2CRFA

Solution structure of the ran_bp1 domain of ran-binding protein-3
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
150
structure length
150
Chain Sequence
GSSGSSGTARKCLLEKVEVITGEEAESNVLQMQCKLFVFDKTSQSWVERGRGLLRLNDMASTDDGTLQSRLVMRTQGSLRLILNTKLWAQMQIDKASEKSIHITAMDTEDQGVKVFLISASSKDTGQLYAALHHRILALRSRVESGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the Ran_BP1 domain of RAN-binding protein-3
rcsb
source organism Homo sapiens
molecule tags Transport protein
molecule keywords RAN binding protein 3
total genus 17
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2005-05-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00638 Ran_BP1 RanBP1 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2crfA01
3LJUX 1P5TA 1BWNA 4A6FB 1UNRA 2YT0A 3SV1A 1XCGA 3HW2B 2COAA 5FI1A 4PNKA 5DHFB 1U29A 3FM8C 3CIKA 2Z0PA 1OY2A 1MIZB 5CLQB 2ELBA 2Z0QA 3QIJA 3PSCA 4H8SA 1MKEA 2DKQA 2LG1A 1QQGA 2P8VA 1AQCA 2ADZA 2G35A 2COCA 5C6RA 2DA0A 2NMBA 5D27A 1AWEA 1KI1B 4YONA 2LOZA 5HE2A 4IFSA 5JP4A 4IOYX 1DROA 5DH9B 3SYXA 2ZPYA 3PEGA 1XODA 4A6KA 1FAOA 2COFA 5J3QA 1X86A 4WSFA 3TCAA 3T06A 2GS0A 4ZRIA 2DYQA 5JHGA 3F0WA 4HB4B 1EGXA 1M7EA 1BTKA 5EFXA 3KZ1A 3IVFA 2W2WA 1WJ1A 3DXDA 4DBBA 4CHMA 1BTNA 3GYOA 3A98B 4Y94A 2QKMA 1XD4A 1DBHA 2IYBA 2HE7A 2YF0A 3QBVB 2XQNM 3V5WA 3SO6A 1ZC3B 5J3TA 3GYPA 3TFMA 1NTYA 2H7EA 3MPXA 4HB0B 2J0JA 4EKUA 3U8ZA 3N7CA 4HATB 2DLWA 3TVVA 1Y5OA 5JHHA 1UEFA 2EMTA 1WJMA 1UNQA 2D9XA 1FGZA 2E2XA 5LOPB 4KAXB 1FOEA 2CRFA 2D9VA 2FJLA 2Z0OA 2CODA 1B55A 1XR0B 3TO1A 1PMSA 2I5FA 1GC7A 1UNPA 3ULBA 5KCVA 2MWNB 2YS1A 2DN6A 4GPTB 4D0NB 3FSSA 4HAYB 2HTHB 2Y8FA 3DXEA 1J19A 4KHAA 1WGUA 2L1CA 3ODOA 4F7UP 4BBKA 4DX8A 3VOQA 1TQZA 3PP2A 1X1FA 4CYEA 3KY9A 2J59M 2RNRB 1FHXA 3RCPA 4KHOA 2K2UA 2AEHA 5C5BA 1OMWA 1GC6A 2LYDA 4HDQA 1NTVA 3WYFB 2LULA 2N23A 4DXAB 3UZTA 1X11A 3KSYA 2DHIA 2OQBA 5DIFB 3SNHA 1DDWA 2RSGA 5LONB 4WVFB 1KZGA 1RRPB 4EJNA 2D9YA 3QWMA 2KCJA 2GCLA 2LKOA 1RJ2A 1XX0A 3PVWA 5GOWB 4P7IA 1MPHA 2P0FA 1MK9B 1FHWA 3FEHA 1V89A 2RLOA 4B6HA 1ISNA 2D2QA 1P3RA 3AJ4A 4Z2MB 2K00A 4K81A 4KVGB 2ROVA 1FB8A 2V76A 2J0MA 5D3WA 2P0HA 2MKRA 1QC6A 2DTCA 2UVMA 5JLJB 4HAVB 1X1GA 1K5GB 2I1KA 4HAXB 3ZVRA 5KQ4A 2W2XC 1WI1A 2DHKA 2M38A 2VSZA 4GZUA 4EMOA 1FHOA 4GXBA 2PZ1A 2YT1A 3HQCA 4GN1A 4K17A 1H4RA 2JP2A 1Q67A 2AL6A 4A6FA 1U5GA 4KHBB 4F7HA 3SUZA 3D8EA 1MK7B 1LW3A 2KUPA 3AU5A 5L81A 4MK0A 4F7GA 4HAWB 2I5CA 1V5UA 1WVHA 2W2XD 2YS3A 3BJIA 2YS5A 1I2HA 2R0DA 4YL8A 4XWXA 4Z2NA 3M1IB 5CLLB 2DKPA 2GCJA 2CY4A 1GG3A 4HB3B 1FGYA 1V5MA 3ZDTA 2D9ZA 3CXBB 2N0YA 3PZDA 1UPQA 1BAKA 1TXDA 3D8DA 1E5WA 3KRXA 4PQ0A 2DFKA 1U5EA 1V61A 1IRSA 3MDBC 4K2PA 2I1JA 1ZC4B 1ZM0A 5D3VA 2VKIA 1UPRA 2DX5A 1P6SA 1SGHA 2J0KA 2UZRA 1PLSA 2Y8GA 3TW1A 3G9WA 2Q13A 1Y19B 2X18A 1J0WA 2DYNA 4IAPA 1I7AA 1N3HA 2R09A 2YVCA 3AU4A 2YSZA 1X05A 1EAZA 1W1DA 1ZVRA 1MAIA 1EF1A 1U27A 1W1GA 3P7ZA 3PG7A 3D8FA 3X23A 1ZSQA 4NY0A 1DDVA 4K2OA 4A6HA 3WA0A 