 1W1GA 1DYNA 4D0NB 1WI1A 4GN1A 2J0MA 1PFJA 1AWEA 4A6KA 1GC7A 1NTVA 2DHKA 2D9WA 5C6RA 4HHVA 1WJMA 2LOXA 2Y7BA 2ELBA 1EAZA 4DX8A 2J59M 3A8PA 2EMSA 2UVMA 1MAIA 1DROA 1BTNA 2FJLA 1FGYA 3MDBC 2Z0PA 1MK9B 4DX90 5KQ4A 5HE3A 1ZM0A 2Y8FA 2DHJA 1ISNA 1TQZA 2K2UA 4HAYB 4YL8A 1MIZB 1OY2A 3FM8C 1K5DB 2ZPYA 3SV1A 3PG7A 5J3YA 3U8ZA 5C16A 3IVFA 1LW3A 5C5BB 2Z0OA 3G9WA 3SUZA 2P0HA 5DI9B 2P0FA 2GCJA 1KI1B 1U29A 3F5RA 4K2PA 5JHHA 3UZTA 1FHOA 1PLSA 2RSGA 4Z2NA 4CHJA 3ODXA 3M1IB 1OQNA 4Z2MB 4WSFA 1XCGA 3CXBB 5D3YA 4YONA 3SNHA 2X18A 1IRSA 4HDOA 2MDXA 3ODOA 4K17A 2OTXA 1EF1A 1PMSA 1W1DA 4EJNA 4DBBA 4EKUA 1FGZA 3U7DA 4HB3B 4HDQA 3AU4A 1FOEA 3KSYA 4TKNA 1NI2A 2EMTA 2YS1A 5KQ1A 2YT0A 1UNPA 1KZGA 4A6FB 2H7DA 1Y19B 3ULCA 1FB8A 1K5GB 3X23A 1X1FA 4HAZB 4A6HA 1LB1A 1NTYA 2D9VA 2DA0A 4K81A 2DX5A 1U5EA 4WVFB 3BINA 4C0AA 3TO1A 1P5TA 2L1CA 5LONB 3PSCA 4HB0B 1V89A 4F7HA 1ZSQA 1U5FA 2LYDA 1P6SA 5LOPB 1N3HA 2RVBB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PVW A;  2EC1 A;  1M7E A;  1I2H A;  1UEF A;  4CHM A;  5HE1 A;  3HQC A;  1SHC A;  1AQC A;  2YSZ A;  1XD4 A;  1FHW A;  2QKM A;  3A8Q A;  3NSU A;  1DBH A;  4HAW B;  1BAK A;  2DYN A;  1H4R A;  2W2X C;  1BTK A;  3P7Z A;  2M14 A;  5KCV A;  4IOY X;  1E5W A;  3PVL A;  1DDV A;  3CIK A;  2Z0Q A;  3PEG A;  2E2X A;  2W2W A;  2Y8G A;  2COF A;  3QBV B;  5EFX A;  1NU2 A;  1V61 A;  5CLL B;  1ZC3 B;  3ODW A;  5D27 A;  1KZ7 A;  1ZC4 B;  2PZ1 A;  1J0W A;  4GZU A;  4XWX A;  1WGQ A;  1B55 A;  2R09 A;  1U5D A;  3DXE A;  3HK0 A;  4K2O A;  2YS5 A;  1X86 A;  2DKQ A;  1V5U A;  3FSS A;  2DKP A;  1H10 A;  4KHA A;  2D11 A;  2LKO A;  5CLQ B;  1U2B A;  4KVG B;  2RUK B;  3KRX A;  1DDW A;  4GXB A;  4P7I A;  3OAN A;  2LOZ A;  2UZR A;  2NMB A;  2KGX B;  2I5C A;  4GPT B;  3ZDT A;  2L2I A;  5HE0 A;  4F7G A;  3AU5 A;  3ML4 A;  2V76 A;  2DN6 A;  2Q13 A;  3F0W A;  2OQB A;  4HB2 B;  2KCJ A;  3VOQ A;  1U27 A;  2COD A;  1TXD A;  2ELA A;  3GYP A;  2D9Y A;  4IFS A;  3TW1 A;  3ULB A;  2YF0 A;  4L6E A;  2DLW A;  2GJY A;  2H7E A;  3QWM A;  1TJ6 A;  5DIF B;  4EMO A;  5JHG A;  5DH9 B;  