2DKQA

Solution structure of the ptb domain of kiaa1075 protein from human
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
160
structure length
160
Chain Sequence
GSSGSSGMSTAADLLRQGAACSVLYLTSVETESLTGPQAVARASSAALSCSPRPTPAVVHFKVSAQGITLTDNQRKLFFRRHYPVNSITFSSTDPQDRRWTNPDGTTSKIFGFVAKKPGSPWENVCHLFAELDPDQPAGAIVTFITKVLLGQRKSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords KIAA1075 protein
publication title Solution structure of the PTB domain of KIAA1075 protein from human
rcsb
source organism Homo sapiens
total genus 19
structure length 160
sequence length 160
ec nomenclature
pdb deposition date 2006-04-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08416 PTB Phosphotyrosine-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2dkqA01
2HTHB 1U5DA 5C5BB 3TFMA 4KHOA 3TO1A 2D11A 4F7UP 5JHHA 3ULBA 2LKOA 2J59M 1GC7A 2Z0OA 5JP4A 1ZVRA 4CHMA 4YL8A 5HE0A 1XR0B 3A98B 5JLJB 2D9VA 5CLQB 1ISNA 1WG7A 2I1JA 5J3YA 5D3VA 2DX5A 4HAVB 1N3HA 3PZDA 5FI1A 2DN6A 4NSWA 1I7AA 4GXBA 4EMOA 1P6SA 2ROVA 2COCA 5C79A 4HDOA 2CY4A 1UNQA 1AQCA 2H7EA 2YS5A 2RUKB 3U7DA 1UNPA 2YS3A 1Y5OA 1TXDA 3MDBC 1PMSA 5D27A 3CIKA 4Y94A 1E5WA 3PG7A 2P0HA 2IFSA 1UNRA 2J0MA 5DI9B 4ZRKA 4K2PA 2ELBA 4A6KA 3NSUA 3SNHA 3KZ1A 4A6FA 2YF0A 3CXBB 1H10A 1DBHA 2JP2A 2ROZB 2OQBA 2OTXA 2CODA 2ZPYA 4HHVA 1QC6A 2L2IA 1FOEA 1TQZA 1MKEA 1J19A 5KQ1A 2Z0PA 4PNKA 2K2JA 1MK9B 1SGHA 3PVLA 1I2HA 1OMWA 3PVUA 3VOQA 3X23A 4HDQA 1QQGA 2HE7A 3LJUX 3ZVRA 5J3QA 4HAXB 3KRXA 1Q67A 4BBKA 1Y19B 2D4QA 2MKRA 3UZTA 4IAPA 1XD4A 2P8VA 1WJ1A 1MAIA 5LONB 2G35A 5DHAB 3OANA 2ADZA 1LB1A 2XQNM 2GCJA 3ZDTA 1EF1A 3IVFA 1U29A 4GMXB 2MFQA 1OQNA 3ML4A 2V76A 3ULCA 2VRWB 1DROA 3V5WA 5D3XA 1IRSA 4WVFB 3U8ZA 4A6HA 4IOYX 1WGQA 2BCJA 4Z2MB 2EMSA 1BTNA 3DXEA 2LOZA 5C16A 2Y8GA 1X1FA 1DDVA 1RJ2A 4HAWB 3FM8C 2FJLA 2Q13A 2RSGA 2DHJA 3RCPA 3FEHA 4F7GA 2K00A 1DDMA 1MPHA 2DX1A 1P5TA 1J0WA 3F5RA 4HB2B 4K17A 1XX0A 1EAZA 5JHGA 4GN1A 3N7CA 4YONA 5DHFB 2Z0QA 3WYFB 4XWXA 3QIJA 1ZC3B 1X1GA 3QBVB 3SO6A 3AU4A 1FGYA 2YRYA 2YT1A 2R09A 5GOWB 1XCGA 1OY2A 1FB8A 2LOXA 2P0DA 4D0NB 2Y7BA 1W1HA 1XKEA 1FHXA 3D8EA 2COAA 5CLLB 2NMBA 5KQ4A 4MY6A 5HE3A 3GYPA 4KVGB 4NY0A 