2VRWB 2Y7BA 1U2BA 5J3YA 5C5BB 4HDOA 2M14A 4TKNA 2L2IA 3NSUA 1PFJA 2IFSA 2ROZB 2H7DA 1XKEA 1V5PA 3A8QA 2RVBB 3U7DA 2YRYA 3KRWA 4GMVA 1W1HA 5HE3A 2QKLA 1LB1A 1U5FA 2UZSA 3VIAA 1K5DB 4HAUB 3DXCA 2EC1A 1DDMA 2CAYA 4ZRKA 1U5DA 5KQ1A 1M7RA 2P0DA 2D10A 1NU2A 3OANA 2CY5A 2K2JA 1DYNA 1H10A 1KZ7A 3A8PA 4DX90 2RUKB 2KGXB 1MIXA 1OQNA 4HAZB 3ML4A 5DI9B 4A5KA 3BINA 3ODXA 5HE1A 2MDXA 2DHJA 1V88A 3F5RA 4HB2B 3HK0A 2BCJA 4MY6A 1TJ6A 5D3XA 4MT7A 2MFQA 4NSWA 1EVHA 5C16A 3ODWA 3O96A 2GJYA 2RGNB 2D11A 3PVLA 2ELAA 4GMXB 4HHVA 4CHJA 2OTXA 2LOXA 5HE0A 5D3YA 4ZRJA 1NI2A 2DX1A 1WGQA 5C79A 1Z87A 1SHCA 4C0AA 4TYZA 3PVUA 2D9WA 3P6AA 2NZ8B 4WJ7A 2D4QA 2EMSA 2EJ8A 3ULCA 5FI0A 4L6EA 5DHAB 1WG7A
chains in the Genus database with same CATH superfamily
3LJUX 1ZYIA 1P5TA 1BWNA 4A6FB 4L1RA 1UNRA 2YT0A 3SV1A 1XCGA 3NWAA 3HW2B 4GOUA 2COAA 5FI1A 4PNKA 5DHFB 1U29A 3FM8C 3CIKA 2Z0PA 1OY2A 3DCXA 1MIZB 5CLQB 2ELBA 2Z0QA 3QIJA 3PSCA 4H8SA 1MKEA 2DKQA 2LG1A 1QQGA 2P8VA 1AQCA 2ADZA 2G35A 2COCA 5C6RA 2DA0A 2NMBA 5D27A 2RRFA 1AWEA 1KI1B 4YONA 2LOZA 2Z13A 5HE2A 4IFSA 5JP4A 4IOYX 1DROA 5DH9B 3SYXA 2ZPYA 3PEGA 1XODA 4A6KA 1FAOA 2COFA 5J3QA 1X86A 4WSFA 3TCAA 4OT1A 1T77A 3T06A 2GS0A 4ZRIA 2DYQA 5JHGA 3F0WA 4HB4B 1EGXA 1M7EA 1BTKA 5EFXA 2ZKMX 3KZ1A 3IVFA 2W2WA 1WJ1A 3DXDA 4DBBA 4CHMA 1BTNA 3GYOA 3A98B 4Y94A 2QKMA 1XD4A 1DBHA 3U12A 2IYBA 2HE7A 2YF0A 3QBVB 2XQNM 3V5WA 3SO6A 1ZC3B 5J3TA 3GYPA 3TFMA 1NTYA 2H7EA 3MPXA 4HB0B 2J0JA 4EKUA 3U8ZA 3N7CA 4QXAB 2DLWA 4HATB 3TVVA 1Y5OA 5JHHA 1UEFA 4QJ5B 2EMTA 1WJMA 1UNQA 2D9XA 1FGZA 2E2XA 2GUMA 5LOPB 4KAXB 1FOEA 2CRFA 2D9VA 2FJLA 2Z0OA 2CODA 1B55A 1XR0B 3TO1A 1PMSA 2I5FA 1GC7A 1UNPA 2Z59A 3ULBA 5KCVA 2MWNB 2YS1A 2DN6A 4GPTB 4D0NB 3FSSA 4HAYB 2HTHB 2Y8FA 3DXEA 1J19A 4KHAA 1WGUA 2L1CA 3ODOA 4F7UP 4BBKA 4DX8A 3VOQA 1TQZA 3PP2A 1X1FA 4CYEA 3KY9A 2J59M 2RNRB 3B77A 3NWFA 1FHXA 3RCPA 4KHOA 2K2UA 2AEHA 5C5BA 1OMWA 1GC6A 2LYDA 4HDQA 1NTVA 4D6WA 4GNKB 3WYFB 2LULA 2N23A 4DXAB 3UZTA 1X11A 3KSYA 2DHIA 2FJUB 2OQBA 5DIFB 3SNHA 1DDWA 2RSGA 5LONB 4WVFB 1KZGA 3NWDA 1RRPB 4EJNA 2D9YA 3QWMA 2KCJA 2GCLA 2LKOA 1RJ2A 1XX0A 3PVWA 5GOWB 4P7IA 1MPHA 2P0FA 1MK9B 1FHWA 3FEHA 1V89A 3HIEA 2RLOA 2Z4DA 4B6HA 1ISNA 2D2QA 1P3RA 3AJ4A 4Z2MB 2K00A 4K81A 4KVGB 2ROVA 1FB8A 2V76A 2J0MA 5D3WA 2P0HA 5I2SA 2MKRA 3OHMB 1QC6A 2DTCA 2UVMA 5JLJB 4HAVB 1X1GA 1K5GB 2I1KA 4HAXB 3ZVRA 5KQ4A 2W2XC 1WI1A 2DHKA 2M38A 2VSZA 4GZUA 4EMOA 1FHOA 2PZ1A 4GXBA 2YT1A 4OSNA 3HQCA 4GN1A 4K17A 1H4RA 2JP2A 3NW8A 1Q67A 2AL6A 4A6FA 1U5GA 4KHBB 4F7HA 4DIXA 3SUZA 3D8EA 1MK7B 1LW3A 2KUPA 3AU5A 4QJ4B 5L81A 4MK0A 4F7GA 4HAWB 2I5CA 1V5UA 1WVHA 2W2XD 5I2MA 2YS3A 3BJIA 2YS5A 1I2HA 2R0DA 4YL8A 4XWXA 4Z2NA 3M1IB 5CLLB 2DKPA 2GCJA 2CY4A 1GG3A 4HB3B 1FGYA 1V5MA 3ZDTA 2D9ZA 3CXBB 2N0YA 3PZDA 1UPQA 2KUQA 1BAKA 1TXDA 3D8DA 1E5WA 3KRXA 4PQ0A 2DFKA 1U5EA 1V61A 4CSQA 1IRSA 3MDBC 4K2PA 2I1JA 1ZC4B 1ZM0A 5M4YB 5D3VA 2VKIA 1UPRA 2DX5A 1P6SA 1SGHA 2J0KA 2UZRA 1MI1A 