2CRFA

Solution structure of the ran_bp1 domain of ran-binding protein-3
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
150
structure length
150
Chain Sequence
GSSGSSGTARKCLLEKVEVITGEEAESNVLQMQCKLFVFDKTSQSWVERGRGLLRLNDMASTDDGTLQSRLVMRTQGSLRLILNTKLWAQMQIDKASEKSIHITAMDTEDQGVKVFLISASSKDTGQLYAALHHRILALRSRVESGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the Ran_BP1 domain of RAN-binding protein-3
rcsb
source organism Homo sapiens
molecule tags Transport protein
molecule keywords RAN binding protein 3
total genus 17
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2005-05-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00638 Ran_BP1 RanBP1 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2crfA01
2J0KA 3VIAA 4HAVB 3TFMA 1UNRA 3HK0A 1ZC4B 3AJ4A 1H4RA 1LW3A 1GG3A 1UNPA 1ZC3B 1W1GA 2HTHB 1U2BA 1H10A 2CODA 2I5CA 5KQ4A 3AU4A 5JLJB 3DXEA 4H8SA 2D9WA 1XKEA 2R09A 3QWMA 4CHMA 4EKUA 4ZRIA 4IAPA 3MPXA 3FSSA 1X05A 3P6AA 1U27A 1QQGA 1FHOA 3G9WA 1OMWA 3PP2A 1XX0A 3F0WA 5JP4A 2UZRA 5FI1A 1SGHA 2H7DA 5C79A 3PZDA 4A6KA 4BBKA 4L6EA 3LJUX 3RCPA 4K17A 4NSWA 1GC6A 2DTCA 2Y7BA 1K5GB 1XR0B 1WGQA 3SUZA 3ML4A 1NI2A 5LOPB 2VKIA 3GYOA 1Y19B 2RSGA 4P7IA 3U7DA 3D8FA 4A6FB 2I1KA 4HAXB 2GCLA 4YONA 3M1IB 4HHVA 3KZ1A 4A5KA 1MKEA 2K2UA 1EGXA 2FJLA 4KHBB 1OQNA 3HQCA 2DLWA 2CY4A 2R0DA 2P0HA 1BAKA 3O96A 2ELBA 2YSZA 1DDMA 3P7ZA 2D9XA 3U8ZA 4KVGB 3SV1A 2CRFA 1IRSA 3D8DA 2J0JA 3X23A 4K2OA 1N3HA 5D3WA 1RRPB 3ODOA 2DX5A 2OQBA 5DI9B 5CLLB 2EJ8A 1AQCA 2LULA 4MY6A 2KUPA 4D0NB 3QIJA 1EF1A 1NU2A 4B6HA 2EMSA 1Z87A 2EC1A 2Z0PA 1WI1A 3VOQA 5JHGA 1J0WA 5J3TA 1SHCA 1U5EA 2D9ZA 4XWXA 2DHJA 1ZVRA 3A98B 1TXDA 3TW1A 4HB2B 5C5BB 2QKMA 5D27A 1WJMA 2LG1A 3PVWA 5C5BA 2DFKA 2D4QA 1U29A 1FGZA 1UNQA 2P0DA 2Y8FA 2MDXA 1V5PA 2EMTA 4F7HA 5CLQB 3OANA 3ODXA 2YVCA 5D3VA 1KZGA 2GCJA 1V61A 4CHJA 1KI1B 1FOEA 1W1DA 2COAA 4HDOA 2CY5A 3MDBC 3UZTA 1RJ2A 2W2XD 1BWNA 3CXBB 1PFJA 1EVHA 1XCGA 2DA0A 1B55A 3V5WA 4HB4B 4IOYX 4A6FA 1J19A 1ZM0A 2IFSA 4HAWB 5D3XA 2N0YA 2YT0A 4MK0A 3WA0A 1M7RA 4Z2NA 3WYFB 2GJYA 1W1HA 1MIXA 3CIKA 1U5DA 5C16A 2OTXA 2CAYA 2YS3A 4KHAA 1FHXA 4KHOA 4NY0A 1TJ6A 1Y5OA 2ELAA 1X1FA 1ZSQA 2VSZA 4DX90 1EAZA 2Z0OA 2W2WA 1X1GA 3BINA 5JHHA 3TCAA 1AWEA 4F7UP 4MT7A 5L81A 4DX8A 5J3QA 5LONB 4ZRJA 1I2HA 2NZ8B 1BTNA 1V89A 2D9VA 4CYEA 4KAXB 2P8VA 1MK9B 1TQZA 3TO1A 1MPHA 2I1JA 4HB0B 5HE3A 1FGYA 4ZRKA 2ROZB 2DHKA 2UVMA 3AU5A 2COFA 1WVHA 1FAOA 4GMXB 2W2XC 5DH9B 3FM8C 1ISNA 3DXDA 2K2JA 2MFQA 3PG7A 3NSUA 4EMOA 1P6SA 3ZDTA 4GPTB 5HE0A 4GZUA 2L2IA 1XD4A 1DDVA 1KZ7A 1UEFA 4HDQA 2DYNA 1M7EA 2K00A 3PVLA 3T06A 1E5WA 1K5DB 3ZVRA 2E2XA 2KCJA 1DDWA 1V5UA 2BCJA 2GS0A 2YF0A 3A8PA 2VRWB 3ULBA 3ULCA 4HAUB 2J0MA 1I7AA 4HB3B 4TYZA 4DBBA 2RVBB 2LOXA 1MAIA 5HE1A 2NMBA 1U5FA 4DXAB 2MKRA 2L1CA 5EFXA 1V88A 1WGUA 2YRYA 1P5TA 3D8EA 2ROVA 1Q67A 2Z0QA 1U5GA 2IYBA 1BTKA 2YS5A 1OY2A 4GN1A 2COCA 4HAZB 1MIZB 2YT1A 2V76A 3BJIA 2D2QA 1FB8A 4Z2MB 