5JLJ B;  1EVH A;  4NY0 A;  2D9X A;  5FI1 A;  2CY4 A;  1DDM A;  3KY9 A;  1X05 A;  5DHF B;  1EGX A;  2D9Z A;  4HB4 B;  1V5P A;  2NZ8 B;  2XQN M;  1WJ1 A;  1X11 A;  3SO6 A;  3ZVR A;  2LUL A;  1I7A A;  2P8V A;  5FI0 A;  2I5F A;  4KHB B;  2YT1 A;  4A6F A;  1UPR A;  5J3Q A;  2D10 A;  3D8F A;  2IFS A;  2DTC A;  2JP2 A;  4ZRK A;  1XOD A;  3LJU X;  1MIX A;  1P3R A;  2DHI A;  2COC A;  4NSW A;  1XX0 A;  3DXC A;  2LG1 A;  2AL6 A;  2VKI A;  2W2X D;  3DXD A;  1QC6 A;  1J19 A;  1FAO A;  2RGN B;  1UNR A;  1ZVR A;  3PP2 A;  2AEH A;  2J0J A;  1GC6 A;  2ROZ B;  2N23 A;  5D3V A;  4KAX B;  4ZRJ A;  4DXA B;  3P6A A;  4HAX B;  1Z87 A;  1BWN A;  3A98 B;  1Y5O A;  2J0K A;  1WG7 A;  3PVU A;  2GCL A;  4TYZ A;  3N7C A;  1MK7 B;  1X1G A;  2ROV A;  4MY6 A;  2DFK A;  4GMX B;  2MFQ A;  1MPH A;  1WGU A;  2CAY A;  4H8S A;  4PQ0 A;  2N0Y A;  3O96 A;  2DX1 A;  4WJ7 A;  4BBK A;  1QQG A;  4F7U P;  2VSZ A;  5GOW B;  4IAP A;  2RNR B;  4Y94 A;  1SGH A;  2QKL A;  4MT7 A;  3AJ4 A;  1XR0 B;  5HE2 A;  2G35 A;  3PZD A;  4B6H A;  1V5M A;  2I1J A;  2K00 A;  1XKE A;  4CYE A;  4HAV B;  3TFM A;  1Q67 A;  2HE7 A;  2UZS A;  1W1H A;  5C5B A;  4HAU B;  3V5W A;  3T06 A;  5C79 A;  2COA A;  1WVH A;  2D2Q A;  3D8E A;  1RRP B;  2BCJ A;  2P0D A;  3VIA A;  4HAT B;  5D3X A;  1RJ2 A;  3FEH A;  5DHA B;  1UPQ A;  1FHX A;  3D8D A;  2CRF A;  4MK0 A;  2R0D A;  3SYX A;  2ADZ A;  3TCA A;  5JP4 A;  2VRW B;  3KZ1 A;  3WYF B;  4ZRI A;  1M7R A;  3GYO A;  5J3T A;  5D3W A;  2MKR A;  2YVC A;  2IYB A;  5L81 A;  1OMW A;  2EJ8 A;  2HTH B;  2RLO A;  4A5K A;  2DYQ A;  3HW2 B;  3WA0 A;  2YRY A;  2M38 A;  2CY5 A;  1U5G A;  1MKE A;  4KHO A;  3BJI A;  2I1K A;  2KUP A;  1GG3 A;  2K2J A;  2GS0 A;  3MPX A;  4GMV A;  3TVV A;  3KRW A;  2YS3 A;  2D4Q A;  2MWN B;  3RCP A;  1UNQ A;  4PNK A;  3QIJ A;  1V88 A;  1W1G A;  1DYN A;  4D0N B;  1WI1 A;  4GN1 A;  2J0M A;  1PFJ A;  1AWE A;  4A6K A;  1GC7 A;  1NTV A;  2DHK A;  2D9W A;  5C6R A;  4HHV A;  1WJM A;  2LOX A;  2Y7B A;  2ELB A;  1EAZ A;  4DX8 A;  2J59 M;  3A8P A;  2EMS A;  2UVM A;  1MAI A;  1DRO A;  1BTN