2CRFA

Solution structure of the ran_bp1 domain of ran-binding protein-3
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
150
structure length
150
Chain Sequence
b'GSSGSSGTARKCLLEKVEVITGEEAESNVLQMQCKLFVFDKTSQSWVERGRGLLRLNDMASTDDGTLQSRLVMRTQGSLRLILNTKLWAQMQIDKASEKSIHITAMDTEDQGVKVFLISASSKDTGQLYAALHHRILALRSRVESGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RAN binding protein 3
publication title Solution structure of the Ran_BP1 domain of RAN-binding protein-3
rcsb
source organism Homo sapiens
molecule tags Transport protein
total genus 17
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2005-05-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00638 Ran_BP1 RanBP1 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2crfA01
3D8DA 1OQNA 3U8ZA 3LJUX 4HAXB 1BAKA 3PVWA 5C79A 3U7DA 3QIJA 1WJMA 3GYOA 3PP2A 2D9VA 1KI1B 2Z0PA 1LW3A 1DDWA 2RGNB 1MPHA 1XKEA 1AWEA 3D8EA 1V5MA 2D9XA 2DN6A 1DDVA 3TVVA 2M38A 3IVFA 3AJ4A 5D27A 2J0MA 4ZRJA 5JHGA 2LOZA 2RNRB 1XCGA 3PVUA 1WVHA 1EVHA 3PVLA 2DX5A 2IYBA 4HB4B 4HAYB 1W1HA 2V76A 2YT1A 4HHVA 3MDBC 2N23A 2LKOA 2J59M 1M7RA 4KAXB 3DXDA 4HAVB 4WJ7A 5DH9B 1FB8A 1V88A 2AL6A 4BBKA 1KZGA 2G35A 1UNQA 2ROZB 4HAUB 1U2BA 1H4RA 4NY0A 1WG7A 5HE1A 5L81A 2W2XC 4GMXB 2H7EA 4YONA 3TO1A 4HAZB 1WJ1A 2ADZA 3NSUA 1P3RA 1ZC3B 2K2JA 2J0JA 3TW1A 2LULA 1PLSA 3TCAA 1X86A 2CAYA 4D0NB 2DHIA 2GCLA 2NZ8B 1FAOA 2EJ8A 3P7ZA 1PFJA 2DA0A 1SHCA 3AU4A 3N7CA 2GS0A 3ODOA 2DYNA 1EF1A 2N0YA 2PZ1A 2DKPA 1V5UA 1X05A 1ZSQA 3CXBB 3GYPA 1MK7B 1W1DA 4DX90 2Y8GA 2DHJA 1U5GA 1GG3A 3TFMA 5D3WA 2COFA 2XQNM 2YRYA 5C5BB 1B55A 4C0AA 3PG7A 4Y94A 1DBHA 2DLWA 1MAIA 1OY2A 2COAA 1MK9B 3FEHA 2RSGA 1UNRA 1RJ2A 2RLOA 2FJLA 3FM8C 3T06A 2I1KA 2L1CA 2YSZA 5HE3A 2YT0A 1W1GA 1WGUA 1EGXA 4GMVA 2M14A 1NTVA 2IFSA 3ODWA 4CHMA 5C5BA 4HB2B 3CIKA 1XX0A 1GC6A 2W2WA 2OQBA 3F5RA 2HE7A 4CYEA 4MT7A 2ELAA 2DX1A 5FI0A 1ISNA 4WVFB 2P0FA 1J19A 1UNPA 3ULCA 1LB1A 4YL8A 2EMTA 4L6EA 2VRWB 4DXAB 3VOQA 1UPRA 4K81A 2ELBA 3A98B 5LONB 4CHJA 4F7GA 1WI1A 1AQCA 3BJIA 1NI2A 2J0KA 2ZPYA 3SV1A 1GC7A 4K17A 2BCJA 3V5WA 2DYQA 4IAPA 2RUKB 1P6SA 1I2HA 5LOPB 3SNHA 1KZ7A 2CODA 2LYDA 4Z2MB 3PSCA 1DDMA 2EMSA 3A8PA 5EFXA 3UZTA 2D2QA 2P8VA 1UPQA 2GCJA 1XD4A 1XR0B 1SGHA 2CY5A 2Y7BA 1Y19B 4IOYX 4EJNA 3PZDA 2KUPA 5KQ4A 4A6FB 5J3YA 3X23A 4EMOA 3AU5A 4Z2NA 1IRSA 2MWNB 5CLQB 3ZVRA 2H7DA 1FGZA 1BTKA 4GXBA 1BWNA 1Y5OA 5J3QA 1Z87A 1Q67A 4XWXA 2D9YA 4KHOA 3ULBA 4MK0A 2UVMA 4B6HA 1V89A 5DI9B 1EAZA 4H8SA 1ZM0A 2YVCA 4PQ0A 3ODXA 3HK0A 2ROVA 3QBVB 2Z0OA 2Z0QA 3SUZA 4A6FA 1TQZA 2UZSA 4KVGB 1V5PA 3FSSA 2W2XD 2MDXA 4PNKA 1ZC4B 2DTCA 2D4QA 4HAWB 2UZRA 3DXEA 5D3YA 1WGQA 1P5TA 5DIFB 1UEFA 3ML4A 2E2XA 2CY4A 4A6HA 1MIXA 4IFSA 3RCPA 1U29A 2VKIA 1OMWA 4HDQA 3HQCA 2AEHA 2L2IA 1H10A 3WYFB 1NTYA 4MY6A 2DFKA 3G9WA 3PEGA 1FHWA 3KY9A 4K2PA 5J3TA 1RRPB 1QC6A 2QKLA 2NMBA 1X1FA 1MIZB 2P0DA 3O96A 2I5FA 3KRWA 1FGYA 1N3HA 4HATB 1DROA 2COCA 2Y8FA 1K5DB 2R0DA 