1PLSA 2Y8GA 3TW1A 3G9WA 2Q13A 2R2YA 1Y19B 2X18A 1J0WA 2DYNA 4IAPA 1I7AA 1N3HA 5IRSA 2R09A 2YVCA 3AU4A 2YSZA 1X05A 3HSAA 1EAZA 1W1DA 1ZVRA 1MAIA 1EF1A 1U27A 1W1GA 3P7ZA 3PG7A 3D8FA 3X23A 3A58A 1ZSQA 4NY0A 1DDVA 2KR0A 4K2OA 4A6HA 3WA0A 2VRWB 2Y7BA 1U2BA 5J3YA 5C5BB 4HDOA 2M14A 4HSIA 4TKNA 2L2IA 3NSUA 4QJ3B 1PFJA 2IFSA 2K49A 2ROZB 2YT2A 2H7DA 1XKEA 1V5PA 5LG4B 3A8QA 2RVBB 3U7DA 2YRYA 3KRWA 4GMVA 1W1HA 5HE3A 2QKLA 4KHBA 1LB1A 1U5FA 2UZSA 3VIAA 1K5DB 2KIEA 4HAUB 3DXCA 2EC1A 1DDMA 2CAYA 4ZRKA 2NBVA 1U5DA 5KQ1A 1M7RA 2P0DA 2D10A 1NU2A 3OANA 2CY5A 2K2JA 1DYNA 1H10A 1KZ7A 3A8PA 4DX90 2RUKB 2KGXB 1MIXA 1OQNA 4HAZB 3ML4A 5DI9B 4A5KA 3BINA 3ODXA 5HE1A 2MDXA 2DHJA 1V88A 3F5RA 4HB2B 3HK0A 2BCJA 4MY6A 1TJ6A 5D3XA 4MT7A 2MFQA 4NSWA 1EVHA 5C16A 3ODWA 3O96A 2GJYA 2RGNB 2D11A 3PVLA 2ELAA 4GMXB 4HHVA 4CHJA 2OTXA 2LOXA 5HE0A 5D3YA 4ZRJA 1NI2A 2DX1A 1WGQA 5C79A 1Z87A 2K8EA 1SHCA 4C0AA 4TYZA 3PVUA 2D9WA 3P6AA 2NZ8B 3FVCA 4WJ7A 2D4QA 2EMSA 2Z14A 2EJ8A 2KIGA 3ULCA 5FI0A 4L6EA 5DHAB 1WG7A
chains in the Genus database with same CATH topology
3LJUX 1P5TA 1BWNA 4A6FB 1UNRA 2YT0A 3SV1A 1XCGA 3HW2B 2COAA 5FI1A 4PNKA 5DHFB 1U29A 3FM8C 3CIKA 2Z0PA 1OY2A 1MIZB 5CLQB 2ELBA 2Z0QA 3QIJA 3PSCA 4H8SA 1MKEA 2DKQA 2LG1A 1QQGA 2P8VA 1AQCA 2ADZA 2G35A 2COCA 5C6RA 2DA0A 2NMBA 5D27A 1AWEA 1KI1B 4YONA 2LOZA 5HE2A 4IFSA 5JP4A 4IOYX 1DROA 5DH9B 3SYXA 2ZPYA 3PEGA 1XODA 4A6KA 1FAOA 2COFA 5J3QA 1X86A 4WSFA 3TCAA 3T06A 2GS0A 4ZRIA 2DYQA 5JHGA 3F0WA 4HB4B 1EGXA 1M7EA 1BTKA 5EFXA 3KZ1A 3IVFA 2W2WA 1WJ1A 3DXDA 4DBBA 4CHMA 1BTNA 3GYOA 3A98B 4Y94A 2QKMA 1XD4A 1DBHA 2IYBA 2HE7A 2YF0A 3QBVB 2XQNM 3V5WA 3SO6A 1ZC3B 5J3TA 3GYPA 3TFMA 1NTYA 2H7EA 3MPXA 4HB0B 2J0JA 4EKUA 3U8ZA 3N7CA 4HATB 2DLWA 3TVVA 1Y5OA 5JHHA 1UEFA 2EMTA 1WJMA 1UNQA 2D9XA 1FGZA 2E2XA 5LOPB 4KAXB 1FOEA 2CRFA 2D9VA 2FJLA 2Z0OA 2CODA 1B55A 1XR0B 3TO1A 1PMSA 2I5FA 1GC7A 1UNPA 3ULBA 5KCVA 2MWNB 2YS1A 2DN6A 4GPTB 4D0NB 3FSSA 4HAYB 2HTHB 2Y8FA 3DXEA 1J19A 4KHAA 1WGUA 2L1CA 3ODOA 4F7UP 4BBKA 4DX8A 3VOQA 1TQZA 3PP2A 1X1FA 4CYEA 3KY9A 2J59M 2RNRB 1FHXA 3RCPA 4KHOA 2K2UA 2AEHA 5C5BA 1OMWA 1GC6A 2LYDA 4HDQA 1NTVA 3WYFB 2LULA 2N23A 4DXAB 3UZTA 1X11A 3KSYA 2DHIA 2OQBA 5DIFB 3SNHA 1DDWA 2RSGA 5LONB 4WVFB 1KZGA 1RRPB 4EJNA 2D9YA 3QWMA 2KCJA 2GCLA 2LKOA 1RJ2A 1XX0A 3PVWA 5GOWB 4P7IA 1MPHA 2P0FA 1MK9B 1FHWA 3FEHA 1V89A 2RLOA 4B6HA 1ISNA 2D2QA 1P3RA 3AJ4A 4Z2MB 2K00A 4K81A 4KVGB 2ROVA 1FB8A 2V76A 2J0MA 5D3WA 2P0HA 2MKRA 1QC6A 2DTCA 2UVMA 5JLJB 4HAVB 1X1GA 1K5GB 2I1KA 4HAXB 3ZVRA 5KQ4A 2W2XC 1WI1A 2DHKA 2M38A 2VSZA 4GZUA 4EMOA 1FHOA 4GXBA 2PZ1A 2YT1A 3HQCA 4GN1A 4K17A 1H4RA 2JP2A 1Q67A 2AL6A 4A6FA 1U5GA 4KHBB 4F7HA 3SUZA 3D8EA 1MK7B 1LW3A 2KUPA 3AU5A 5L81A 4MK0A 4F7GA 4HAWB 2I5CA 1V5UA 1WVHA 2W2XD 2YS3A 3BJIA 2YS5A 1I2HA 2R0DA 4YL8A 4XWXA 4Z2NA 3M1IB 5CLLB 2DKPA 2GCJA 2CY4A 1GG3A 4HB3B 1FGYA 1V5MA 3ZDTA 2D9ZA 3CXBB 2N0YA 3PZDA 1UPQA 1BAKA 1TXDA 3D8DA 1E5WA 3KRXA 4PQ0A 