2CRFA

Solution structure of the ran_bp1 domain of ran-binding protein-3
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
150
structure length
150
Chain Sequence
GSSGSSGTARKCLLEKVEVITGEEAESNVLQMQCKLFVFDKTSQSWVERGRGLLRLNDMASTDDGTLQSRLVMRTQGSLRLILNTKLWAQMQIDKASEKSIHITAMDTEDQGVKVFLISASSKDTGQLYAALHHRILALRSRVESGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RAN binding protein 3
publication title Solution structure of the Ran_BP1 domain of RAN-binding protein-3
rcsb
source organism Homo sapiens
molecule tags Transport protein
total genus 17
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2005-05-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00638 Ran_BP1 RanBP1 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2crfA01
2D9VA 4HB2B 1WGUA 2R0DA 4TYZA 4GZUA 5C79A 2HE7A 1W1DA 2EJ8A 4KHBB 4EMOA 4NY0A 4TKNA 4ZRIA 2NZ8B 2Z0PA 3RCPA 1EVHA 5FI1A 1MKEA 3GYOA 4K17A 4A6KA 4HDQA 2ADZA 2YS1A 2LKOA 1UPRA 2JP2A 3HQCA 1Y19B 1P6SA 5D3YA 3U8ZA 3A98B 1WJ1A 5D3XA 3TO1A 3WYFB 1I7AA 1PFJA 4K2OA 3DXEA 4GXBA 4HB0B 1V5MA 3PSCA 2L1CA 1ZM0A 3PZDA 5D3WA 1H4RA 5JHHA 3IVFA 2I1KA 5JP4A 2ELBA 3ZDTA 2COCA 4DX8A 1MIZB 4NSWA 1RRPB 2K2UA 5C5BB 1DROA 3FEHA 2VKIA 2ROZB 1ZC3B 2I5FA 3TCAA 2UVMA 4HAYB 1AWEA 2AL6A 1NTYA 1DDMA 2YT0A 1MIXA 3KSYA 3PVUA 2YSZA 1XR0B 1EF1A 3M1IB 3G9WA 2DX5A 3ODOA 3X23A 4K81A 2PZ1A 2RUKB 2DN6A 2N0YA 4K2PA 2W2XD 2EMTA 3KRWA 1NU2A 4DX90 4HAZB 4H8SA 4ZRJA 1AQCA 1H10A 2IFSA 1BAKA 1UNPA 1XODA 1GC6A 2MFQA 2KGXB 5J3TA 2LG1A 4EJNA 3KZ1A 5DHAB 1BTKA 5J3QA 3HK0A 1Y5OA 2J0KA 1DYNA 1SGHA 5CLQB 1PMSA 2LOZA 3VIAA 4A6HA 1MK9B 1K5GB 2LULA 2YRYA 2D4QA 1DDVA 2I1JA 4HAVB 3AU5A 2YVCA 2M38A 2LYDA 4Z2NA 4DBBA 1DDWA 3DXDA 2FJLA 3TFMA 2MKRA 2K2JA 2EC1A 1OY2A 2OTXA 2P8VA 2DX1A 2D9ZA 1M7EA 2Y7BA 5LOPB 1U27A 2OQBA 1ZC4B 2DFKA 2IYBA 2W2WA 2D9WA 3D8FA 5D27A 2KUPA 2NMBA 3UZTA 4F7HA 1XD4A 2Y8GA 1UPQA 2CRFA 2RLOA 1NI2A 4IAPA 3ODXA 3ZVRA 3ULBA 5KQ4A 3DXCA 2VSZA 3AU4A 1V5PA 1OQNA 2CAYA 2YF0A 4HDOA 3OANA 4KAXB 4HAUB 1DBHA 1U2BA 3T06A 3MDBC 3P6AA 3PP2A 5JLJB 5HE0A 2V76A 4WJ7A 1V61A 3PG7A 5FI0A 1U5GA 2D10A 2I5CA 4HAWB 1UNQA 1KZ7A 3VOQA 5DHFB 2GCJA 5C5BA 3A8PA 4HATB 2CODA 1FGYA 1EAZA 2MWNB 1K5DB 1ZVRA 2CY4A 3WA0A 3HW2B 4KVGB 1GG3A 3AJ4A 2ZPYA 5KQ1A 1XKEA 2N23A 3U7DA 4BBKA 1TQZA 1FGZA 4Z2MB 2ROVA 2J59M 2X18A 2Y8FA 5EFXA 2CY5A 2DYNA 1V5UA 1LB1A 2DKPA 1GC7A 3SYXA 2DHIA 2MDXA 1OMWA 2G35A 2DA0A 4F7UP 2D11A 1FHWA 2Q13A 2RGNB 1J19A 3D8EA 2VRWB 5L81A 4D0NB 1ISNA 3TW1A 5HE3A 4KHAA 5DI9B 1U29A 2BCJA 1BTNA 3QWMA 2EMSA 1M7RA 1U5EA 1N3HA 2DHJA 1SHCA 1B55A 3PEGA 2Z0OA 2J0JA 3FSSA 3QBVB 4MK0A 1WVHA 1LW3A 1UEFA 2YT1A 2P0FA 1FHOA 4GN1A 5HE1A 4HB3B 3BINA 4EKUA 2HTHB 3SUZA 3ODWA 3O96A 3V5WA 3CIKA 4XWXA 4GPTB 2GCLA 1FOEA 4IFSA 5DIFB 2L2IA 2RVBB 1X1FA 1P5TA 4KHOA 1WI1A 1J0WA 1TXDA 2D2QA 4A6FB 4PQ0A 4WVFB 1WJMA 2J0MA 1MK7B 1BWNA 4HHVA 1IRSA 3NSUA 1WG7A 2XQNM 4GMXB 1PLSA 1MAIA 5HE2A 4MY6A 2H7DA 4CHJA 3SNHA 3QIJA 3ULCA 