4HDOA 5KQ1A 2I1JA 1TXDA 2K2UA 5CLLB 2DKQA 3A8QA 3WA0A 3P6AA 2EC1A 4A6KA 2YS5A 1E5WA 1J0WA 5GOWB 3SO6A 1V61A 4EKUA 3ZDTA 2X18A 5JLJB 3KZ1A 5C16A 1U5EA 5DHAB 1X11A 4WSFA 2K00A 4DX8A 1PMSA 2R09A 5HE2A 1QQGA 3KRXA 4HB3B 2QKMA 4KHAA 1I7AA 4KHBB 2D11A 4GN1A 4ZRKA 2YS1A 3KSYA 1MKEA 4P7IA 2D9WA 1U27A 3VIAA 1FOEA 4F7HA 2I5CA 1X1GA 1NU2A 5DHFB 2LG1A 4HB0B 4NSWA 2DHKA 1M7EA 2KCJA 2KGXB 4DBBA 2OTXA 4GZUA 2D9ZA 3M1IB 5C6RA 2P0HA 4K2OA 5JHHA 2D10A 3QWMA 5D3XA 5KCVA 5D3VA 2LOXA 3MPXA 1DYNA 2MFQA 4F7UP 5HE0A 1U5FA 2RVBB 5FI1A 4ZRIA 1XODA 2GJYA 4GPTB 3D8FA 4TKNA 4A5KA 2Q13A 3HW2B 2HTHB 2MKRA 3OANA 1K5GB 3SYXA 1ZVRA 2YS3A 2VSZA 2CRFA 1BTNA 2YF0A 1FHXA 3DXCA 3F0WA 5JP4A 2JP2A 1TJ6A 3BINA 4TYZA 1U5DA 1FHOA
chains in the Genus database with same CATH superfamily
3D8DA 1OQNA 3U8ZA 3LJUX 4HAXB 1BAKA 3PVWA 5C79A 3U7DA 3QIJA 1WJMA 3GYOA 3PP2A 2KUQA 2D9VA 1KI1B 5I2SA 2Z0PA 1LW3A 1DDWA 2RGNB 1MPHA 1XKEA 1AWEA 3D8EA 4GOUA 1V5MA 4QJ5B 2D9XA 2DN6A 3HSAA 1DDVA 3TVVA 2M38A 5LG4B 3IVFA 3AJ4A 5D27A 2J0MA 3NWAA 4ZRJA 3FVCA 5JHGA 2LOZA 2RNRB 1XCGA 3PVUA 1WVHA 1EVHA 3PVLA 2DX5A 2KIEA 2IYBA 4HB4B 4HAYB 1W1HA 2V76A 2YT1A 4HHVA 3MDBC 2N23A 2LKOA 1T77A 2J59M 1M7RA 4DIXA 4KAXB 3DXDA 4HAVB 4WJ7A 5DH9B 1FB8A 1V88A 3A58A 2AL6A 4BBKA 1KZGA 2G35A 2Z4DA 1UNQA 2ROZB 4HAUB 1U2BA 1H4RA 4NY0A 1WG7A 5HE1A 5L81A 2W2XC 4GMXB 2H7EA 5IRSA 4YONA 3TO1A 4HAZB 1WJ1A 2ADZA 3NSUA 1P3RA 1ZC3B 2K2JA 2J0JA 3TW1A 2LULA 1PLSA 3TCAA 1X86A 2CAYA 4CSQA 4D0NB 2DHIA 2GCLA 2NZ8B 1FAOA 2EJ8A 3P7ZA 1PFJA 2DA0A 1SHCA 3AU4A 3N7CA 2GS0A 3ODOA 2DYNA 3OHMB 1EF1A 2N0YA 2PZ1A 3U12A 2DKPA 1V5UA 1X05A 1ZSQA 3CXBB 3GYPA 1MK7B 1W1DA 5M4YB 4DX90 4D6WA 1ZYIA 2Y8GA 2DHJA 1U5GA 1GG3A 3TFMA 5D3WA 2COFA 2XQNM 2YRYA 5C5BB 1B55A 4C0AA 3PG7A 4Y94A 1DBHA 2DLWA 1MAIA 1OY2A 2COAA 1MK9B 3FEHA 2RSGA 1UNRA 1RJ2A 2R2YA 2RLOA 2FJLA 3FM8C 3T06A 2I1KA 2L1CA 4QXAB 2YSZA 5HE3A 2YT0A 1W1GA 1WGUA 1EGXA 4GMVA 2M14A 1NTVA 2IFSA 3ODWA 4CHMA 5C5BA 4HB2B 3CIKA 1XX0A 1GC6A 2W2WA 2OQBA 3F5RA 4OT1A 2HE7A 4CYEA 4MT7A 4QJ3B 2ELAA 2DX1A 5FI0A 1ISNA 4WVFB 2P0FA 1J19A 1UNPA 3ULCA 1LB1A 4YL8A 2EMTA 4L6EA 2VRWB 4DXAB 4HSIA 3VOQA 2Z13A 1UPRA 4K81A 2ELBA 3A98B 5LONB 4CHJA 4F7GA 1WI1A 2K49A 1AQCA 3BJIA 1NI2A 2J0KA 2ZPYA 3SV1A 1GC7A 4K17A 2BCJA 2GUMA 3V5WA 2DYQA 4IAPA 2RUKB 1P6SA 1I2HA 5LOPB 3SNHA 1KZ7A 2CODA 2LYDA 2RRFA 3PSCA 4Z2MB 1DDMA 2EMSA 3A8PA 5EFXA 3UZTA 2D2QA 2P8VA 1UPQA 2GCJA 2K8EA 1XD4A 1XR0B 1SGHA 2CY5A 2Y7BA 1Y19B 4IOYX 4EJNA 3PZDA 2KUPA 5KQ4A 4A6FB 5J3YA 3X23A 4EMOA 3AU5A 3NWDA 4Z2NA 1IRSA 2MWNB 3DCXA 5CLQB 3ZVRA 3B77A 2H7DA 1FGZA 1BTKA 4GXBA 1BWNA 4OSNA 1Y5OA 2Z14A 5J3QA 1Z87A 1Q67A 4XWXA 2D9YA 4KHOA 3ULBA 4MK0A 2UVMA 4B6HA 1V89A 2KR0A 5DI9B 1EAZA 4H8SA 1ZM0A 2YVCA 4PQ0A 3ODXA 3HK0A 2ROVA 3QBVB 2Z0OA 2Z0QA 3SUZA 4A6FA 5I2MA 1TQZA 2KIGA 2UZSA 4KVGB 1V5PA 3FSSA 2W2XD 2MDXA 4PNKA 1ZC4B 2DTCA 2D4QA 4HAWB 2UZRA 3DXEA 5D3YA 1WGQA 1P5TA 5DIFB 1UEFA 3ML4A 2E2XA 2CY4A 4A6HA 1MIXA 4IFSA 