2DKQA

Solution structure of the ptb domain of kiaa1075 protein from human
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
160
structure length
160
Chain Sequence
GSSGSSGMSTAADLLRQGAACSVLYLTSVETESLTGPQAVARASSAALSCSPRPTPAVVHFKVSAQGITLTDNQRKLFFRRHYPVNSITFSSTDPQDRRWTNPDGTTSKIFGFVAKKPGSPWENVCHLFAELDPDQPAGAIVTFITKVLLGQRKSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the PTB domain of KIAA1075 protein from human
rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords KIAA1075 protein
total genus 19
structure length 160
sequence length 160
ec nomenclature
pdb deposition date 2006-04-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08416 PTB Phosphotyrosine-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2dkqA01
2LOZA 5JLJB 2VSZA 1XR0B 1V89A 4GZUA 2AEHA 1DDMA 3KSYA 4D0NB 3HW2B 3KRWA 1SHCA 1QQGA 3DXCA 2MFQA 4YL8A 5D3YA 1W1HA 4DX8A 4HDOA 3KY9A 1P5TA 1LB1A 4IAPA 5HE1A 3CXBB 2YT0A 2IYBA 3O96A 3ODWA 2I1KA 1WI1A 2ELBA 4F7HA 3HK0A 5LOPB 4K17A 1BAKA 2LULA 4HAXB 2RLOA 3PVLA 5C16A 2N0YA 5KQ4A 5JP4A 3D8FA 2IFSA 3OANA 3ODOA 4K2PA 4HATB 2YT1A 5CLQB 3TFMA 2CODA 5D27A 1W1DA 2ROZB 1J19A 1DDWA 2W2XC 3ODXA 1V5PA 4KAXB 4HB0B 1W1GA 1MIXA 1U27A 1P3RA 2ROVA 4A6KA 3TW1A 4HAZB 2QKMA 1FGZA 1QC6A 2GJYA 1K5DB 1V61A 1M7EA 5DIFB 2D9WA 2D9YA 4TYZA 2D2QA 1V5MA 2YRYA 4F7GA 2LG1A 1EGXA 2VKIA 2HTHB 3HQCA 4HB2B 5JHGA 1NI2A 4YONA 1TQZA 1PMSA 1RJ2A 2R09A 2RGNB 5JHHA 1X1GA 1K5GB 5KQ1A 1XX0A 1U5FA 3ZDTA 3TVVA 3A8PA 5KCVA 2DX1A 2M14A 2Z0OA 2W2WA 2P0DA 2GS0A 4GMVA 2J0KA 4CHMA 2CAYA 2P0HA 3N7CA 5HE2A 1MAIA 1Q67A 4K81A 1X1FA 3D8DA 5EFXA 1Z87A 3GYOA 3PVWA 2BCJA 2N23A 4DX90 4KHAA 3VIAA 4PNKA 2KUPA 5J3TA 4ZRIA 1FOEA 3F0WA 3SO6A 2RUKB 1PLSA 2CY4A 2MKRA 1B55A 1X05A 2J0JA 1I7AA 4F7UP 4MK0A 4WVFB 3ML4A 1KI1B 1UNPA 3BINA 4A5KA 1H10A 1U29A 1BWNA 3AU5A 2MWNB 5DH9B 1IRSA 4MY6A 1I2HA 1H4RA 2AL6A 1ZM0A 2DYQA 5FI1A 3CIKA 3UZTA 2YS3A 4GN1A 1BTNA 1UNQA 1V5UA 2COAA 1N3HA 2DKPA 3MPXA 1PFJA 1TJ6A 5D3XA 2E2XA 4Z2MB 1GG3A 3AU4A 1U5GA 1KZ7A 2EJ8A 2D4QA 2L1CA 3SNHA 2H7DA 5FI0A 4TKNA 3D8EA 5DHFB 5J3QA 3RCPA 1V88A 2K2JA 4HAVB 3F5RA 1ISNA 2HE7A 3KRXA 4XWXA 2ELAA 2FJLA 3QWMA 2H7EA 2R0DA 4CYEA 5C5BA 3LJUX 5C79A 3WYFB 1XODA 2LKOA 5C6RA 3G9WA 1BTKA 2COCA 3PZDA 4L6EA 4IOYX 3WA0A 2EMTA 2X18A 2YSZA 1XD4A 4NSWA 2D9VA 2DLWA 1M7RA 2YS1A 2P0FA 3PP2A 1SGHA 5D3WA 3U7DA 1ZC3B 1NTYA 1UEFA 3V5WA 1MKEA 1ZSQA 4MT7A 2EC1A 4HB4B 1E5WA 2Q13A 1EF1A 1EVHA 2ADZA 4EMOA 2LYDA 4HAWB 1WGUA 1XKEA 5C5BB 3FM8C 1U5DA 3IVFA 1DYNA 1LW3A 5LONB 1EAZA 3PG7A 2D11A 4GMXB 4DBBA 2DKQA 4HDQA 2L2IA 4HAYB 5CLLB 4EJNA 3U8ZA 1MPHA 3ULBA 2DYNA 5HE0A 5L81A 1MIZB 2GCLA 1FHXA 2COFA 2DTCA 1FAOA 4HHVA 1KZGA 1OY2A 2D9ZA 5DI9B 2D10A 4WSFA 2MDXA 4NY0A 4C0AA 1U5EA 1FGYA 4H8SA 4ZRJA 1MK9B 2K2UA 3PVUA 4KHBB 4P7IA 5D3VA 4Z2NA 2RSGA 3ZVRA 3PEGA 2CY5A 4GPTB 2RVBB 1FB8A 1U2BA 2K00A 2Y7BA 2W2XD 1DROA 1UPQA 3PSCA 3SYXA 2J0MA 2LOXA 2ZPYA 1WGQA 5HE3A 1NU2A 2G35A 2CRFA 4KHOA 