3P7ZA 3D8DA 5J3YA 2RSGA 1U5DA 3KY9A 4CHMA 4ZRKA 2GJYA 2E2XA 1QQGA 1Z87A 1NTVA 1X05A 1W1HA 2DTCA 4YONA 2DKQA 2UZRA 1P3RA 1V89A 4HB4B 4P7IA 4PNKA 1Q67A 2D9XA 2D9YA 2P0HA 4GMVA 1X11A 3ML4A 4L6EA 1WGQA 1TJ6A 5C16A 1FB8A 2YS3A 2GS0A 3F5RA 1FAOA 5GOWB 5C6RA 3N7CA 1RJ2A 2R09A 4A5KA 2DYQA 2YS5A 2RNRB 4C0AA 2DLWA 2M14A 3PVLA 5D3VA 3MPXA 4MT7A 1XX0A 1UNRA 3FM8C 1ZSQA 5KCVA 2K00A 1FHXA 5DH9B 2LOXA 1U5FA 5JHGA 2AEHA 5CLLB 3PVWA 1E5WA 2KCJA 3TVVA 1V88A 3SV1A 3GYPA 4Y94A 3BJIA 2Z0QA 1KZGA 2COFA 2H7EA 2W2XC 3A8QA 4YL8A 3F0WA 2QKLA 1QC6A 2UZSA 2COAA 1MPHA 4F7GA 2QKMA 2ELAA 3KRXA 5LONB 1EGXA 3SO6A 4CYEA 1XCGA 1X1GA 1KI1B 4B6HA 4IOYX 3CXBB 3LJUX 2DHKA 2P0DA 1W1GA 4DXAB 4HAXB 4A6FA 4WSFA 1I2HA 1X86A
chains in the Genus database with same CATH superfamily
2D9VA 2ZKMX 4HB2B 1WGUA 2R0DA 4TYZA 4GZUA 4QXAB 5C79A 2HE7A 1W1DA 2EJ8A 4KHBB 4EMOA 2Z13A 4NY0A 4TKNA 4ZRIA 2NZ8B 2Z0PA 3RCPA 1EVHA 5FI1A 1MKEA 3HIEA 3GYOA 4K17A 4A6KA 4HDQA 2ADZA 2YS1A 2LKOA 1UPRA 2JP2A 3HQCA 3HSAA 1Y19B 1P6SA 5D3YA 3U8ZA 3A98B 1WJ1A 1ZYIA 5D3XA 3TO1A 3WYFB 1I7AA 1PFJA 4K2OA 3DXEA 5M4YB 4GXBA 4HB0B 1V5MA 3PSCA 2L1CA 1ZM0A 3PZDA 5D3WA 1H4RA 5JHHA 3IVFA 2I1KA 5JP4A 2ELBA 2Z14A 3ZDTA 2COCA 4DX8A 1MIZB 4NSWA 1RRPB 2K2UA 5C5BB 1DROA 3FEHA 2VKIA 4CSQA 2ROZB 1ZC3B 2I5FA 3TCAA 2UVMA 4HAYB 1AWEA 2AL6A 1NTYA 1DDMA 2RRFA 2YT0A 1MIXA 3KSYA 3PVUA 2YSZA 1XR0B 1EF1A 3M1IB 3G9WA 2DX5A 3ODOA 3X23A 4K81A 2PZ1A 2RUKB 2DN6A 2N0YA 4K2PA 2W2XD 2EMTA 3KRWA 1NU2A 4DX90 4HAZB 4H8SA 4ZRJA 1AQCA 1H10A 2IFSA 1BAKA 3U12A 5I2MA 1UNPA 1XODA 1GC6A 2MFQA 2KGXB 5J3TA 2LG1A 4OT1A 4EJNA 3KZ1A 5DHAB 1BTKA 5J3QA 3HK0A 5IRSA 1Y5OA 2J0KA 1DYNA 1SGHA 2Z4DA 5CLQB 1PMSA 2LOZA 3VIAA 3NWAA 4A6HA 1MK9B 1K5GB 2LULA 2YRYA 2D4QA 1DDVA 2I1JA 4HAVB 3AU5A 2YVCA 2M38A 2LYDA 4Z2NA 4DBBA 1DDWA 3DXDA 2FJLA 3TFMA 2MKRA 2K2JA 2EC1A 1OY2A 2OTXA 2P8VA 2DX1A 2D9ZA 1M7EA 3NW8A 2Y7BA 5LOPB 1U27A 2OQBA 1ZC4B 1MI1A 2DFKA 4KHBA 3A58A 2IYBA 4QJ3B 2W2WA 2D9WA 3D8FA 5D27A 2KUPA 2NMBA 3UZTA 4F7HA 1XD4A 2Y8GA 1UPQA 2CRFA 2RLOA 1NI2A 4IAPA 3ODXA 3ZVRA 3ULBA 2YT2A 5KQ4A 3DXCA 2VSZA 3AU4A 2KIEA 1V5PA 1OQNA 2CAYA 2YF0A 4HDOA 3OANA 4KAXB 4HAUB 1DBHA 1U2BA 3T06A 3MDBC 3P6AA 3PP2A 5JLJB 5HE0A 2V76A 4WJ7A 1V61A 3PG7A 5FI0A 1U5GA 2D10A 2I5CA 4HAWB 1UNQA 1KZ7A 3VOQA 5DHFB 2GCJA 4DIXA 5C5BA 3A8PA 4HATB 2CODA 1FGYA 1EAZA 2MWNB 1K5DB 1ZVRA 2CY4A 3WA0A 3HW2B 2Z59A 4KVGB 1GG3A 3AJ4A 2ZPYA 5KQ1A 1XKEA 4QJ5B 2N23A 3U7DA 4BBKA 1TQZA 1FGZA 4Z2MB 2ROVA 2J59M 2X18A 2Y8FA 5EFXA 2CY5A 2DYNA 1V5UA 1LB1A 2K8EA 2DKPA 1GC7A 3SYXA 2DHIA 2MDXA 1OMWA 2G35A 2DA0A 4F7UP 2D11A 1FHWA 2Q13A 2RGNB 1J19A 3D8EA 2VRWB 5L81A 4D0NB 1ISNA 3TW1A 5HE3A 4KHAA 5DI9B 1U29A 2BCJA 1BTNA 3QWMA 2EMSA 2R2YA 1M7RA 1U5EA 1N3HA 5LG4B 2DHJA 1SHCA 1B55A 3PEGA 2Z0OA 2J0JA 3FSSA 3QBVB 4MK0A 1WVHA 1LW3A 1UEFA 2YT1A 2KR0A 2P0FA 1FHOA 4GN1A 5HE1A 4HB3B 4OSNA 3BINA 4EKUA 2HTHB 3SUZA 3ODWA 3O96A 3V5WA 3CIKA 4XWXA 4GPTB 2GCLA 1FOEA 4IFSA 5DIFB 