3RCPA 1U29A 2NBVA 2VKIA 1OMWA 4HDQA 3HQCA 2AEHA 2L2IA 1H10A 3WYFB 1NTYA 4MY6A 2DFKA 3G9WA 3PEGA 1FHWA 3KY9A 4K2PA 5J3TA 1RRPB 1QC6A 2QKLA 3HIEA 2NMBA 1X1FA 1MIZB 2P0DA 3O96A 2I5FA 2Z59A 3KRWA 1FGYA 1N3HA 4HATB 1DROA 2COCA 2Y8FA 1K5DB 2R0DA 4HDOA 5KQ1A 2I1JA 1TXDA 2K2UA 5CLLB 2DKQA 3A8QA 3WA0A 3P6AA 2EC1A 4GNKB 4A6KA 2YS5A 4L1RA 1E5WA 1J0WA 5GOWB 3SO6A 1V61A 4EKUA 3ZDTA 2X18A 5JLJB 3KZ1A 5C16A 1U5EA 5DHAB 1X11A 4WSFA 2K00A 4DX8A 1PMSA 2R09A 5HE2A 1QQGA 3KRXA 4HB3B 2QKMA 4KHAA 1I7AA 4KHBB 2D11A 3NW8A 4GN1A 4ZRKA 2YS1A 3KSYA 1MKEA 4P7IA 2D9WA 1U27A 3VIAA 1FOEA 4F7HA 2I5CA 1X1GA 1NU2A 5DHFB 2LG1A 4HB0B 4NSWA 4QJ4B 2DHKA 1M7EA 2KCJA 2KGXB 4DBBA 2OTXA 4KHBA 4GZUA 2D9ZA 3M1IB 5C6RA 2P0HA 4K2OA 5JHHA 2D10A 3QWMA 5D3XA 5KCVA 5D3VA 2ZKMX 2LOXA 3MPXA 1DYNA 2MFQA 4F7UP 5HE0A 1U5FA 2RVBB 5FI1A 4ZRIA 1XODA 2GJYA 4GPTB 3D8FA 2YT2A 4TKNA 4A5KA 2Q13A 3HW2B 2HTHB 2FJUB 2MKRA 3OANA 1K5GB 3SYXA 1ZVRA 2YS3A 2VSZA 2CRFA 1BTNA 2YF0A 1FHXA 3DXCA 3F0WA 5JP4A 1MI1A 2JP2A 1TJ6A 3BINA 3NWFA 4TYZA 1U5DA 1FHOA
chains in the Genus database with same CATH topology
3D8DA 1OQNA 3U8ZA 3LJUX 4HAXB 1BAKA 3PVWA 5C79A 3U7DA 3QIJA 1WJMA 3GYOA 3PP2A 2D9VA 1KI1B 2Z0PA 1LW3A 1DDWA 2RGNB 1MPHA 1XKEA 1AWEA 3D8EA 1V5MA 2D9XA 2DN6A 1DDVA 3TVVA 2M38A 3IVFA 3AJ4A 5D27A 2J0MA 4ZRJA 5JHGA 2LOZA 2RNRB 1XCGA 3PVUA 1WVHA 1EVHA 3PVLA 2DX5A 2IYBA 4HB4B 4HAYB 1W1HA 2V76A 2YT1A 4HHVA 3MDBC 2N23A 2LKOA 2J59M 1M7RA 4KAXB 3DXDA 4HAVB 4WJ7A 5DH9B 1FB8A 1V88A 2AL6A 4BBKA 1KZGA 2G35A 1UNQA 2ROZB 4HAUB 1U2BA 1H4RA 4NY0A 1WG7A 5HE1A 5L81A 2W2XC 4GMXB 2H7EA 4YONA 3TO1A 4HAZB 1WJ1A 2ADZA 3NSUA 1P3RA 1ZC3B 2K2JA 2J0JA 3TW1A 2LULA 1PLSA 3TCAA 1X86A 2CAYA 4D0NB 2DHIA 2GCLA 2NZ8B 1FAOA 2EJ8A 3P7ZA 1PFJA 2DA0A 1SHCA 3AU4A 3N7CA 2GS0A 3ODOA 2DYNA 1EF1A 2N0YA 2PZ1A 2DKPA 1V5UA 1X05A 1ZSQA 3CXBB 3GYPA 1MK7B 1W1DA 4DX90 2Y8GA 2DHJA 1U5GA 1GG3A 3TFMA 5D3WA 2COFA 2XQNM 2YRYA 5C5BB 1B55A 4C0AA 3PG7A 4Y94A 1DBHA 2DLWA 1MAIA 1OY2A 2COAA 1MK9B 3FEHA 2RSGA 1UNRA 1RJ2A 2RLOA 2FJLA 3FM8C 3T06A 2I1KA 2L1CA 2YSZA 5HE3A 2YT0A 1W1GA 1WGUA 1EGXA 4GMVA 2M14A 1NTVA 2IFSA 3ODWA 4CHMA 5C5BA 4HB2B 3CIKA 1XX0A 1GC6A 2W2WA 2OQBA 3F5RA 2HE7A 4CYEA 4MT7A 2ELAA 2DX1A 5FI0A 1ISNA 4WVFB 2P0FA 1J19A 1UNPA 3ULCA 1LB1A 4YL8A 2EMTA 4L6EA 2VRWB 4DXAB 3VOQA 1UPRA 4K81A 2ELBA 3A98B 5LONB 4CHJA 4F7GA 1WI1A 1AQCA 3BJIA 1NI2A 2J0KA 2ZPYA 3SV1A 1GC7A 4K17A 2BCJA 3V5WA 2DYQA 4IAPA 2RUKB 1P6SA 1I2HA 5LOPB 3SNHA 1KZ7A 2CODA 2LYDA 4Z2MB 3PSCA 1DDMA 2EMSA 3A8PA 5EFXA 3UZTA 2D2QA 2P8VA 1UPQA 2GCJA 1XD4A 1XR0B 1SGHA 2CY5A 2Y7BA 1Y19B 4IOYX 4EJNA 3PZDA 2KUPA 5KQ4A 4A6FB 5J3YA 3X23A 4EMOA 3AU5A 4Z2NA 1IRSA 2MWNB 5CLQB 3ZVRA 2H7DA 1FGZA 1BTKA 4GXBA 1BWNA 1Y5OA 5J3QA 1Z87A 1Q67A 4XWXA 2D9YA 4KHOA 3ULBA 4MK0A 2UVMA 4B6HA 1V89A 5DI9B 1EAZA 4H8SA 1ZM0A 2YVCA 4PQ0A 3ODXA 3HK0A 2ROVA 3QBVB 2Z0OA 2Z0QA 3SUZA 4A6FA 1TQZA 2UZSA 4KVGB 1V5PA 3FSSA 2W2XD 2MDXA 4PNKA 1ZC4B 2DTCA 2D4QA 4HAWB 