A;  2FJL A;  1FGY A;  3MDB C;  2Z0P A;  1MK9 B;  4DX9 0;  5KQ4 A;  5HE3 A;  1ZM0 A;  2Y8F A;  2DHJ A;  1ISN A;  1TQZ A;  2K2U A;  4HAY B;  4YL8 A;  1MIZ B;  1OY2 A;  3FM8 C;  1K5D B;  2ZPY A;  3SV1 A;  3PG7 A;  5J3Y A;  3U8Z A;  5C16 A;  3IVF A;  1LW3 A;  5C5B B;  2Z0O A;  3G9W A;  3SUZ A;  2P0H A;  5DI9 B;  2P0F A;  2GCJ A;  1KI1 B;  1U29 A;  3F5R A;  4K2P A;  5JHH A;  3UZT A;  1FHO A;  1PLS A;  2RSG A;  4Z2N A;  4CHJ A;  3ODX A;  3M1I B;  1OQN A;  4Z2M B;  4WSF A;  1XCG A;  3CXB B;  5D3Y A;  4YON A;  3SNH A;  2X18 A;  1IRS A;  4HDO A;  2MDX A;  3ODO A;  4K17 A;  2OTX A;  1EF1 A;  1PMS A;  1W1D A;  4EJN A;  4DBB A;  4EKU A;  1FGZ A;  3U7D A;  4HB3 B;  4HDQ A;  3AU4 A;  1FOE A;  3KSY A;  4TKN A;  1NI2 A;  2EMT A;  2YS1 A;  5KQ1 A;  2YT0 A;  1UNP A;  1KZG A;  4A6F B;  2H7D A;  1Y19 B;  3ULC A;  1FB8 A;  1K5G B;  3X23 A;  1X1F A;  4HAZ B;  4A6H A;  1LB1 A;  1NTY A;  2D9V A;  2DA0 A;  4K81 A;  2DX5 A;  1U5E A;  4WVF B;  3BIN A;  4C0A A;  3TO1 A;  1P5T A;  2L1C A;  5LON B;  3PSC A;  4HB0 B;  1V89 A;  4F7H A;  1ZSQ A;  1U5F A;  2LYD A;  1P6S A;  5LOP B;  1N3H A;  2RVB B; 
#chains in the Genus database with same CATH topology
 3PVW A;  2EC1 A;  1M7E A;  1I2H A;  1UEF A;  4CHM A;  5HE1 A;  3HQC A;  1SHC A;  1AQC A;  2YSZ A;  1XD4 A;  1FHW A;  2QKM A;  3A8Q A;  3NSU A;  1DBH A;  4HAW B;  1BAK A;  2DYN A;  1H4R A;  2W2X C;  1BTK A;  3NWF A;  3P7Z A;  2M14 A;  2Z14 A;  5KCV A;  4IOY X;  1E5W A;  3NW8 A;  4GOU A;  3PVL A;  1DDV A;  3CIK A;  2Z0Q A;  3PEG A;  2E2X A;  2W2W A;  3U12 A;  2Y8G A;  2COF A;  3QBV B;  5EFX A;  1NU2 A;  2RRF A;  1V61 A;  5CLL B;  1ZC3 B;  3ODW A;  5D27 A;  1KZ7 A;  1ZC4 B;  2PZ1 A;  1J0W A;  4GZU A;  4XWX A;  1WGQ A;  1ZYI A;  1B55 A;  2R09 A;  1U5D A;  3DXE A;  3HK0 A;  4K2O A;  2YS5 A;  1X86 A;  2DKQ A;  1V5U A;  3FSS A;  2DKP A;  1H10 A;  4KHA A;  2D11 A;  2LKO A;  5CLQ B;  1U2B A;  4KVG B;  2RUK B;  3KRX A;  4HSI A;  1DDW A;  4GXB A;  4P7I A;  3OAN A;  4GNK B;  2LOZ A;  2K49 A;  4OSN A;  2UZR A;  2NMB A;  2KGX B;  2I5C A;  4GPT B;  3ZDT A;  