2L2IA 2RVBB 3B77A 1X1FA 1P5TA 4KHOA 1WI1A 1J0WA 1TXDA 2D2QA 2NBVA 4A6FB 4PQ0A 2KUQA 4WVFB 1WJMA 2J0MA 1MK7B 1BWNA 4HHVA 1IRSA 3NSUA 1WG7A 2XQNM 4GMXB 1PLSA 1MAIA 3FVCA 4MY6A 2H7DA 5HE2A 4CHJA 3SNHA 3QIJA 4D6WA 4QJ4B 3ULCA 3P7ZA 3D8DA 5J3YA 2RSGA 1U5DA 3KY9A 4CHMA 4ZRKA 4GOUA 2GJYA 2E2XA 1QQGA 1Z87A 1NTVA 2GUMA 1X05A 1W1HA 2DTCA 4YONA 2DKQA 2UZRA 1P3RA 1V89A 4HB4B 4P7IA 4PNKA 1Q67A 4GNKB 2D9XA 2D9YA 2P0HA 4GMVA 4HSIA 1X11A 3ML4A 4L1RA 5I2SA 2KIGA 4L6EA 1WGQA 1TJ6A 5C16A 1FB8A 2YS3A 2GS0A 3F5RA 2FJUB 1FAOA 5GOWB 5C6RA 3N7CA 1RJ2A 2R09A 4A5KA 2DYQA 2YS5A 2RNRB 4C0AA 2DLWA 2M14A 3PVLA 5D3VA 3MPXA 4MT7A 1XX0A 1UNRA 3FM8C 1ZSQA 5KCVA 2K00A 1FHXA 5DH9B 2LOXA 1U5FA 5JHGA 2AEHA 5CLLB 3PVWA 1E5WA 1T77A 2KCJA 3TVVA 1V88A 3SV1A 3GYPA 4Y94A 3BJIA 2Z0QA 3DCXA 1KZGA 2COFA 2H7EA 2W2XC 3A8QA 4YL8A 3F0WA 2QKLA 1QC6A 2UZSA 2COAA 1MPHA 4F7GA 2QKMA 2ELAA 3KRXA 5LONB 1EGXA 3SO6A 4CYEA 1XCGA 1X1GA 1KI1B 4B6HA 4IOYX 3CXBB 3LJUX 2K49A 3NWDA 2DHKA 3NWFA 2P0DA 1W1GA 3OHMB 4DXAB 4HAXB 4A6FA 4WSFA 1I2HA 1X86A
chains in the Genus database with same CATH topology
2D9VA 4HB2B 1WGUA 2R0DA 4TYZA 4GZUA 5C79A 2HE7A 1W1DA 2EJ8A 4KHBB 4EMOA 4NY0A 4TKNA 4ZRIA 2NZ8B 2Z0PA 3RCPA 1EVHA 5FI1A 1MKEA 3GYOA 4K17A 4A6KA 4HDQA 2ADZA 2YS1A 2LKOA 1UPRA 2JP2A 3HQCA 1Y19B 1P6SA 5D3YA 3U8ZA 3A98B 1WJ1A 5D3XA 3TO1A 3WYFB 1I7AA 1PFJA 4K2OA 3DXEA 4GXBA 4HB0B 1V5MA 3PSCA 2L1CA 1ZM0A 3PZDA 5D3WA 1H4RA 5JHHA 3IVFA 2I1KA 5JP4A 2ELBA 3ZDTA 2COCA 4DX8A 1MIZB 4NSWA 1RRPB 2K2UA 5C5BB 1DROA 3FEHA 2VKIA 2ROZB 1ZC3B 2I5FA 3TCAA 2UVMA 4HAYB 1AWEA 2AL6A 1NTYA 1DDMA 2YT0A 1MIXA 3KSYA 3PVUA 2YSZA 1XR0B 1EF1A 3M1IB 3G9WA 2DX5A 3ODOA 3X23A 4K81A 2PZ1A 2RUKB 2DN6A 2N0YA 4K2PA 2W2XD 2EMTA 3KRWA 1NU2A 4DX90 4HAZB 4H8SA 4ZRJA 1AQCA 1H10A 2IFSA 1BAKA 1UNPA 1XODA 1GC6A 2MFQA 2KGXB 5J3TA 2LG1A 4EJNA 3KZ1A 5DHAB 1BTKA 5J3QA 3HK0A 1Y5OA 2J0KA 1DYNA 1SGHA 5CLQB 1PMSA 2LOZA 3VIAA 4A6HA 1MK9B 1K5GB 2LULA 2YRYA 2D4QA 1DDVA 2I1JA 4HAVB 3AU5A 2YVCA 2M38A 2LYDA 4Z2NA 4DBBA 1DDWA 3DXDA 2FJLA 3TFMA 2MKRA 2K2JA 2EC1A 1OY2A 2OTXA 2P8VA 2DX1A 2D9ZA 1M7EA 2Y7BA 5LOPB 1U27A 2OQBA 1ZC4B 2DFKA 2IYBA 2W2WA 2D9WA 3D8FA 5D27A 2KUPA 2NMBA 3UZTA 4F7HA 1XD4A 2Y8GA 1UPQA 2CRFA 2RLOA 1NI2A 4IAPA 3ODXA 3ZVRA 3ULBA 5KQ4A 3DXCA 2VSZA 3AU4A 1V5PA 1OQNA 2CAYA 2YF0A 4HDOA 3OANA 4KAXB 4HAUB 1DBHA 1U2BA 3T06A 3MDBC 3P6AA 3PP2A 5JLJB 5HE0A 2V76A 4WJ7A 1V61A 3PG7A 5FI0A 1U5GA 2D10A 2I5CA 4HAWB 1UNQA 1KZ7A 3VOQA 5DHFB 2GCJA 5C5BA 3A8PA 4HATB 2CODA 1FGYA 1EAZA 2MWNB 1K5DB 1ZVRA 2CY4A 3WA0A 3HW2B 4KVGB 1GG3A 3AJ4A 2ZPYA 5KQ1A 1XKEA 2N23A 3U7DA 4BBKA 1TQZA 1FGZA 4Z2MB 2ROVA 2J59M 2X18A 2Y8FA 5EFXA 2CY5A 2DYNA 1V5UA 1LB1A 2DKPA 1GC7A 3SYXA 2DHIA 2MDXA 1OMWA 2G35A 2DA0A 4F7UP 2D11A 1FHWA 2Q13A 2RGNB 1J19A 3D8EA 2VRWB 5L81A 4D0NB 1ISNA 3TW1A 5HE3A 4KHAA 5DI9B 1U29A 2BCJA 1BTNA 3QWMA 2EMSA 1M7RA 1U5EA 1N3HA 2DHJA 1SHCA 1B55A 3PEGA 2Z0OA 2J0JA 3FSSA 3QBVB 4MK0A 1WVHA 1LW3A 1UEFA 2YT1A 