1WJ1A 2YS1A 2N23A 2DN6A 2DKQA 4A6HA 1NTVA 5FI0A 2DHIA 2Y8GA 5DIFB 5DHAB 2ADZA 2UZSA 1NTYA 5HE2A 4WJ7A 4TKNA 2PZ1A 5D3YA 4K81A 2RGNB 5KCVA 3HW2B 2DYQA 5C6RA 2G35A 3PVUA 2H7EA 1FHWA 2D10A 4GMVA 4IFSA 4HATB 4WSFA 3SYXA 2JP2A 4GXBA 2AEHA 3KSYA 1X11A 2LYDA 2M38A 1WG7A 1DROA 2X18A 2LOZA 2ZPYA 4HAYB 4EJNA 2M14A 4C0AA 1V5MA 2D9YA 2LKOA 1X86A 2J59M 3GYPA 2D11A 4Y94A 5J3YA 3ODWA 3KRWA 2AL6A 3PEGA 3TVVA 1XODA 1UPQA 1GC7A 1MK7B 2DX1A 2I5FA 2MWNB 2HE7A 5KQ1A 3IVFA 1DBHA 2Q13A 4PNKA 1P3RA 1UPRA 1PMSA 5GOWB 3DXCA 4YL8A 2DKPA 1PLSA 4F7GA 4PQ0A 1LB1A 5DHFB 3KRXA 4K2PA 3N7CA 2XQNM 2RNRB 3F5RA 2QKLA 3PSCA 3KY9A 3QBVB 3SNHA 1QC6A 2P0FA 1DYNA 4WVFB 3SO6A 3A8QA 2KGXB 2RLOA 2RUKB 3FEHA
chains in the Genus database with same CATH superfamily
2J0KA 3VIAA 3DCXA 4HAVB 3TFMA 1UNRA 3HK0A 1ZC4B 3AJ4A 1H4RA 1LW3A 1GG3A 1UNPA 1ZC3B 1W1GA 2HTHB 1U2BA 1H10A 2CODA 2I5CA 5KQ4A 3AU4A 5JLJB 3DXEA 4H8SA 2D9WA 1XKEA 2R09A 3QWMA 4CHMA 4EKUA 2KR0A 4ZRIA 4IAPA 3MPXA 3FSSA 1X05A 3P6AA 1U27A 1QQGA 1MI1A 1FHOA 3G9WA 1OMWA 3PP2A 1XX0A 3F0WA 5JP4A 2UZRA 5FI1A 1SGHA 2H7DA 2FJUB 5C79A 3PZDA 4A6KA 4BBKA 4L6EA 3LJUX 3RCPA 4OSNA 4K17A 4NSWA 1GC6A 2DTCA 2Y7BA 5IRSA 1K5GB 1XR0B 1WGQA 2KIEA 3ML4A 1NI2A 3SUZA 5LOPB 2VKIA 3GYOA 1Y19B 2RSGA 4P7IA 3U7DA 3D8FA 4A6FB 1T77A 2I1KA 4HAXB 2GCLA 4YONA 3M1IB 4HHVA 3KZ1A 4A5KA 1MKEA 2K2UA 1EGXA 2FJLA 4KHBB 1OQNA 3HQCA 2DLWA 2CY4A 2R0DA 2P0HA 3NWAA 1BAKA 3O96A 2ELBA 2NBVA 2YSZA 1DDMA 3P7ZA 2D9XA 3U8ZA 1ZYIA 4KVGB 3SV1A 3A58A 2CRFA 1IRSA 3D8DA 2J0JA 4CSQA 3X23A 4K2OA 1N3HA 5D3WA 1RRPB 3ODOA 2DX5A 2OQBA 5DI9B 5CLLB 2EJ8A 1AQCA 2LULA 4MY6A 2KUPA 4D0NB 3QIJA 1EF1A 1NU2A 4B6HA 2EMSA 1Z87A 2EC1A 2R2YA 2Z0PA 1WI1A 3VOQA 5I2SA 5JHGA 1J0WA 5J3TA 1SHCA 1U5EA 2D9ZA 4XWXA 3NWDA 2DHJA 1ZVRA 3A98B 1TXDA 3TW1A 4HB2B 5C5BB 2QKMA 5D27A 1WJMA 2LG1A 3HIEA 3PVWA 5C5BA 2DFKA 2D4QA 2Z4DA 1U29A 1FGZA 1UNQA 2P0DA 2Y8FA 2MDXA 1V5PA 2EMTA 4F7HA 5CLQB 3B77A 3OANA 3ODXA 2YVCA 5D3VA 1KZGA 2GCJA 1V61A 4CHJA 1KI1B 1FOEA 2YT2A 1W1DA 2COAA 4HDOA 2CY5A 3MDBC 3UZTA 1RJ2A 2W2XD 1BWNA 3CXBB 1PFJA 1EVHA 1XCGA 2DA0A 1B55A 3V5WA 4HB4B 4IOYX 4A6FA 3NWFA 1J19A 1ZM0A 2IFSA 4HAWB 5D3XA 2N0YA 2YT0A 3OHMB 4MK0A 3WA0A 4QJ4B 1M7RA 4Z2NA 3WYFB 2GJYA 1W1HA 2Z59A 3CIKA 1MIXA 1U5DA 5C16A 4OT1A 2OTXA 2CAYA 2YS3A 4KHAA 1FHXA 4KHOA 4NY0A 1TJ6A 1Y5OA 2ELAA 1X1FA 1ZSQA 2VSZA 4DX90 1EAZA 2Z0OA 2Z13A 2W2WA 1X1GA 3BINA 5JHHA 3TCAA 1AWEA 2K8EA 4F7UP 4MT7A 4DIXA 5L81A 4DX8A 5J3QA 5LONB 4ZRJA 1I2HA 2NZ8B 1BTNA 1V89A 2D9VA 4CYEA 4KAXB 2P8VA 5M4YB 1MK9B 1TQZA 3TO1A 1MPHA 4QJ3B 2I1JA 4HB0B 5HE3A 1FGYA 4ZRKA 2ROZB 2DHKA 2UVMA 3AU5A 2COFA 1WVHA 1FAOA 4GMXB 2W2XC 5DH9B 3FM8C 1ISNA 3DXDA 2K2JA 2MFQA 3PG7A 2KIGA 3NSUA 4EMOA 1P6SA 3ZDTA 4GPTB 5HE0A 4GZUA 2L2IA 1XD4A 1DDVA 1KZ7A 4HSIA 1UEFA 4HDQA 2DYNA 2ZKMX 1M7EA 2K00A 3PVLA 3T06A 5I2MA 1E5WA 1K5DB 3ZVRA 2E2XA 2KCJA 1DDWA 1V5UA 2BCJA 2GS0A 2YF0A 3A8PA 2VRWB 3ULBA 3ULCA 4HAUB 2J0MA 1I7AA 4HB3B 4TYZA 