2L2I A;  5HE0 A;  4F7G A;  3AU5 A;  3FVC A;  3ML4 A;  2V76 A;  2Z4D A;  2DN6 A;  4CSQ A;  4D6W A;  2Q13 A;  3F0W A;  2OQB A;  4HB2 B;  2Z13 A;  2KCJ A;  2GUM A;  3VOQ A;  1U27 A;  2COD A;  1TXD A;  2ELA A;  3GYP A;  2D9Y A;  4IFS A;  3TW1 A;  3ULB A;  2YF0 A;  3DCX A;  4L6E A;  1MI1 A;  2DLW A;  5I2M A;  2GJY A;  2H7E A;  3QWM A;  1TJ6 A;  5DIF B;  4EMO A;  5JHG A;  5DH9 B;  2KUQ A;  5JLJ B;  1EVH A;  4L1R A;  4NY0 A;  2D9X A;  5FI1 A;  2CY4 A;  2K8E A;  1DDM A;  3KY9 A;  1X05 A;  5DHF B;  1EGX A;  2D9Z A;  4HB4 B;  4QJ3 B;  1V5P A;  2NZ8 B;  2XQN M;  1WJ1 A;  1X11 A;  3SO6 A;  3ZVR A;  2LUL A;  1I7A A;  2P8V A;  5FI0 A;  2I5F A;  4KHB B;  2YT1 A;  4A6F A;  1UPR A;  5J3Q A;  2D10 A;  3D8F A;  2IFS A;  2DTC A;  2JP2 A;  4ZRK A;  1XOD A;  3LJU X;  1MIX A;  1P3R A;  2DHI A;  2COC A;  4NSW A;  1XX0 A;  3DXC A;  2LG1 A;  2AL6 A;  2VKI A;  2W2X D;  3DXD A;  1QC6 A;  1J19 A;  1FAO A;  2RGN B;  1UNR A;  1ZVR A;  3PP2 A;  2AEH A;  2J0J A;  1GC6 A;  2ROZ B;  2N23 A;  5D3V A;  3A58 A;  4KAX B;  4ZRJ A;  4DXA B;  3P6A A;  4HAX B;  1Z87 A;  1BWN A;  3A98 B;  1Y5O A;  3NWA A;  5M4Y B;  2J0K A;  1WG7 A;  2Z59 A;  3PVU A;  2GCL A;  4TYZ A;  3N7C A;  1MK7 B;  1X1G A;  2KIG A;  2ROV A;  4MY6 A;  2DFK A;  4GMX B;  2MFQ A;  1MPH A;  1WGU A;  2CAY A;  4H8S A;  4PQ0 A;  2N0Y A;  3O96 A;  2DX1 A;  4WJ7 A;  4BBK A;  1QQG A;  4F7U P;  2VSZ A;  5GOW B;  4IAP A;  2RNR B;  4Y94 A;  1SGH A;  2KR0 A;  2QKL A;  4MT7 A;  3AJ4 A;  1XR0 B;  5HE2 A;  2G35 A;  3PZD A;  4B6H A;  1T77 A;  1V5M A;  2I1J A;  2K00 A;  1XKE A;  4CYE A;  4HAV B;  4OT1 A;  3TFM A;  1Q67 A;  2HE7 A;  2UZS A;  1W1H A;  5C5B A;  4HAU B;  3NWD A;  3V5W A;  2KIE A;  3T06 A;  5C79 A;  2COA A;  1WVH A;  2D2Q A;  3D8E A;  1RRP B;  2BCJ A;  2P0D A;  3VIA A;  4HAT B;  5D3X A;  1RJ2 A;  3FEH A;  5DHA B;  1UPQ A;  1FHX A;  3D8D A;  2CRF A;  4MK0 A;  2R0D A;  3SYX A;  2NBV A;  2ADZ A;  3TCA A;  5JP4 A;  2VRW B;  3KZ1 A;  3WYF B;  4ZRI A;  1M7R A;  3OHM B;  3GYO A;  5J3T A;  5D3W A;  2MKR A;  2YVC A;  2IYB A;  5L81 A;  1OMW A;  2EJ8 