2P0FA 1FHOA 4GN1A 5HE1A 4HB3B 3BINA 4EKUA 2HTHB 3SUZA 3ODWA 3O96A 3V5WA 3CIKA 4XWXA 4GPTB 2GCLA 1FOEA 4IFSA 5DIFB 2L2IA 2RVBB 1X1FA 1P5TA 4KHOA 1WI1A 1J0WA 1TXDA 2D2QA 4A6FB 4PQ0A 4WVFB 1WJMA 2J0MA 1MK7B 1BWNA 4HHVA 1IRSA 3NSUA 1WG7A 2XQNM 4GMXB 1PLSA 1MAIA 5HE2A 4MY6A 2H7DA 4CHJA 3SNHA 3QIJA 3ULCA 3P7ZA 3D8DA 5J3YA 2RSGA 1U5DA 3KY9A 4CHMA 4ZRKA 2GJYA 2E2XA 1QQGA 1Z87A 1NTVA 1X05A 1W1HA 2DTCA 4YONA 2DKQA 2UZRA 1P3RA 1V89A 4HB4B 4P7IA 4PNKA 1Q67A 2D9XA 2D9YA 2P0HA 4GMVA 1X11A 3ML4A 4L6EA 1WGQA 1TJ6A 5C16A 1FB8A 2YS3A 2GS0A 3F5RA 1FAOA 5GOWB 5C6RA 3N7CA 1RJ2A 2R09A 4A5KA 2DYQA 2YS5A 2RNRB 4C0AA 2DLWA 2M14A 3PVLA 5D3VA 3MPXA 4MT7A 1XX0A 1UNRA 3FM8C 1ZSQA 5KCVA 2K00A 1FHXA 5DH9B 2LOXA 1U5FA 5JHGA 2AEHA 5CLLB 3PVWA 1E5WA 2KCJA 3TVVA 1V88A 3SV1A 3GYPA 4Y94A 3BJIA 2Z0QA 1KZGA 2COFA 2H7EA 2W2XC 3A8QA 4YL8A 3F0WA 2QKLA 1QC6A 2UZSA 2COAA 1MPHA 4F7GA 2QKMA 2ELAA 3KRXA 5LONB 1EGXA 3SO6A 4CYEA 1XCGA 1X1GA 1KI1B 4B6HA 4IOYX 3CXBB 3LJUX 2DHKA 2P0DA 1W1GA 4DXAB 4HAXB 4A6FA 4WSFA 1I2HA 1X86A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2D9V A;  4HB2 B;  1WGU A;  2R0D A;  4TYZ A;  4GZU A;  5C79 A;  2HE7 A;  1W1D A;  2EJ8 A;  4KHB B;  4EMO A;  4NY0 A;  4TKN A;  4ZRI A;  2NZ8 B;  2Z0P A;  3RCP A;  1EVH A;  5FI1 A;  1MKE A;  3GYO A;  4K17 A;  4A6K A;  4HDQ A;  2ADZ A;  2YS1 A;  2LKO A;  1UPR A;  2JP2 A;  3HQC A;  1Y19 B;  1P6S A;  5D3Y A;  3U8Z A;  3A98 B;  1WJ1 A;  5D3X A;  3TO1 A;  3WYF B;  1I7A A;  1PFJ A;  4K2O A;  3DXE A;  4GXB A;  4HB0 B;  1V5M A;  3PSC A;  2L1C A;  1ZM0 A;  3PZD A;  5D3W A;  1H4R A;  5JHH A;  3IVF A;  2I1K A;  5JP4 A;  2ELB A;  3ZDT A;  2COC A;  4DX8 A;  1MIZ B;  4NSW A;  1RRP B;  2K2U A;  5C5B B;  1DRO A;  3FEH A;  2VKI A;  2ROZ B;  1ZC3 B;  2I5F A;  3TCA A;  2UVM A;  4HAY B;  1AWE A;  2AL6 A;  1NTY A;  1DDM A;  2YT0 A;  1MIX A;  3KSY A;  3PVU A;  2YSZ A;  1XR0 B;  1EF1 A;  3M1I B;  3G9W A;  2DX5 A;  3ODO A;  3X23 A;  4K81 A;  2PZ1 A;  2RUK B;  2DN6 A;  2N0Y A;  4K2P A;  2W2X D;  2EMT A;  3KRW A;  1NU2 A;  4DX9 0;  4HAZ B;  4H8S A;  4ZRJ A;  1AQC A;  1H10 A;  2IFS A;  1BAK A;  1UNP A;  1XOD A;  1GC6 A;  2MFQ A;  2KGX B;  5J3T A;  2LG1 A;  4EJN A;  3KZ1 A;  5DHA B;  1BTK A;  5J3Q A;  3HK0 A;  1Y5O A;  2J0K A;  1DYN A;  1SGH A;  5CLQ B;  1PMS A;  2LOZ A;  3VIA A;  4A6H A;  1MK9 B;  1K5G B;  2LUL A;  2YRY A;  2D4Q A;  1DDV A;  2I1J A;  4HAV B;  3AU5 A;  2YVC A;  2M38 A;  2LYD A;  4Z2N A;  4DBB A;  1DDW A;  3DXD A;  2FJL A;  3TFM A;  2MKR A;  2K2J A;  2EC1 A;  1OY2 A;  2OTX A;  2P8V A;  2DX1 A;  2D9Z A;  1M7E A;  2Y7B A;  5LOP B;  1U27 A;  2OQB A;  1ZC4 B;  2DFK A;  2IYB A;  2W2W A;  2D9W A;  3D8F A;  5D27 A;  2KUP A;  2NMB A;  3UZT A;  4F7H A;  1XD4 A;  2Y8G A;  1UPQ A;  2CRF A;  2RLO A;  1NI2 A;  4IAP A;  3ODX A;  3ZVR A;  3ULB A;  5KQ4 A;  3DXC A;  2VSZ A;  3AU4 A;  1V5P A;  1OQN A;  2CAY A;  2YF0 A;  4HDO A;  3OAN A;  4KAX B;  4HAU B;  1DBH A;  1U2B