4DBBA 2RVBB 4KHBA 2KUQA 2LOXA 1MAIA 5HE1A 2NMBA 1U5FA 4DXAB 2MKRA 3HSAA 2L1CA 5EFXA 1V88A 1WGUA 2YRYA 1P5TA 3D8EA 4GOUA 2ROVA 1Q67A 2Z0QA 1U5GA 2IYBA 1BTKA 2YS5A 4QXAB 1OY2A 4GN1A 2COCA 4HAZB 1MIZB 2YT1A 2V76A 2RRFA 3BJIA 2D2QA 1FB8A 4Z2MB 1WJ1A 2YS1A 2N23A 2DN6A 2DKQA 4A6HA 1NTVA 5FI0A 2DHIA 2Y8GA 5DIFB 5DHAB 2ADZA 2UZSA 1NTYA 5HE2A 4WJ7A 4TKNA 2PZ1A 5D3YA 4K81A 2RGNB 4GNKB 5KCVA 3HW2B 2DYQA 5C6RA 2G35A 3PVUA 2H7EA 4L1RA 1FHWA 2D10A 4GMVA 4IFSA 4HATB 4WSFA 3SYXA 2JP2A 4GXBA 2AEHA 3KSYA 1X11A 2LYDA 2M38A 1WG7A 2Z14A 1DROA 2X18A 2LOZA 2ZPYA 4HAYB 4EJNA 2M14A 4C0AA 1V5MA 2D9YA 2LKOA 1X86A 2J59M 2GUMA 3GYPA 2D11A 4Y94A 5J3YA 3ODWA 3KRWA 2AL6A 3PEGA 3TVVA 1XODA 1UPQA 1GC7A 1MK7B 2DX1A 2I5FA 2MWNB 2HE7A 5KQ1A 3IVFA 3U12A 1DBHA 4QJ5B 2Q13A 3FVCA 5LG4B 4PNKA 1P3RA 2K49A 1UPRA 1PMSA 5GOWB 3DXCA 4YL8A 2DKPA 3NW8A 1PLSA 4F7GA 4PQ0A 1LB1A 5DHFB 3KRXA 4K2PA 3N7CA 2XQNM 2RNRB 3F5RA 2QKLA 3PSCA 4D6WA 3KY9A 3QBVB 3SNHA 1QC6A 2P0FA 1DYNA 4WVFB 3SO6A 3A8QA 2KGXB 2RLOA 2RUKB 3FEHA
chains in the Genus database with same CATH topology
2J0KA 3VIAA 4HAVB 3TFMA 1UNRA 3HK0A 1ZC4B 3AJ4A 1H4RA 1LW3A 1GG3A 1UNPA 1ZC3B 1W1GA 2HTHB 1U2BA 1H10A 2CODA 2I5CA 5KQ4A 3AU4A 5JLJB 3DXEA 4H8SA 2D9WA 1XKEA 2R09A 3QWMA 4CHMA 4EKUA 4ZRIA 4IAPA 3MPXA 3FSSA 1X05A 3P6AA 1U27A 1QQGA 1FHOA 3G9WA 1OMWA 3PP2A 1XX0A 3F0WA 5JP4A 2UZRA 5FI1A 1SGHA 2H7DA 5C79A 3PZDA 4A6KA 4BBKA 4L6EA 3LJUX 3RCPA 4K17A 4NSWA 1GC6A 2DTCA 2Y7BA 1K5GB 1XR0B 1WGQA 3SUZA 3ML4A 1NI2A 5LOPB 2VKIA 3GYOA 1Y19B 2RSGA 4P7IA 3U7DA 3D8FA 4A6FB 2I1KA 4HAXB 2GCLA 4YONA 3M1IB 4HHVA 3KZ1A 4A5KA 1MKEA 2K2UA 1EGXA 2FJLA 4KHBB 1OQNA 3HQCA 2DLWA 2CY4A 2R0DA 2P0HA 1BAKA 3O96A 2ELBA 2YSZA 1DDMA 3P7ZA 2D9XA 3U8ZA 4KVGB 3SV1A 2CRFA 1IRSA 3D8DA 2J0JA 3X23A 4K2OA 1N3HA 5D3WA 1RRPB 3ODOA 2DX5A 2OQBA 5DI9B 5CLLB 2EJ8A 1AQCA 2LULA 4MY6A 2KUPA 4D0NB 3QIJA 1EF1A 1NU2A 4B6HA 2EMSA 1Z87A 2EC1A 2Z0PA 1WI1A 3VOQA 5JHGA 1J0WA 5J3TA 1SHCA 1U5EA 2D9ZA 4XWXA 2DHJA 1ZVRA 3A98B 1TXDA 3TW1A 4HB2B 5C5BB 2QKMA 5D27A 1WJMA 2LG1A 3PVWA 5C5BA 2DFKA 2D4QA 1U29A 1FGZA 1UNQA 2P0DA 2Y8FA 2MDXA 1V5PA 2EMTA 4F7HA 5CLQB 3OANA 3ODXA 2YVCA 5D3VA 1KZGA 2GCJA 1V61A 4CHJA 1KI1B 1FOEA 1W1DA 2COAA 4HDOA 2CY5A 3MDBC 3UZTA 1RJ2A 2W2XD 1BWNA 3CXBB 1PFJA 1EVHA 1XCGA 2DA0A 1B55A 3V5WA 4HB4B 4IOYX 4A6FA 1J19A 1ZM0A 2IFSA 4HAWB 5D3XA 2N0YA 2YT0A 4MK0A 3WA0A 1M7RA 4Z2NA 3WYFB 2GJYA 1W1HA 1MIXA 3CIKA 1U5DA 5C16A 2OTXA 2CAYA 2YS3A 4KHAA 1FHXA 4KHOA 4NY0A 1TJ6A 1Y5OA 2ELAA 1X1FA 1ZSQA 2VSZA 4DX90 1EAZA 2Z0OA 2W2WA 1X1GA 3BINA 5JHHA 3TCAA 1AWEA 4F7UP 4MT7A 5L81A 4DX8A 5J3QA 5LONB 4ZRJA 1I2HA 2NZ8B 1BTNA 1V89A 2D9VA 4CYEA 4KAXB 2P8VA 1MK9B 1TQZA 3TO1A 1MPHA 2I1JA 4HB0B 5HE3A 1FGYA 4ZRKA 2ROZB 2DHKA 2UVMA 3AU5A 2COFA 1WVHA 1FAOA 4GMXB 2W2XC 5DH9B 3FM8C 1ISNA 3DXDA 2K2JA 2MFQA 3PG7A 3NSUA 4EMOA 1P6SA 3ZDTA 4GPTB 5HE0A 4GZUA 2L2IA 1XD4A 1DDVA 1KZ7A 1UEFA 4HDQA 2DYNA 1M7EA 2K00A 3PVLA 3T06A 1E5WA 1K5DB 3ZVRA 2E2XA 2KCJA 1DDWA 1V5UA 2BCJA 2GS0A 2YF0A 3A8PA 2VRWB 3ULBA 3ULCA 4HAUB 2J0MA 1I7AA 4HB3B 4TYZA 4DBBA 2RVBB 2LOXA 1MAIA 5HE1A 2NMBA 1U5FA 4DXAB 2MKRA 2L1CA 5EFXA 1V88A 1WGUA 2YRYA 1P5TA 3D8EA 2ROVA 1Q67A 2Z0QA 1U5GA 2IYBA 1BTKA 2YS5A 1OY2A 4GN1A 2COCA 4HAZB 1MIZB 2YT1A 2V76A 3BJIA 2D2QA 1FB8A 4Z2MB 1WJ1A 2YS1A 2N23A 2DN6A 2DKQA 4A6HA 1NTVA 5FI0A 2DHIA 2Y8GA 5DIFB 5DHAB 2ADZA 2UZSA 1NTYA 5HE2A 4WJ7A 4TKNA 2PZ1A 5D3YA 4K81A 2RGNB 5KCVA 3HW2B 2DYQA 5C6RA 2G35A 3PVUA 2H7EA 1FHWA 2D10A 4GMVA 4IFSA 4HATB 4WSFA 3SYXA 2JP2A 4GXBA 2AEHA 3KSYA 1X11A 2LYDA 2M38A 1WG7A 1DROA 2X18A 2LOZA 2ZPYA 4HAYB 4EJNA 2M14A 4C0AA 1V5MA 2D9YA 2LKOA 1X86A 2J59M 3GYPA 2D11A 4Y94A 5J3YA 3ODWA 3KRWA 2AL6A 3PEGA 3TVVA 1XODA 1UPQA 1GC7A 1MK7B 2DX1A 2I5FA 2MWNB 2HE7A 5KQ1A 3IVFA 1DBHA 2Q13A 4PNKA 1P3RA 1UPRA 1PMSA 5GOWB 3DXCA 4YL8A 2DKPA 1PLSA 4F7GA 4PQ0A 1LB1A 5DHFB 3KRXA 4K2PA 3N7CA 2XQNM 2RNRB 3F5RA 2QKLA 3PSCA 3KY9A 3QBVB 3SNHA 1QC6A 2P0FA 1DYNA 4WVFB 3SO6A 3A8QA 2KGXB 2RLOA 2RUKB 3FEHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2J0K A;  3VIA A;  4HAV B;  3TFM A;  1UNR A;  3HK0 A;  1ZC4 B;  3AJ4 A;  1H4R A;  1LW3 A;  1GG3 A;  1UNP A;  1ZC3 B;  1W1G A;  2HTH B;  1U2B A;  1H10 A;  2COD A;  2I5C A;  5KQ4 A;  3AU4 A;  5JLJ B;  3DXE A;  4H8S A;  2D9W A;  1XKE A;  2R09 A;  3QWM A;  4CHM A;  4EKU A;  4ZRI A;  4IAP A;  3MPX A;  3FSS A;  1X05 A;  3P6A A;  1U27 A;  1QQG A;  1FHO A;  3G9W A;  1OMW A;  3PP2 A;  1XX0 A;  3F0W A;  5JP4 A;  2UZR A;  5FI1 A;  1SGH A;  2H7D A;  5C79 A;  3PZD A;  4A6K A;  4BBK A;  4L6E A;  3LJU X;  3RCP A;  4K17 A;  4NSW A;  1GC6 A;  2DTC A;  2Y7B A;  1K5G B;  1XR0 B;  1WGQ A;  3SUZ A;  3ML4 A;  1NI2 A;  5LOP B;  2VKI A;  3GYO A;  1Y19 B;  2RSG A;  4P7I A;  3U7D A;  3D8F A;  4A6F B;  2I1K A;  4HAX B;  2GCL A;  4YON A;  3M1I B;  4HHV A;  3KZ1 A;  4A5K A;  1MKE A;  2K2U A;  1EGX A;  2FJL A;  4KHB B;  1OQN A;  3HQC A;  2DLW A;  2CY4 A;  2R0D A;  2P0H A;  1BAK A;  3O96 A;  2ELB A;  2YSZ A;  1DDM A;  3P7Z A;  2D9X A;  3U8Z A;  4KVG B;  3SV1 A;  2CRF A;  1IRS A;  3D8D A;  2J0J A;  3X23 A;  4K2O A;  1N3H A;  5D3W A;  1RRP B;  3ODO A;  2DX5 A;  2OQB A;  5DI9 B;  5CLL B;  2EJ8 A;  1AQC A;  2LUL A;  4MY6 A;  2KUP A;  4D0N B;  3QIJ A;  1EF1 A;  1NU2 A;  4B6H A;  2EMS A;  1Z87 A;  2EC1 A;  2Z0P A;  1WI1 A;  3VOQ A;  5JHG A;  1J0W A;  5J3T A;  1SHC A;  1U5E A;  2D9Z A;  4XWX A;  2DHJ A;  1ZVR A;  3A98 B;  1TXD A;  3TW1 A;  4HB2 B;  5C5B B;  2QKM A;  5D27 A;  1WJM A;  2LG1 A;  3PVW A;  5C5B A;  2DFK A;  2D4Q A;  1U29 A;  1FGZ A;  1UNQ A;  2P0D A;  2Y8F A;  2MDX A;  1V5P A;  2EMT A;  4F7H A;  5CLQ B;  3OAN A;  3ODX A;  2YVC A;  5D3V A;  1KZG A;  2GCJ A;  1V61 A;  4CHJ A;  1KI1 B;  1FOE A;  1W1D A;  2COA A;  4HDO A;  2CY5 A;  3MDB C;  3UZT A;  1RJ2 A;  2W2X D;  1BWN A;  3CXB B;  1PFJ A;  1EVH A;  1XCG A;  2DA0 A;  1B55 A;  3V5W A;  4HB4 B;  4IOY X;  4A6F A;  1J19 A;  1ZM0 