1NTYA 3PEGA 1KI1B 2D9YA 2GJYA 1BAKA 2KCJA 2DTCA 1ZSQA 2M14A 2K2UA 3KSYA 2UZSA 5DIFB 3MPXA 4K81A 3ODWA 2CRFA 2PZ1A 2DLWA 3TW1A 1DDWA 3BINA 1M7EA 2D2QA 2MWNB 1V5PA 2I5FA 3DXDA 4A6FB 2CY5A 5FI0A 4C0AA 1K5DB 1V5UA 3T06A 1WGUA 2QKMA 3A8PA 5HE1A 5KCVA 4PQ0A 1KZ7A 1MK7B 4EKUA 1V5MA 5LOPB 3WA0A 2LULA 4MK0A 2W2XC 2MDXA 1U5EA 2LYDA 1NU2A 4CYEA 1AWEA 4KHBB 2W2WA 5C5BA 2YT0A 2EC1A 2J0KA 2D9XA 3AJ4A 1U5FA 3SYXA 4WSFA 3O96A 1XODA 2DA0A 3KRWA 1V89A 1ZM0A 2D9WA 2UZRA 3GYOA 2P0FA 1H4RA 2W2XD 2I1KA 2NZ8B 3TVVA 1FGZA 2I5CA 2Y8FA 3P7ZA 2AL6A 1PLSA 1RRPB 2RGNB 1EVHA 1V61A 5DH9B 4Z2NA 2RNRB 2DHIA 1Z87A 1NTVA 3PP2A 1KZGA 1FHOA 1DYNA 3ODXA 4TYZA 4MT7A 4DXAB 1X11A 4TKNA 2DKQA 2GS0A 3G9WA 1LW3A 1SHCA 1ZC4B 3PVWA 3TCAA 1BTKA 5J3TA 3M1IB 2D9ZA 2N0YA 5C6RA 5EFXA 4F7HA 1W1GA 2R0DA 2CAYA 1EGXA 1FHWA 2EMTA 2L1CA 2VSZA 2J0JA 1GC6A 2RVBB 3P6AA 3BJIA 3AU5A 4GMVA 1U5GA 4HAZB 2KGXB 2LG1A 4EJNA 4H8SA 4ZRIA 4KHAA 1W1DA 3HQCA 4HB3B 2DHKA 2DFKA 5L81A 5HE2A 1U27A 1X05A 4IFSA 2M38A 4P7IA 1PFJA 3F0WA 4L6EA 1P3RA 3HW2B 1K5GB 2H7DA 1MIXA 1UPRA 3QWMA 2RLOA 3D8FA 1M7RA 2YSZA 1NI2A 3FSSA 2YS1A 3KY9A 2DYNA 2YVCA 4K2OA 3SV1A 1WJMA 2IYBA 4A5KA 2E2XA 1V88A 3A8QA 3VIAA 5D3YA 2DKPA 4DX90 4HB0B 4DBBA 2D10A 2N23A 3HK0A 4HAUB 1B55A 2DYQA 2ELAA 1BWNA 3SUZA 4CHJA 4GPTB 1MIZB 2VKIA 4KAXB 2EJ8A 1WVHA 3ODOA 2QKLA 1TJ6A 4HB4B 4HATB 4WJ7A 1FAOA 2AEHA 2X18A 1UEFA 1GG3A 4B6HA 2UVMA 2KUPA 3PSCA 3D8DA 3DXCA 1U2BA 2COFA 4ZRJA 4GZUA 4DX8A 1WI1A 5D3WA 2GCLA 1X86A 4HAYB 1UPQA
chains in the Genus database with same CATH superfamily
2HTHB 1U5DA 5C5BB 3TFMA 4CSQA 4KHOA 3TO1A 2D11A 4F7UP 5JHHA 3ULBA 2LKOA 2J59M 1GC7A 2Z0OA 5JP4A 1ZVRA 4CHMA 4YL8A 4HSIA 5HE0A 1XR0B 3A98B 5JLJB 2D9VA 5CLQB 1ISNA 1WG7A 2I1JA 5J3YA 4QJ3B 2DX5A 5D3VA 4HAVB 1N3HA 2RRFA 3PZDA 5FI1A 5I2MA 2DN6A 4NSWA 1I7AA 4GXBA 4EMOA 3A58A 1P6SA 2ROVA 2COCA 5C79A 4HDOA 2CY4A 1UNQA 1AQCA 2H7EA 2YS5A 2RUKB 3U7DA 1UNPA 2YS3A 1Y5OA 1TXDA 3MDBC 1PMSA 5D27A 3CIKA 4Y94A 1E5WA 3PG7A 2P0HA 2IFSA 1UNRA 2J0MA 5DI9B 4ZRKA 4K2PA 2ELBA 4A6KA 3NSUA 3SNHA 3KZ1A 4A6FA 2YF0A 3CXBB 1H10A 1DBHA 2JP2A 2ROZB 2R2YA 2OQBA 2OTXA 2CODA 2ZPYA 4HHVA 1QC6A 2L2IA 1FOEA 1TQZA 1MKEA 1J19A 