A;  3T06 A;  3MDB C;  3P6A A;  3PP2 A;  5JLJ B;  5HE0 A;  2V76 A;  4WJ7 A;  1V61 A;  3PG7 A;  5FI0 A;  1U5G A;  2D10 A;  2I5C A;  4HAW B;  1UNQ A;  1KZ7 A;  3VOQ A;  5DHF B;  2GCJ A;  5C5B A;  3A8P A;  4HAT B;  2COD A;  1FGY A;  1EAZ A;  2MWN B;  1K5D B;  1ZVR A;  2CY4 A;  3WA0 A;  3HW2 B;  4KVG B;  1GG3 A;  3AJ4 A;  2ZPY A;  5KQ1 A;  1XKE A;  2N23 A;  3U7D A;  4BBK A;  1TQZ A;  1FGZ A;  4Z2M B;  2ROV A;  2J59 M;  2X18 A;  2Y8F A;  5EFX A;  2CY5 A;  2DYN A;  1V5U A;  1LB1 A;  2DKP A;  1GC7 A;  3SYX A;  2DHI A;  2MDX A;  1OMW A;  2G35 A;  2DA0 A;  4F7U P;  2D11 A;  1FHW A;  2Q13 A;  2RGN B;  1J19 A;  3D8E A;  2VRW B;  5L81 A;  4D0N B;  1ISN A;  3TW1 A;  5HE3 A;  4KHA A;  5DI9 B;  1U29 A;  2BCJ A;  1BTN A;  3QWM A;  2EMS A;  1M7R A;  1U5E A;  1N3H A;  2DHJ A;  1SHC A;  1B55 A;  3PEG A;  2Z0O A;  2J0J A;  3FSS A;  3QBV B;  4MK0 A;  1WVH A;  1LW3 A;  1UEF A;  2YT1 A;  2P0F A;  1FHO A;  4GN1 A;  5HE1 A;  4HB3 B;  3BIN A;  4EKU A;  2HTH B;  3SUZ A;  3ODW A;  3O96 A;  3V5W A;  3CIK A;  4XWX A;  4GPT B;  2GCL A;  1FOE A;  4IFS A;  5DIF B;  2L2I A;  2RVB B;  1X1F A;  1P5T A;  4KHO A;  1WI1 A;  1J0W A;  1TXD A;  2D2Q A;  4A6F B;  4PQ0 A;  4WVF B;  1WJM A;  2J0M A;  1MK7 B;  1BWN A;  4HHV A;  1IRS A;  3NSU A;  1WG7 A;  2XQN M;  4GMX B;  1PLS A;  1MAI A;  5HE2 A;  4MY6 A;  2H7D A;  4CHJ A;  3SNH A;  3QIJ A;  3ULC A;  3P7Z A;  3D8D A;  5J3Y A;  2RSG A;  1U5D A;  3KY9 A;  4CHM A;  4ZRK A;  2GJY A;  2E2X A;  1QQG A;  1Z87 A;  1NTV A;  1X05 A;  1W1H A;  2DTC A;  4YON A;  2DKQ A;  2UZR A;  1P3R A;  1V89 A;  4HB4 B;  4P7I A;  4PNK A;  1Q67 A;  2D9X A;  2D9Y A;  2P0H A;  4GMV A;  1X11 A;  3ML4 A;  4L6E A;  1WGQ A;  1TJ6 A;  5C16 A;  1FB8 A;  2YS3 A;  2GS0 A;  3F5R A;  1FAO A;  5GOW B;  5C6R A;  3N7C A;  1RJ2 A;  2R09 A;  4A5K A;  2DYQ A;  2YS5 A;  2RNR B;  4C0A A;  2DLW A;  2M14 A;  3PVL A;  5D3V A;  3MPX A;  4MT7 A;  1XX0 A;  1UNR A;  3FM8 C;  1ZSQ A;  5KCV A;  2K00 A;  1FHX A;  5DH9 B;  2LOX A;  1U5F A;  5JHG A;  2AEH A;  5CLL B;  3PVW A;  1E5W A;  2KCJ A;  3TVV A;  1V88 A;  3SV1 A;  3GYP A;  4Y94 A;  3BJI A;  2Z0Q A;  1KZG A;  2COF A;  2H7E A;  2W2X C;  3A8Q A;  4YL8 A;  3F0W A;  2QKL A;  1QC6 A;  2UZS A;  2COA A;  1MPH A;  4F7G A;  2QKM A;  2ELA A;  3KRX A;  5LON B;  1EGX A;  3SO6 A;  4CYE A;  1XCG A;  1X1G A;  1KI1 B;  4B6H A;  4IOY X;  3CXB B;  3LJU X;  2DHK A;  2P0D A;  1W1G A;  4DXA B;  4HAX B;  4A6F A;  4WSF A;  1I2H A;  1X86 A; 
#chains in the Genus database with same CATH topology