2DFKA 1U5EA 1V61A 1IRSA 3MDBC 4K2PA 2I1JA 1ZC4B 1ZM0A 5D3VA 2VKIA 1UPRA 2DX5A 1P6SA 1SGHA 2J0KA 2UZRA 1PLSA 2Y8GA 3TW1A 3G9WA 2Q13A 1Y19B 2X18A 1J0WA 2DYNA 4IAPA 1I7AA 1N3HA 2R09A 2YVCA 3AU4A 2YSZA 1X05A 1EAZA 1W1DA 1ZVRA 1MAIA 1EF1A 1U27A 1W1GA 3P7ZA 3PG7A 3D8FA 3X23A 1ZSQA 4NY0A 1DDVA 4K2OA 4A6HA 3WA0A 2VRWB 2Y7BA 1U2BA 5J3YA 5C5BB 4HDOA 2M14A 4TKNA 2L2IA 3NSUA 1PFJA 2IFSA 2ROZB 2H7DA 1XKEA 1V5PA 3A8QA 2RVBB 3U7DA 2YRYA 3KRWA 4GMVA 1W1HA 5HE3A 2QKLA 1LB1A 1U5FA 2UZSA 3VIAA 1K5DB 4HAUB 3DXCA 2EC1A 1DDMA 2CAYA 4ZRKA 1U5DA 5KQ1A 1M7RA 2P0DA 2D10A 1NU2A 3OANA 2CY5A 2K2JA 1DYNA 1H10A 1KZ7A 3A8PA 4DX90 2RUKB 2KGXB 1MIXA 1OQNA 4HAZB 3ML4A 5DI9B 4A5KA 3BINA 3ODXA 5HE1A 2MDXA 2DHJA 1V88A 3F5RA 4HB2B 3HK0A 2BCJA 4MY6A 1TJ6A 5D3XA 4MT7A 2MFQA 4NSWA 1EVHA 5C16A 3ODWA 3O96A 2GJYA 2RGNB 2D11A 3PVLA 2ELAA 4GMXB 4HHVA 4CHJA 2OTXA 2LOXA 5HE0A 5D3YA 4ZRJA 1NI2A 2DX1A 1WGQA 5C79A 1Z87A 1SHCA 4C0AA 4TYZA 3PVUA 2D9WA 3P6AA 2NZ8B 4WJ7A 2D4QA 2EMSA 2EJ8A 3ULCA 5FI0A 4L6EA 5DHAB 1WG7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LJU X;  1P5T A;  1BWN A;  4A6F B;  1UNR A;  2YT0 A;  3SV1 A;  1XCG A;  3HW2 B;  2COA A;  5FI1 A;  4PNK A;  5DHF B;  1U29 A;  3FM8 C;  3CIK A;  2Z0P A;  1OY2 A;  1MIZ B;  5CLQ B;  2ELB A;  2Z0Q A;  3QIJ A;  3PSC A;  4H8S A;  1MKE A;  2DKQ A;  2LG1 A;  1QQG A;  2P8V A;  1AQC A;  2ADZ A;  2G35 A;  2COC A;  5C6R A;  2DA0 A;  2NMB A;  5D27 A;  1AWE A;  1KI1 B;  4YON A;  2LOZ A;  5HE2 A;  4IFS A;  5JP4 A;  4IOY X;  1DRO A;  5DH9 B;  3SYX A;  2ZPY A;  3PEG A;  1XOD A;  4A6K A;  1FAO A;  2COF A;  5J3Q A;  1X86 A;  4WSF A;  3TCA A;  3T06 A;  2GS0 A;  4ZRI A;  2DYQ A;  5JHG A;  3F0W A;  4HB4 B;  1EGX A;  1M7E A;  1BTK A;  5EFX A;  3KZ1 A;  3IVF A;  2W2W A;  1WJ1 A;  3DXD A;  4DBB A;  4CHM A;  1BTN A;  3GYO A;  3A98 B;  4Y94 A;  2QKM A;  1XD4 A;  1DBH A;  2IYB A;  2HE7 A;  2YF0 A;  3QBV B;  2XQN M;  3V5W A;  3SO6 A;  1ZC3 B;  5J3T A;  3GYP A;  3TFM A;  1NTY A;  2H7E A;  3MPX A;  4HB0 B;  2J0J A;  4EKU A;  3U8Z A;  3N7C A;  4HAT B;  2DLW A;  3TVV A;  1Y5O A;  5JHH A;  1UEF A;  2EMT A;  1WJM A;  1UNQ A;  2D9X A;  1FGZ A;  2E2X A;  5LOP B;  4KAX B;  1FOE A;  2CRF A;  2D9V A;  2FJL A;  2Z0O A;  2COD A;  1B55 A;  1XR0 B;  3TO1 A;  1PMS A;  2I5F A;  1GC7 A;  1UNP A;  3ULB A;  5KCV A;  2MWN B;  2YS1 A;  2DN6 A;  4GPT B;  4D0N B;  3FSS A;  4HAY B;  2HTH B;  2Y8F A;  3DXE A;  1J19 A;  4KHA A;  1WGU A;  2L1C A;  3ODO A;  4F7U P;  4BBK A;  4DX8 A;  3VOQ A;  1TQZ A;  3PP2 A;  1X1F A;  4CYE A;  3KY9 A;  2J59 M;  2RNR B;  1FHX A;  3RCP A;  4KHO A;  2K2U A;  2AEH A;  5C5B A;  1OMW A;  1GC6 A;  2LYD A;  4HDQ A;  1NTV A;  3WYF B;  2LUL A;  2N23 A;  4DXA B;  3UZT A;  1X11 A;  3KSY A;  2DHI A;  2OQB A;  5DIF B;  3SNH A;  1DDW A;  2RSG A;  5LON B;  4WVF B;  1KZG A;  1RRP B;  4EJN A;  2D9Y A;  3QWM A;  2KCJ A;  2GCL A;  2LKO A;  1RJ2 A;  1XX0 A;  3PVW A;  5GOW B;  4P7I A;  1MPH