3FVCA 5KQ1A 2Z0PA 4PNKA 2K2JA 1MK9B 1SGHA 3PVLA 1I2HA 1OMWA 4KHBA 3PVUA 3VOQA 3X23A 4HDQA 2KIGA 1QQGA 2HE7A 3LJUX 3ZVRA 5J3QA 4HAXB 3KRXA 1Q67A 4BBKA 1Y19B 2D4QA 2MKRA 3HSAA 3UZTA 4IAPA 1XD4A 2P8VA 1WJ1A 4GOUA 1MAIA 5LONB 2G35A 5DHAB 3OANA 2ADZA 3B77A 4L1RA 1LB1A 2XQNM 2GCJA 3ZDTA 1EF1A 3IVFA 1U29A 4GMXB 2MFQA 1OQNA 3ML4A 2V76A 3ULCA 2VRWB 1DROA 3V5WA 5D3XA 2YT2A 1IRSA 4WVFB 3U8ZA 4A6HA 4IOYX 1WGQA 2BCJA 4Z2MB 2EMSA 1BTNA 3DXEA 2LOZA 5C16A 2Y8GA 1X1FA 1DDVA 1RJ2A 4HAWB 3FM8C 2FJLA 2Q13A 2RSGA 3NWDA 2DHJA 3RCPA 3FEHA 4F7GA 2K00A 1DDMA 1MPHA 2DX1A 1P5TA 1J0WA 3F5RA 4HB2B 4K17A 1XX0A 4QXAB 1EAZA 5JHGA 4GN1A 3N7CA 4YONA 5DHFB 2Z0QA 3WYFB 4XWXA 3QIJA 1ZC3B 1X1GA 3QBVB 3SO6A 3AU4A 2GUMA 1FGYA 3NWAA 2YRYA 2YT1A 2R09A 5GOWB 1XCGA 1OY2A 1FB8A 2LOXA 2P0DA 4D0NB 2Y7BA 1W1HA 1XKEA 1FHXA 3OHMB 3D8EA 2COAA 5CLLB 2NMBA 5KQ4A 4MY6A 5HE3A 3GYPA 4KVGB 4NY0A 1NTYA 1KI1B 3PEGA 2D9YA 2GJYA 1BAKA 2KCJA 3U12A 1ZYIA 2DTCA 1ZSQA 2M14A 2K2UA 3KSYA 2UZSA 2Z59A 5DIFB 2KR0A 3MPXA 4K81A 2KIEA 3ODWA 2CRFA 2PZ1A 2DLWA 3TW1A 1DDWA 3BINA 1M7EA 2D2QA 2MWNB 1V5PA 2I5FA 3DXDA 4A6FB 2CY5A 3NW8A 5FI0A 4C0AA 1K5DB 1V5UA 4QJ5B 3T06A 1WGUA 2QKMA 3A8PA 5HE1A 5KCVA 4PQ0A 1KZ7A 1MK7B 4EKUA 1V5MA 5LOPB 3WA0A 1MI1A 2LULA 2NBVA 4QJ4B 4MK0A 2W2XC 2MDXA 1U5EA 2LYDA 5I2SA 1NU2A 4CYEA 1AWEA 4KHBB 2W2WA 5C5BA 2YT0A 2EC1A 2J0KA 2D9XA 3AJ4A 1U5FA 3SYXA 4WSFA 3O96A 4D6WA 1XODA 2DA0A 3KRWA 1V89A 1ZM0A 2D9WA 2UZRA 3GYOA 2P0FA 1H4RA 4DIXA 2W2XD 2I1KA 2NZ8B 3TVVA 1FGZA 2I5CA 2Y8FA 3P7ZA 2AL6A 1T77A 1PLSA 1RRPB 2RGNB 1EVHA 1V61A 5DH9B 4Z2NA 2RNRB 2DHIA 1Z87A 1NTVA 3PP2A 4OT1A 1KZGA 1FHOA 1DYNA 3ODXA 4TYZA 4MT7A 4DXAB 1X11A 4TKNA 2DKQA 2GS0A 3HIEA 3G9WA 1LW3A 4GNKB 1SHCA 1ZC4B 3PVWA 3TCAA 1BTKA 2Z14A 5J3TA 3M1IB 2D9ZA 2N0YA 5C6RA 5EFXA 4F7HA 1W1GA 2R0DA 2CAYA 1EGXA 1FHWA 2EMTA 2L1CA 2ZKMX 2VSZA 2J0JA 1GC6A 2RVBB 2Z4DA 3P6AA 3BJIA 3AU5A 4GMVA 1U5GA 4HAZB 2KGXB 2LG1A 4EJNA 4H8SA 4ZRIA 4KHAA 1W1DA 3HQCA 4HB3B 2DHKA 2DFKA 5L81A 5HE2A 1U27A 1X05A 4IFSA 2M38A 4P7IA 1PFJA 3F0WA 4L6EA 1P3RA 3HW2B 2Z13A 1K5GB 2H7DA 1MIXA 1UPRA 3QWMA 2RLOA 3D8FA 1M7RA 2YSZA 1NI2A 3FSSA 2YS1A 3KY9A 2DYNA 2YVCA 4K2OA 3SV1A 1WJMA 2IYBA 4A5KA 