2UZRA 3DXEA 5D3YA 1WGQA 1P5TA 5DIFB 1UEFA 3ML4A 2E2XA 2CY4A 4A6HA 1MIXA 4IFSA 3RCPA 1U29A 2VKIA 1OMWA 4HDQA 3HQCA 2AEHA 2L2IA 1H10A 3WYFB 1NTYA 4MY6A 2DFKA 3G9WA 3PEGA 1FHWA 3KY9A 4K2PA 5J3TA 1RRPB 1QC6A 2QKLA 2NMBA 1X1FA 1MIZB 2P0DA 3O96A 2I5FA 3KRWA 1FGYA 1N3HA 4HATB 1DROA 2COCA 2Y8FA 1K5DB 2R0DA 4HDOA 5KQ1A 2I1JA 1TXDA 2K2UA 5CLLB 2DKQA 3A8QA 3WA0A 3P6AA 2EC1A 4A6KA 2YS5A 1E5WA 1J0WA 5GOWB 3SO6A 1V61A 4EKUA 3ZDTA 2X18A 5JLJB 3KZ1A 5C16A 1U5EA 5DHAB 1X11A 4WSFA 2K00A 4DX8A 1PMSA 2R09A 5HE2A 1QQGA 3KRXA 4HB3B 2QKMA 4KHAA 1I7AA 4KHBB 2D11A 4GN1A 4ZRKA 2YS1A 3KSYA 1MKEA 4P7IA 2D9WA 1U27A 3VIAA 1FOEA 4F7HA 2I5CA 1X1GA 1NU2A 5DHFB 2LG1A 4HB0B 4NSWA 2DHKA 1M7EA 2KCJA 2KGXB 4DBBA 2OTXA 4GZUA 2D9ZA 3M1IB 5C6RA 2P0HA 4K2OA 5JHHA 2D10A 3QWMA 5D3XA 5KCVA 5D3VA 2LOXA 3MPXA 1DYNA 2MFQA 4F7UP 5HE0A 1U5FA 2RVBB 5FI1A 4ZRIA 1XODA 2GJYA 4GPTB 3D8FA 4TKNA 4A5KA 2Q13A 3HW2B 2HTHB 2MKRA 3OANA 1K5GB 3SYXA 1ZVRA 2YS3A 2VSZA 2CRFA 1BTNA 2YF0A 1FHXA 3DXCA 3F0WA 5JP4A 2JP2A 1TJ6A 3BINA 4TYZA 1U5DA 1FHOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3D8D A;  1OQN A;  3U8Z A;  3LJU X;  4HAX B;  1BAK A;  3PVW A;  5C79 A;  3U7D A;  3QIJ A;  1WJM A;  3GYO A;  3PP2 A;  2D9V A;  1KI1 B;  2Z0P A;  1LW3 A;  1DDW A;  2RGN B;  1MPH A;  1XKE A;  1AWE A;  3D8E A;  1V5M A;  2D9X A;  2DN6 A;  1DDV A;  3TVV A;  2M38 A;  3IVF A;  3AJ4 A;  5D27 A;  2J0M A;  4ZRJ A;  5JHG A;  2LOZ A;  2RNR B;  1XCG A;  3PVU A;  1WVH A;  1EVH A;  3PVL A;  2DX5 A;  2IYB A;  4HB4 B;  4HAY B;  1W1H A;  2V76 A;  2YT1 A;  4HHV A;  3MDB C;  2N23 A;  2LKO A;  2J59 M;  1M7R A;  4KAX B;  3DXD A;  4HAV B;  4WJ7 A;  5DH9 B;  1FB8 A;  1V88 A;  2AL6 A;  4BBK A;  1KZG A;  2G35 A;  1UNQ A;  2ROZ B;  4HAU B;  1U2B A;  1H4R A;  4NY0 A;  1WG7 A;  5HE1 A;  5L81 A;  2W2X C;  4GMX B;  2H7E A;  4YON A;  3TO1 A;  4HAZ B;  1WJ1 A;  2ADZ A;  3NSU A;  1P3R A;  1ZC3 B;  2K2J A;  2J0J A;  3TW1 A;  2LUL A;  1PLS A;  3TCA A;  1X86 A;  2CAY A;  4D0N B;  2DHI A;  2GCL A;  2NZ8 B;  1FAO A;  2EJ8 A;  3P7Z A;  1PFJ A;  2DA0 A;  1SHC A;  3AU4 A;  3N7C A;  2GS0 A;  3ODO A;  2DYN A;  1EF1 A;  2N0Y A;  2PZ1 A;  2DKP A;  1V5U A;  1X05 A;  1ZSQ A;  3CXB B;  3GYP A;  1MK7 B;  1W1D A;  4DX9 0;  2Y8G A;  2DHJ A;  1U5G A;  1GG3 A;  3TFM A;  5D3W A;  2COF A;  2XQN M;  2YRY A;  5C5B B;  1B55 A;  4C0A A;  3PG7 A;  4Y94 A;  1DBH A;  2DLW A;  1MAI A;  1OY2 A;  2COA A;  1MK9 B;  3FEH A;  2RSG A;  1UNR A;  1RJ2 A;  2RLO A;  2FJL A;  3FM8 C;  3T06 A;  2I1K A;  2L1C A;  2YSZ A;  5HE3 A;  2YT0 A;  1W1G A;  1WGU A;  1EGX A;  4GMV A;  2M14 A;  1NTV A;  2IFS A;  3ODW A;  4CHM A;  5C5B A;  4HB2 B;  3CIK A;  1XX0 A;  1GC6 A;  2W2W A;  2OQB A;  3F5R A;  2HE7 A;  4CYE A;  4MT7 A;  2ELA A;  2DX1 A;  5FI0 A;  1ISN A;  4WVF B;  2P0F A;  1J19 A;  1UNP A;  3ULC A;  1LB1 A;  4YL8 A;  2EMT A;  4L6E A;  2VRW B;  4DXA B;  3VOQ A;  1UPR A;  4K81 A;  2ELB A;  3A98 B;  5LON B;  4CHJ A;  4F7G