A;  2P0F A;  1MK9 B;  1FHW A;  3FEH A;  1V89 A;  2RLO A;  4B6H A;  1ISN A;  2D2Q A;  1P3R A;  3AJ4 A;  4Z2M B;  2K00 A;  4K81 A;  4KVG B;  2ROV A;  1FB8 A;  2V76 A;  2J0M A;  5D3W A;  2P0H A;  2MKR A;  1QC6 A;  2DTC A;  2UVM A;  5JLJ B;  4HAV B;  1X1G A;  1K5G B;  2I1K A;  4HAX B;  3ZVR A;  5KQ4 A;  2W2X C;  1WI1 A;  2DHK A;  2M38 A;  2VSZ A;  4GZU A;  4EMO A;  1FHO A;  4GXB A;  2PZ1 A;  2YT1 A;  3HQC A;  4GN1 A;  4K17 A;  1H4R A;  2JP2 A;  1Q67 A;  2AL6 A;  4A6F A;  1U5G A;  4KHB B;  4F7H A;  3SUZ A;  3D8E A;  1MK7 B;  1LW3 A;  2KUP A;  3AU5 A;  5L81 A;  4MK0 A;  4F7G A;  4HAW B;  2I5C A;  1V5U A;  1WVH A;  2W2X D;  2YS3 A;  3BJI A;  2YS5 A;  1I2H A;  2R0D A;  4YL8 A;  4XWX A;  4Z2N A;  3M1I B;  5CLL B;  2DKP A;  2GCJ A;  2CY4 A;  1GG3 A;  4HB3 B;  1FGY A;  1V5M A;  3ZDT A;  2D9Z A;  3CXB B;  2N0Y A;  3PZD A;  1UPQ A;  1BAK A;  1TXD A;  3D8D A;  1E5W A;  3KRX A;  4PQ0 A;  2DFK A;  1U5E A;  1V61 A;  1IRS A;  3MDB C;  4K2P A;  2I1J A;  1ZC4 B;  1ZM0 A;  5D3V A;  2VKI A;  1UPR A;  2DX5 A;  1P6S A;  1SGH A;  2J0K A;  2UZR A;  1PLS A;  2Y8G A;  3TW1 A;  3G9W A;  2Q13 A;  1Y19 B;  2X18 A;  1J0W A;  2DYN A;  4IAP A;  1I7A A;  1N3H A;  2R09 A;  2YVC A;  3AU4 A;  2YSZ A;  1X05 A;  1EAZ A;  1W1D A;  1ZVR A;  1MAI A;  1EF1 A;  1U27 A;  1W1G A;  3P7Z A;  3PG7 A;  3D8F A;  3X23 A;  1ZSQ A;  4NY0 A;  1DDV A;  4K2O A;  4A6H A;  3WA0 A;  2VRW B;  2Y7B A;  1U2B A;  5J3Y A;  5C5B B;  4HDO A;  2M14 A;  4TKN A;  2L2I A;  3NSU A;  1PFJ A;  2IFS A;  2ROZ B;  2H7D A;  1XKE A;  1V5P A;  3A8Q A;  2RVB B;  3U7D A;  2YRY A;  3KRW A;  4GMV A;  1W1H A;  5HE3 A;  2QKL A;  1LB1 A;  1U5F A;  2UZS A;  3VIA A;  1K5D B;  4HAU B;  3DXC A;  2EC1 A;  1DDM A;  2CAY A;  4ZRK A;  1U5D A;  5KQ1 A;  1M7R A;  2P0D A;  2D10 A;  1NU2 A;  3OAN A;  2CY5 A;  2K2J A;  1DYN A;  1H10 A;  1KZ7 A;  3A8P A;  4DX9 0;  2RUK B;  2KGX B;  1MIX A;  1OQN A;  4HAZ B;  3ML4 A;  5DI9 B;  4A5K A;  3BIN A;  3ODX A;  5HE1 A;  2MDX A;  2DHJ A;  1V88 A;  3F5R A;  4HB2 B;  3HK0 A;  2BCJ A;  4MY6 A;  1TJ6 A;  5D3X A;  4MT7 A;  2MFQ A;  4NSW A;  1EVH A;  5C16 A;  3ODW A;  3O96 A;  2GJY A;  2RGN B;  2D11 A;  3PVL A;  2ELA A;  4GMX B;  4HHV A;  4CHJ A;  2OTX A;  2LOX A;  5HE0 A;  5D3Y A;  4ZRJ A;  1NI2 A;  2DX1 A;  1WGQ A;  5C79 A;  1Z87 A;  1SHC A;  4C0A A;  4TYZ A;  3PVU A;  2D9W A;  3P6A A;  2NZ8 B;  4WJ7 A;  2D4Q A;  2EMS A;  2EJ8 A;  3ULC A;  5FI0 A;  4L6E A;  5DHA B;  1WG7 A; 
#chains in the Genus database with same CATH topology
