2CRFA

Solution structure of the ran_bp1 domain of ran-binding protein-3
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
150
structure length
150
Chain Sequence
GSSGSSGTARKCLLEKVEVITGEEAESNVLQMQCKLFVFDKTSQSWVERGRGLLRLNDMASTDDGTLQSRLVMRTQGSLRLILNTKLWAQMQIDKASEKSIHITAMDTEDQGVKVFLISASSKDTGQLYAALHHRILALRSRVESGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RAN binding protein 3
publication title Solution structure of the Ran_BP1 domain of RAN-binding protein-3
rcsb
source organism Homo sapiens
molecule tags Transport protein
total genus 17
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2005-05-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00638 Ran_BP1 RanBP1 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2crfA01
4A5KA 1W1DA 2Y8GA 3KSYA 2K2UA 2KCJA 2DKPA 4KHOA 3SNHA 4GMVA 2YS3A 1UPRA 1DYNA 1FGZA 2ROZB 2CODA 4K81A 4F7UP 2MDXA 4HB3B 1M7RA 3ULCA 4PNKA 3CIKA 3PVWA 2RSGA 2H7DA 1WI1A 3F0WA 2E2XA 3PP2A 2V76A 2UZRA 1Y19B 4HB4B 4YL8A 3AJ4A 2Z0OA 2ROVA 3ODXA 1PFJA 2DN6A 5L81A 4CYEA 4EMOA 1I2HA 2J0MA 2M14A 5J3YA 4B6HA 3UZTA 2RNRB 1TJ6A 1FAOA 3N7CA 1XD4A 4YONA 4Y94A 5J3QA 3ML4A 3ZVRA 1MAIA 2L1CA 5D27A 2DTCA 2PZ1A 3TW1A 1ZSQA 3MPXA 1GG3A 5DHFB 4A6HA 1NI2A 5FI0A 2I1KA 3BINA 2DHKA 4DX8A 2GCJA 1Q67A 2K00A 2G35A 3SV1A 5LOPB 4HB0B 4GN1A 2CRFA 2W2XD 1WVHA 4HAVB 2XQNM 2I5FA 4DBBA 5KQ1A 2LULA 1UEFA 3A8QA 4F7HA 2YT1A 1IRSA 2NZ8B 4C0AA 3F5RA 1NTVA 4IOYX 4TKNA 4MK0A 5C6RA 1UNRA 5HE1A 2Y7BA 2COAA 1P6SA 2W2WA 1LB1A 2D9YA 2P0HA 4HDOA 1KZ7A 2I5CA 4F7GA 1XR0B 2D9XA 4HAWB 1DROA 5JHGA 3PSCA 4GMXB 2COFA 5D3WA 3X23A 3ZDTA 3KRXA 4HHVA 4EKUA 2EC1A 3MDBC 1LW3A 1V5PA 2I1JA 3TO1A 1MK7B 1FB8A 1FHOA 2UVMA 4WJ7A 2COCA 5CLQB 1DDMA 1PMSA 1WGQA 1M7EA 1EVHA 2OTXA 3KZ1A 1K5GB 4HB2B 2YSZA 1X11A 2KGXB 3DXCA 5JP4A 3BJIA 5LONB 1EAZA 2CY4A 4KAXB 2MFQA 4ZRJA 2EMTA 1SHCA 1FHWA 1NU2A 2CAYA 1OMWA 1XKEA 3KY9A 2ZPYA 3U8ZA 1V61A 4A6FA 4HAYB 5D3XA 1V88A 1U5GA 4HAXB 1X86A 2RUKB 5C16A 2J59M 1DDVA 3QIJA 4MT7A 3CXBB 1MK9B 4MY6A 4TYZA 2ADZA 2EMSA 4WVFB 3PEGA 3AU5A 4HDQA 4HAZB 4WSFA 2VRWB 2AL6A 1H10A 2D9ZA 2JP2A 3HQCA 1BTNA 2ELAA 3ODWA 3HW2B 2DYNA 2DFKA 1E5WA 2W2XC 1BWNA 3GYOA 4BBKA 2LOXA 4Z2NA 1PLSA 3GYPA 2DYQA 1MIZB 5D3YA 2DKQA 1Y5OA 3TCAA 4D0NB 1OY2A 2J0JA 2RGNB 3M1IB 1V5UA 3PVUA 1V89A 2YT0A 1P5TA 1TXDA 2CY5A 2EJ8A 2YS5A 2K2JA 2MKRA 2R0DA 5KQ4A 1U5FA 2HTHB 3PVLA 3G9WA 4H8SA 1U27A 4K2PA 3OANA 3WA0A 1BAKA 3ULBA 3ODOA 2YS1A 1WGUA 2H7EA 1I7AA 2DX5A 2YVCA 3PZDA 2D10A 2OQBA 3KRWA 5C79A 2IFSA 2FJLA 2Q13A 3FM8C 1MPHA 1NTYA 4HAUB 4KHBB 1AQCA 2KUPA 5JLJB 1ZC3B 1WG7A 5J3TA 1X1FA 2VKIA 2DHJA 5C5BA 1QC6A 3TFMA 2LKOA 2L2IA 1ISNA 1MKEA 1KI1B 1RRPB 2YRYA 3V5WA 5JHHA 2P0FA 2UZSA 4XWXA 1WJ1A 3DXDA 2R09A 2ELBA 2LOZA 4P7IA 2AEHA 2LG1A 5CLLB 4A6KA 3TVVA 4GZUA 2DHIA 5DI9B 3D8FA 4IFSA 2LYDA 2NMBA 5DIFB 4KHAA 3AU4A 1UNPA 4A6FB 1UPQA 1RJ2A 3D8DA 4PQ0A 2MWNB 4IAPA 3U7DA 5HE0A 1Z87A 2D9VA 2D2QA 5FI1A 2DA0A 3WYFB 5KCVA 1ZVRA 