A;  1WI1 A;  1AQC A;  3BJI A;  1NI2 A;  2J0K A;  2ZPY A;  3SV1 A;  1GC7 A;  4K17 A;  2BCJ A;  3V5W A;  2DYQ A;  4IAP A;  2RUK B;  1P6S A;  1I2H A;  5LOP B;  3SNH A;  1KZ7 A;  2COD A;  2LYD A;  4Z2M B;  3PSC A;  1DDM A;  2EMS A;  3A8P A;  5EFX A;  3UZT A;  2D2Q A;  2P8V A;  1UPQ A;  2GCJ A;  1XD4 A;  1XR0 B;  1SGH A;  2CY5 A;  2Y7B A;  1Y19 B;  4IOY X;  4EJN A;  3PZD A;  2KUP A;  5KQ4 A;  4A6F B;  5J3Y A;  3X23 A;  4EMO A;  3AU5 A;  4Z2N A;  1IRS A;  2MWN B;  5CLQ B;  3ZVR A;  2H7D A;  1FGZ A;  1BTK A;  4GXB A;  1BWN A;  1Y5O A;  5J3Q A;  1Z87 A;  1Q67 A;  4XWX A;  2D9Y A;  4KHO A;  3ULB A;  4MK0 A;  2UVM A;  4B6H A;  1V89 A;  5DI9 B;  1EAZ A;  4H8S A;  1ZM0 A;  2YVC A;  4PQ0 A;  3ODX A;  3HK0 A;  2ROV A;  3QBV B;  2Z0O A;  2Z0Q A;  3SUZ A;  4A6F A;  1TQZ A;  2UZS A;  4KVG B;  1V5P A;  3FSS A;  2W2X D;  2MDX A;  4PNK A;  1ZC4 B;  2DTC A;  2D4Q A;  4HAW B;  2UZR A;  3DXE A;  5D3Y A;  1WGQ A;  1P5T A;  5DIF B;  1UEF A;  3ML4 A;  2E2X A;  2CY4 A;  4A6H A;  1MIX A;  4IFS A;  3RCP A;  1U29 A;  2VKI A;  1OMW A;  4HDQ A;  3HQC A;  2AEH A;  2L2I A;  1H10 A;  3WYF B;  1NTY A;  4MY6 A;  2DFK A;  3G9W A;  3PEG A;  1FHW A;  3KY9 A;  4K2P A;  5J3T A;  1RRP B;  1QC6 A;  2QKL A;  2NMB A;  1X1F A;  1MIZ B;  2P0D A;  3O96 A;  2I5F A;  3KRW A;  1FGY A;  1N3H A;  4HAT B;  1DRO A;  2COC A;  2Y8F A;  1K5D B;  2R0D A;  4HDO A;  5KQ1 A;  2I1J A;  1TXD A;  2K2U A;  5CLL B;  2DKQ A;  3A8Q A;  3WA0 A;  3P6A A;  2EC1 A;  4A6K A;  2YS5 A;  1E5W A;  1J0W A;  5GOW B;  3SO6 A;  1V61 A;  4EKU A;  3ZDT A;  2X18 A;  5JLJ B;  3KZ1 A;  5C16 A;  1U5E A;  5DHA B;  1X11 A;  4WSF A;  2K00 A;  4DX8 A;  1PMS A;  2R09 A;  5HE2 A;  1QQG A;  3KRX A;  4HB3 B;  2QKM A;  4KHA A;  1I7A A;  4KHB B;  2D11 A;  4GN1 A;  4ZRK A;  2YS1 A;  3KSY A;  1MKE A;  4P7I A;  2D9W A;  1U27 A;  3VIA A;  1FOE A;  4F7H A;  2I5C A;  1X1G A;  1NU2 A;  5DHF B;  2LG1 A;  4HB0 B;  4NSW A;  2DHK A;  1M7E A;  2KCJ A;  2KGX B;  4DBB A;  2OTX A;  4GZU A;  2D9Z A;  3M1I B;  5C6R A;  2P0H A;  4K2O A;  5JHH A;  2D10 A;  3QWM A;  5D3X A;  5KCV A;  5D3V A;  2LOX A;  3MPX A;  1DYN A;  2MFQ A;  4F7U P;  5HE0 A;  1U5F A;  2RVB B;  5FI1 A;  4ZRI A;  1XOD A;  2GJY A;  4GPT B;  3D8F A;  4TKN A;  4A5K A;  2Q13 A;  3HW2 B;  2HTH B;  2MKR A;  3OAN A;  1K5G B;  3SYX A;  1ZVR A;  2YS3 A;  2VSZ A;  2CRF A;  1BTN A;  2YF0 A;  1FHX A;  3DXC A;  3F0W A;  5JP4 A;  2JP2 A;  1TJ6 A;  3BIN A;  4TYZ A;  1U5D A;  1FHO A; 
#chains in the Genus database with same CATH topology