1UPRA 2PZ1A 4EKUA 2P8VA 1Y19B 3BJIA 4CHJA 1XCGA 2EMSA 3X23A 4HAUB 2Y8FA 1GC7A 3VOQA 2XQNM 1WJMA 1WG7A 1FHWA 2YF0A 1ZC4B 1X11A 4DXAB 2DHJA 3A8QA 3P6AA 1WJ1A 2GCJA 2I5CA 1Y5OA 3MDBC 3DXDA 2DA0A 5DHAB 4ZRKA 5J3YA 3DXEA 2Z0QA 3AJ4A 1RRPB 4A6HA 2I1JA 1AQCA 1OQNA 4Y94A 2DHIA 2QKLA 3ULCA 3A98B 2UZSA 3KZ1A 2DHKA 1FHOA 3QIJA 1X86A 3P7ZA 2VRWB 1ZVRA 2M38A 1WVHA 2RNRB 1TXDA 4A6FB 3SV1A 4A6FA 2OQBA 2V76A 2YVCA 4BBKA 2DN6A 1DBHA 2KCJA 1J0WA 1AWEA 3T06A 4KVGB 1P6SA 3NSUA 3QBVB 2Y8GA 2UVMA 2YS5A 2DFKA 1DDVA 3SUZA 3FSSA 4K2OA 2DX5A 2NMBA 2I5FA 3TCAA 4HB3B 4PQ0A 2UZRA 1UNRA 4GXBA 1NTVA 2Z0PA 4WJ7A 5GOWB 4B6HA 3TO1A 2JP2A 3GYPA 2NZ8B 2J59M 1OMWA 2D9XA 3M1IB 4IFSA 1MK7B 2OTXA 1GC6A 3FEHA 2KGXB
chains in the Genus database with same CATH superfamily
2LOZA 5JLJB 2K8EA 1XR0B 1V89A 2VSZA 2AEHA 4GZUA 1DDMA 3KSYA 4D0NB 4DIXA 3HW2B 3KRWA 1SHCA 1QQGA 3DXCA 2MFQA 4YL8A 5D3YA 1W1HA 4QJ4B 4DX8A 4HDOA 3KY9A 1P5TA 1LB1A 4IAPA 5HE1A 3CXBB 2YT0A 2IYBA 3O96A 3ODWA 2I1KA 1WI1A 2ELBA 4F7HA 3HK0A 5LOPB 4K17A 1BAKA 5I2MA 2LULA 4HAXB 2RLOA 3PVLA 5C16A 2N0YA 5KQ4A 5JP4A 3D8FA 2IFSA 3NWFA 3OANA 3ODOA 4K2PA 4HATB 2YT1A 5CLQB 3TFMA 2CODA 5D27A 1W1DA 2ROZB 1J19A 1DDWA 2W2XC 3ODXA 1V5PA 4KAXB 4HB0B 5IRSA 1W1GA 1MIXA 1U27A 1P3RA 3HIEA 2ROVA 4A6KA 3TW1A 4HAZB 2FJUB 2QKMA 1FGZA 1QC6A 2GJYA 1K5DB 1V61A 1M7EA 5DIFB 2D9WA 4D6WA 2RRFA 2D9YA 4TYZA 2D2QA 1V5MA 2YRYA 4F7GA 2LG1A 1EGXA 2VKIA 1ZYIA 4QJ3B 2HTHB 2K49A 3HQCA 4HB2B 5JHGA 1NI2A 4YONA 2Z14A 1TQZA 1PMSA 1RJ2A 2R09A 2RGNB 5JHHA 1X1GA 3A58A 1K5GB 5KQ1A 1XX0A 1U5FA 3ZDTA 3TVVA 3A8PA 5KCVA 2DX1A 2M14A 2Z0OA 2W2WA 2P0DA 2GS0A 4GMVA 2J0KA 4CHMA 3DCXA 2CAYA 2P0HA 3N7CA 5HE2A 1MAIA 1Q67A 4K81A 1X1FA 3D8DA 5EFXA 1Z87A 3GYOA 3PVWA 2BCJA 2N23A 4DX90 4KHAA 3VIAA 3U12A 4PNKA 2KUPA 5J3TA 4ZRIA 1FOEA 3F0WA 3SO6A 3NW8A 2RUKB 1PLSA 2CY4A 2MKRA 1B55A 1X05A 2NBVA 2J0JA 1I7AA 2KIGA 4F7UP 4MK0A 4WVFB 3ML4A 1KI1B 1UNPA 3BINA 4A5KA 1H10A 1U29A 1BWNA 3AU5A 2MWNB 5DH9B 1IRSA 4MY6A 1I2HA 1H4RA 3NWAA 2AL6A 1ZM0A 2DYQA 5FI1A 3CIKA 3UZTA 2YS3A 4GN1A 1BTNA 1UNQA 1V5UA 2COAA 1N3HA 2DKPA 3MPXA 1PFJA 1TJ6A 5D3XA 2E2XA 4Z2MB 1GG3A 4KHBA 3AU4A 1T77A 5I2SA 4GOUA 1U5GA 1KZ7A 2EJ8A 2D4QA 2L1CA 3SNHA 2H7DA 5FI0A 4TKNA 3D8EA 5DHFB 5J3QA 3RCPA 1V88A 2K2JA 4HAVB 3F5RA 1ISNA 2HE7A 3KRXA 4XWXA 2ELAA 2FJLA 3QWMA 2H7EA 2R0DA 4CYEA 5C5BA 3LJUX 5C79A 3WYFB 1XODA 2LKOA 5C6RA 3G9WA 1BTKA 2COCA 3PZDA 4L6EA 1MI1A 4IOYX 3WA0A 2EMTA 2X18A 2YSZA 1XD4A 4NSWA 2D9VA 2DLWA 1M7RA 2YS1A 2P0FA 3PP2A 1SGHA 5D3WA 3U7DA 1ZC3B 1NTYA 1UEFA 3V5WA 1MKEA 1ZSQA 4MT7A 2EC1A 2YT2A 4HB4B 1E5WA 2R2YA 4QXAB 2Q13A 2Z4DA 1EF1A 4OSNA 1EVHA 2ADZA 4EMOA 4GNKB 2LYDA 4HAWB 1WGUA 1XKEA 5C5BB 3FM8C 1U5DA 3IVFA 2KIEA 1DYNA 1LW3A 5LONB 1EAZA 3PG7A 2D11A 4OT1A 4GMXB 4DBBA 2DKQA 4HDQA 2L2IA 4HAYB 5CLLB 4EJNA 3U8ZA 1MPHA 3ULBA 2DYNA 5HE0A 5L81A 1MIZB 2GCLA 1FHXA 2COFA 5LG4B 2DTCA 1FAOA 4HHVA 1KZGA 1OY2A 2D9ZA 5DI9B 2D10A 4WSFA 2MDXA 4NY0A 4C0AA 