1GC6A 4CHMA 3FSSA 3SYXA 1GC7A 1DDWA 3T06A 3QBVB 3D8EA 3HK0A 2M38A 4L6EA 1N3HA 4ZRKA 3DXEA 4GXBA 1XODA 1U5EA 2N23A 1ZM0A 1KZGA 5HE2A 1WJMA 2Z0QA 1TQZA 2P0DA 1H4RA 1UNQA 1FHXA 4CHJA 4ZRIA 1J0WA 1U5DA 1W1GA 3A8PA 5DH9B 2IYBA 2GJYA 1V5MA 1P3RA 3NSUA 3PG7A 3FEHA 1EGXA 2Y8FA 2VSZA 2QKMA 1X05A 4KVGB 4GPTB 1B55A 1U2BA 1W1HA 3IVFA 3SO6A 3P6AA 1FGYA 2J0KA 1XCGA 2GS0A 4K2OA 4DX90 2HE7A 3LJUX 1MIXA 2D4QA 4HATB 2RLOA 3A98B 1OQNA 2QKLA 1SGHA 2DX1A 3RCPA 5GOWB 1J19A 2Z0PA 1FOEA 2YF0A 4NY0A 2GCLA 2X18A 5EFXA 1BTKA 5HE3A 4DXAB 4K17A 4NSWA 1EF1A 1QQGA 2BCJA 3VIAA 1K5DB 3QWMA 5DHAB 5D3VA 2RVBB 4EJNA 2D11A 3VOQA 1X1GA 5C5BB 1U29A 1XX0A 2D9WA 4Z2MB 2P8VA 2N0YA 2DLWA 1ZC4B 3SUZA 3O96A 1AWEA 1DBHA 3P7ZA
chains in the Genus database with same CATH superfamily
4D6WA 4A5KA 1W1DA 2Y8GA 3KSYA 2K2UA 4OSNA 2KCJA 2DKPA 4KHOA 3SNHA 4GMVA 2YS3A 1UPRA 1DYNA 1FGZA 2ROZB 2CODA 4K81A 4F7UP 2MDXA 4HB3B 1M7RA 5I2MA 3ULCA 4PNKA 2Z4DA 3CIKA 2RSGA 3PVWA 3NWAA 4GOUA 2H7DA 1WI1A 3F0WA 2E2XA 3NWDA 3PP2A 2V76A 2UZRA 1Y19B 4HB4B 4YL8A 3AJ4A 2Z0OA 2ROVA 3ODXA 1PFJA 2DN6A 5L81A 4CYEA 4EMOA 1I2HA 2J0MA 2M14A 5J3YA 4B6HA 3UZTA 2RNRB 1TJ6A 1FAOA 3N7CA 1XD4A 3FVCA 4YONA 4Y94A 5J3QA 3ML4A 3ZVRA 1MAIA 2L1CA 5D27A 2DTCA 4DIXA 2PZ1A 3TW1A 1ZSQA 3HSAA 3MPXA 5M4YB 1GG3A 2KUQA 5DHFB 4A6HA 1NI2A 5FI0A 3OHMB 2I1KA 4HSIA 2KIGA 3BINA 2DHKA 4DX8A 2GCJA 1Q67A 2K00A 2G35A 3SV1A 5LOPB 4HB0B 4GN1A 2KR0A 2CRFA 2W2XD 1WVHA 4HAVB 2XQNM 2I5FA 4DBBA 5KQ1A 2LULA 1MI1A 1UEFA 3A8QA 4F7HA 2YT1A 1IRSA 2NZ8B 4C0AA 3U12A 3F5RA 1NTVA 4IOYX 4TKNA 4MK0A 5C6RA 1UNRA 5HE1A 2Y7BA 2COAA 1P6SA 2W2WA 1LB1A 4QXAB 2D9YA 2P0HA 4HDOA 1KZ7A 2I5CA 4F7GA 1XR0B 2D9XA 4HAWB 1DROA 5JHGA 3PSCA 4GMXB 2COFA 5D3WA 3X23A 3ZDTA 3KRXA 4HHVA 4EKUA 4KHBA 2EC1A 3MDBC 3DCXA 1LW3A 1V5PA 2I1JA 3TO1A 1MK7B 1FB8A 1FHOA 2UVMA 4WJ7A 2COCA 5CLQB 1DDMA 1PMSA 1WGQA 1M7EA 1EVHA 2OTXA 3KZ1A 1K5GB 4HB2B 2YSZA 1ZYIA 1X11A 2KGXB 3DXCA 5JP4A 3BJIA 5LONB 1EAZA 2CY4A 4KAXB 2MFQA 2ZKMX 4ZRJA 2EMTA 1SHCA 1FHWA 1NU2A 2CAYA 1OMWA 1XKEA 3KY9A 2ZPYA 3U8ZA 4GNKB 1V61A 4A6FA 4HAYB 5D3XA 3NW8A 4QJ5B 1V88A 1U5GA 4HAXB 1X86A 2RUKB 5C16A 2J59M 1DDVA 3QIJA 4MT7A 3CXBB 1MK9B 4MY6A 4TYZA 2ADZA 2EMSA 4WVFB 3PEGA 3AU5A 4HDQA 4HAZB 4WSFA 2VRWB 2AL6A 1H10A 2D9ZA 2JP2A 3HIEA 2Z13A 3HQCA 1BTNA 2ELAA 3ODWA 3HW2B 2DYNA 2DFKA 1E5WA 2W2XC 1BWNA 3GYOA 4BBKA 2LOXA 4Z2NA 1PLSA 3GYPA 2DYQA 1MIZB 5D3YA 2DKQA 1Y5OA 3TCAA 4D0NB 1OY2A 2J0JA 2RGNB 3M1IB 1V5UA 3PVUA 1V89A 2YT0A 1P5TA 1TXDA 2CY5A 2EJ8A 2YS5A 2K2JA 2MKRA 2R0DA 5KQ4A 1U5FA 2GUMA 2HTHB 3PVLA 3G9WA 4H8SA 1U27A 4K2PA 3OANA 3WA0A 1BAKA 3ULBA 3ODOA 2YS1A 1WGUA 2H7EA 1I7AA 2DX5A 2YVCA 3PZDA 2D10A 2OQBA 3KRWA 5C79A 2IFSA 2FJLA 2Q13A 4QJ3B 3A58A 3FM8C 1MPHA 2FJUB 1NTYA 4HAUB 4KHBB 3B77A 1AQCA 2KUPA 5JLJB 1ZC3B 1WG7A 5J3TA 1X1FA 2VKIA 2DHJA 5C5BA 1QC6A 3TFMA 2R2YA 2LKOA 2L2IA 5IRSA 1ISNA 1MKEA 1KI1B 1RRPB 2YRYA 3V5WA 4L1RA 3NWFA 5JHHA 2P0FA 2UZSA 4XWXA 1WJ1A 2Z59A 