A;  2IFS A;  4HAW B;  5D3X A;  2N0Y A;  2YT0 A;  4MK0 A;  3WA0 A;  1M7R A;  4Z2N A;  3WYF B;  2GJY A;  1W1H A;  1MIX A;  3CIK A;  1U5D A;  5C16 A;  2OTX A;  2CAY A;  2YS3 A;  4KHA A;  1FHX A;  4KHO A;  4NY0 A;  1TJ6 A;  1Y5O A;  2ELA A;  1X1F A;  1ZSQ A;  2VSZ A;  4DX9 0;  1EAZ A;  2Z0O A;  2W2W A;  1X1G A;  3BIN A;  5JHH A;  3TCA A;  1AWE A;  4F7U P;  4MT7 A;  5L81 A;  4DX8 A;  5J3Q A;  5LON B;  4ZRJ A;  1I2H A;  2NZ8 B;  1BTN A;  1V89 A;  2D9V A;  4CYE A;  4KAX B;  2P8V A;  1MK9 B;  1TQZ A;  3TO1 A;  1MPH A;  2I1J A;  4HB0 B;  5HE3 A;  1FGY A;  4ZRK A;  2ROZ B;  2DHK A;  2UVM A;  3AU5 A;  2COF A;  1WVH A;  1FAO A;  4GMX B;  2W2X C;  5DH9 B;  3FM8 C;  1ISN A;  3DXD A;  2K2J A;  2MFQ A;  3PG7 A;  3NSU A;  4EMO A;  1P6S A;  3ZDT A;  4GPT B;  5HE0 A;  4GZU A;  2L2I A;  1XD4 A;  1DDV A;  1KZ7 A;  1UEF A;  4HDQ A;  2DYN A;  1M7E A;  2K00 A;  3PVL A;  3T06 A;  1E5W A;  1K5D B;  3ZVR A;  2E2X A;  2KCJ A;  1DDW A;  1V5U A;  2BCJ A;  2GS0 A;  2YF0 A;  3A8P A;  2VRW B;  3ULB A;  3ULC A;  4HAU B;  2J0M A;  1I7A A;  4HB3 B;  4TYZ A;  4DBB A;  2RVB B;  2LOX A;  1MAI A;  5HE1 A;  2NMB A;  1U5F A;  4DXA B;  2MKR A;  2L1C A;  5EFX A;  1V88 A;  1WGU A;  2YRY A;  1P5T A;  3D8E A;  2ROV A;  1Q67 A;  2Z0Q A;  1U5G A;  2IYB A;  1BTK A;  2YS5 A;  1OY2 A;  4GN1 A;  2COC A;  4HAZ B;  1MIZ B;  2YT1 A;  2V76 A;  3BJI A;  2D2Q A;  1FB8 A;  4Z2M B;  1WJ1 A;  2YS1 A;  2N23 A;  2DN6 A;  2DKQ A;  4A6H A;  1NTV A;  5FI0 A;  2DHI A;  2Y8G A;  5DIF B;  5DHA B;  2ADZ A;  2UZS A;  1NTY A;  5HE2 A;  4WJ7 A;  4TKN A;  2PZ1 A;  5D3Y A;  4K81 A;  2RGN B;  5KCV A;  3HW2 B;  2DYQ A;  5C6R A;  2G35 A;  3PVU A;  2H7E A;  1FHW A;  2D10 A;  4GMV A;  4IFS A;  4HAT B;  4WSF A;  3SYX A;  2JP2 A;  4GXB A;  2AEH A;  3KSY A;  1X11 A;  2LYD A;  2M38 A;  1WG7 A;  1DRO A;  2X18 A;  2LOZ A;  2ZPY A;  4HAY B;  4EJN A;  2M14 A;  4C0A A;  1V5M A;  2D9Y A;  2LKO A;  1X86 A;  2J59 M;  3GYP A;  2D11 A;  4Y94 A;  5J3Y A;  3ODW A;  3KRW A;  2AL6 A;  3PEG A;  3TVV A;  1XOD A;  1UPQ A;  1GC7 A;  1MK7 B;  2DX1 A;  2I5F A;  2MWN B;  2HE7 A;  5KQ1 A;  3IVF A;  1DBH A;  2Q13 A;  4PNK A;  1P3R A;  1UPR A;  1PMS A;  5GOW B;  3DXC A;  4YL8 A;  2DKP A;  1PLS A;  4F7G A;  4PQ0 A;  1LB1 A;  5DHF B;  3KRX A;  4K2P A;  3N7C A;  2XQN M;  2RNR B;  3F5R A;  2QKL A;  3PSC A;  3KY9 A;  3QBV B;  3SNH A;  1QC6 A;  2P0F A;  1DYN A;  4WVF B;  3SO6 A;  3A8Q A;  2KGX B;  2RLO A;  2RUK B;  3FEH A; 
#chains in the Genus database with same CATH topology