1U5EA 1FGYA 4H8SA 2ZKMX 4ZRJA 1MK9B 2K2UA 3PVUA 4KHBB 5M4YB 4P7IA 5D3VA 4Z2NA 2RSGA 3ZVRA 3PEGA 3FVCA 2CY5A 4GPTB 2RVBB 1FB8A 1U2BA 2K00A 3HSAA 2Y7BA 2W2XD 1DROA 1UPQA 3PSCA 3SYXA 2J0MA 2LOXA 2ZPYA 1WGQA 4QJ5B 5HE3A 1NU2A 4L1RA 2G35A 2CRFA 4KHOA 1UPRA 2PZ1A 4EKUA 2P8VA 1Y19B 3BJIA 4CHJA 1XCGA 2EMSA 3X23A 4HAUB 2Y8FA 1GC7A 3VOQA 2XQNM 1WJMA 1WG7A 3OHMB 1FHWA 2YF0A 1ZC4B 1X11A 4DXAB 2DHJA 3A8QA 3P6AA 1WJ1A 2GCJA 2I5CA 1Y5OA 3MDBC 3DXDA 2DA0A 5DHAB 4ZRKA 5J3YA 3DXEA 2Z59A 2Z0QA 3AJ4A 1RRPB 4A6HA 2I1JA 1AQCA 2Z13A 1OQNA 4Y94A 2DHIA 2QKLA 3ULCA 3A98B 2UZSA 3KZ1A 4HSIA 2DHKA 1FHOA 3QIJA 1X86A 2KUQA 3P7ZA 2VRWB 3B77A 1ZVRA 2M38A 1WVHA 2RNRB 1TXDA 4A6FB 3SV1A 4A6FA 2OQBA 2V76A 2YVCA 4BBKA 2DN6A 1DBHA 2KCJA 1J0WA 2KR0A 2GUMA 1AWEA 3T06A 4KVGB 1P6SA 3NSUA 3QBVB 2Y8GA 2UVMA 2YS5A 2DFKA 1DDVA 3SUZA 3FSSA 4K2OA 2DX5A 2NMBA 2I5FA 3TCAA 4HB3B 4PQ0A 2UZRA 1UNRA 4GXBA 1NTVA 2Z0PA 4WJ7A 5GOWB 4B6HA 3NWDA 3TO1A 2JP2A 4CSQA 3GYPA 2NZ8B 2J59M 1OMWA 2D9XA 3M1IB 4IFSA 1MK7B 2OTXA 1GC6A 3FEHA 2KGXB
chains in the Genus database with same CATH topology
2LOZA 5JLJB 2VSZA 1XR0B 1V89A 4GZUA 2AEHA 1DDMA 3KSYA 4D0NB 3HW2B 3KRWA 1SHCA 1QQGA 3DXCA 2MFQA 4YL8A 5D3YA 1W1HA 4DX8A 4HDOA 3KY9A 1P5TA 1LB1A 4IAPA 5HE1A 3CXBB 2YT0A 2IYBA 3O96A 3ODWA 2I1KA 1WI1A 2ELBA 4F7HA 3HK0A 5LOPB 4K17A 1BAKA 2LULA 4HAXB 2RLOA 3PVLA 5C16A 2N0YA 5KQ4A 5JP4A 3D8FA 2IFSA 3OANA 3ODOA 4K2PA 4HATB 2YT1A 5CLQB 3TFMA 2CODA 5D27A 1W1DA 2ROZB 1J19A 1DDWA 2W2XC 3ODXA 1V5PA 4KAXB 4HB0B 1W1GA 1MIXA 1U27A 1P3RA 2ROVA 4A6KA 3TW1A 4HAZB 2QKMA 1FGZA 1QC6A 2GJYA 1K5DB 1V61A 1M7EA 5DIFB 2D9WA 2D9YA 4TYZA 2D2QA 1V5MA 2YRYA 4F7GA 2LG1A 1EGXA 2VKIA 2HTHB 3HQCA 4HB2B 5JHGA 1NI2A 4YONA 1TQZA 1PMSA 1RJ2A 2R09A 2RGNB 5JHHA 1X1GA 1K5GB 5KQ1A 1XX0A 1U5FA 3ZDTA 3TVVA 3A8PA 5KCVA 2DX1A 2M14A 2Z0OA 2W2WA 2P0DA 2GS0A 4GMVA 2J0KA 4CHMA 2CAYA 2P0HA 3N7CA 5HE2A 1MAIA 1Q67A 4K81A 1X1FA 3D8DA 5EFXA 1Z87A 3GYOA 3PVWA 2BCJA 2N23A 4DX90 4KHAA 3VIAA 4PNKA 2KUPA 5J3TA 4ZRIA 1FOEA 3F0WA 3SO6A 2RUKB 1PLSA 2CY4A 2MKRA 1B55A 1X05A 2J0JA 1I7AA 4F7UP 4MK0A 4WVFB 3ML4A 1KI1B 1UNPA 3BINA 4A5KA 1H10A 1U29A 1BWNA 3AU5A 2MWNB 5DH9B 1IRSA 4MY6A 1I2HA 1H4RA 2AL6A 1ZM0A 2DYQA 5FI1A 3CIKA 3UZTA 2YS3A 4GN1A 1BTNA 1UNQA 1V5UA 2COAA 1N3HA 2DKPA 3MPXA 1PFJA 1TJ6A 5D3XA 2E2XA 4Z2MB 1GG3A 3AU4A 1U5GA 1KZ7A 2EJ8A 2D4QA 2L1CA 3SNHA 2H7DA 5FI0A 4TKNA 3D8EA 5DHFB 5J3QA 3RCPA 1V88A 2K2JA 4HAVB 3F5RA 1ISNA 2HE7A 3KRXA 4XWXA 2ELAA 2FJLA 3QWMA 2H7EA 2R0DA 4CYEA 5C5BA 3LJUX 5C79A 3WYFB 1XODA 2LKOA 5C6RA 3G9WA 1BTKA 2COCA 3PZDA 4L6EA 4IOYX 3WA0A 2EMTA 2X18A 2YSZA 1XD4A 4NSWA 2D9VA 2DLWA 1M7RA 2YS1A 2P0FA 3PP2A 1SGHA 5D3WA 3U7DA 1ZC3B 1NTYA 1UEFA 3V5WA 1MKEA 1ZSQA 4MT7A 2EC1A 4HB4B 1E5WA 2Q13A 1EF1A 1EVHA 2ADZA 4EMOA 2LYDA 4HAWB 1WGUA 1XKEA 5C5BB 3FM8C 1U5DA 3IVFA 1DYNA 1LW3A 5LONB 1EAZA 3PG7A 2D11A 4GMXB 4DBBA 2DKQA 4HDQA 2L2IA 4HAYB 5CLLB 4EJNA 3U8ZA 1MPHA 3ULBA 2DYNA 5HE0A 5L81A 1MIZB 