3DXDA 2R09A 2ELBA 2LOZA 4P7IA 2AEHA 2LG1A 2K8EA 5CLLB 3TVVA 4GZUA 4A6KA 2KIEA 2DHIA 5DI9B 3D8FA 4IFSA 2LYDA 2NMBA 5DIFB 4KHAA 3AU4A 1UNPA 4A6FB 1UPQA 1RJ2A 3D8DA 4PQ0A 2MWNB 4IAPA 3U7DA 5HE0A 1Z87A 2D9VA 2D2QA 5FI1A 2DA0A 3WYFB 5KCVA 1ZVRA 1GC6A 4CHMA 3FSSA 3SYXA 1GC7A 1DDWA 3T06A 3QBVB 3D8EA 2NBVA 2M38A 3HK0A 1N3HA 4L6EA 4OT1A 4ZRKA 5LG4B 3DXEA 4GXBA 1XODA 1U5EA 2N23A 1ZM0A 1KZGA 5HE2A 1WJMA 4CSQA 2Z0QA 1TQZA 2P0DA 1H4RA 1UNQA 1FHXA 4CHJA 4ZRIA 1J0WA 1U5DA 1W1GA 4QJ4B 3A8PA 5DH9B 2IYBA 2GJYA 1V5MA 1P3RA 3NSUA 3PG7A 3FEHA 1EGXA 2Y8FA 2VSZA 2QKMA 1X05A 4KVGB 4GPTB 1B55A 1U2BA 1W1HA 3IVFA 3SO6A 3P6AA 1FGYA 2J0KA 1XCGA 2GS0A 4K2OA 4DX90 2RRFA 1T77A 2HE7A 3LJUX 1MIXA 2D4QA 4HATB 2RLOA 3A98B 1OQNA 2K49A 2QKLA 1SGHA 2Z14A 5I2SA 2DX1A 3RCPA 5GOWB 2YT2A 1J19A 2Z0PA 1FOEA 2YF0A 4NY0A 2GCLA 2X18A 5EFXA 1BTKA 5HE3A 4DXAB 4K17A 4NSWA 1EF1A 1QQGA 2BCJA 3VIAA 1K5DB 3QWMA 5DHAB 5D3VA 2RVBB 4EJNA 2D11A 3VOQA 1X1GA 5C5BB 1U29A 1XX0A 2D9WA 4Z2MB 2P8VA 2N0YA 2DLWA 1ZC4B 3SUZA 3O96A 1AWEA 1DBHA 3P7ZA
chains in the Genus database with same CATH topology
4A5KA 1W1DA 2Y8GA 3KSYA 2K2UA 2KCJA 2DKPA 4KHOA 3SNHA 4GMVA 2YS3A 1UPRA 1DYNA 1FGZA 2ROZB 2CODA 4K81A 4F7UP 2MDXA 4HB3B 1M7RA 3ULCA 4PNKA 3CIKA 3PVWA 2RSGA 2H7DA 1WI1A 3F0WA 2E2XA 3PP2A 2V76A 2UZRA 1Y19B 4HB4B 4YL8A 3AJ4A 2Z0OA 2ROVA 3ODXA 1PFJA 2DN6A 5L81A 4CYEA 4EMOA 1I2HA 2J0MA 2M14A 5J3YA 4B6HA 3UZTA 2RNRB 1TJ6A 1FAOA 3N7CA 1XD4A 4YONA 4Y94A 5J3QA 3ML4A 3ZVRA 1MAIA 2L1CA 5D27A 2DTCA 2PZ1A 3TW1A 1ZSQA 3MPXA 1GG3A 5DHFB 4A6HA 1NI2A 5FI0A 2I1KA 3BINA 2DHKA 4DX8A 2GCJA 1Q67A 2K00A 2G35A 3SV1A 5LOPB 4HB0B 4GN1A 2CRFA 2W2XD 1WVHA 4HAVB 2XQNM 2I5FA 4DBBA 5KQ1A 2LULA 1UEFA 3A8QA 4F7HA 2YT1A 1IRSA 2NZ8B 4C0AA 3F5RA 1NTVA 4IOYX 4TKNA 4MK0A 5C6RA 1UNRA 5HE1A 2Y7BA 2COAA 1P6SA 2W2WA 1LB1A 2D9YA 2P0HA 4HDOA 1KZ7A 2I5CA 4F7GA 1XR0B 2D9XA 4HAWB 1DROA 5JHGA 3PSCA 4GMXB 2COFA 5D3WA 3X23A 3ZDTA 3KRXA 4HHVA 4EKUA 2EC1A 3MDBC 1LW3A 1V5PA 2I1JA 3TO1A 1MK7B 1FB8A 1FHOA 2UVMA 4WJ7A 2COCA 5CLQB 1DDMA 1PMSA 1WGQA 1M7EA 1EVHA 2OTXA 3KZ1A 1K5GB 4HB2B 2YSZA 1X11A 2KGXB 3DXCA 5JP4A 3BJIA 5LONB 1EAZA 2CY4A 4KAXB 2MFQA 4ZRJA 2EMTA 1SHCA 1FHWA 1NU2A 2CAYA 1OMWA 1XKEA 3KY9A 2ZPYA 3U8ZA 1V61A 4A6FA 4HAYB 5D3XA 1V88A 1U5GA 4HAXB 1X86A 2RUKB 5C16A 2J59M 1DDVA 3QIJA 4MT7A 3CXBB 1MK9B 4MY6A 4TYZA 2ADZA 2EMSA 4WVFB 3PEGA 3AU5A 4HDQA 4HAZB 4WSFA 2VRWB 2AL6A 1H10A 2D9ZA 2JP2A 3HQCA 1BTNA 2ELAA 3ODWA 3HW2B 2DYNA 2DFKA 1E5WA 2W2XC 1BWNA 3GYOA 4BBKA 2LOXA 4Z2NA 1PLSA 3GYPA 2DYQA 1MIZB 5D3YA 2DKQA 1Y5OA 3TCAA 4D0NB 1OY2A 2J0JA 2RGNB 3M1IB 1V5UA 3PVUA 1V89A 2YT0A 1P5TA 1TXDA 2CY5A 2EJ8A 2YS5A 2K2JA 2MKRA 2R0DA 5KQ4A 1U5FA 2HTHB 3PVLA 3G9WA 4H8SA 1U27A 4K2PA 3OANA 3WA0A 1BAKA 3ULBA 3ODOA 2YS1A 1WGUA 2H7EA 1I7AA 2DX5A 2YVCA 3PZDA 2D10A 2OQBA 3KRWA 5C79A 2IFSA 2FJLA 2Q13A 3FM8C 1MPHA 1NTYA 4HAUB 4KHBB 1AQCA 2KUPA 5JLJB 1ZC3B 1WG7A 5J3TA 1X1FA 2VKIA 2DHJA 5C5BA 1QC6A 3TFMA 