 3D8D A;  1OQN A;  3U8Z A;  3LJU X;  4HAX B;  1BAK A;  3PVW A;  5C79 A;  3U7D A;  3QIJ A;  1WJM A;  3GYO A;  3PP2 A;  2KUQ A;  2D9V A;  1KI1 B;  5I2S A;  2Z0P A;  1LW3 A;  1DDW A;  2RGN B;  1MPH A;  1XKE A;  1AWE A;  3D8E A;  4GOU A;  1V5M A;  4QJ5 B;  2D9X A;  2DN6 A;  3HSA A;  1DDV A;  3TVV A;  2M38 A;  5LG4 B;  3IVF A;  3AJ4 A;  5D27 A;  2J0M A;  3NWA A;  4ZRJ A;  3FVC A;  5JHG A;  2LOZ A;  2RNR B;  1XCG A;  3PVU A;  1WVH A;  1EVH A;  3PVL A;  2DX5 A;  2KIE A;  2IYB A;  4HB4 B;  4HAY B;  1W1H A;  2V76 A;  2YT1 A;  4HHV A;  3MDB C;  2N23 A;  2LKO A;  1T77 A;  2J59 M;  1M7R A;  4DIX A;  4KAX B;  3DXD A;  4HAV B;  4WJ7 A;  5DH9 B;  1FB8 A;  1V88 A;  3A58 A;  2AL6 A;  4BBK A;  1KZG A;  2G35 A;  2Z4D A;  1UNQ A;  2ROZ B;  4HAU B;  1U2B A;  1H4R A;  4NY0 A;  1WG7 A;  5HE1 A;  5L81 A;  2W2X C;  4GMX B;  2H7E A;  5IRS A;  4YON A;  3TO1 A;  4HAZ B;  1WJ1 A;  2ADZ A;  3NSU A;  1P3R A;  1ZC3 B;  2K2J A;  2J0J A;  3TW1 A;  2LUL A;  1PLS A;  3TCA A;  1X86 A;  2CAY A;  4CSQ A;  4D0N B;  2DHI A;  2GCL A;  2NZ8 B;  1FAO A;  2EJ8 A;  3P7Z A;  1PFJ A;  2DA0 A;  1SHC A;  3AU4 A;  3N7C A;  2GS0 A;  3ODO A;  2DYN A;  3OHM B;  1EF1 A;  2N0Y A;  2PZ1 A;  3U12 A;  2DKP A;  1V5U A;  1X05 A;  1ZSQ A;  3CXB B;  3GYP A;  1MK7 B;  1W1D A;  5M4Y B;  4DX9 0;  4D6W A;  1ZYI A;  2Y8G A;  2DHJ A;  1U5G A;  1GG3 A;  3TFM A;  5D3W A;  2COF A;  2XQN M;  2YRY A;  5C5B B;  1B55 A;  4C0A A;  3PG7 A;  4Y94 A;  1DBH A;  2DLW A;  1MAI A;  1OY2 A;  2COA A;  1MK9 B;  3FEH A;  2RSG A;  1UNR A;  1RJ2 A;  2R2Y A;  2RLO A;  2FJL A;  3FM8 C;  3T06 A;  2I1K A;  2L1C A;  4QXA B;  2YSZ A;  5HE3 A;  2YT0 A;  1W1G A;  1WGU A;  1EGX A;  4GMV A;  2M14 A;  1NTV A;  2IFS A;  3ODW A;  4CHM A;  5C5B A;  4HB2 B;  3CIK A;  1XX0 A;  1GC6 A;  2W2W A;  2OQB A;  3F5R A;  4OT1 A;  2HE7 A;  4CYE A;  4MT7 A;  4QJ3 B;  2ELA A;  2DX1 A;  5FI0 A;  1ISN A;  4WVF B;  2P0F A;  1J19 A;  1UNP A;  3ULC A;  1LB1 A;  4YL8 A;  2EMT A;  4L6E A;  2VRW B;  4DXA B;  4HSI A;  3VOQ A;  2Z13 A;  1UPR A;  4K81 A;  2ELB A;  3A98 B;  5LON B;  4CHJ A;  4F7G A;  1WI1 A;  2K49 A;  1AQC A;  3BJI A;  1NI2 A;  2J0K A;  2ZPY A;  3SV1 A;  1GC7 A;  4K17 A;  2BCJ A;  2GUM A;  3V5W A;  2DYQ A;  4IAP A;  2RUK B;  1P6S A;  1I2H A;  5LOP B;  3SNH A;  1KZ7 A;  2COD A;  2LYD A;  2RRF A;  3PSC A;  4Z2M B;  1DDM A;  2EMS A;  3A8P A;  5EFX A;  3UZT A;  2D2Q A;  2P8V A;  1UPQ A;  2GCJ A;  2K8E A;  1XD4 A;  1XR0 B;  1SGH A;  2CY5 A;  2Y7B A;  1Y19 B;  4IOY X;  4EJN A;  3PZD A;  2KUP A;  5KQ4 A;  4A6F B;  5J3Y A;  3X23 A;  4EMO A;  3AU5 A;  3NWD A;  4Z2N A;  1IRS A;  2MWN B;  3DCX A;  5CLQ B;  3ZVR A;  3B77 A;  2H7D A;  1FGZ A;  1BTK A;  4GXB A;  1BWN A;  4OSN A;  1Y5O A;  2Z14 A;  5J3Q A;  1Z87 A;  1Q67 A;  4XWX A;  2D9Y A;  4KHO A;  3ULB A;  4MK0 A;  2UVM A;  4B6H A;  1V89 A;  2KR0 A;  5DI9 B;  1EAZ A;  4H8S A;  1ZM0 A;  2YVC A;  4PQ0 A;  3ODX A;  3HK0 A;  2ROV A;  3QBV B;  2Z0O A;  2Z0Q A;  3SUZ A;  4A6F A;  5I2M A;  1TQZ A;  2KIG A;  2UZS A;  4KVG B;  1V5P A;  3FSS A;  2W2X D;  2MDX A;  4PNK A;  1ZC4 B;  2DTC A;  2D4Q A;  4HAW B;  2UZR A;  3DXE A;  5D3Y A;  1WGQ A;  1P5T A;  5DIF B;  1UEF A;  3ML4 A;  2E2X A;  2CY4 A;  4A6H A;  1MIX A;  4IFS A;  3RCP A;  1U29 A;  2NBV A;  2VKI A;  1OMW A;  4HDQ A;  3HQC A;  2AEH A;  2L2I A;  1H10 A;  3WYF B;  1NTY A;  