 3LJU X;  1ZYI A;  1P5T A;  1BWN A;  4A6F B;  4L1R A;  1UNR A;  2YT0 A;  3SV1 A;  1XCG A;  3NWA A;  3HW2 B;  4GOU A;  2COA A;  5FI1 A;  4PNK A;  5DHF B;  1U29 A;  3FM8 C;  3CIK A;  2Z0P A;  1OY2 A;  3DCX A;  1MIZ B;  5CLQ B;  2ELB A;  2Z0Q A;  3QIJ A;  3PSC A;  4H8S A;  1MKE A;  2DKQ A;  2LG1 A;  1QQG A;  2P8V A;  1AQC A;  2ADZ A;  2G35 A;  2COC A;  5C6R A;  2DA0 A;  2NMB A;  5D27 A;  2RRF A;  1AWE A;  1KI1 B;  4YON A;  2LOZ A;  2Z13 A;  5HE2 A;  4IFS A;  5JP4 A;  4IOY X;  1DRO A;  5DH9 B;  3SYX A;  2ZPY A;  3PEG A;  1XOD A;  4A6K A;  1FAO A;  2COF A;  5J3Q A;  1X86 A;  4WSF A;  3TCA A;  4OT1 A;  1T77 A;  3T06 A;  2GS0 A;  4ZRI A;  2DYQ A;  5JHG A;  3F0W A;  4HB4 B;  1EGX A;  1M7E A;  1BTK A;  5EFX A;  2ZKM X;  3KZ1 A;  3IVF A;  2W2W A;  1WJ1 A;  3DXD A;  4DBB A;  4CHM A;  1BTN A;  3GYO A;  3A98 B;  4Y94 A;  2QKM A;  1XD4 A;  1DBH A;  3U12 A;  2IYB A;  2HE7 A;  2YF0 A;  3QBV B;  2XQN M;  3V5W A;  3SO6 A;  1ZC3 B;  5J3T A;  3GYP A;  3TFM A;  1NTY A;  2H7E A;  3MPX A;  4HB0 B;  2J0J A;  4EKU A;  3U8Z A;  3N7C A;  4QXA B;  2DLW A;  4HAT B;  3TVV A;  1Y5O A;  5JHH A;  1UEF A;  4QJ5 B;  2EMT A;  1WJM A;  1UNQ A;  2D9X A;  1FGZ A;  2E2X A;  2GUM A;  5LOP B;  4KAX B;  1FOE A;  2CRF A;  2D9V A;  2FJL A;  2Z0O A;  2COD A;  1B55 A;  1XR0 B;  3TO1 A;  1PMS A;  2I5F A;  1GC7 A;  1UNP A;  2Z59 A;  3ULB A;  5KCV A;  2MWN B;  2YS1 A;  2DN6 A;  4GPT B;  4D0N B;  3FSS A;  4HAY B;  2HTH B;  2Y8F A;  3DXE A;  1J19 A;  4KHA A;  1WGU A;  2L1C A;  3ODO A;  4F7U P;  4BBK A;  4DX8 A;  3VOQ A;  1TQZ A;  3PP2 A;  1X1F A;  4CYE A;  3KY9 A;  2J59 M;  2RNR B;  3B77 A;  3NWF A;  1FHX A;  3RCP A;  4KHO A;  2K2U A;  2AEH A;  5C5B A;  1OMW A;  1GC6 A;  2LYD A;  4HDQ A;  1NTV A;  4D6W A;  4GNK B;  3WYF B;  2LUL A;  2N23 A;  4DXA B;  3UZT A;  1X11 A;  3KSY A;  2DHI A;  2FJU B;  2OQB A;  5DIF B;  3SNH A;  1DDW A;  2RSG A;  5LON B;  4WVF B;  1KZG A;  3NWD A;  1RRP B;  4EJN A;  2D9Y A;  3QWM A;  2KCJ A;  2GCL A;  2LKO A;  1RJ2 A;  1XX0 A;  3PVW A;  5GOW B;  4P7I A;  1MPH A;  2P0F A;  1MK9 B;  1FHW A;  3FEH A;  1V89 A;  3HIE A;  2RLO A;  2Z4D A;  4B6H A;  1ISN A;  2D2Q A;  1P3R A;  3AJ4 A;  4Z2M B;  2K00 A;  4K81 A;  4KVG B;  2ROV A;  1FB8 A;  2V76 A;  2J0M A;  5D3W A;  2P0H A;  5I2S A;  2MKR A;  3OHM B;  1QC6 A;  2DTC A;  2UVM A;  5JLJ B;  4HAV B;  1X1G A;  1K5G B;  2I1K A;  4HAX B;  3ZVR A;  5KQ4 A;  2W2X C;  1WI1 A;  2DHK A;  2M38 A;  2VSZ A;  4GZU A;  4EMO A;  1FHO A;  2PZ1 A;  4GXB A;  2YT1 A;  4OSN A;  3HQC A;  4GN1 A;  4K17 A;  1H4R A;  2JP2 A;  3NW8 A;  1Q67 A;  2AL6 A;  4A6F A;  1U5G A;  4KHB B;  4F7H A;  4DIX A;  3SUZ A;  3D8E A;  1MK7 B;  1LW3 A;  2KUP A;  3AU5 A;  4QJ4 B;  5L81 A;  4MK0 A;  4F7G A;  4HAW B;  2I5C A;  1V5U A;  1WVH A;  2W2X D;  5I2M A;  2YS3 A;  3BJI A;  2YS5 A;  1I2H A;  2R0D A;  4YL8 A;  4XWX A;  4Z2N A;  3M1I B;  5CLL B;  2DKP A;  2GCJ A;  2CY4 A;  1GG3 A;  4HB3 B;  1FGY A;  1V5M A;  3ZDT A;  2D9Z A;  3CXB B;  2N0Y A;  3PZD A;  1UPQ A;  2KUQ A;  1BAK A;  1TXD A;  3D8D A;  1E5W A;  3KRX A;  4PQ0 A;  2DFK A;  1U5E A;  1V61 A;  4CSQ A;  1IRS A;  3MDB C;  4K2P A;  2I1J A;  1ZC4 B;  1ZM0 A;  5M4Y B;  5D3V A;  2VKI A;  1UPR A;  2DX5 A;  1P6S A;  1SGH A;  2J0K A;  2UZR A;  1MI1 A;  1PLS A;  2Y8G A;  3TW1 A;  3G9W A;  2Q13 A;  2R2Y A;  1Y19 B;  2X18 A;  1J0W A;  2DYN