2LKOA 2L2IA 1ISNA 1MKEA 1KI1B 1RRPB 2YRYA 3V5WA 5JHHA 2P0FA 2UZSA 4XWXA 1WJ1A 3DXDA 2R09A 2ELBA 2LOZA 4P7IA 2AEHA 2LG1A 5CLLB 4A6KA 3TVVA 4GZUA 2DHIA 5DI9B 3D8FA 4IFSA 2LYDA 2NMBA 5DIFB 4KHAA 3AU4A 1UNPA 4A6FB 1UPQA 1RJ2A 3D8DA 4PQ0A 2MWNB 4IAPA 3U7DA 5HE0A 1Z87A 2D9VA 2D2QA 5FI1A 2DA0A 3WYFB 5KCVA 1ZVRA 1GC6A 4CHMA 3FSSA 3SYXA 1GC7A 1DDWA 3T06A 3QBVB 3D8EA 3HK0A 2M38A 4L6EA 1N3HA 4ZRKA 3DXEA 4GXBA 1XODA 1U5EA 2N23A 1ZM0A 1KZGA 5HE2A 1WJMA 2Z0QA 1TQZA 2P0DA 1H4RA 1UNQA 1FHXA 4CHJA 4ZRIA 1J0WA 1U5DA 1W1GA 3A8PA 5DH9B 2IYBA 2GJYA 1V5MA 1P3RA 3NSUA 3PG7A 3FEHA 1EGXA 2Y8FA 2VSZA 2QKMA 1X05A 4KVGB 4GPTB 1B55A 1U2BA 1W1HA 3IVFA 3SO6A 3P6AA 1FGYA 2J0KA 1XCGA 2GS0A 4K2OA 4DX90 2HE7A 3LJUX 1MIXA 2D4QA 4HATB 2RLOA 3A98B 1OQNA 2QKLA 1SGHA 2DX1A 3RCPA 5GOWB 1J19A 2Z0PA 1FOEA 2YF0A 4NY0A 2GCLA 2X18A 5EFXA 1BTKA 5HE3A 4DXAB 4K17A 4NSWA 1EF1A 1QQGA 2BCJA 3VIAA 1K5DB 3QWMA 5DHAB 5D3VA 2RVBB 4EJNA 2D11A 3VOQA 1X1GA 5C5BB 1U29A 1XX0A 2D9WA 4Z2MB 2P8VA 2N0YA 2DLWA 1ZC4B 3SUZA 3O96A 1AWEA 1DBHA 3P7ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A5K A;  1W1D A;  2Y8G A;  3KSY A;  2K2U A;  2KCJ A;  2DKP A;  4KHO A;  3SNH A;  4GMV A;  2YS3 A;  1UPR A;  1DYN A;  1FGZ A;  2ROZ B;  2COD A;  4K81 A;  4F7U P;  2MDX A;  4HB3 B;  1M7R A;  3ULC A;  4PNK A;  3CIK A;  3PVW A;  2RSG A;  2H7D A;  1WI1 A;  3F0W A;  2E2X A;  3PP2 A;  2V76 A;  2UZR A;  1Y19 B;  4HB4 B;  4YL8 A;  3AJ4 A;  2Z0O A;  2ROV A;  3ODX A;  1PFJ A;  2DN6 A;  5L81 A;  4CYE A;  4EMO A;  1I2H A;  2J0M A;  2M14 A;  5J3Y A;  4B6H A;  3UZT A;  2RNR B;  1TJ6 A;  1FAO A;  3N7C A;  1XD4 A;  4YON A;  4Y94 A;  5J3Q A;  3ML4 A;  3ZVR A;  1MAI A;  2L1C A;  5D27 A;  2DTC A;  2PZ1 A;  3TW1 A;  1ZSQ A;  3MPX A;  1GG3 A;  5DHF B;  4A6H A;  1NI2 A;  5FI0 A;  2I1K A;  3BIN A;  2DHK A;  4DX8 A;  2GCJ A;  1Q67 A;  2K00 A;  2G35 A;  3SV1 A;  5LOP B;  4HB0 B;  4GN1 A;  2CRF A;  2W2X D;  1WVH A;  4HAV B;  2XQN M;  2I5F A;  4DBB A;  5KQ1 A;  2LUL A;  1UEF A;  3A8Q A;  4F7H A;  2YT1 A;  1IRS A;  2NZ8 B;  4C0A A;  3F5R A;  1NTV A;  4IOY X;  4TKN A;  4MK0 A;  5C6R A;  1UNR A;  5HE1 A;  2Y7B A;  2COA A;  1P6S A;  2W2W A;  1LB1 A;  2D9Y A;  2P0H A;  4HDO A;  1KZ7 A;  2I5C A;  4F7G A;  1XR0 B;  2D9X A;  4HAW B;  1DRO A;  5JHG A;  3PSC A;  4GMX B;  2COF A;  5D3W A;  3X23 A;  3ZDT A;  3KRX A;  4HHV A;  4EKU A;  2EC1 A;  3MDB C;  1LW3 A;  1V5P A;  2I1J A;  3TO1 A;  1MK7 B;  1FB8 A;  1FHO A;  2UVM A;  4WJ7 A;  2COC A;  5CLQ B;  1DDM A;  1PMS A;  1WGQ A;  1M7E A;  1EVH A;  2OTX A;  3KZ1 A;  1K5G B;  4HB2 B;  2YSZ A;  1X11 A;  2KGX B;  3DXC A;  5JP4 A;  3BJI A;  5LON B;  1EAZ A;  2CY4 A;  4KAX B;  2MFQ A;  4ZRJ A;  2EMT A;  1SHC A;  1FHW A;  1NU2 A;  2CAY A;  1OMW A;  1XKE A;  3KY9 A;  2ZPY A;  3U8Z A;  1V61 A;  4A6F A;  4HAY B;  5D3X A;  1V88 A;  1U5G A;  4HAX B;  1X86 A;  2RUK B;  5C16 A;  2J59 M;  1DDV A;  3QIJ A;  4MT7 A;  3CXB B;  1MK9 B;  4MY6 A;  4TYZ A;  2ADZ A;  2EMS A;  4WVF B;  3PEG A;  3AU5 A;  4HDQ A;  4HAZ B;  4WSF A;  2VRW B;  2AL6 A;  1H10 A;  2D9Z A;  2JP2 A;  3HQC A;  1BTN A;  2ELA A;  3ODW A;  3HW2 B;  2DYN A;  2DFK A;  1E5W A;  2W2X C;  1BWN A;  3GYO A;  4BBK A;  2LOX A;  4Z2N A;  1PLS A;  3GYP A;  2DYQ A;  1MIZ B;  5D3Y A;  2DKQ A;  1Y5O A;  3TCA A;  4D0N B;  1OY2 A;  2J0J A;  2RGN B;  3M1I B;  1V5U A;  3PVU A;  1V89 A;  2YT0 A;  1P5T A;  1TXD A;  2CY5 A;  2EJ8 A;  2YS5 A;  2K2J A;  2MKR A;  2R0D A;  5KQ4 A;  1U5F A;  2HTH B;  3PVL A;  3G9W A;  4H8S A;  1U27 A;  4K2P A;  3OAN A;  3WA0 A;  1BAK A;  3ULB A;  3ODO A;  2YS1 A;  1WGU A;  2H7E A;  1I7A A;  2DX5 A;  2YVC A;  3PZD A;  2D10 A;  2OQB A;  3KRW A;  5C79 A;  2IFS A;  2FJL A;  2Q13 A;  3FM8 C;  1MPH A;  1NTY A;  4HAU B;  4KHB B;  1AQC A;  2KUP A;  5JLJ B;  1ZC3 B;  1WG7 A;  5J3T A;  1X1F A;  2VKI A;  2DHJ A;  5C5B A;  1QC6 A;  3TFM A;  2LKO A;  2L2I A;  1ISN A;  1MKE A;  1KI1 B;  1RRP B;  2YRY A;  3V5W A;  5JHH A;  2P0F A;  2UZS A;  4XWX A;  1WJ1 A;  3DXD A;  2R09 A;  2ELB A;  2LOZ A;  4P7I A;  2AEH A;  2LG1 A;  5CLL B;  4A6K A;  3TVV A;  4GZU A;  2DHI A;  5DI9 B;  3D8F A;  4IFS A;  2LYD A;  2NMB A;  5DIF B;  4KHA A;  3AU4 A;  1UNP A;  4A6F B;  1UPQ A;  1RJ2 A;  3D8D A;  4PQ0 A;  2MWN B;  4IAP A;  3U7D A;  5HE0 A;  1Z87 A;  2D9V A;  2D2Q A;  5FI1 A;  2DA0 A;  3WYF B;  5KCV A;  1ZVR A;  1GC6 A;  4CHM A;  3FSS A;  3SYX A;  1GC7 A;  1DDW A;  3T06 A;  3QBV B;  3D8E A;  3HK0 A;  2M38 A;  4L6E A;  1N3H A;  4ZRK A;  3DXE A;  4GXB A;  1XOD A;  1U5E A;  2N23 A;  1ZM0 A;  1KZG A;  5HE2 A;  1WJM A;  2Z0Q A;  1TQZ A;  2P0D A;  1H4R A;  1UNQ A;  1FHX A;  4CHJ A;  4ZRI A;  1J0W A;  1U5D A;  1W1G A;  3A8P A;  5DH9 B;  2IYB A;  2GJY A;  1V5M A;  1P3R A;  3NSU A;  3PG7 A;  3FEH A;  1EGX A;  2Y8F A;  2VSZ A;  2QKM A;  1X05 A;  4KVG B;  4GPT B;  1B55 A;  1U2B A;  1W1H A;  3IVF A;  3SO6 A;  3P6A A;  1FGY A;  2J0K A;  1XCG A;  2GS0 A;  4K2O A;  4DX9 0;  2HE7 A;  3LJU X;  1MIX A;  2D4Q A;  4HAT B;  2RLO A;  3A98 B;  1OQN A;  2QKL A;  1SGH A;  2DX1 A;  3RCP A;  5GOW B;  1J19 A;  2Z0P A;  1FOE A;  2YF0 A;  4NY0 A;  2GCL A;  2X18 A;  5EFX A;  1BTK A;  5HE3 A;  4DXA B;  4K17 A;  4NSW A;  1EF1 A;  1QQG A;  2BCJ A;  3VIA A;  1K5D B;  3QWM A;  5DHA B;  5D3V A;  2RVB B;  4EJN A;  2D11 A;  3VOQ A;  1X1G A;  5C5B B;  1U29 A;  1XX0 A;  2D9W A;  4Z2M B;  2P8V A;  2N0Y A;  2DLW A;  1ZC4 B;  3SUZ A;  3O96 A;  1AWE A;  1DBH A;  3P7Z A; 
#chains in the Genus database with same CATH topology