2GCLA 1FHXA 2COFA 2DTCA 1FAOA 4HHVA 1KZGA 1OY2A 2D9ZA 5DI9B 2D10A 4WSFA 2MDXA 4NY0A 4C0AA 1U5EA 1FGYA 4H8SA 4ZRJA 1MK9B 2K2UA 3PVUA 4KHBB 4P7IA 5D3VA 4Z2NA 2RSGA 3ZVRA 3PEGA 2CY5A 4GPTB 2RVBB 1FB8A 1U2BA 2K00A 2Y7BA 2W2XD 1DROA 1UPQA 3PSCA 3SYXA 2J0MA 2LOXA 2ZPYA 1WGQA 5HE3A 1NU2A 2G35A 2CRFA 4KHOA 1UPRA 2PZ1A 4EKUA 2P8VA 1Y19B 3BJIA 4CHJA 1XCGA 2EMSA 3X23A 4HAUB 2Y8FA 1GC7A 3VOQA 2XQNM 1WJMA 1WG7A 1FHWA 2YF0A 1ZC4B 1X11A 4DXAB 2DHJA 3A8QA 3P6AA 1WJ1A 2GCJA 2I5CA 1Y5OA 3MDBC 3DXDA 2DA0A 5DHAB 4ZRKA 5J3YA 3DXEA 2Z0QA 3AJ4A 1RRPB 4A6HA 2I1JA 1AQCA 1OQNA 4Y94A 2DHIA 2QKLA 3ULCA 3A98B 2UZSA 3KZ1A 2DHKA 1FHOA 3QIJA 1X86A 3P7ZA 2VRWB 1ZVRA 2M38A 1WVHA 2RNRB 1TXDA 4A6FB 3SV1A 4A6FA 2OQBA 2V76A 2YVCA 4BBKA 2DN6A 1DBHA 2KCJA 1J0WA 1AWEA 3T06A 4KVGB 1P6SA 3NSUA 3QBVB 2Y8GA 2UVMA 2YS5A 2DFKA 1DDVA 3SUZA 3FSSA 4K2OA 2DX5A 2NMBA 2I5FA 3TCAA 4HB3B 4PQ0A 2UZRA 1UNRA 4GXBA 1NTVA 2Z0PA 4WJ7A 5GOWB 4B6HA 3TO1A 2JP2A 3GYPA 2NZ8B 2J59M 1OMWA 2D9XA 3M1IB 4IFSA 1MK7B 2OTXA 1GC6A 3FEHA 2KGXB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LOZ A;  5JLJ B;  2VSZ A;  1XR0 B;  1V89 A;  4GZU A;  2AEH A;  1DDM A;  3KSY A;  4D0N B;  3HW2 B;  3KRW A;  1SHC A;  1QQG A;  3DXC A;  2MFQ A;  4YL8 A;  5D3Y A;  1W1H A;  4DX8 A;  4HDO A;  3KY9 A;  1P5T A;  1LB1 A;  4IAP A;  5HE1 A;  3CXB B;  2YT0 A;  2IYB A;  3O96 A;  3ODW A;  2I1K A;  1WI1 A;  2ELB A;  4F7H A;  3HK0 A;  5LOP B;  4K17 A;  1BAK A;  2LUL A;  4HAX B;  2RLO A;  3PVL A;  5C16 A;  2N0Y A;  5KQ4 A;  5JP4 A;  3D8F A;  2IFS A;  3OAN A;  3ODO A;  4K2P A;  4HAT B;  2YT1 A;  5CLQ B;  3TFM A;  2COD A;  5D27 A;  1W1D A;  2ROZ B;  1J19 A;  1DDW A;  2W2X C;  3ODX A;  1V5P A;  4KAX B;  4HB0 B;  1W1G A;  1MIX A;  1U27 A;  1P3R A;  2ROV A;  4A6K A;  3TW1 A;  4HAZ B;  2QKM A;  1FGZ A;  1QC6 A;  2GJY A;  1K5D B;  1V61 A;  1M7E A;  5DIF B;  2D9W A;  2D9Y A;  4TYZ A;  2D2Q A;  1V5M A;  2YRY A;  4F7G A;  2LG1 A;  1EGX A;  2VKI A;  2HTH B;  3HQC A;  4HB2 B;  5JHG A;  1NI2 A;  4YON A;  1TQZ A;  1PMS A;  1RJ2 A;  2R09 A;  2RGN B;  5JHH A;  1X1G A;  1K5G B;  5KQ1 A;  1XX0 A;  1U5F A;  3ZDT A;  3TVV A;  3A8P A;  5KCV A;  2DX1 A;  2M14 A;  2Z0O A;  2W2W A;  2P0D A;  2GS0 A;  4GMV A;  2J0K A;  4CHM A;  2CAY A;  2P0H A;  3N7C A;  5HE2 A;  1MAI A;  1Q67 A;  4K81 A;  1X1F A;  3D8D A;  5EFX A;  1Z87 A;  3GYO A;  3PVW A;  2BCJ A;  2N23 A;  4DX9 0;  4KHA A;  3VIA A;  4PNK A;  2KUP A;  5J3T A;  4ZRI A;  1FOE A;  3F0W A;  3SO6 A;  2RUK B;  1PLS A;  2CY4 A;  2MKR A;  1B55 A;  1X05 A;  2J0J A;  1I7A A;  4F7U P;  4MK0 A;  4WVF B;  3ML4 A;  1KI1 B;  1UNP A;  3BIN A;  4A5K A;  1H10 A;  1U29 A;  1BWN A;  3AU5 A;  2MWN B;  5DH9 B;  1IRS A;  4MY6 A;  1I2H A;  1H4R A;  2AL6 A;  1ZM0 A;  2DYQ A;  5FI1 A;  3CIK A;  3UZT A;  2YS3 A;  4GN1 A;  1BTN A;  1UNQ A;  1V5U A;  2COA A;  1N3H A;  2DKP A;  3MPX A;  1PFJ A;  1TJ6 A;  5D3X A;  2E2X A;  4Z2M B;  1GG3 A;  3AU4 A;  1U5G A;  