4MY6 A;  2DFK A;  3G9W A;  3PEG A;  1FHW A;  3KY9 A;  4K2P A;  5J3T A;  1RRP B;  1QC6 A;  2QKL A;  3HIE A;  2NMB A;  1X1F A;  1MIZ B;  2P0D A;  3O96 A;  2I5F A;  2Z59 A;  3KRW A;  1FGY A;  1N3H A;  4HAT B;  1DRO A;  2COC A;  2Y8F A;  1K5D B;  2R0D A;  4HDO A;  5KQ1 A;  2I1J A;  1TXD A;  2K2U A;  5CLL B;  2DKQ A;  3A8Q A;  3WA0 A;  3P6A A;  2EC1 A;  4GNK B;  4A6K A;  2YS5 A;  4L1R A;  1E5W A;  1J0W A;  5GOW B;  3SO6 A;  1V61 A;  4EKU A;  3ZDT A;  2X18 A;  5JLJ B;  3KZ1 A;  5C16 A;  1U5E A;  5DHA B;  1X11 A;  4WSF A;  2K00 A;  4DX8 A;  1PMS A;  2R09 A;  5HE2 A;  1QQG A;  3KRX A;  4HB3 B;  2QKM A;  4KHA A;  1I7A A;  4KHB B;  2D11 A;  3NW8 A;  4GN1 A;  4ZRK A;  2YS1 A;  3KSY A;  1MKE A;  4P7I A;  2D9W A;  1U27 A;  3VIA A;  1FOE A;  4F7H A;  2I5C A;  1X1G A;  1NU2 A;  5DHF B;  2LG1 A;  4HB0 B;  4NSW A;  4QJ4 B;  2DHK A;  1M7E A;  2KCJ A;  2KGX B;  4DBB A;  2OTX A;  4KHB A;  4GZU A;  2D9Z A;  3M1I B;  5C6R A;  2P0H A;  4K2O A;  5JHH A;  2D10 A;  3QWM A;  5D3X A;  5KCV A;  5D3V A;  2ZKM X;  2LOX A;  3MPX A;  1DYN A;  2MFQ A;  4F7U P;  5HE0 A;  1U5F A;  2RVB B;  5FI1 A;  4ZRI A;  1XOD A;  2GJY A;  4GPT B;  3D8F A;  2YT2 A;  4TKN A;  4A5K A;  2Q13 A;  3HW2 B;  2HTH B;  2FJU B;  2MKR A;  3OAN A;  1K5G B;  3SYX A;  1ZVR A;  2YS3 A;  2VSZ A;  2CRF A;  1BTN A;  2YF0 A;  1FHX A;  3DXC A;  3F0W A;  5JP4 A;  1MI1 A;  2JP2 A;  1TJ6 A;  3BIN A;  3NWF A;  4TYZ A;  1U5D A;  1FHO A; 
#chains in the Genus database with same CATH homology
 3D8D A;  1OQN A;  3U8Z A;  3LJU X;  4HAX B;  1BAK A;  3PVW A;  5C79 A;  3U7D A;  3QIJ A;  1WJM A;  3GYO A;  3PP2 A;  2D9V A;  1KI1 B;  2Z0P A;  1LW3 A;  1DDW A;  2RGN B;  1MPH A;  1XKE A;  1AWE A;  3D8E A;  1V5M A;  2D9X A;  2DN6 A;  1DDV A;  3TVV A;  2M38 A;  3IVF A;  3AJ4 A;  5D27 A;  2J0M A;  4ZRJ A;  5JHG A;  2LOZ A;  2RNR B;  1XCG A;  3PVU A;  1WVH A;  1EVH A;  3PVL A;  2DX5 A;  2IYB A;  4HB4 B;  4HAY B;  1W1H A;  2V76 A;  2YT1 A;  4HHV A;  3MDB C;  2N23 A;  2LKO A;  2J59 M;  1M7R A;  4KAX B;  3DXD A;  4HAV B;  4WJ7 A;  5DH9 B;  1FB8 A;  1V88 A;  2AL6 A;  4BBK A;  1KZG A;  2G35 A;  1UNQ A;  2ROZ B;  4HAU B;  1U2B A;  1H4R A;  4NY0 A;  1WG7 A;  5HE1 A;  5L81 A;  2W2X C;  4GMX B;  2H7E A;  4YON A;  3TO1 A;  4HAZ B;  1WJ1 A;  2ADZ A;  3NSU A;  1P3R A;  1ZC3 B;  2K2J A;  2J0J A;  3TW1 A;  2LUL A;  1PLS A;  3TCA A;  1X86 A;  2CAY A;  4D0N B;  2DHI A;  2GCL A;  2NZ8 B;  1FAO A;  2EJ8 A;  3P7Z A;  1PFJ A;  2DA0 A;  1SHC A;  3AU4 A;  3N7C A;  2GS0 A;  3ODO A;  2DYN A;  1EF1 A;  2N0Y A;  2PZ1 A;  2DKP A;  1V5U A;  1X05 A;  1ZSQ A;  3CXB B;  3GYP A;  1MK7 B;  1W1D A;  4DX9 0;  2Y8G A;  2DHJ A;  1U5G A;  1GG3 A;  3TFM A;  5D3W A;  2COF A;  2XQN M;  2YRY A;  5C5B B;  1B55 A;  4C0A A;  3PG7 A;  4Y94 A;  1DBH A;  2DLW A;  1MAI A;  1OY2 A;  2COA A;  1MK9 B;  3FEH A;  2RSG A;  1UNR A;  1RJ2 A;  2RLO A;  2FJL A;  3FM8 C;  3T06 A;  2I1K A;  2L1C A;  2YSZ A;  