 4D6W A;  4A5K A;  1W1D A;  2Y8G A;  3KSY A;  2K2U A;  4OSN A;  2KCJ A;  2DKP A;  4KHO A;  3SNH A;  4GMV A;  2YS3 A;  1UPR A;  1DYN A;  1FGZ A;  2ROZ B;  2COD A;  4K81 A;  4F7U P;  2MDX A;  4HB3 B;  1M7R A;  5I2M A;  3ULC A;  4PNK A;  2Z4D A;  3CIK A;  2RSG A;  3PVW A;  3NWA A;  4GOU A;  2H7D A;  1WI1 A;  3F0W A;  2E2X A;  3NWD A;  3PP2 A;  2V76 A;  2UZR A;  1Y19 B;  4HB4 B;  4YL8 A;  3AJ4 A;  2Z0O A;  2ROV A;  3ODX A;  1PFJ A;  2DN6 A;  5L81 A;  4CYE A;  4EMO A;  1I2H A;  2J0M A;  2M14 A;  5J3Y A;  4B6H A;  3UZT A;  2RNR B;  1TJ6 A;  1FAO A;  3N7C A;  1XD4 A;  3FVC A;  4YON A;  4Y94 A;  5J3Q A;  3ML4 A;  3ZVR A;  1MAI A;  2L1C A;  5D27 A;  2DTC A;  4DIX A;  2PZ1 A;  3TW1 A;  1ZSQ A;  3HSA A;  3MPX A;  5M4Y B;  1GG3 A;  2KUQ A;  5DHF B;  4A6H A;  1NI2 A;  5FI0 A;  3OHM B;  2I1K A;  4HSI A;  2KIG A;  3BIN A;  2DHK A;  4DX8 A;  2GCJ A;  1Q67 A;  2K00 A;  2G35 A;  3SV1 A;  5LOP B;  4HB0 B;  4GN1 A;  2KR0 A;  2CRF A;  2W2X D;  1WVH A;  4HAV B;  2XQN M;  2I5F A;  4DBB A;  5KQ1 A;  2LUL A;  1MI1 A;  1UEF A;  3A8Q A;  4F7H A;  2YT1 A;  1IRS A;  2NZ8 B;  4C0A A;  3U12 A;  3F5R A;  1NTV A;  4IOY X;  4TKN A;  4MK0 A;  5C6R A;  1UNR A;  5HE1 A;  2Y7B A;  2COA A;  1P6S A;  2W2W A;  1LB1 A;  4QXA B;  2D9Y A;  2P0H A;  4HDO A;  1KZ7 A;  2I5C A;  4F7G A;  1XR0 B;  2D9X A;  4HAW B;  1DRO A;  5JHG A;  3PSC A;  4GMX B;  2COF A;  5D3W A;  3X23 A;  3ZDT A;  3KRX A;  4HHV A;  4EKU A;  4KHB A;  2EC1 A;  3MDB C;  3DCX A;  1LW3 A;  1V5P A;  2I1J A;  3TO1 A;  1MK7 B;  1FB8 A;  1FHO A;  2UVM A;  4WJ7 A;  2COC A;  5CLQ B;  1DDM A;  1PMS A;  1WGQ A;  1M7E A;  1EVH A;  2OTX A;  3KZ1 A;  1K5G B;  4HB2 B;  2YSZ A;  1ZYI A;  1X11 A;  2KGX B;  3DXC A;  5JP4 A;  3BJI A;  5LON B;  1EAZ A;  2CY4 A;  4KAX B;  2MFQ A;  2ZKM X;  4ZRJ A;  2EMT A;  1SHC A;  1FHW A;  1NU2 A;  2CAY A;  1OMW A;  1XKE A;  3KY9 A;  2ZPY A;  3U8Z A;  4GNK B;  1V61 A;  4A6F A;  4HAY B;  5D3X A;  3NW8 A;  4QJ5 B;  1V88 A;  1U5G A;  4HAX B;  1X86 A;  2RUK B;  5C16 A;  2J59 M;  1DDV A;  3QIJ A;  4MT7 A;  3CXB B;  1MK9 B;  4MY6 A;  4TYZ A;  2ADZ A;  2EMS A;  4WVF B;  3PEG A;  3AU5 A;  4HDQ A;  4HAZ B;  4WSF A;  2VRW B;  2AL6 A;  1H10 A;  2D9Z A;  2JP2 A;  3HIE A;  2Z13 A;  3HQC A;  1BTN A;  2ELA A;  3ODW A;  3HW2 B;  2DYN A;  2DFK A;  1E5W A;  2W2X C;  1BWN A;  3GYO A;  4BBK A;  2LOX A;  4Z2N A;  1PLS A;  3GYP A;  2DYQ A;  1MIZ B;  5D3Y A;  2DKQ A;  1Y5O A;  3TCA A;  4D0N B;  1OY2 A;  2J0J A;  2RGN B;  3M1I B;  1V5U A;  3PVU A;  1V89 A;  2YT0 A;  1P5T A;  1TXD A;  2CY5 A;  2EJ8 A;  2YS5 A;  2K2J A;  2MKR A;  2R0D A;  5KQ4 A;  1U5F A;  2GUM A;  2HTH B;  3PVL A;  3G9W A;  4H8S A;  1U27 A;  4K2P A;  3OAN A;  3WA0 A;  1BAK A;  3ULB A;  3ODO A;  2YS1 A;  1WGU A;  2H7E A;  1I7A A;  2DX5 A;  2YVC A;  3PZD A;  2D10 A;  2OQB A;  3KRW A;  5C79 A;  2IFS A;  2FJL A;  2Q13 A;  4QJ3 B;  3A58 A;  3FM8 C;  1MPH A;  2FJU B;  1NTY A;  4HAU B;  4KHB B;  3B77 A;  1AQC A;  2KUP A;  5JLJ B;  1ZC3 B;  1WG7 A;  5J3T A;  1X1F A;  2VKI A;  2DHJ A;  5C5B A;  1QC6 A;  3TFM A;  2R2Y A;  2LKO A;  2L2I A;  5IRS A;  1ISN A;  1MKE A;  1KI1 B;  1RRP B;  2YRY A;  3V5W A;  4L1R A;  3NWF A;  5JHH A;  2P0F A;  2UZS A;  4XWX A;  1WJ1 A;  2Z59 A;  3DXD A;  2R09 A;  2ELB A;  2LOZ A;  4P7I A;  2AEH A;  2LG1 A;  2K8E A;  5CLL B;  3TVV A;  4GZU A;  4A6K A;  