A;  2HTH B;  2RLO A;  4A5K A;  2DYQ A;  3HW2 B;  2R2Y A;  3WA0 A;  2YRY A;  2M38 A;  2CY5 A;  1U5G A;  1MKE A;  4KHO A;  3BJI A;  2I1K A;  2KUP A;  1GG3 A;  2K2J A;  2GS0 A;  3MPX A;  4GMV A;  3TVV A;  3KRW A;  2YS3 A;  2D4Q A;  2MWN B;  4DIX A;  3RCP A;  1UNQ A;  4PNK A;  3QIJ A;  1V88 A;  1W1G A;  1DYN A;  4D0N B;  1WI1 A;  4GN1 A;  2J0M A;  1PFJ A;  1AWE A;  4A6K A;  1GC7 A;  1NTV A;  2DHK A;  2D9W A;  5C6R A;  4QJ5 B;  4HHV A;  5LG4 B;  1WJM A;  2LOX A;  2Y7B A;  2ELB A;  4KHB A;  1EAZ A;  4DX8 A;  2J59 M;  3A8P A;  2EMS A;  2UVM A;  1MAI A;  1DRO A;  1BTN A;  2FJL A;  1FGY A;  3MDB C;  2Z0P A;  1MK9 B;  4DX9 0;  5KQ4 A;  2YT2 A;  5HE3 A;  1ZM0 A;  2Y8F A;  2DHJ A;  1ISN A;  1TQZ A;  2K2U A;  4HAY B;  4YL8 A;  1MIZ B;  1OY2 A;  3FM8 C;  1K5D B;  2ZPY A;  3SV1 A;  3PG7 A;  5J3Y A;  3U8Z A;  5C16 A;  3IVF A;  1LW3 A;  5C5B B;  2Z0O A;  4QXA B;  3G9W A;  3SUZ A;  2P0H A;  5DI9 B;  2P0F A;  2GCJ A;  1KI1 B;  1U29 A;  3F5R A;  5I2S A;  4K2P A;  5JHH A;  3UZT A;  1FHO A;  1PLS A;  3B77 A;  2RSG A;  4Z2N A;  4CHJ A;  3ODX A;  3M1I B;  1OQN A;  4Z2M B;  3HIE A;  4WSF A;  1XCG A;  2ZKM X;  3CXB B;  5D3Y A;  4YON A;  3SNH A;  2X18 A;  1IRS A;  4HDO A;  2MDX A;  3ODO A;  5IRS A;  4K17 A;  2OTX A;  1EF1 A;  1PMS A;  1W1D A;  4EJN A;  4DBB A;  4EKU A;  1FGZ A;  2FJU B;  3U7D A;  4HB3 B;  4QJ4 B;  4HDQ A;  3AU4 A;  1FOE A;  3KSY A;  4TKN A;  1NI2 A;  2EMT A;  2YS1 A;  5KQ1 A;  2YT0 A;  1UNP A;  1KZG A;  4A6F B;  2H7D A;  1Y19 B;  3ULC A;  1FB8 A;  1K5G B;  3X23 A;  1X1F A;  4HAZ B;  4A6H A;  1LB1 A;  1NTY A;  2D9V A;  2DA0 A;  4K81 A;  2DX5 A;  1U5E A;  4WVF B;  3BIN A;  4C0A A;  3TO1 A;  1P5T A;  2L1C A;  5LON B;  3PSC A;  4HB0 B;  3HSA A;  1V89 A;  4F7H A;  1ZSQ A;  1U5F A;  2LYD A;  1P6S A;  5LOP B;  1N3H A;  2RVB B; 
#chains in the Genus database with same CATH homology