1KZ7 A;  2EJ8 A;  2D4Q A;  2L1C A;  3SNH A;  2H7D A;  5FI0 A;  4TKN A;  3D8E A;  5DHF B;  5J3Q A;  3RCP A;  1V88 A;  2K2J A;  4HAV B;  3F5R A;  1ISN A;  2HE7 A;  3KRX A;  4XWX A;  2ELA A;  2FJL A;  3QWM A;  2H7E A;  2R0D A;  4CYE A;  5C5B A;  3LJU X;  5C79 A;  3WYF B;  1XOD A;  2LKO A;  5C6R A;  3G9W A;  1BTK A;  2COC A;  3PZD A;  4L6E A;  4IOY X;  3WA0 A;  2EMT A;  2X18 A;  2YSZ A;  1XD4 A;  4NSW A;  2D9V A;  2DLW A;  1M7R A;  2YS1 A;  2P0F A;  3PP2 A;  1SGH A;  5D3W A;  3U7D A;  1ZC3 B;  1NTY A;  1UEF A;  3V5W A;  1MKE A;  1ZSQ A;  4MT7 A;  2EC1 A;  4HB4 B;  1E5W A;  2Q13 A;  1EF1 A;  1EVH A;  2ADZ A;  4EMO A;  2LYD A;  4HAW B;  1WGU A;  1XKE A;  5C5B B;  3FM8 C;  1U5D A;  3IVF A;  1DYN A;  1LW3 A;  5LON B;  1EAZ A;  3PG7 A;  2D11 A;  4GMX B;  4DBB A;  2DKQ A;  4HDQ A;  2L2I A;  4HAY B;  5CLL B;  4EJN A;  3U8Z A;  1MPH A;  3ULB A;  2DYN A;  5HE0 A;  5L81 A;  1MIZ B;  2GCL A;  1FHX A;  2COF A;  2DTC A;  1FAO A;  4HHV A;  1KZG A;  1OY2 A;  2D9Z A;  5DI9 B;  2D10 A;  4WSF A;  2MDX A;  4NY0 A;  4C0A A;  1U5E A;  1FGY A;  4H8S A;  4ZRJ A;  1MK9 B;  2K2U A;  3PVU A;  4KHB B;  4P7I A;  5D3V A;  4Z2N A;  2RSG A;  3ZVR A;  3PEG A;  2CY5 A;  4GPT B;  2RVB B;  1FB8 A;  1U2B A;  2K00 A;  2Y7B A;  2W2X D;  1DRO A;  1UPQ A;  3PSC A;  3SYX A;  2J0M A;  2LOX A;  2ZPY A;  1WGQ A;  5HE3 A;  1NU2 A;  2G35 A;  2CRF A;  4KHO A;  1UPR A;  2PZ1 A;  4EKU A;  2P8V A;  1Y19 B;  3BJI A;  4CHJ A;  1XCG A;  2EMS A;  3X23 A;  4HAU B;  2Y8F A;  1GC7 A;  3VOQ A;  2XQN M;  1WJM A;  1WG7 A;  1FHW A;  2YF0 A;  1ZC4 B;  1X11 A;  4DXA B;  2DHJ A;  3A8Q A;  3P6A A;  1WJ1 A;  2GCJ A;  2I5C A;  1Y5O A;  3MDB C;  3DXD A;  2DA0 A;  5DHA B;  4ZRK A;  5J3Y A;  3DXE A;  2Z0Q A;  3AJ4 A;  1RRP B;  4A6H A;  2I1J A;  1AQC A;  1OQN A;  4Y94 A;  2DHI A;  2QKL A;  3ULC A;  3A98 B;  2UZS A;  3KZ1 A;  2DHK A;  1FHO A;  3QIJ A;  1X86 A;  3P7Z A;  2VRW B;  1ZVR A;  2M38 A;  1WVH A;  2RNR B;  1TXD A;  4A6F B;  3SV1 A;  4A6F A;  2OQB A;  2V76 A;  2YVC A;  4BBK A;  2DN6 A;  1DBH A;  2KCJ A;  1J0W A;  1AWE A;  3T06 A;  4KVG B;  1P6S A;  3NSU A;  3QBV B;  2Y8G A;  2UVM A;  2YS5 A;  2DFK A;  1DDV A;  3SUZ A;  3FSS A;  4K2O A;  2DX5 A;  2NMB A;  2I5F A;  3TCA A;  4HB3 B;  4PQ0 A;  2UZR A;  1UNR A;  4GXB A;  1NTV A;  2Z0P A;  4WJ7 A;  5GOW B;  4B6H A;  3TO1 A;  2JP2 A;  3GYP A;  2NZ8 B;  2J59 M;  1OMW A;  2D9X A;  3M1I B;  4IFS A;  1MK7 B;  2OTX A;  1GC6 A;  3FEH A;  2KGX B; 
#chains in the Genus database with same CATH topology