2KIE A;  2DHI A;  5DI9 B;  3D8F A;  4IFS A;  2LYD A;  2NMB A;  5DIF B;  4KHA A;  3AU4 A;  1UNP A;  4A6F B;  1UPQ A;  1RJ2 A;  3D8D A;  4PQ0 A;  2MWN B;  4IAP A;  3U7D A;  5HE0 A;  1Z87 A;  2D9V A;  2D2Q A;  5FI1 A;  2DA0 A;  3WYF B;  5KCV A;  1ZVR A;  1GC6 A;  4CHM A;  3FSS A;  3SYX A;  1GC7 A;  1DDW A;  3T06 A;  3QBV B;  3D8E A;  2NBV A;  2M38 A;  3HK0 A;  1N3H A;  4L6E A;  4OT1 A;  4ZRK A;  5LG4 B;  3DXE A;  4GXB A;  1XOD A;  1U5E A;  2N23 A;  1ZM0 A;  1KZG A;  5HE2 A;  1WJM A;  4CSQ A;  2Z0Q A;  1TQZ A;  2P0D A;  1H4R A;  1UNQ A;  1FHX A;  4CHJ A;  4ZRI A;  1J0W A;  1U5D A;  1W1G A;  4QJ4 B;  3A8P A;  5DH9 B;  2IYB A;  2GJY A;  1V5M A;  1P3R A;  3NSU A;  3PG7 A;  3FEH A;  1EGX A;  2Y8F A;  2VSZ A;  2QKM A;  1X05 A;  4KVG B;  4GPT B;  1B55 A;  1U2B A;  1W1H A;  3IVF A;  3SO6 A;  3P6A A;  1FGY A;  2J0K A;  1XCG A;  2GS0 A;  4K2O A;  4DX9 0;  2RRF A;  1T77 A;  2HE7 A;  3LJU X;  1MIX A;  2D4Q A;  4HAT B;  2RLO A;  3A98 B;  1OQN A;  2K49 A;  2QKL A;  1SGH A;  2Z14 A;  5I2S A;  2DX1 A;  3RCP A;  5GOW B;  2YT2 A;  1J19 A;  2Z0P A;  1FOE A;  2YF0 A;  4NY0 A;  2GCL A;  2X18 A;  5EFX A;  1BTK A;  5HE3 A;  4DXA B;  4K17 A;  4NSW A;  1EF1 A;  1QQG A;  2BCJ A;  3VIA A;  1K5D B;  3QWM A;  5DHA B;  5D3V A;  2RVB B;  4EJN A;  2D11 A;  3VOQ A;  1X1G A;  5C5B B;  1U29 A;  1XX0 A;  2D9W A;  4Z2M B;  2P8V A;  2N0Y A;  2DLW A;  1ZC4 B;  3SUZ A;  3O96 A;  1AWE A;  1DBH A;  3P7Z A; 
#chains in the Genus database with same CATH homology
 4A5K A;  1W1D A;  2Y8G A;  3KSY A;  2K2U A;  2KCJ A;  2DKP A;  4KHO A;  3SNH A;  4GMV A;  2YS3 A;  1UPR A;  1DYN A;  1FGZ A;  2ROZ B;  2COD A;  4K81 A;  4F7U P;  2MDX A;  4HB3 B;  1M7R A;  3ULC A;  4PNK A;  3CIK A;  3PVW A;  2RSG A;  2H7D A;  1WI1 A;  3F0W A;  2E2X A;  3PP2 A;  2V76 A;  2UZR A;  1Y19 B;  4HB4 B;  4YL8 A;  3AJ4 A;  2Z0O A;  2ROV A;  3ODX A;  1PFJ A;  2DN6 A;  5L81 A;  4CYE A;  4EMO A;  1I2H A;  2J0M A;  2M14 A;  5J3Y A;  4B6H A;  3UZT A;  2RNR B;  1TJ6 A;  1FAO A;  3N7C A;  1XD4 A;  4YON A;  4Y94 A;  5J3Q A;  3ML4 A;  3ZVR A;  1MAI A;  2L1C A;  5D27 A;  2DTC A;  2PZ1 A;  3TW1 A;  1ZSQ A;  3MPX A;  1GG3 A;  5DHF B;  4A6H A;  1NI2 A;  5FI0 A;  2I1K A;  3BIN A;  2DHK A;  4DX8 A;  2GCJ A;  1Q67 A;  2K00 A;  2G35 A;  3SV1 A;  5LOP B;  4HB0 B;  4GN1 A;  2CRF A;  2W2X D;  1WVH A;  4HAV B;  2XQN M;  2I5F A;  4DBB A;  5KQ1 A;  2LUL A;  1UEF A;  3A8Q A;  4F7H A;  2YT1 A;  1IRS A;  2NZ8 B;  4C0A A;  3F5R A;  1NTV A;  4IOY X;  4TKN A;  4MK0 A;  5C6R A;  1UNR A;  5HE1 A;  2Y7B A;  2COA A;  1P6S A;  2W2W A;  1LB1 A;  2D9Y A;  2P0H A;  4HDO A;  1KZ7 A;  2I5C A;  4F7G A;  1XR0 B;  2D9X A;  4HAW B;  1DRO A;  5JHG A;  3PSC A;  4GMX B;  2COF A;  5D3W A;  3X23 A;  3ZDT A;  3KRX A;  4HHV A;  4EKU A;  2EC1 A;  3MDB C;  1LW3 A;  1V5P A;  2I1J A;  3TO1 A;  1MK7 B;  1FB8 A;  1FHO A;  2UVM A;  4WJ7 A;  2COC A;  5CLQ B;  1DDM A;  1PMS A;  1WGQ A;  1M7E A;  