A;  4IAP A;  1I7A A;  1N3H A;  5IRS A;  2R09 A;  2YVC A;  3AU4 A;  2YSZ A;  1X05 A;  3HSA A;  1EAZ A;  1W1D A;  1ZVR A;  1MAI A;  1EF1 A;  1U27 A;  1W1G A;  3P7Z A;  3PG7 A;  3D8F A;  3X23 A;  3A58 A;  1ZSQ A;  4NY0 A;  1DDV A;  2KR0 A;  4K2O A;  4A6H A;  3WA0 A;  2VRW B;  2Y7B A;  1U2B A;  5J3Y A;  5C5B B;  4HDO A;  2M14 A;  4HSI A;  4TKN A;  2L2I A;  3NSU A;  4QJ3 B;  1PFJ A;  2IFS A;  2K49 A;  2ROZ B;  2YT2 A;  2H7D A;  1XKE A;  1V5P A;  5LG4 B;  3A8Q A;  2RVB B;  3U7D A;  2YRY A;  3KRW A;  4GMV A;  1W1H A;  5HE3 A;  2QKL A;  4KHB A;  1LB1 A;  1U5F A;  2UZS A;  3VIA A;  1K5D B;  2KIE A;  4HAU B;  3DXC A;  2EC1 A;  1DDM A;  2CAY A;  4ZRK A;  2NBV A;  1U5D A;  5KQ1 A;  1M7R A;  2P0D A;  2D10 A;  1NU2 A;  3OAN A;  2CY5 A;  2K2J A;  1DYN A;  1H10 A;  1KZ7 A;  3A8P A;  4DX9 0;  2RUK B;  2KGX B;  1MIX A;  1OQN A;  4HAZ B;  3ML4 A;  5DI9 B;  4A5K A;  3BIN A;  3ODX A;  5HE1 A;  2MDX A;  2DHJ A;  1V88 A;  3F5R A;  4HB2 B;  3HK0 A;  2BCJ A;  4MY6 A;  1TJ6 A;  5D3X A;  4MT7 A;  2MFQ A;  4NSW A;  1EVH A;  5C16 A;  3ODW A;  3O96 A;  2GJY A;  2RGN B;  2D11 A;  3PVL A;  2ELA A;  4GMX B;  4HHV A;  4CHJ A;  2OTX A;  2LOX A;  5HE0 A;  5D3Y A;  4ZRJ A;  1NI2 A;  2DX1 A;  1WGQ A;  5C79 A;  1Z87 A;  2K8E A;  1SHC A;  4C0A A;  4TYZ A;  3PVU A;  2D9W A;  3P6A A;  2NZ8 B;  3FVC A;  4WJ7 A;  2D4Q A;  2EMS A;  2Z14 A;  2EJ8 A;  2KIG A;  3ULC A;  5FI0 A;  4L6E A;  5DHA B;  1WG7 A; 
#chains in the Genus database with same CATH homology
 3LJU X;  1P5T A;  1BWN A;  4A6F B;  1UNR A;  2YT0 A;  3SV1 A;  1XCG A;  3HW2 B;  2COA A;  5FI1 A;  4PNK A;  5DHF B;  1U29 A;  3FM8 C;  3CIK A;  2Z0P A;  1OY2 A;  1MIZ B;  5CLQ B;  2ELB A;  2Z0Q A;  3QIJ A;  3PSC A;  4H8S A;  1MKE A;  2DKQ A;  2LG1 A;  1QQG A;  2P8V A;  1AQC A;  2ADZ A;  2G35 A;  2COC A;  5C6R A;  2DA0 A;  2NMB A;  5D27 A;  1AWE A;  1KI1 B;  4YON A;  2LOZ A;  5HE2 A;  4IFS A;  5JP4 A;  4IOY X;  1DRO A;  5DH9 B;  3SYX A;  2ZPY A;  3PEG A;  1XOD A;  4A6K A;  1FAO A;  2COF A;  5J3Q A;  1X86 A;  4WSF A;  3TCA A;  3T06 A;  2GS0 A;  4ZRI A;  2DYQ A;  5JHG A;  3F0W A;  4HB4 B;  1EGX A;  1M7E A;  1BTK A;  5EFX A;  3KZ1 A;  3IVF A;  2W2W A;  1WJ1 A;  3DXD A;  4DBB A;  4CHM A;  1BTN A;  3GYO A;  3A98 B;  4Y94 A;  2QKM A;  1XD4 A;  1DBH A;  2IYB A;  2HE7 A;  2YF0 A;  3QBV B;  2XQN M;  3V5W A;  3SO6 A;  1ZC3 B;  5J3T A;  3GYP A;  3TFM A;  1NTY A;  2H7E A;  3MPX A;  4HB0 B;  2J0J A;  4EKU A;  3U8Z A;  3N7C A;  4HAT B;  2DLW A;  3TVV A;  1Y5O A;  5JHH A;  1UEF A;  2EMT A;  1WJM A;  1UNQ A;  2D9X A;  1FGZ A;  2E2X A;  5LOP B;  4KAX B;  1FOE A;  2CRF A;  2D9V A;  2FJL A;  2Z0O A;  2COD A;  1B55 A;  1XR0 B;  3TO1 A;  1PMS A;  2I5F A;  1GC7 A;  1UNP A;  3ULB A;  5KCV A;  2MWN B;  2YS1 A;  2DN6 A;  4GPT B;  4D0N B;  3FSS A;  4HAY B;  2HTH B;  2Y8F A;  3DXE A;  1J19 A;  4KHA A;  1WGU A;  2L1C A;  3ODO A;  4F7U P;  4BBK A;  4DX8 A;  3VOQ A;  1TQZ A;  3PP2 