2E2XA 1V88A 3A8QA 3VIAA 5D3YA 2DKPA 4DX90 4HB0B 2K49A 4DBBA 2D10A 2N23A 3HK0A 4HAUB 1B55A 5M4YB 2DYQA 2ELAA 1BWNA 3SUZA 4CHJA 4GPTB 1MIZB 5LG4B 2VKIA 4KAXB 2EJ8A 1WVHA 3DCXA 3ODOA 2QKLA 1TJ6A 4HB4B 4HATB 4WJ7A 1FAOA 2AEHA 2X18A 4OSNA 1UEFA 1GG3A 4B6HA 2K8EA 2UVMA 2KUPA 3PSCA 2FJUB 3D8DA 3DXCA 1U2BA 2COFA 4ZRJA 4GZUA 2KUQA 4DX8A 3NWFA 5IRSA 1WI1A 5D3WA 2GCLA 1X86A 4HAYB 1UPQA
chains in the Genus database with same CATH topology
2HTHB 1U5DA 5C5BB 3TFMA 4KHOA 3TO1A 2D11A 4F7UP 5JHHA 3ULBA 2LKOA 2J59M 1GC7A 2Z0OA 5JP4A 1ZVRA 4CHMA 4YL8A 5HE0A 1XR0B 3A98B 5JLJB 2D9VA 5CLQB 1ISNA 1WG7A 2I1JA 5J3YA 5D3VA 2DX5A 4HAVB 1N3HA 3PZDA 5FI1A 2DN6A 4NSWA 1I7AA 4GXBA 4EMOA 1P6SA 2ROVA 2COCA 5C79A 4HDOA 2CY4A 1UNQA 1AQCA 2H7EA 2YS5A 2RUKB 3U7DA 1UNPA 2YS3A 1Y5OA 1TXDA 3MDBC 1PMSA 5D27A 3CIKA 4Y94A 1E5WA 3PG7A 2P0HA 2IFSA 1UNRA 2J0MA 5DI9B 4ZRKA 4K2PA 2ELBA 4A6KA 3NSUA 3SNHA 3KZ1A 4A6FA 2YF0A 3CXBB 1H10A 1DBHA 2JP2A 2ROZB 2OQBA 2OTXA 2CODA 2ZPYA 4HHVA 1QC6A 2L2IA 1FOEA 1TQZA 1MKEA 1J19A 5KQ1A 2Z0PA 4PNKA 2K2JA 1MK9B 1SGHA 3PVLA 1I2HA 1OMWA 3PVUA 3VOQA 3X23A 4HDQA 1QQGA 2HE7A 3LJUX 3ZVRA 5J3QA 4HAXB 3KRXA 1Q67A 4BBKA 1Y19B 2D4QA 2MKRA 3UZTA 4IAPA 1XD4A 2P8VA 1WJ1A 1MAIA 5LONB 2G35A 5DHAB 3OANA 2ADZA 1LB1A 2XQNM 2GCJA 3ZDTA 1EF1A 3IVFA 1U29A 4GMXB 2MFQA 1OQNA 3ML4A 2V76A 3ULCA 2VRWB 1DROA 3V5WA 5D3XA 1IRSA 4WVFB 3U8ZA 4A6HA 4IOYX 1WGQA 2BCJA 4Z2MB 2EMSA 1BTNA 3DXEA 2LOZA 5C16A 2Y8GA 1X1FA 1DDVA 1RJ2A 4HAWB 3FM8C 2FJLA 2Q13A 2RSGA 2DHJA 3RCPA 3FEHA 4F7GA 2K00A 1DDMA 1MPHA 2DX1A 1P5TA 1J0WA 3F5RA 4HB2B 4K17A 1XX0A 1EAZA 5JHGA 4GN1A 3N7CA 4YONA 5DHFB 2Z0QA 3WYFB 4XWXA 3QIJA 1ZC3B 1X1GA 3QBVB 3SO6A 3AU4A 1FGYA 2YRYA 2YT1A 2R09A 5GOWB 1XCGA 1OY2A 1FB8A 2LOXA 2P0DA 4D0NB 2Y7BA 1W1HA 1XKEA 1FHXA 3D8EA 2COAA 5CLLB 2NMBA 5KQ4A 4MY6A 5HE3A 3GYPA 4KVGB 4NY0A 1NTYA 3PEGA 1KI1B 2D9YA 2GJYA 1BAKA 2KCJA 2DTCA 1ZSQA 2M14A 2K2UA 3KSYA 2UZSA 5DIFB 3MPXA 4K81A 3ODWA 2CRFA 2PZ1A 2DLWA 3TW1A 1DDWA 3BINA 1M7EA 2D2QA 2MWNB 1V5PA 2I5FA 3DXDA 4A6FB 2CY5A 5FI0A 4C0AA 1K5DB 1V5UA 3T06A 1WGUA 2QKMA 3A8PA 5HE1A 5KCVA 4PQ0A 1KZ7A 1MK7B 4EKUA 1V5MA 5LOPB 3WA0A 2LULA 4MK0A 2W2XC 2MDXA 1U5EA 2LYDA 