1EVH A;  2OTX A;  3KZ1 A;  1K5G B;  4HB2 B;  2YSZ A;  1X11 A;  2KGX B;  3DXC A;  5JP4 A;  3BJI A;  5LON B;  1EAZ A;  2CY4 A;  4KAX B;  2MFQ A;  4ZRJ A;  2EMT A;  1SHC A;  1FHW A;  1NU2 A;  2CAY A;  1OMW A;  1XKE A;  3KY9 A;  2ZPY A;  3U8Z A;  1V61 A;  4A6F A;  4HAY B;  5D3X A;  1V88 A;  1U5G A;  4HAX B;  1X86 A;  2RUK B;  5C16 A;  2J59 M;  1DDV A;  3QIJ A;  4MT7 A;  3CXB B;  1MK9 B;  4MY6 A;  4TYZ A;  2ADZ A;  2EMS A;  4WVF B;  3PEG A;  3AU5 A;  4HDQ A;  4HAZ B;  4WSF A;  2VRW B;  2AL6 A;  1H10 A;  2D9Z A;  2JP2 A;  3HQC A;  1BTN A;  2ELA A;  3ODW A;  3HW2 B;  2DYN A;  2DFK A;  1E5W A;  2W2X C;  1BWN A;  3GYO A;  4BBK A;  2LOX A;  4Z2N A;  1PLS A;  3GYP A;  2DYQ A;  1MIZ B;  5D3Y A;  2DKQ A;  1Y5O A;  3TCA A;  4D0N B;  1OY2 A;  2J0J A;  2RGN B;  3M1I B;  1V5U A;  3PVU A;  1V89 A;  2YT0 A;  1P5T A;  1TXD A;  2CY5 A;  2EJ8 A;  2YS5 A;  2K2J A;  2MKR A;  2R0D A;  5KQ4 A;  1U5F A;  2HTH B;  3PVL A;  3G9W A;  4H8S A;  1U27 A;  4K2P A;  3OAN A;  3WA0 A;  1BAK A;  3ULB A;  3ODO A;  2YS1 A;  1WGU A;  2H7E A;  1I7A A;  2DX5 A;  2YVC A;  3PZD A;  2D10 A;  2OQB A;  3KRW A;  5C79 A;  2IFS A;  2FJL A;  2Q13 A;  3FM8 C;  1MPH A;  1NTY A;  4HAU B;  4KHB B;  1AQC A;  2KUP A;  5JLJ B;  1ZC3 B;  1WG7 A;  5J3T A;  1X1F A;  2VKI A;  2DHJ A;  5C5B A;  1QC6 A;  3TFM A;  2LKO A;  2L2I A;  1ISN A;  1MKE A;  1KI1 B;  1RRP B;  2YRY A;  3V5W A;  5JHH A;  2P0F A;  2UZS A;  4XWX A;  1WJ1 A;  3DXD A;  2R09 A;  2ELB A;  2LOZ A;  4P7I A;  2AEH A;  2LG1 A;  5CLL B;  4A6K A;  3TVV A;  4GZU A;  2DHI A;  5DI9 B;  3D8F A;  4IFS A;  2LYD A;  2NMB A;  5DIF B;  4KHA A;  3AU4 A;  1UNP A;  4A6F B;  1UPQ A;  1RJ2 A;  3D8D A;  4PQ0 A;  2MWN B;  4IAP A;  3U7D A;  5HE0 A;  1Z87 A;  2D9V A;  2D2Q A;  5FI1 A;  2DA0 A;  3WYF B;  5KCV A;  1ZVR A;  1GC6 A;  4CHM A;  3FSS A;  3SYX A;  1GC7 A;  1DDW A;  3T06 A;  3QBV B;  3D8E A;  3HK0 A;  2M38 A;  4L6E A;  1N3H A;  4ZRK A;  3DXE A;  4GXB A;  1XOD A;  1U5E A;  2N23 A;  1ZM0 A;  1KZG A;  5HE2 A;  1WJM A;  2Z0Q A;  1TQZ A;  2P0D A;  1H4R A;  1UNQ A;  1FHX A;  4CHJ A;  4ZRI A;  1J0W A;  1U5D A;  1W1G A;  3A8P A;  5DH9 B;  2IYB A;  2GJY A;  1V5M A;  1P3R A;  3NSU A;  3PG7 A;  3FEH A;  1EGX A;  2Y8F A;  2VSZ A;  2QKM A;  1X05 A;  4KVG B;  4GPT B;  1B55 A;  1U2B A;  1W1H A;  3IVF A;  3SO6 A;  3P6A A;  1FGY A;  2J0K A;  1XCG A;  2GS0 A;  4K2O A;  4DX9 0;  2HE7 A;  3LJU X;  1MIX A;  2D4Q A;  4HAT B;  2RLO A;  3A98 B;  1OQN A;  2QKL A;  1SGH A;  2DX1 A;  3RCP A;  5GOW B;  1J19 A;  2Z0P A;  1FOE A;  2YF0 A;  4NY0 A;  2GCL A;  2X18 A;  5EFX A;  1BTK A;  5HE3 A;  4DXA B;  4K17 A;  4NSW A;  1EF1 A;  1QQG A;  2BCJ A;  3VIA A;  1K5D B;  3QWM A;  5DHA B;  5D3V A;  2RVB B;  4EJN A;  2D11 A;  3VOQ A;  1X1G A;  5C5B B;  1U29 A;  1XX0 A;  2D9W A;  4Z2M B;  2P8V A;  2N0Y A;  2DLW A;  1ZC4 B;  3SUZ A;  3O96 A;  1AWE A;  1DBH A;  3P7Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...