A;  1X1F A;  4CYE A;  3KY9 A;  2J59 M;  2RNR B;  1FHX A;  3RCP A;  4KHO A;  2K2U A;  2AEH A;  5C5B A;  1OMW A;  1GC6 A;  2LYD A;  4HDQ A;  1NTV A;  3WYF B;  2LUL A;  2N23 A;  4DXA B;  3UZT A;  1X11 A;  3KSY A;  2DHI A;  2OQB A;  5DIF B;  3SNH A;  1DDW A;  2RSG A;  5LON B;  4WVF B;  1KZG A;  1RRP B;  4EJN A;  2D9Y A;  3QWM A;  2KCJ A;  2GCL A;  2LKO A;  1RJ2 A;  1XX0 A;  3PVW A;  5GOW B;  4P7I A;  1MPH A;  2P0F A;  1MK9 B;  1FHW A;  3FEH A;  1V89 A;  2RLO A;  4B6H A;  1ISN A;  2D2Q A;  1P3R A;  3AJ4 A;  4Z2M B;  2K00 A;  4K81 A;  4KVG B;  2ROV A;  1FB8 A;  2V76 A;  2J0M A;  5D3W A;  2P0H A;  2MKR A;  1QC6 A;  2DTC A;  2UVM A;  5JLJ B;  4HAV B;  1X1G A;  1K5G B;  2I1K A;  4HAX B;  3ZVR A;  5KQ4 A;  2W2X C;  1WI1 A;  2DHK A;  2M38 A;  2VSZ A;  4GZU A;  4EMO A;  1FHO A;  4GXB A;  2PZ1 A;  2YT1 A;  3HQC A;  4GN1 A;  4K17 A;  1H4R A;  2JP2 A;  1Q67 A;  2AL6 A;  4A6F A;  1U5G A;  4KHB B;  4F7H A;  3SUZ A;  3D8E A;  1MK7 B;  1LW3 A;  2KUP A;  3AU5 A;  5L81 A;  4MK0 A;  4F7G A;  4HAW B;  2I5C A;  1V5U A;  1WVH A;  2W2X D;  2YS3 A;  3BJI A;  2YS5 A;  1I2H A;  2R0D A;  4YL8 A;  4XWX A;  4Z2N A;  3M1I B;  5CLL B;  2DKP A;  2GCJ A;  2CY4 A;  1GG3 A;  4HB3 B;  1FGY A;  1V5M A;  3ZDT A;  2D9Z A;  3CXB B;  2N0Y A;  3PZD A;  1UPQ A;  1BAK A;  1TXD A;  3D8D A;  1E5W A;  3KRX A;  4PQ0 A;  2DFK A;  1U5E A;  1V61 A;  1IRS A;  3MDB C;  4K2P A;  2I1J A;  1ZC4 B;  1ZM0 A;  5D3V A;  2VKI A;  1UPR A;  2DX5 A;  1P6S A;  1SGH A;  2J0K A;  2UZR A;  1PLS A;  2Y8G A;  3TW1 A;  3G9W A;  2Q13 A;  1Y19 B;  2X18 A;  1J0W A;  2DYN A;  4IAP A;  1I7A A;  1N3H A;  2R09 A;  2YVC A;  3AU4 A;  2YSZ A;  1X05 A;  1EAZ A;  1W1D A;  1ZVR A;  1MAI A;  1EF1 A;  1U27 A;  1W1G A;  3P7Z A;  3PG7 A;  3D8F A;  3X23 A;  1ZSQ A;  4NY0 A;  1DDV A;  4K2O A;  4A6H A;  3WA0 A;  2VRW B;  2Y7B A;  1U2B A;  5J3Y A;  5C5B B;  4HDO A;  2M14 A;  4TKN A;  2L2I A;  3NSU A;  1PFJ A;  2IFS A;  2ROZ B;  2H7D A;  1XKE A;  1V5P A;  3A8Q A;  2RVB B;  3U7D A;  2YRY A;  3KRW A;  4GMV A;  1W1H A;  5HE3 A;  2QKL A;  1LB1 A;  1U5F A;  2UZS A;  3VIA A;  1K5D B;  4HAU B;  3DXC A;  2EC1 A;  1DDM A;  2CAY A;  4ZRK A;  1U5D A;  5KQ1 A;  1M7R A;  2P0D A;  2D10 A;  1NU2 A;  3OAN A;  2CY5 A;  2K2J A;  1DYN A;  1H10 A;  1KZ7 A;  3A8P A;  4DX9 0;  2RUK B;  2KGX B;  1MIX A;  1OQN A;  4HAZ B;  3ML4 A;  5DI9 B;  4A5K A;  3BIN A;  3ODX A;  5HE1 A;  2MDX A;  2DHJ A;  1V88 A;  3F5R A;  4HB2 B;  3HK0 A;  2BCJ A;  4MY6 A;  1TJ6 A;  5D3X A;  4MT7 A;  2MFQ A;  4NSW A;  1EVH A;  5C16 A;  3ODW A;  3O96 A;  2GJY A;  2RGN B;  2D11 A;  3PVL A;  2ELA A;  4GMX B;  4HHV A;  4CHJ A;  2OTX A;  2LOX A;  5HE0 A;  5D3Y A;  4ZRJ A;  1NI2 A;  2DX1 A;  1WGQ A;  5C79 A;  1Z87 A;  1SHC A;  4C0A A;  4TYZ A;  3PVU A;  2D9W A;  3P6A A;  2NZ8 B;  4WJ7 A;  2D4Q A;  2EMS A;  2EJ8 A;  3ULC A;  5FI0 A;  4L6E A;  5DHA B;  1WG7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...