5HE3 A;  2YT0 A;  1W1G A;  1WGU A;  1EGX A;  4GMV A;  2M14 A;  1NTV A;  2IFS A;  3ODW A;  4CHM A;  5C5B A;  4HB2 B;  3CIK A;  1XX0 A;  1GC6 A;  2W2W A;  2OQB A;  3F5R A;  2HE7 A;  4CYE A;  4MT7 A;  2ELA A;  2DX1 A;  5FI0 A;  1ISN A;  4WVF B;  2P0F A;  1J19 A;  1UNP A;  3ULC A;  1LB1 A;  4YL8 A;  2EMT A;  4L6E A;  2VRW B;  4DXA B;  3VOQ A;  1UPR A;  4K81 A;  2ELB A;  3A98 B;  5LON B;  4CHJ A;  4F7G A;  1WI1 A;  1AQC A;  3BJI A;  1NI2 A;  2J0K A;  2ZPY A;  3SV1 A;  1GC7 A;  4K17 A;  2BCJ A;  3V5W A;  2DYQ A;  4IAP A;  2RUK B;  1P6S A;  1I2H A;  5LOP B;  3SNH A;  1KZ7 A;  2COD A;  2LYD A;  4Z2M B;  3PSC A;  1DDM A;  2EMS A;  3A8P A;  5EFX A;  3UZT A;  2D2Q A;  2P8V A;  1UPQ A;  2GCJ A;  1XD4 A;  1XR0 B;  1SGH A;  2CY5 A;  2Y7B A;  1Y19 B;  4IOY X;  4EJN A;  3PZD A;  2KUP A;  5KQ4 A;  4A6F B;  5J3Y A;  3X23 A;  4EMO A;  3AU5 A;  4Z2N A;  1IRS A;  2MWN B;  5CLQ B;  3ZVR A;  2H7D A;  1FGZ A;  1BTK A;  4GXB A;  1BWN A;  1Y5O A;  5J3Q A;  1Z87 A;  1Q67 A;  4XWX A;  2D9Y A;  4KHO A;  3ULB A;  4MK0 A;  2UVM A;  4B6H A;  1V89 A;  5DI9 B;  1EAZ A;  4H8S A;  1ZM0 A;  2YVC A;  4PQ0 A;  3ODX A;  3HK0 A;  2ROV A;  3QBV B;  2Z0O A;  2Z0Q A;  3SUZ A;  4A6F A;  1TQZ A;  2UZS A;  4KVG B;  1V5P A;  3FSS A;  2W2X D;  2MDX A;  4PNK A;  1ZC4 B;  2DTC A;  2D4Q A;  4HAW B;  2UZR A;  3DXE A;  5D3Y A;  1WGQ A;  1P5T A;  5DIF B;  1UEF A;  3ML4 A;  2E2X A;  2CY4 A;  4A6H A;  1MIX A;  4IFS A;  3RCP A;  1U29 A;  2VKI A;  1OMW A;  4HDQ A;  3HQC A;  2AEH A;  2L2I A;  1H10 A;  3WYF B;  1NTY A;  4MY6 A;  2DFK A;  3G9W A;  3PEG A;  1FHW A;  3KY9 A;  4K2P A;  5J3T A;  1RRP B;  1QC6 A;  2QKL A;  2NMB A;  1X1F A;  1MIZ B;  2P0D A;  3O96 A;  2I5F A;  3KRW A;  1FGY A;  1N3H A;  4HAT B;  1DRO A;  2COC A;  2Y8F A;  1K5D B;  2R0D A;  4HDO A;  5KQ1 A;  2I1J A;  1TXD A;  2K2U A;  5CLL B;  2DKQ A;  3A8Q A;  3WA0 A;  3P6A A;  2EC1 A;  4A6K A;  2YS5 A;  1E5W A;  1J0W A;  5GOW B;  3SO6 A;  1V61 A;  4EKU A;  3ZDT A;  2X18 A;  5JLJ B;  3KZ1 A;  5C16 A;  1U5E A;  5DHA B;  1X11 A;  4WSF A;  2K00 A;  4DX8 A;  1PMS A;  2R09 A;  5HE2 A;  1QQG A;  3KRX A;  4HB3 B;  2QKM A;  4KHA A;  1I7A A;  4KHB B;  2D11 A;  4GN1 A;  4ZRK A;  2YS1 A;  3KSY A;  1MKE A;  4P7I A;  2D9W A;  1U27 A;  3VIA A;  1FOE A;  4F7H A;  2I5C A;  1X1G A;  1NU2 A;  5DHF B;  2LG1 A;  4HB0 B;  4NSW A;  2DHK A;  1M7E A;  2KCJ A;  2KGX B;  4DBB A;  2OTX A;  4GZU A;  2D9Z A;  3M1I B;  5C6R A;  2P0H A;  4K2O A;  5JHH A;  2D10 A;  3QWM A;  5D3X A;  5KCV A;  5D3V A;  2LOX A;  3MPX A;  1DYN A;  2MFQ A;  4F7U P;  5HE0 A;  1U5F A;  2RVB B;  5FI1 A;  4ZRI A;  1XOD A;  2GJY A;  4GPT B;  3D8F A;  4TKN A;  4A5K A;  2Q13 A;  3HW2 B;  2HTH B;  2MKR A;  3OAN A;  1K5G B;  3SYX A;  1ZVR A;  2YS3 A;  2VSZ A;  2CRF A;  1BTN A;  2YF0 A;  1FHX A;  3DXC A;  3F0W A;  5JP4 A;  2JP2 A;  1TJ6 A;  3BIN A;  4TYZ A;  1U5D A;  1FHO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...