 3PVW A;  2EC1 A;  1M7E A;  1I2H A;  1UEF A;  4CHM A;  5HE1 A;  3HQC A;  1SHC A;  1AQC A;  2YSZ A;  1XD4 A;  1FHW A;  2QKM A;  3A8Q A;  3NSU A;  1DBH A;  4HAW B;  1BAK A;  2DYN A;  1H4R A;  2W2X C;  1BTK A;  3P7Z A;  2M14 A;  5KCV A;  4IOY X;  1E5W A;  3PVL A;  1DDV A;  3CIK A;  2Z0Q A;  3PEG A;  2E2X A;  2W2W A;  2Y8G A;  2COF A;  3QBV B;  5EFX A;  1NU2 A;  1V61 A;  5CLL B;  1ZC3 B;  3ODW A;  5D27 A;  1KZ7 A;  1ZC4 B;  2PZ1 A;  1J0W A;  4GZU A;  4XWX A;  1WGQ A;  1B55 A;  2R09 A;  1U5D A;  3DXE A;  3HK0 A;  4K2O A;  2YS5 A;  1X86 A;  2DKQ A;  1V5U A;  3FSS A;  2DKP A;  1H10 A;  4KHA A;  2D11 A;  2LKO A;  5CLQ B;  1U2B A;  4KVG B;  2RUK B;  3KRX A;  1DDW A;  4GXB A;  4P7I A;  3OAN A;  2LOZ A;  2UZR A;  2NMB A;  2KGX B;  2I5C A;  4GPT B;  3ZDT A;  2L2I A;  5HE0 A;  4F7G A;  3AU5 A;  3ML4 A;  2V76 A;  2DN6 A;  2Q13 A;  3F0W A;  2OQB A;  4HB2 B;  2KCJ A;  3VOQ A;  1U27 A;  2COD A;  1TXD A;  2ELA A;  3GYP A;  2D9Y A;  4IFS A;  3TW1 A;  3ULB A;  2YF0 A;  4L6E A;  2DLW A;  2GJY A;  2H7E A;  3QWM A;  1TJ6 A;  5DIF B;  4EMO A;  5JHG A;  5DH9 B;  5JLJ B;  1EVH A;  4NY0 A;  2D9X A;  5FI1 A;  2CY4 A;  1DDM A;  3KY9 A;  1X05 A;  5DHF B;  1EGX A;  2D9Z A;  4HB4 B;  1V5P A;  2NZ8 B;  2XQN M;  1WJ1 A;  1X11 A;  3SO6 A;  3ZVR A;  2LUL A;  1I7A A;  2P8V A;  5FI0 A;  2I5F A;  4KHB B;  2YT1 A;  4A6F A;  1UPR A;  5J3Q A;  2D10 A;  3D8F A;  2IFS A;  2DTC A;  2JP2 A;  4ZRK A;  1XOD A;  3LJU X;  1MIX A;  1P3R A;  2DHI A;  2COC A;  4NSW A;  1XX0 A;  3DXC A;  2LG1 A;  2AL6 A;  2VKI A;  2W2X D;  3DXD A;  1QC6 A;  1J19 A;  1FAO A;  2RGN B;  1UNR A;  1ZVR A;  3PP2 A;  2AEH A;  2J0J A;  1GC6 A;  2ROZ B;  2N23 A;  5D3V A;  4KAX B;  4ZRJ A;  4DXA B;  3P6A A;  4HAX B;  1Z87 A;  1BWN A;  3A98 B;  1Y5O A;  2J0K A;  1WG7 A;  3PVU A;  2GCL A;  4TYZ A;  3N7C A;  1MK7 B;  1X1G A;  2ROV A;  4MY6 A;  2DFK A;  4GMX B;  2MFQ A;  1MPH A;  1WGU A;  2CAY A;  4H8S A;  4PQ0 A;  2N0Y A;  3O96 A;  2DX1 A;  4WJ7 A;  4BBK A;  1QQG A;  4F7U P;  2VSZ A;  5GOW B;  4IAP A;  2RNR B;  4Y94 A;  1SGH A;  2QKL A;  4MT7 A;  3AJ4 A;  1XR0 B;  5HE2 A;  2G35 A;  3PZD A;  4B6H A;  1V5M A;  2I1J A;  2K00 A;  1XKE A;  4CYE A;  4HAV B;  3TFM A;  1Q67 A;  2HE7 A;  2UZS A;  1W1H A;  5C5B A;  4HAU B;  3V5W A;  3T06 A;  5C79 