 2LOZ A;  5JLJ B;  2K8E A;  1XR0 B;  1V89 A;  2VSZ A;  2AEH A;  4GZU A;  1DDM A;  3KSY A;  4D0N B;  4DIX A;  3HW2 B;  3KRW A;  1SHC A;  1QQG A;  3DXC A;  2MFQ A;  4YL8 A;  5D3Y A;  1W1H A;  4QJ4 B;  4DX8 A;  4HDO A;  3KY9 A;  1P5T A;  1LB1 A;  4IAP A;  5HE1 A;  3CXB B;  2YT0 A;  2IYB A;  3O96 A;  3ODW A;  2I1K A;  1WI1 A;  2ELB A;  4F7H A;  3HK0 A;  5LOP B;  4K17 A;  1BAK A;  5I2M A;  2LUL A;  4HAX B;  2RLO A;  3PVL A;  5C16 A;  2N0Y A;  5KQ4 A;  5JP4 A;  3D8F A;  2IFS A;  3NWF A;  3OAN A;  3ODO A;  4K2P A;  4HAT B;  2YT1 A;  5CLQ B;  3TFM A;  2COD A;  5D27 A;  1W1D A;  2ROZ B;  1J19 A;  1DDW A;  2W2X C;  3ODX A;  1V5P A;  4KAX B;  4HB0 B;  5IRS A;  1W1G A;  1MIX A;  1U27 A;  1P3R A;  3HIE A;  2ROV A;  4A6K A;  3TW1 A;  4HAZ B;  2FJU B;  2QKM A;  1FGZ A;  1QC6 A;  2GJY A;  1K5D B;  1V61 A;  1M7E A;  5DIF B;  2D9W A;  4D6W A;  2RRF A;  2D9Y A;  4TYZ A;  2D2Q A;  1V5M A;  2YRY A;  4F7G A;  2LG1 A;  1EGX A;  2VKI A;  1ZYI A;  4QJ3 B;  2HTH B;  2K49 A;  3HQC A;  4HB2 B;  5JHG A;  1NI2 A;  4YON A;  2Z14 A;  1TQZ A;  1PMS A;  1RJ2 A;  2R09 A;  2RGN B;  5JHH A;  1X1G A;  3A58 A;  1K5G B;  5KQ1 A;  1XX0 A;  1U5F A;  3ZDT A;  3TVV A;  3A8P A;  5KCV A;  2DX1 A;  2M14 A;  2Z0O A;  2W2W A;  2P0D A;  2GS0 A;  4GMV A;  2J0K A;  4CHM A;  3DCX A;  2CAY A;  2P0H A;  3N7C A;  5HE2 A;  1MAI A;  1Q67 A;  4K81 A;  1X1F A;  3D8D A;  5EFX A;  1Z87 A;  3GYO A;  3PVW A;  2BCJ A;  2N23 A;  4DX9 0;  4KHA A;  3VIA A;  3U12 A;  4PNK A;  2KUP A;  5J3T A;  4ZRI A;  1FOE A;  3F0W A;  3SO6 A;  3NW8 A;  2RUK B;  1PLS A;  2CY4 A;  2MKR A;  1B55 A;  1X05 A;  2NBV A;  2J0J A;  1I7A A;  2KIG A;  4F7U P;  4MK0 A;  4WVF B;  3ML4 A;  1KI1 B;  1UNP A;  3BIN A;  4A5K A;  1H10 A;  1U29 A;  1BWN A;  3AU5 A;  2MWN B;  5DH9 B;  1IRS A;  4MY6 A;  1I2H A;  1H4R A;  3NWA A;  2AL6 A;  1ZM0 A;  2DYQ A;  5FI1 A;  3CIK A;  3UZT A;  2YS3 A;  4GN1 A;  1BTN A;  1UNQ A;  1V5U A;  2COA A;  1N3H A;  2DKP A;  3MPX A;  1PFJ A;  1TJ6 A;  5D3X A;  2E2X A;  4Z2M B;  1GG3 A;  4KHB A;  3AU4 A;  1T77 A;  5I2S A;  4GOU A;  1U5G A;  1KZ7 A;  2EJ8 A;  2D4Q A;  2L1C A;  3SNH A;  2H7D A;  5FI0 A;  4TKN A;  3D8E A;  5DHF B;  5J3Q A;  3RCP A;  1V88 A;  2K2J A;  4HAV B;  3F5R A;  1ISN A;  2HE7 A;  3KRX A;  4XWX A;  2ELA A;  2FJL A;  3QWM A;  2H7E A;  2R0D A;  4CYE A;  5C5B A;  3LJU X;  5C79 A;  3WYF B;  1XOD A;  2LKO A;  5C6R A;  3G9W A;  1BTK A;  2COC A;  3PZD A;  4L6E A;  1MI1 A;  4IOY X;  3WA0 A;  2EMT A;  2X18 A;  2YSZ A;  1XD4 A;  4NSW A;  2D9V A;  2DLW A;  1M7R A;  2YS1 A;  2P0F A;  3PP2 A;  1SGH A;  5D3W A;  3U7D A;  1ZC3 B;  1NTY A;  1UEF A;  3V5W A;  1MKE A;  1ZSQ A;  4MT7 A;  2EC1 A;  2YT2 A;  4HB4 B;  1E5W A;  2R2Y A;  4QXA B;  2Q13 A;  2Z4D A;  1EF1 A;  4OSN A;  1EVH A;  2ADZ A;  4EMO A;  4GNK B;  2LYD A;  4HAW B;  1WGU A;  1XKE A;  5C5B B;  3FM8 C;  1U5D A;  3IVF A;  2KIE A;  1DYN A;  1LW3 A;  5LON B;  1EAZ A;  3PG7 A;  2D11 A;  4OT1 A;  4GMX B;  4DBB A;  2DKQ A;  4HDQ A;  2L2I A;  4HAY B;  5CLL B;  4EJN A;  3U8Z A;  1MPH A;  3ULB A;  2DYN A;  5HE0 A;  5L81 A;  1MIZ B;  2GCL A;  1FHX A;  2COF A;  5LG4 B;  2DTC A;  1FAO A;  4HHV A;  1KZG A;  1OY2 A;  2D9Z A;  5DI9 B;  2D10 A;  4WSF A;  2MDX A;  4NY0 A;  4C0A A;  1U5E A;  1FGY A;  4H8S A;  2ZKM X;  4ZRJ A;  1MK9 B;  2K2U A;  3PVU A;  4KHB B;  5M4Y B;  4P7I A;  5D3V