1NU2A 4CYEA 1AWEA 4KHBB 2W2WA 5C5BA 2YT0A 2EC1A 2J0KA 2D9XA 3AJ4A 1U5FA 3SYXA 4WSFA 3O96A 1XODA 2DA0A 3KRWA 1V89A 1ZM0A 2D9WA 2UZRA 3GYOA 2P0FA 1H4RA 2W2XD 2I1KA 2NZ8B 3TVVA 1FGZA 2I5CA 2Y8FA 3P7ZA 2AL6A 1PLSA 1RRPB 2RGNB 1EVHA 1V61A 5DH9B 4Z2NA 2RNRB 2DHIA 1Z87A 1NTVA 3PP2A 1KZGA 1FHOA 1DYNA 3ODXA 4TYZA 4MT7A 4DXAB 1X11A 4TKNA 2DKQA 2GS0A 3G9WA 1LW3A 1SHCA 1ZC4B 3PVWA 3TCAA 1BTKA 5J3TA 3M1IB 2D9ZA 2N0YA 5C6RA 5EFXA 4F7HA 1W1GA 2R0DA 2CAYA 1EGXA 1FHWA 2EMTA 2L1CA 2VSZA 2J0JA 1GC6A 2RVBB 3P6AA 3BJIA 3AU5A 4GMVA 1U5GA 4HAZB 2KGXB 2LG1A 4EJNA 4H8SA 4ZRIA 4KHAA 1W1DA 3HQCA 4HB3B 2DHKA 2DFKA 5L81A 5HE2A 1U27A 1X05A 4IFSA 2M38A 4P7IA 1PFJA 3F0WA 4L6EA 1P3RA 3HW2B 1K5GB 2H7DA 1MIXA 1UPRA 3QWMA 2RLOA 3D8FA 1M7RA 2YSZA 1NI2A 3FSSA 2YS1A 3KY9A 2DYNA 2YVCA 4K2OA 3SV1A 1WJMA 2IYBA 4A5KA 2E2XA 1V88A 3A8QA 3VIAA 5D3YA 2DKPA 4DX90 4HB0B 4DBBA 2D10A 2N23A 3HK0A 4HAUB 1B55A 2DYQA 2ELAA 1BWNA 3SUZA 4CHJA 4GPTB 1MIZB 2VKIA 4KAXB 2EJ8A 1WVHA 3ODOA 2QKLA 1TJ6A 4HB4B 4HATB 4WJ7A 1FAOA 2AEHA 2X18A 1UEFA 1GG3A 4B6HA 2UVMA 2KUPA 3PSCA 3D8DA 3DXCA 1U2BA 2COFA 4ZRJA 4GZUA 4DX8A 1WI1A 5D3WA 2GCLA 1X86A 4HAYB 1UPQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HTH B;  1U5D A;  5C5B B;  3TFM A;  4KHO A;  3TO1 A;  2D11 A;  4F7U P;  5JHH A;  3ULB A;  2LKO A;  2J59 M;  1GC7 A;  2Z0O A;  5JP4 A;  1ZVR A;  4CHM A;  4YL8 A;  5HE0 A;  1XR0 B;  3A98 B;  5JLJ B;  2D9V A;  5CLQ B;  1ISN A;  1WG7 A;  2I1J A;  5J3Y A;  5D3V A;  2DX5 A;  4HAV B;  1N3H A;  3PZD A;  5FI1 A;  2DN6 A;  4NSW A;  1I7A A;  4GXB A;  4EMO A;  1P6S A;  2ROV A;  2COC A;  5C79 A;  4HDO A;  2CY4 A;  1UNQ A;  1AQC A;  2H7E A;  2YS5 A;  2RUK B;  3U7D A;  1UNP A;  2YS3 A;  1Y5O A;  1TXD A;  3MDB C;  1PMS A;  5D27 A;  3CIK A;  4Y94 A;  1E5W A;  3PG7 A;  2P0H A;  2IFS A;  1UNR A;  2J0M A;  5DI9 B;  4ZRK A;  4K2P A;  2ELB A;  4A6K A;  3NSU A;  3SNH A;  3KZ1 A;  4A6F A;  2YF0 A;  3CXB B;  1H10 A;  1DBH A;  2JP2 A;  2ROZ B;  2OQB A;  2OTX A;  2COD A;  2ZPY A;  4HHV A;  1QC6 A;  2L2I A;  1FOE A;  1TQZ A;  1MKE A;  1J19 A;  5KQ1 A;  2Z0P A;  4PNK A;  2K2J A;  1MK9 B;  1SGH A;  3PVL A;  1I2H A;  1OMW A;  3PVU A;  3VOQ A;  