A;  2COA A;  1WVH A;  2D2Q A;  3D8E A;  1RRP B;  2BCJ A;  2P0D A;  3VIA A;  4HAT B;  5D3X A;  1RJ2 A;  3FEH A;  5DHA B;  1UPQ A;  1FHX A;  3D8D A;  2CRF A;  4MK0 A;  2R0D A;  3SYX A;  2ADZ A;  3TCA A;  5JP4 A;  2VRW B;  3KZ1 A;  3WYF B;  4ZRI A;  1M7R A;  3GYO A;  5J3T A;  5D3W A;  2MKR A;  2YVC A;  2IYB A;  5L81 A;  1OMW A;  2EJ8 A;  2HTH B;  2RLO A;  4A5K A;  2DYQ A;  3HW2 B;  3WA0 A;  2YRY A;  2M38 A;  2CY5 A;  1U5G A;  1MKE A;  4KHO A;  3BJI A;  2I1K A;  2KUP A;  1GG3 A;  2K2J A;  2GS0 A;  3MPX A;  4GMV A;  3TVV A;  3KRW A;  2YS3 A;  2D4Q A;  2MWN B;  3RCP A;  1UNQ A;  4PNK A;  3QIJ A;  1V88 A;  1W1G A;  1DYN A;  4D0N B;  1WI1 A;  4GN1 A;  2J0M A;  1PFJ A;  1AWE A;  4A6K A;  1GC7 A;  1NTV A;  2DHK A;  2D9W A;  5C6R A;  4HHV A;  1WJM A;  2LOX A;  2Y7B A;  2ELB A;  1EAZ A;  4DX8 A;  2J59 M;  3A8P A;  2EMS A;  2UVM A;  1MAI A;  1DRO A;  1BTN A;  2FJL A;  1FGY A;  3MDB C;  2Z0P A;  1MK9 B;  4DX9 0;  5KQ4 A;  5HE3 A;  1ZM0 A;  2Y8F A;  2DHJ A;  1ISN A;  1TQZ A;  2K2U A;  4HAY B;  4YL8 A;  1MIZ B;  1OY2 A;  3FM8 C;  1K5D B;  2ZPY A;  3SV1 A;  3PG7 A;  5J3Y A;  3U8Z A;  5C16 A;  3IVF A;  1LW3 A;  5C5B B;  2Z0O A;  3G9W A;  3SUZ A;  2P0H A;  5DI9 B;  2P0F A;  2GCJ A;  1KI1 B;  1U29 A;  3F5R A;  4K2P A;  5JHH A;  3UZT A;  1FHO A;  1PLS A;  2RSG A;  4Z2N A;  4CHJ A;  3ODX A;  3M1I B;  1OQN A;  4Z2M B;  4WSF A;  1XCG A;  3CXB B;  5D3Y A;  4YON A;  3SNH A;  2X18 A;  1IRS A;  4HDO A;  2MDX A;  3ODO A;  4K17 A;  2OTX A;  1EF1 A;  1PMS A;  1W1D A;  4EJN A;  4DBB A;  4EKU A;  1FGZ A;  3U7D A;  4HB3 B;  4HDQ A;  3AU4 A;  1FOE A;  3KSY A;  4TKN A;  1NI2 A;  2EMT A;  2YS1 A;  5KQ1 A;  2YT0 A;  1UNP A;  1KZG A;  4A6F B;  2H7D A;  1Y19 B;  3ULC A;  1FB8 A;  1K5G B;  3X23 A;  1X1F A;  4HAZ B;  4A6H A;  1LB1 A;  1NTY A;  2D9V A;  2DA0 A;  4K81 A;  2DX5 A;  1U5E A;  4WVF B;  3BIN A;  4C0A A;  3TO1 A;  1P5T A;  2L1C A;  5LON B;  3PSC A;  4HB0 B;  1V89 A;  4F7H A;  1ZSQ A;  1U5F A;  2LYD A;  1P6S A;  5LOP B;  1N3H A;  2RVB B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...