 2J0K A;  3VIA A;  3DCX A;  4HAV B;  3TFM A;  1UNR A;  3HK0 A;  1ZC4 B;  3AJ4 A;  1H4R A;  1LW3 A;  1GG3 A;  1UNP A;  1ZC3 B;  1W1G A;  2HTH B;  1U2B A;  1H10 A;  2COD A;  2I5C A;  5KQ4 A;  3AU4 A;  5JLJ B;  3DXE A;  4H8S A;  2D9W A;  1XKE A;  2R09 A;  3QWM A;  4CHM A;  4EKU A;  2KR0 A;  4ZRI A;  4IAP A;  3MPX A;  3FSS A;  1X05 A;  3P6A A;  1U27 A;  1QQG A;  1MI1 A;  1FHO A;  3G9W A;  1OMW A;  3PP2 A;  1XX0 A;  3F0W A;  5JP4 A;  2UZR A;  5FI1 A;  1SGH A;  2H7D A;  2FJU B;  5C79 A;  3PZD A;  4A6K A;  4BBK A;  4L6E A;  3LJU X;  3RCP A;  4OSN A;  4K17 A;  4NSW A;  1GC6 A;  2DTC A;  2Y7B A;  5IRS A;  1K5G B;  1XR0 B;  1WGQ A;  2KIE A;  3ML4 A;  1NI2 A;  3SUZ A;  5LOP B;  2VKI A;  3GYO A;  1Y19 B;  2RSG A;  4P7I A;  3U7D A;  3D8F A;  4A6F B;  1T77 A;  2I1K A;  4HAX B;  2GCL A;  4YON A;  3M1I B;  4HHV A;  3KZ1 A;  4A5K A;  1MKE A;  2K2U A;  1EGX A;  2FJL A;  4KHB B;  1OQN A;  3HQC A;  2DLW A;  2CY4 A;  2R0D A;  2P0H A;  3NWA A;  1BAK A;  3O96 A;  2ELB A;  2NBV A;  2YSZ A;  1DDM A;  3P7Z A;  2D9X A;  3U8Z A;  1ZYI A;  4KVG B;  3SV1 A;  3A58 A;  2CRF A;  1IRS A;  3D8D A;  2J0J A;  4CSQ A;  3X23 A;  4K2O A;  1N3H A;  5D3W A;  1RRP B;  3ODO A;  2DX5 A;  2OQB A;  5DI9 B;  5CLL B;  2EJ8 A;  1AQC A;  2LUL A;  4MY6 A;  2KUP A;  4D0N B;  3QIJ A;  1EF1 A;  1NU2 A;  4B6H A;  2EMS A;  1Z87 A;  2EC1 A;  2R2Y A;  2Z0P A;  1WI1 A;  3VOQ A;  5I2S A;  5JHG A;  1J0W A;  5J3T A;  1SHC A;  1U5E A;  2D9Z A;  4XWX A;  3NWD A;  2DHJ A;  1ZVR A;  3A98 B;  1TXD A;  3TW1 A;  4HB2 B;  5C5B B;  2QKM A;  5D27 A;  1WJM A;  2LG1 A;  3HIE A;  3PVW A;  5C5B A;  2DFK A;  2D4Q A;  2Z4D A;  1U29 A;  1FGZ A;  1UNQ A;  2P0D A;  2Y8F A;  2MDX A;  1V5P A;  2EMT A;  4F7H A;  5CLQ B;  3B77 A;  3OAN A;  3ODX A;  2YVC A;  5D3V A;  1KZG A;  2GCJ A;  1V61 A;  4CHJ A;  1KI1 B;  1FOE A;  2YT2 A;  1W1D A;  2COA A;  4HDO A;  2CY5 A;  3MDB C;  3UZT A;  1RJ2 A;  2W2X D;  1BWN A;  3CXB B;  1PFJ A;  1EVH A;  1XCG A;  2DA0 A;  1B55 A;  3V5W A;  4HB4 B;  4IOY X;  4A6F A;  3NWF A;  1J19 A;  1ZM0 A;  2IFS A;  4HAW B;  5D3X A;  2N0Y A;  2YT0 A;  3OHM B;  4MK0 A;  3WA0 A;  4QJ4 B;  1M7R A;  4Z2N A;  3WYF B;  2GJY A;  1W1H A;  2Z59 A;  3CIK A;  1MIX A;  1U5D A;  5C16 A;  4OT1 A;  2OTX A;  2CAY A;  2YS3 A;  4KHA A;  1FHX A;  4KHO A;  4NY0 A;  1TJ6 A;  1Y5O A;  2ELA A;  1X1F A;  1ZSQ A;  2VSZ A;  4DX9 0;  1EAZ A;  2Z0O A;  2Z13 A;  2W2W A;  1X1G A;  3BIN A;  5JHH A;  3TCA A;  1AWE A;  2K8E A;  4F7U P;  4MT7 A;  4DIX A;  5L81 A;  4DX8 A;  5J3Q A;  5LON B;  4ZRJ A;  1I2H A;  2NZ8 B;  1BTN A;  1V89 A;  2D9V A;  4CYE A;  4KAX B;  2P8V A;  5M4Y B;  1MK9 B;  1TQZ A;  3TO1 A;  1MPH A;  4QJ3 B;  2I1J A;  4HB0 B;  5HE3 A;  1FGY A;  4ZRK A;  2ROZ B;  2DHK A;  2UVM A;  3AU5 A;  2COF A;  1WVH A;  1FAO A;  4GMX B;  2W2X C;  5DH9 B;  3FM8 C;  1ISN A;  3DXD A;  2K2J A;  2MFQ A;  3PG7 A;  2KIG A;  3NSU A;  4EMO A;  1P6S A;  3ZDT A;  4GPT B;  5HE0 A;  4GZU A;  2L2I A;  1XD4 A;  1DDV A;  1KZ7 A;  4HSI A;  1UEF A;  4HDQ A;  2DYN A;  2ZKM X;  1M7E A;  2K00 A;  3PVL A;  3T06 A;  5I2M A;  1E5W A;  1K5D B;  3ZVR A;  2E2X A;  2KCJ A;  1DDW A;  1V5U A;  2BCJ A;  2GS0 A;  2YF0 A;  3A8P A;  2VRW B;  3ULB A;  3ULC A;  4HAU B;  2J0M A;  1I7A A;  4HB3 B;  4TYZ A;  4DBB A;  2RVB B;  4KHB A;  2KUQ A;  2LOX A;  1MAI A;  5HE1 A;  2NMB A;  1U5F A;  4DXA