A;  4Z2N A;  2RSG A;  3ZVR A;  3PEG A;  3FVC A;  2CY5 A;  4GPT B;  2RVB B;  1FB8 A;  1U2B A;  2K00 A;  3HSA A;  2Y7B A;  2W2X D;  1DRO A;  1UPQ A;  3PSC A;  3SYX A;  2J0M A;  2LOX A;  2ZPY A;  1WGQ A;  4QJ5 B;  5HE3 A;  1NU2 A;  4L1R A;  2G35 A;  2CRF A;  4KHO A;  1UPR A;  2PZ1 A;  4EKU A;  2P8V A;  1Y19 B;  3BJI A;  4CHJ A;  1XCG A;  2EMS A;  3X23 A;  4HAU B;  2Y8F A;  1GC7 A;  3VOQ A;  2XQN M;  1WJM A;  1WG7 A;  3OHM B;  1FHW A;  2YF0 A;  1ZC4 B;  1X11 A;  4DXA B;  2DHJ A;  3A8Q A;  3P6A A;  1WJ1 A;  2GCJ A;  2I5C A;  1Y5O A;  3MDB C;  3DXD A;  2DA0 A;  5DHA B;  4ZRK A;  5J3Y A;  3DXE A;  2Z59 A;  2Z0Q A;  3AJ4 A;  1RRP B;  4A6H A;  2I1J A;  1AQC A;  2Z13 A;  1OQN A;  4Y94 A;  2DHI A;  2QKL A;  3ULC A;  3A98 B;  2UZS A;  3KZ1 A;  4HSI A;  2DHK A;  1FHO A;  3QIJ A;  1X86 A;  2KUQ A;  3P7Z A;  2VRW B;  3B77 A;  1ZVR A;  2M38 A;  1WVH A;  2RNR B;  1TXD A;  4A6F B;  3SV1 A;  4A6F A;  2OQB A;  2V76 A;  2YVC A;  4BBK A;  2DN6 A;  1DBH A;  2KCJ A;  1J0W A;  2KR0 A;  2GUM A;  1AWE A;  3T06 A;  4KVG B;  1P6S A;  3NSU A;  3QBV B;  2Y8G A;  2UVM A;  2YS5 A;  2DFK A;  1DDV A;  3SUZ A;  3FSS A;  4K2O A;  2DX5 A;  2NMB A;  2I5F A;  3TCA A;  4HB3 B;  4PQ0 A;  2UZR A;  1UNR A;  4GXB A;  1NTV A;  2Z0P A;  4WJ7 A;  5GOW B;  4B6H A;  3NWD A;  3TO1 A;  2JP2 A;  4CSQ A;  3GYP A;  2NZ8 B;  2J59 M;  1OMW A;  2D9X A;  3M1I B;  4IFS A;  1MK7 B;  2OTX A;  1GC6 A;  3FEH A;  2KGX B; 
#chains in the Genus database with same CATH homology
 2LOZ A;  5JLJ B;  2VSZ A;  1XR0 B;  1V89 A;  4GZU A;  2AEH A;  1DDM A;  3KSY A;  4D0N B;  3HW2 B;  3KRW A;  1SHC A;  1QQG A;  3DXC A;  2MFQ A;  4YL8 A;  5D3Y A;  1W1H A;  4DX8 A;  4HDO A;  3KY9 A;  1P5T A;  1LB1 A;  4IAP A;  5HE1 A;  3CXB B;  2YT0 A;  2IYB A;  3O96 A;  3ODW A;  2I1K A;  1WI1 A;  2ELB A;  4F7H A;  3HK0 A;  5LOP B;  4K17 A;  1BAK A;  2LUL A;  4HAX B;  2RLO A;  3PVL A;  5C16 A;  2N0Y A;  5KQ4 A;  5JP4 A;  3D8F A;  2IFS A;  3OAN A;  3ODO A;  4K2P A;  4HAT B;  2YT1 A;  5CLQ B;  3TFM A;  2COD A;  5D27 A;  1W1D A;  2ROZ B;  1J19 A;  1DDW A;  2W2X C;  3ODX A;  1V5P A;  4KAX B;  4HB0 B;  1W1G A;  1MIX A;  1U27 A;  1P3R A;  2ROV A;  4A6K A;  3TW1 A;  4HAZ B;  2QKM A;  1FGZ A;  1QC6 A;  2GJY A;  1K5D B;  1V61 A;  1M7E A;  5DIF B;  2D9W A;  2D9Y A;  4TYZ A;  2D2Q A;  1V5M A;  2YRY A;  4F7G A;  2LG1 A;  1EGX A;  2VKI A;  2HTH B;  3HQC A;  4HB2 B;  5JHG A;  1NI2 A;  4YON A;  1TQZ A;  1PMS A;  1RJ2 A;  2R09 A;  2RGN B;  5JHH A;  1X1G A;  1K5G B;  5KQ1 A;  1XX0 A;  1U5F A;  3ZDT A;  3TVV A;  3A8P A;  5KCV A;  2DX1 A;  2M14 A;  2Z0O A;  2W2W A;  2P0D A;  2GS0 A;  4GMV A;  2J0K A;  4CHM A;  2CAY A;  2P0H A;  3N7C A;  5HE2 A;  1MAI A;  1Q67 A;  4K81 A;  1X1F A;  3D8D A;  5EFX A;  1Z87 A;  3GYO A;  3PVW A;  2BCJ A;  2N23 A;  4DX9 0;  4KHA A;  3VIA A;  4PNK A;  2KUP A;  5J3T A;  4ZRI A;  1FOE A;  3F0W A;  3SO6 A;  2RUK B;  1PLS A;  2CY4 A;  2MKR A;  1B55 