 2D9V A;  2ZKM X;  4HB2 B;  1WGU A;  2R0D A;  4TYZ A;  4GZU A;  4QXA B;  5C79 A;  2HE7 A;  1W1D A;  2EJ8 A;  4KHB B;  4EMO A;  2Z13 A;  4NY0 A;  4TKN A;  4ZRI A;  2NZ8 B;  2Z0P A;  3RCP A;  1EVH A;  5FI1 A;  1MKE A;  3HIE A;  3GYO A;  4K17 A;  4A6K A;  4HDQ A;  2ADZ A;  2YS1 A;  2LKO A;  1UPR A;  2JP2 A;  3HQC A;  3HSA A;  1Y19 B;  1P6S A;  5D3Y A;  3U8Z A;  3A98 B;  1WJ1 A;  1ZYI A;  5D3X A;  3TO1 A;  3WYF B;  1I7A A;  1PFJ A;  4K2O A;  3DXE A;  5M4Y B;  4GXB A;  4HB0 B;  1V5M A;  3PSC A;  2L1C A;  1ZM0 A;  3PZD A;  5D3W A;  1H4R A;  5JHH A;  3IVF A;  2I1K A;  5JP4 A;  2ELB A;  2Z14 A;  3ZDT A;  2COC A;  4DX8 A;  1MIZ B;  4NSW A;  1RRP B;  2K2U A;  5C5B B;  1DRO A;  3FEH A;  2VKI A;  4CSQ A;  2ROZ B;  1ZC3 B;  2I5F A;  3TCA A;  2UVM A;  4HAY B;  1AWE A;  2AL6 A;  1NTY A;  1DDM A;  2RRF A;  2YT0 A;  1MIX A;  3KSY A;  3PVU A;  2YSZ A;  1XR0 B;  1EF1 A;  3M1I B;  3G9W A;  2DX5 A;  3ODO A;  3X23 A;  4K81 A;  2PZ1 A;  2RUK B;  2DN6 A;  2N0Y A;  4K2P A;  2W2X D;  2EMT A;  3KRW A;  1NU2 A;  4DX9 0;  4HAZ B;  4H8S A;  4ZRJ A;  1AQC A;  1H10 A;  2IFS A;  1BAK A;  3U12 A;  5I2M A;  1UNP A;  1XOD A;  1GC6 A;  2MFQ A;  2KGX B;  5J3T A;  2LG1 A;  4OT1 A;  4EJN A;  3KZ1 A;  5DHA B;  1BTK A;  5J3Q A;  3HK0 A;  5IRS A;  1Y5O A;  2J0K A;  1DYN A;  1SGH A;  2Z4D A;  5CLQ B;  1PMS A;  2LOZ A;  3VIA A;  3NWA A;  4A6H A;  1MK9 B;  1K5G B;  2LUL A;  2YRY A;  2D4Q A;  1DDV A;  2I1J A;  4HAV B;  3AU5 A;  2YVC A;  2M38 A;  2LYD A;  4Z2N A;  4DBB A;  1DDW A;  3DXD A;  2FJL A;  3TFM A;  2MKR A;  2K2J A;  2EC1 A;  1OY2 A;  2OTX A;  2P8V A;  2DX1 A;  2D9Z A;  1M7E A;  3NW8 A;  2Y7B A;  5LOP B;  1U27 A;  2OQB A;  1ZC4 B;  1MI1 A;  2DFK A;  4KHB A;  3A58 A;  2IYB A;  4QJ3 B;  2W2W A;  2D9W A;  3D8F A;  5D27 A;  2KUP A;  2NMB A;  3UZT A;  4F7H A;  1XD4 A;  2Y8G A;  1UPQ A;  2CRF A;  2RLO A;  1NI2 A;  4IAP A;  3ODX A;  3ZVR A;  3ULB A;  2YT2 A;  5KQ4 A;  3DXC A;  2VSZ A;  3AU4 A;  2KIE A;  1V5P A;  1OQN A;  2CAY A;  2YF0 A;  4HDO A;  3OAN A;  4KAX B;  4HAU B;  1DBH A;  1U2B A;  3T06 A;  3MDB C;  3P6A A;  3PP2 A;  5JLJ B;  5HE0 A;  2V76 A;  4WJ7 A;  1V61 A;  3PG7 A;  5FI0 A;  1U5G A;  2D10 A;  2I5C A;  4HAW B;  1UNQ A;  1KZ7 A;  3VOQ A;  5DHF B;  2GCJ A;  4DIX A;  5C5B A;  3A8P A;  4HAT B;  2COD A;  1FGY A;  1EAZ A;  2MWN B;  1K5D B;  1ZVR A;  2CY4 A;  3WA0 A;  3HW2 B;  2Z59 A;  4KVG B;  1GG3 A;  3AJ4 A;  2ZPY A;  5KQ1 A;  1XKE A;  4QJ5 B;  2N23 A;  3U7D A;  4BBK A;  1TQZ A;  1FGZ A;  4Z2M B;  2ROV A;  2J59 M;  2X18 A;  2Y8F A;  5EFX A;  2CY5 A;  2DYN A;  1V5U A;  1LB1 A;  2K8E A;  2DKP A;  1GC7 A;  3SYX A;  2DHI A;  2MDX A;  1OMW A;  2G35 A;  2DA0 A;  4F7U P;  2D11 A;  1FHW A;  2Q13 A;  2RGN B;  1J19 A;  3D8E A;  2VRW B;  5L81 A;  4D0N B;  1ISN A;  3TW1 A;  5HE3 A;  4KHA A;  5DI9 B;  1U29 A;  2BCJ A;  1BTN A;  3QWM A;  2EMS A;  2R2Y A;  1M7R A;  1U5E A;  1N3H A;  5LG4 B;  2DHJ A;  1SHC A;  1B55 A;  3PEG A;  2Z0O A;  2J0J A;  3FSS A;  3QBV B;  4MK0 A;  1WVH A;  1LW3 A;  1UEF A;  2YT1 A;  2KR0 A;  2P0F A;  1FHO A;  4GN1 A;  5HE1 A;  4HB3 B;  4OSN A;  3BIN A;  4EKU A;  2HTH B;  3SUZ A;  3ODW A;  3O96 A;  3V5W A;  3CIK A;  4XWX A;  4GPT B;  2GCL A;  1FOE A;  4IFS A;  5DIF B;  2L2I A;  2RVB B;  3B77 A;  1X1F A;  1P5T A;  4KHO A;  1WI1 A;  1J0W A;  1TXD A;  2D2Q A;  2NBV A;  4A6F B;  