B;  2MKR A;  3HSA A;  2L1C A;  5EFX A;  1V88 A;  1WGU A;  2YRY A;  1P5T A;  3D8E A;  4GOU A;  2ROV A;  1Q67 A;  2Z0Q A;  1U5G A;  2IYB A;  1BTK A;  2YS5 A;  4QXA B;  1OY2 A;  4GN1 A;  2COC A;  4HAZ B;  1MIZ B;  2YT1 A;  2V76 A;  2RRF A;  3BJI A;  2D2Q A;  1FB8 A;  4Z2M B;  1WJ1 A;  2YS1 A;  2N23 A;  2DN6 A;  2DKQ A;  4A6H A;  1NTV A;  5FI0 A;  2DHI A;  2Y8G A;  5DIF B;  5DHA B;  2ADZ A;  2UZS A;  1NTY A;  5HE2 A;  4WJ7 A;  4TKN A;  2PZ1 A;  5D3Y A;  4K81 A;  2RGN B;  4GNK B;  5KCV A;  3HW2 B;  2DYQ A;  5C6R A;  2G35 A;  3PVU A;  2H7E A;  4L1R A;  1FHW A;  2D10 A;  4GMV A;  4IFS A;  4HAT B;  4WSF A;  3SYX A;  2JP2 A;  4GXB A;  2AEH A;  3KSY A;  1X11 A;  2LYD A;  2M38 A;  1WG7 A;  2Z14 A;  1DRO A;  2X18 A;  2LOZ A;  2ZPY A;  4HAY B;  4EJN A;  2M14 A;  4C0A A;  1V5M A;  2D9Y A;  2LKO A;  1X86 A;  2J59 M;  2GUM A;  3GYP A;  2D11 A;  4Y94 A;  5J3Y A;  3ODW A;  3KRW A;  2AL6 A;  3PEG A;  3TVV A;  1XOD A;  1UPQ A;  1GC7 A;  1MK7 B;  2DX1 A;  2I5F A;  2MWN B;  2HE7 A;  5KQ1 A;  3IVF A;  3U12 A;  1DBH A;  4QJ5 B;  2Q13 A;  3FVC A;  5LG4 B;  4PNK A;  1P3R A;  2K49 A;  1UPR A;  1PMS A;  5GOW B;  3DXC A;  4YL8 A;  2DKP A;  3NW8 A;  1PLS A;  4F7G A;  4PQ0 A;  1LB1 A;  5DHF B;  3KRX A;  4K2P A;  3N7C A;  2XQN M;  2RNR B;  3F5R A;  2QKL A;  3PSC A;  4D6W A;  3KY9 A;  3QBV B;  3SNH A;  1QC6 A;  2P0F A;  1DYN A;  4WVF B;  3SO6 A;  3A8Q A;  2KGX B;  2RLO A;  2RUK B;  3FEH A; 
#chains in the Genus database with same CATH homology
 2J0K A;  3VIA A;  4HAV B;  3TFM A;  1UNR A;  3HK0 A;  1ZC4 B;  3AJ4 A;  1H4R A;  1LW3 A;  1GG3 A;  1UNP A;  1ZC3 B;  1W1G A;  2HTH B;  1U2B A;  1H10 A;  2COD A;  2I5C A;  5KQ4 A;  3AU4 A;  5JLJ B;  3DXE A;  4H8S A;  2D9W A;  1XKE A;  2R09 A;  3QWM A;  4CHM A;  4EKU A;  4ZRI A;  4IAP A;  3MPX A;  3FSS A;  1X05 A;  3P6A A;  1U27 A;  1QQG A;  1FHO A;  3G9W A;  1OMW A;  3PP2 A;  1XX0 A;  3F0W A;  5JP4 A;  2UZR A;  5FI1 A;  1SGH A;  2H7D A;  5C79 A;  3PZD A;  4A6K A;  4BBK A;  4L6E A;  3LJU X;  3RCP A;  4K17 A;  4NSW A;  1GC6 A;  2DTC A;  2Y7B A;  1K5G B;  1XR0 B;  1WGQ A;  3SUZ A;  3ML4 A;  1NI2 A;  5LOP B;  2VKI A;  3GYO A;  1Y19 B;  2RSG A;  4P7I A;  3U7D A;  3D8F A;  4A6F B;  2I1K A;  4HAX B;  2GCL A;  4YON A;  3M1I B;  4HHV A;  3KZ1 A;  4A5K A;  1MKE A;  2K2U A;  1EGX A;  2FJL A;  4KHB B;  1OQN A;  3HQC A;  2DLW A;  2CY4 A;  2R0D A;  2P0H A;  1BAK A;  3O96 A;  2ELB A;  2YSZ A;  1DDM A;  3P7Z A;  2D9X A;  3U8Z A;  4KVG B;  3SV1 A;  2CRF A;  1IRS A;  3D8D A;  2J0J A;  3X23 A;  4K2O A;  1N3H A;  5D3W A;  1RRP B;  3ODO A;  2DX5 A;  2OQB A;  5DI9 B;  5CLL B;  2EJ8 A;  1AQC A;  2LUL A;  4MY6 A;  2KUP A;  4D0N B;  3QIJ A;  1EF1 A;  1NU2 A;  4B6H A;  2EMS A;  1Z87 A;  2EC1 A;  2Z0P A;  1WI1 A;  3VOQ A;  5JHG A;  1J0W A;  5J3T A;  1SHC A;  1U5E A;  2D9Z A;  4XWX A;  2DHJ A;  1ZVR A;  3A98 B;  1TXD A;  3TW1 A;  4HB2 B;  5C5B B;  2QKM A;  5D27 A;  1WJM A;  2LG1 