3X23 A;  4HDQ A;  1QQG A;  2HE7 A;  3LJU X;  3ZVR A;  5J3Q A;  4HAX B;  3KRX A;  1Q67 A;  4BBK A;  1Y19 B;  2D4Q A;  2MKR A;  3UZT A;  4IAP A;  1XD4 A;  2P8V A;  1WJ1 A;  1MAI A;  5LON B;  2G35 A;  5DHA B;  3OAN A;  2ADZ A;  1LB1 A;  2XQN M;  2GCJ A;  3ZDT A;  1EF1 A;  3IVF A;  1U29 A;  4GMX B;  2MFQ A;  1OQN A;  3ML4 A;  2V76 A;  3ULC A;  2VRW B;  1DRO A;  3V5W A;  5D3X A;  1IRS A;  4WVF B;  3U8Z A;  4A6H A;  4IOY X;  1WGQ A;  2BCJ A;  4Z2M B;  2EMS A;  1BTN A;  3DXE A;  2LOZ A;  5C16 A;  2Y8G A;  1X1F A;  1DDV A;  1RJ2 A;  4HAW B;  3FM8 C;  2FJL A;  2Q13 A;  2RSG A;  2DHJ A;  3RCP A;  3FEH A;  4F7G A;  2K00 A;  1DDM A;  1MPH A;  2DX1 A;  1P5T A;  1J0W A;  3F5R A;  4HB2 B;  4K17 A;  1XX0 A;  1EAZ A;  5JHG A;  4GN1 A;  3N7C A;  4YON A;  5DHF B;  2Z0Q A;  3WYF B;  4XWX A;  3QIJ A;  1ZC3 B;  1X1G A;  3QBV B;  3SO6 A;  3AU4 A;  1FGY A;  2YRY A;  2YT1 A;  2R09 A;  5GOW B;  1XCG A;  1OY2 A;  1FB8 A;  2LOX A;  2P0D A;  4D0N B;  2Y7B A;  1W1H A;  1XKE A;  1FHX A;  3D8E A;  2COA A;  5CLL B;  2NMB A;  5KQ4 A;  4MY6 A;  5HE3 A;  3GYP A;  4KVG B;  4NY0 A;  1NTY A;  3PEG A;  1KI1 B;  2D9Y A;  2GJY A;  1BAK A;  2KCJ A;  2DTC A;  1ZSQ A;  2M14 A;  2K2U A;  3KSY A;  2UZS A;  5DIF B;  3MPX A;  4K81 A;  3ODW A;  2CRF A;  2PZ1 A;  2DLW A;  3TW1 A;  1DDW A;  3BIN A;  1M7E A;  2D2Q A;  2MWN B;  1V5P A;  2I5F A;  3DXD A;  4A6F B;  2CY5 A;  5FI0 A;  4C0A A;  1K5D B;  1V5U A;  3T06 A;  1WGU A;  2QKM A;  3A8P A;  5HE1 A;  5KCV A;  4PQ0 A;  1KZ7 A;  1MK7 B;  4EKU A;  1V5M A;  5LOP B;  3WA0 A;  2LUL A;  4MK0 A;  2W2X C;  2MDX A;  1U5E A;  2LYD A;  1NU2 A;  4CYE A;  1AWE A;  4KHB B;  2W2W A;  5C5B A;  2YT0 A;  2EC1 A;  2J0K A;  2D9X A;  3AJ4 A;  1U5F A;  3SYX A;  4WSF A;  3O96 A;  1XOD A;  2DA0 A;  3KRW A;  1V89 A;  1ZM0 A;  2D9W A;  2UZR A;  3GYO A;  2P0F A;  1H4R A;  2W2X D;  2I1K A;  2NZ8 B;  3TVV A;  1FGZ A;  2I5C A;  2Y8F A;  3P7Z A;  2AL6 A;  1PLS A;  1RRP B;  2RGN B;  1EVH A;  1V61 A;  5DH9 B;  4Z2N A;  2RNR B;  2DHI A;  1Z87 A;  1NTV A;  3PP2 A;  1KZG A;  1FHO A;  1DYN A;  3ODX A;  4TYZ A;  4MT7 A;  4DXA B;  1X11 A;  4TKN A;  2DKQ A;  2GS0 A;  3G9W A;  1LW3 A;  1SHC