4PQ0 A;  2KUQ A;  4WVF B;  1WJM A;  2J0M A;  1MK7 B;  1BWN A;  4HHV A;  1IRS A;  3NSU A;  1WG7 A;  2XQN M;  4GMX B;  1PLS A;  1MAI A;  3FVC A;  4MY6 A;  2H7D A;  5HE2 A;  4CHJ A;  3SNH A;  3QIJ A;  4D6W A;  4QJ4 B;  3ULC A;  3P7Z A;  3D8D A;  5J3Y A;  2RSG A;  1U5D A;  3KY9 A;  4CHM A;  4ZRK A;  4GOU A;  2GJY A;  2E2X A;  1QQG A;  1Z87 A;  1NTV A;  2GUM A;  1X05 A;  1W1H A;  2DTC A;  4YON A;  2DKQ A;  2UZR A;  1P3R A;  1V89 A;  4HB4 B;  4P7I A;  4PNK A;  1Q67 A;  4GNK B;  2D9X A;  2D9Y A;  2P0H A;  4GMV A;  4HSI A;  1X11 A;  3ML4 A;  4L1R A;  5I2S A;  2KIG A;  4L6E A;  1WGQ A;  1TJ6 A;  5C16 A;  1FB8 A;  2YS3 A;  2GS0 A;  3F5R A;  2FJU B;  1FAO A;  5GOW B;  5C6R A;  3N7C A;  1RJ2 A;  2R09 A;  4A5K A;  2DYQ A;  2YS5 A;  2RNR B;  4C0A A;  2DLW A;  2M14 A;  3PVL A;  5D3V A;  3MPX A;  4MT7 A;  1XX0 A;  1UNR A;  3FM8 C;  1ZSQ A;  5KCV A;  2K00 A;  1FHX A;  5DH9 B;  2LOX A;  1U5F A;  5JHG A;  2AEH A;  5CLL B;  3PVW A;  1E5W A;  1T77 A;  2KCJ A;  3TVV A;  1V88 A;  3SV1 A;  3GYP A;  4Y94 A;  3BJI A;  2Z0Q A;  3DCX A;  1KZG A;  2COF A;  2H7E A;  2W2X C;  3A8Q A;  4YL8 A;  3F0W A;  2QKL A;  1QC6 A;  2UZS A;  2COA A;  1MPH A;  4F7G A;  2QKM A;  2ELA A;  3KRX A;  5LON B;  1EGX A;  3SO6 A;  4CYE A;  1XCG A;  1X1G A;  1KI1 B;  4B6H A;  4IOY X;  3CXB B;  3LJU X;  2K49 A;  3NWD A;  2DHK A;  3NWF A;  2P0D A;  1W1G A;  3OHM B;  4DXA B;  4HAX B;  4A6F A;  4WSF A;  1I2H A;  1X86 A; 
#chains in the Genus database with same CATH homology
 2D9V A;  4HB2 B;  1WGU A;  2R0D A;  4TYZ A;  4GZU A;  5C79 A;  2HE7 A;  1W1D A;  2EJ8 A;  4KHB B;  4EMO A;  4NY0 A;  4TKN A;  4ZRI A;  2NZ8 B;  2Z0P A;  3RCP A;  1EVH A;  5FI1 A;  1MKE A;  3GYO A;  4K17 A;  4A6K A;  4HDQ A;  2ADZ A;  2YS1 A;  2LKO A;  1UPR A;  2JP2 A;  3HQC A;  1Y19 B;  1P6S A;  5D3Y A;  3U8Z A;  3A98 B;  1WJ1 A;  5D3X A;  3TO1 A;  3WYF B;  1I7A A;  1PFJ A;  4K2O A;  3DXE A;  4GXB A;  4HB0 B;  1V5M A;  3PSC A;  2L1C A;  1ZM0 A;  3PZD A;  5D3W A;  1H4R A;  5JHH A;  3IVF A;  2I1K A;  5JP4 A;  2ELB A;  3ZDT A;  2COC A;  4DX8 A;  1MIZ B;  4NSW A;  1RRP B;  2K2U A;  5C5B B;  1DRO A;  3FEH A;  2VKI A;  2ROZ B;  1ZC3 B;  2I5F A;  3TCA A;  2UVM A;  4HAY B;  1AWE A;  2AL6 A;  1NTY A;  1DDM A;  2YT0 A;  1MIX A;  3KSY A;  3PVU A;  2YSZ A;  1XR0 B;  1EF1 A;  3M1I B;  3G9W A;  2DX5 A;  3ODO A;  3X23 A;  4K81 A;  2PZ1 A;  2RUK B;  2DN6 A;  2N0Y A;  4K2P A;  2W2X D;  2EMT A;  3KRW A;  1NU2 A;  4DX9 0;  4HAZ B;  4H8S A;  4ZRJ A;  1AQC A;  1H10 A;  2IFS A;  1BAK A;  1UNP A;  1XOD A;  1GC6 A;  2MFQ A;  2KGX B;  5J3T A;  2LG1 A;  4EJN A;  3KZ1 A;  5DHA B;  1BTK A;  5J3Q A;  3HK0 A;  1Y5O A;  2J0K A;  1DYN A;  1SGH A;  5CLQ B;  1PMS A;  2LOZ A;  3VIA A;  4A6H A;  1MK9 B;  1K5G B;  2LUL A;  2YRY A;  2D4Q A;  1DDV A;  2I1J A;  4HAV B;  3AU5 A;  2YVC A;  2M38 A;  2LYD A;  4Z2N A;  4DBB A;  1DDW A;  3DXD A;  2FJL A;  3TFM A;  2MKR A;  2K2J A;  2EC1 A;  1OY2 