A;  3PVW A;  5C5B A;  2DFK A;  2D4Q A;  1U29 A;  1FGZ A;  1UNQ A;  2P0D A;  2Y8F A;  2MDX A;  1V5P A;  2EMT A;  4F7H A;  5CLQ B;  3OAN A;  3ODX A;  2YVC A;  5D3V A;  1KZG A;  2GCJ A;  1V61 A;  4CHJ A;  1KI1 B;  1FOE A;  1W1D A;  2COA A;  4HDO A;  2CY5 A;  3MDB C;  3UZT A;  1RJ2 A;  2W2X D;  1BWN A;  3CXB B;  1PFJ A;  1EVH A;  1XCG A;  2DA0 A;  1B55 A;  3V5W A;  4HB4 B;  4IOY X;  4A6F A;  1J19 A;  1ZM0 A;  2IFS A;  4HAW B;  5D3X A;  2N0Y A;  2YT0 A;  4MK0 A;  3WA0 A;  1M7R A;  4Z2N A;  3WYF B;  2GJY A;  1W1H A;  1MIX A;  3CIK A;  1U5D A;  5C16 A;  2OTX A;  2CAY A;  2YS3 A;  4KHA A;  1FHX A;  4KHO A;  4NY0 A;  1TJ6 A;  1Y5O A;  2ELA A;  1X1F A;  1ZSQ A;  2VSZ A;  4DX9 0;  1EAZ A;  2Z0O A;  2W2W A;  1X1G A;  3BIN A;  5JHH A;  3TCA A;  1AWE A;  4F7U P;  4MT7 A;  5L81 A;  4DX8 A;  5J3Q A;  5LON B;  4ZRJ A;  1I2H A;  2NZ8 B;  1BTN A;  1V89 A;  2D9V A;  4CYE A;  4KAX B;  2P8V A;  1MK9 B;  1TQZ A;  3TO1 A;  1MPH A;  2I1J A;  4HB0 B;  5HE3 A;  1FGY A;  4ZRK A;  2ROZ B;  2DHK A;  2UVM A;  3AU5 A;  2COF A;  1WVH A;  1FAO A;  4GMX B;  2W2X C;  5DH9 B;  3FM8 C;  1ISN A;  3DXD A;  2K2J A;  2MFQ A;  3PG7 A;  3NSU A;  4EMO A;  1P6S A;  3ZDT A;  4GPT B;  5HE0 A;  4GZU A;  2L2I A;  1XD4 A;  1DDV A;  1KZ7 A;  1UEF A;  4HDQ A;  2DYN A;  1M7E A;  2K00 A;  3PVL A;  3T06 A;  1E5W A;  1K5D B;  3ZVR A;  2E2X A;  2KCJ A;  1DDW A;  1V5U A;  2BCJ A;  2GS0 A;  2YF0 A;  3A8P A;  2VRW B;  3ULB A;  3ULC A;  4HAU B;  2J0M A;  1I7A A;  4HB3 B;  4TYZ A;  4DBB A;  2RVB B;  2LOX A;  1MAI A;  5HE1 A;  2NMB A;  1U5F A;  4DXA B;  2MKR A;  2L1C A;  5EFX A;  1V88 A;  1WGU A;  2YRY A;  1P5T A;  3D8E A;  2ROV A;  1Q67 A;  2Z0Q A;  1U5G A;  2IYB A;  1BTK A;  2YS5 A;  1OY2 A;  4GN1 A;  2COC A;  4HAZ B;  1MIZ B;  2YT1 A;  2V76 A;  3BJI A;  2D2Q A;  1FB8 A;  4Z2M B;  1WJ1 A;  2YS1 A;  2N23 A;  2DN6 A;  2DKQ A;  4A6H A;  1NTV A;  5FI0 A;  2DHI A;  2Y8G A;  5DIF B;  5DHA B;  2ADZ A;  2UZS A;  1NTY A;  5HE2 A;  4WJ7 A;  4TKN A;  2PZ1 A;  5D3Y A;  4K81 A;  2RGN B;  5KCV A;  3HW2 B;  2DYQ A;  5C6R A;  2G35 A;  3PVU A;  2H7E A;  1FHW A;  2D10 A;  4GMV A;  4IFS A;  4HAT B;  4WSF A;  3SYX A;  2JP2 A;  4GXB A;  2AEH A;  3KSY A;  1X11 A;  2LYD A;  2M38 A;  1WG7 A;  1DRO A;  2X18 A;  2LOZ A;  2ZPY A;  4HAY B;  4EJN A;  2M14 A;  4C0A A;  1V5M A;  2D9Y A;  2LKO A;  1X86 A;  2J59 M;  3GYP A;  2D11 A;  4Y94 A;  5J3Y A;  3ODW A;  3KRW A;  2AL6 A;  3PEG A;  3TVV A;  1XOD A;  1UPQ A;  1GC7 A;  1MK7 B;  2DX1 A;  2I5F A;  2MWN B;  2HE7 A;  5KQ1 A;  3IVF A;  1DBH A;  2Q13 A;  4PNK A;  1P3R A;  1UPR A;  1PMS A;  5GOW B;  3DXC A;  4YL8 A;  2DKP A;  1PLS A;  4F7G A;  4PQ0 A;  1LB1 A;  5DHF B;  3KRX A;  4K2P A;  3N7C A;  2XQN M;  2RNR B;  3F5R A;  2QKL A;  3PSC A;  3KY9 A;  3QBV B;  3SNH A;  1QC6 A;  2P0F A;  1DYN A;  4WVF B;  3SO6 A;  3A8Q A;  2KGX B;  2RLO A;  2RUK B;  3FEH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...