A;  1ZC4 B;  3PVW A;  3TCA A;  1BTK A;  5J3T A;  3M1I B;  2D9Z A;  2N0Y A;  5C6R A;  5EFX A;  4F7H A;  1W1G A;  2R0D A;  2CAY A;  1EGX A;  1FHW A;  2EMT A;  2L1C A;  2VSZ A;  2J0J A;  1GC6 A;  2RVB B;  3P6A A;  3BJI A;  3AU5 A;  4GMV A;  1U5G A;  4HAZ B;  2KGX B;  2LG1 A;  4EJN A;  4H8S A;  4ZRI A;  4KHA A;  1W1D A;  3HQC A;  4HB3 B;  2DHK A;  2DFK A;  5L81 A;  5HE2 A;  1U27 A;  1X05 A;  4IFS A;  2M38 A;  4P7I A;  1PFJ A;  3F0W A;  4L6E A;  1P3R A;  3HW2 B;  1K5G B;  2H7D A;  1MIX A;  1UPR A;  3QWM A;  2RLO A;  3D8F A;  1M7R A;  2YSZ A;  1NI2 A;  3FSS A;  2YS1 A;  3KY9 A;  2DYN A;  2YVC A;  4K2O A;  3SV1 A;  1WJM A;  2IYB A;  4A5K A;  2E2X A;  1V88 A;  3A8Q A;  3VIA A;  5D3Y A;  2DKP A;  4DX9 0;  4HB0 B;  4DBB A;  2D10 A;  2N23 A;  3HK0 A;  4HAU B;  1B55 A;  2DYQ A;  2ELA A;  1BWN A;  3SUZ A;  4CHJ A;  4GPT B;  1MIZ B;  2VKI A;  4KAX B;  2EJ8 A;  1WVH A;  3ODO A;  2QKL A;  1TJ6 A;  4HB4 B;  4HAT B;  4WJ7 A;  1FAO A;  2AEH A;  2X18 A;  1UEF A;  1GG3 A;  4B6H A;  2UVM A;  2KUP A;  3PSC A;  3D8D A;  3DXC A;  1U2B A;  2COF A;  4ZRJ A;  4GZU A;  4DX8 A;  1WI1 A;  5D3W A;  2GCL A;  1X86 A;  4HAY B;  1UPQ A; 
#chains in the Genus database with same CATH topology
 2HTH B;  1U5D A;  5C5B B;  3TFM A;  4CSQ A;  4KHO A;  3TO1 A;  2D11 A;  4F7U P;  5JHH A;  3ULB A;  2LKO A;  2J59 M;  1GC7 A;  2Z0O A;  5JP4 A;  1ZVR A;  4CHM A;  4YL8 A;  4HSI A;  5HE0 A;  1XR0 B;  3A98 B;  5JLJ B;  2D9V A;  5CLQ B;  1ISN A;  1WG7 A;  2I1J A;  5J3Y A;  4QJ3 B;  2DX5 A;  5D3V A;  4HAV B;  1N3H A;  2RRF A;  3PZD A;  5FI1 A;  5I2M A;  2DN6 A;  4NSW A;  1I7A A;  4GXB A;  4EMO A;  3A58 A;  1P6S A;  2ROV A;  2COC A;  5C79 A;  4HDO A;  2CY4 A;  1UNQ A;  1AQC A;  2H7E A;  2YS5 A;  2RUK B;  3U7D A;  1UNP A;  2YS3 A;  1Y5O A;  1TXD A;  3MDB C;  1PMS A;  5D27 A;  3CIK A;  4Y94 A;  1E5W A;  3PG7 A;  2P0H A;  2IFS A;  1UNR A;  2J0M A;  5DI9 B;  4ZRK A;  4K2P A;  2ELB A;  4A6K A;  3NSU A;  3SNH A;  3KZ1 A;  4A6F A;  2YF0 A;  3CXB B;  1H10 A;  1DBH A;  2JP2 A;  2ROZ B;  2R2Y A;  2OQB A;  2OTX A;  2COD A;  2ZPY A;  4HHV A;  1QC6 A;  2L2I A;  1FOE A;  1TQZ A;  1MKE A;  1J19 A;  3FVC A;  5KQ1 A;  