A;  1X05 A;  2J0J A;  1I7A A;  4F7U P;  4MK0 A;  4WVF B;  3ML4 A;  1KI1 B;  1UNP A;  3BIN A;  4A5K A;  1H10 A;  1U29 A;  1BWN A;  3AU5 A;  2MWN B;  5DH9 B;  1IRS A;  4MY6 A;  1I2H A;  1H4R A;  2AL6 A;  1ZM0 A;  2DYQ A;  5FI1 A;  3CIK A;  3UZT A;  2YS3 A;  4GN1 A;  1BTN A;  1UNQ A;  1V5U A;  2COA A;  1N3H A;  2DKP A;  3MPX A;  1PFJ A;  1TJ6 A;  5D3X A;  2E2X A;  4Z2M B;  1GG3 A;  3AU4 A;  1U5G A;  1KZ7 A;  2EJ8 A;  2D4Q A;  2L1C A;  3SNH A;  2H7D A;  5FI0 A;  4TKN A;  3D8E A;  5DHF B;  5J3Q A;  3RCP A;  1V88 A;  2K2J A;  4HAV B;  3F5R A;  1ISN A;  2HE7 A;  3KRX A;  4XWX A;  2ELA A;  2FJL A;  3QWM A;  2H7E A;  2R0D A;  4CYE A;  5C5B A;  3LJU X;  5C79 A;  3WYF B;  1XOD A;  2LKO A;  5C6R A;  3G9W A;  1BTK A;  2COC A;  3PZD A;  4L6E A;  4IOY X;  3WA0 A;  2EMT A;  2X18 A;  2YSZ A;  1XD4 A;  4NSW A;  2D9V A;  2DLW A;  1M7R A;  2YS1 A;  2P0F A;  3PP2 A;  1SGH A;  5D3W A;  3U7D A;  1ZC3 B;  1NTY A;  1UEF A;  3V5W A;  1MKE A;  1ZSQ A;  4MT7 A;  2EC1 A;  4HB4 B;  1E5W A;  2Q13 A;  1EF1 A;  1EVH A;  2ADZ A;  4EMO A;  2LYD A;  4HAW B;  1WGU A;  1XKE A;  5C5B B;  3FM8 C;  1U5D A;  3IVF A;  1DYN A;  1LW3 A;  5LON B;  1EAZ A;  3PG7 A;  2D11 A;  4GMX B;  4DBB A;  2DKQ A;  4HDQ A;  2L2I A;  4HAY B;  5CLL B;  4EJN A;  3U8Z A;  1MPH A;  3ULB A;  2DYN A;  5HE0 A;  5L81 A;  1MIZ B;  2GCL A;  1FHX A;  2COF A;  2DTC A;  1FAO A;  4HHV A;  1KZG A;  1OY2 A;  2D9Z A;  5DI9 B;  2D10 A;  4WSF A;  2MDX A;  4NY0 A;  4C0A A;  1U5E A;  1FGY A;  4H8S A;  4ZRJ A;  1MK9 B;  2K2U A;  3PVU A;  4KHB B;  4P7I A;  5D3V A;  4Z2N A;  2RSG A;  3ZVR A;  3PEG A;  2CY5 A;  4GPT B;  2RVB B;  1FB8 A;  1U2B A;  2K00 A;  2Y7B A;  2W2X D;  1DRO A;  1UPQ A;  3PSC A;  3SYX A;  2J0M A;  2LOX A;  2ZPY A;  1WGQ A;  5HE3 A;  1NU2 A;  2G35 A;  2CRF A;  4KHO A;  1UPR A;  2PZ1 A;  4EKU A;  2P8V A;  1Y19 B;  3BJI A;  4CHJ A;  1XCG A;  2EMS A;  3X23 A;  4HAU B;  2Y8F A;  1GC7 A;  3VOQ A;  2XQN M;  1WJM A;  1WG7 A;  1FHW A;  2YF0 A;  1ZC4 B;  1X11 A;  4DXA B;  2DHJ A;  3A8Q A;  3P6A A;  1WJ1 A;  2GCJ A;  2I5C A;  1Y5O A;  3MDB C;  3DXD A;  2DA0 A;  5DHA B;  4ZRK A;  5J3Y A;  3DXE A;  2Z0Q A;  3AJ4 A;  1RRP B;  4A6H A;  2I1J A;  1AQC A;  1OQN A;  4Y94 A;  2DHI A;  2QKL A;  3ULC A;  3A98 B;  2UZS A;  3KZ1 A;  2DHK A;  1FHO A;  3QIJ A;  1X86 A;  3P7Z A;  2VRW B;  1ZVR A;  2M38 A;  1WVH A;  2RNR B;  1TXD A;  4A6F B;  3SV1 A;  4A6F A;  2OQB A;  2V76 A;  2YVC A;  4BBK A;  2DN6 A;  1DBH A;  2KCJ A;  1J0W A;  1AWE A;  3T06 A;  4KVG B;  1P6S A;  3NSU A;  3QBV B;  2Y8G A;  2UVM A;  2YS5 A;  2DFK A;  1DDV A;  3SUZ A;  3FSS A;  4K2O A;  2DX5 A;  2NMB A;  2I5F A;  3TCA A;  4HB3 B;  4PQ0 A;  2UZR A;  1UNR A;  4GXB A;  1NTV A;  2Z0P A;  4WJ7 A;  5GOW B;  4B6H A;  3TO1 A;  2JP2 A;  3GYP A;  2NZ8 B;  2J59 M;  1OMW A;  2D9X A;  3M1I B;  4IFS A;  1MK7 B;  2OTX A;  1GC6 A;  3FEH A;  2KGX B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...