A;  2OTX A;  2P8V A;  2DX1 A;  2D9Z A;  1M7E A;  2Y7B A;  5LOP B;  1U27 A;  2OQB A;  1ZC4 B;  2DFK A;  2IYB A;  2W2W A;  2D9W A;  3D8F A;  5D27 A;  2KUP A;  2NMB A;  3UZT A;  4F7H A;  1XD4 A;  2Y8G A;  1UPQ A;  2CRF A;  2RLO A;  1NI2 A;  4IAP A;  3ODX A;  3ZVR A;  3ULB A;  5KQ4 A;  3DXC A;  2VSZ A;  3AU4 A;  1V5P A;  1OQN A;  2CAY A;  2YF0 A;  4HDO A;  3OAN A;  4KAX B;  4HAU B;  1DBH A;  1U2B A;  3T06 A;  3MDB C;  3P6A A;  3PP2 A;  5JLJ B;  5HE0 A;  2V76 A;  4WJ7 A;  1V61 A;  3PG7 A;  5FI0 A;  1U5G A;  2D10 A;  2I5C A;  4HAW B;  1UNQ A;  1KZ7 A;  3VOQ A;  5DHF B;  2GCJ A;  5C5B A;  3A8P A;  4HAT B;  2COD A;  1FGY A;  1EAZ A;  2MWN B;  1K5D B;  1ZVR A;  2CY4 A;  3WA0 A;  3HW2 B;  4KVG B;  1GG3 A;  3AJ4 A;  2ZPY A;  5KQ1 A;  1XKE A;  2N23 A;  3U7D A;  4BBK A;  1TQZ A;  1FGZ A;  4Z2M B;  2ROV A;  2J59 M;  2X18 A;  2Y8F A;  5EFX A;  2CY5 A;  2DYN A;  1V5U A;  1LB1 A;  2DKP A;  1GC7 A;  3SYX A;  2DHI A;  2MDX A;  1OMW A;  2G35 A;  2DA0 A;  4F7U P;  2D11 A;  1FHW A;  2Q13 A;  2RGN B;  1J19 A;  3D8E A;  2VRW B;  5L81 A;  4D0N B;  1ISN A;  3TW1 A;  5HE3 A;  4KHA A;  5DI9 B;  1U29 A;  2BCJ A;  1BTN A;  3QWM A;  2EMS A;  1M7R A;  1U5E A;  1N3H A;  2DHJ A;  1SHC A;  1B55 A;  3PEG A;  2Z0O A;  2J0J A;  3FSS A;  3QBV B;  4MK0 A;  1WVH A;  1LW3 A;  1UEF A;  2YT1 A;  2P0F A;  1FHO A;  4GN1 A;  5HE1 A;  4HB3 B;  3BIN A;  4EKU A;  2HTH B;  3SUZ A;  3ODW A;  3O96 A;  3V5W A;  3CIK A;  4XWX A;  4GPT B;  2GCL A;  1FOE A;  4IFS A;  5DIF B;  2L2I A;  2RVB B;  1X1F A;  1P5T A;  4KHO A;  1WI1 A;  1J0W A;  1TXD A;  2D2Q A;  4A6F B;  4PQ0 A;  4WVF B;  1WJM A;  2J0M A;  1MK7 B;  1BWN A;  4HHV A;  1IRS A;  3NSU A;  1WG7 A;  2XQN M;  4GMX B;  1PLS A;  1MAI A;  5HE2 A;  4MY6 A;  2H7D A;  4CHJ A;  3SNH A;  3QIJ A;  3ULC A;  3P7Z A;  3D8D A;  5J3Y A;  2RSG A;  1U5D A;  3KY9 A;  4CHM A;  4ZRK A;  2GJY A;  2E2X A;  1QQG A;  1Z87 A;  1NTV A;  1X05 A;  1W1H A;  2DTC A;  4YON A;  2DKQ A;  2UZR A;  1P3R A;  1V89 A;  4HB4 B;  4P7I A;  4PNK A;  1Q67 A;  2D9X A;  2D9Y A;  2P0H A;  4GMV A;  1X11 A;  3ML4 A;  4L6E A;  1WGQ A;  1TJ6 A;  5C16 A;  1FB8 A;  2YS3 A;  2GS0 A;  3F5R A;  1FAO A;  5GOW B;  5C6R A;  3N7C A;  1RJ2 A;  2R09 A;  4A5K A;  2DYQ A;  2YS5 A;  2RNR B;  4C0A A;  2DLW A;  2M14 A;  3PVL A;  5D3V A;  3MPX A;  4MT7 A;  1XX0 A;  1UNR A;  3FM8 C;  1ZSQ A;  5KCV A;  2K00 A;  1FHX A;  5DH9 B;  2LOX A;  1U5F A;  5JHG A;  2AEH A;  5CLL B;  3PVW A;  1E5W A;  2KCJ A;  3TVV A;  1V88 A;  3SV1 A;  3GYP A;  4Y94 A;  3BJI A;  2Z0Q A;  1KZG A;  2COF A;  2H7E A;  2W2X C;  3A8Q A;  4YL8 A;  3F0W A;  2QKL A;  1QC6 A;  2UZS A;  2COA A;  1MPH A;  4F7G A;  2QKM A;  2ELA A;  3KRX A;  5LON B;  1EGX A;  3SO6 A;  4CYE A;  1XCG A;  1X1G A;  1KI1 B;  4B6H A;  4IOY X;  3CXB B;  3LJU X;  2DHK A;  2P0D A;  1W1G A;  4DXA B;  4HAX B;  4A6F A;  4WSF A;  1I2H A;  1X86 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...