2Z0P A;  4PNK A;  2K2J A;  1MK9 B;  1SGH A;  3PVL A;  1I2H A;  1OMW A;  4KHB A;  3PVU A;  3VOQ A;  3X23 A;  4HDQ A;  2KIG A;  1QQG A;  2HE7 A;  3LJU X;  3ZVR A;  5J3Q A;  4HAX B;  3KRX A;  1Q67 A;  4BBK A;  1Y19 B;  2D4Q A;  2MKR A;  3HSA A;  3UZT A;  4IAP A;  1XD4 A;  2P8V A;  1WJ1 A;  4GOU A;  1MAI A;  5LON B;  2G35 A;  5DHA B;  3OAN A;  2ADZ A;  3B77 A;  4L1R A;  1LB1 A;  2XQN M;  2GCJ A;  3ZDT A;  1EF1 A;  3IVF A;  1U29 A;  4GMX B;  2MFQ A;  1OQN A;  3ML4 A;  2V76 A;  3ULC A;  2VRW B;  1DRO A;  3V5W A;  5D3X A;  2YT2 A;  1IRS A;  4WVF B;  3U8Z A;  4A6H A;  4IOY X;  1WGQ A;  2BCJ A;  4Z2M B;  2EMS A;  1BTN A;  3DXE A;  2LOZ A;  5C16 A;  2Y8G A;  1X1F A;  1DDV A;  1RJ2 A;  4HAW B;  3FM8 C;  2FJL A;  2Q13 A;  2RSG A;  3NWD A;  2DHJ A;  3RCP A;  3FEH A;  4F7G A;  2K00 A;  1DDM A;  1MPH A;  2DX1 A;  1P5T A;  1J0W A;  3F5R A;  4HB2 B;  4K17 A;  1XX0 A;  4QXA B;  1EAZ A;  5JHG A;  4GN1 A;  3N7C A;  4YON A;  5DHF B;  2Z0Q A;  3WYF B;  4XWX A;  3QIJ A;  1ZC3 B;  1X1G A;  3QBV B;  3SO6 A;  3AU4 A;  2GUM A;  1FGY A;  3NWA A;  2YRY A;  2YT1 A;  2R09 A;  5GOW B;  1XCG A;  1OY2 A;  1FB8 A;  2LOX A;  2P0D A;  4D0N B;  2Y7B A;  1W1H A;  1XKE A;  1FHX A;  3OHM B;  3D8E A;  2COA A;  5CLL B;  2NMB A;  5KQ4 A;  4MY6 A;  5HE3 A;  3GYP A;  4KVG B;  4NY0 A;  1NTY A;  1KI1 B;  3PEG A;  2D9Y A;  2GJY A;  1BAK A;  2KCJ A;  3U12 A;  1ZYI A;  2DTC A;  1ZSQ A;  2M14 A;  2K2U A;  3KSY A;  2UZS A;  2Z59 A;  5DIF B;  2KR0 A;  3MPX A;  4K81 A;  2KIE A;  3ODW A;  2CRF A;  2PZ1 A;  2DLW A;  3TW1 A;  1DDW A;  3BIN A;  1M7E A;  2D2Q A;  2MWN B;  1V5P A;  2I5F A;  3DXD A;  4A6F B;  2CY5 A;  3NW8 A;  5FI0 A;  4C0A A;  1K5D B;  1V5U A;  4QJ5 B;  3T06 A;  1WGU A;  2QKM A;  3A8P A;  5HE1 A;  5KCV A;  4PQ0 A;  1KZ7 A;  1MK7 B;  4EKU A;  1V5M A;  5LOP B;  3WA0 A;  1MI1 A;  2LUL A;  2NBV A;  4QJ4 B;  4MK0 A;  2W2X C;  2MDX A;  1U5E A;  2LYD A;  5I2S A;  1NU2 A;  4CYE A;  1AWE A;  4KHB B;  2W2W A;  5C5B A;  2YT0 A;  2EC1 A;  2J0K A;  2D9X A;  3AJ4 A;  1U5F A;  3SYX A;  4WSF A;  3O96 A;  4D6W A;  1XOD A;  2DA0 A;  3KRW A;  1V89 A;  1ZM0 A;  2D9W A;  2UZR A;  3GYO A;  2P0F A;  1H4R A;  4DIX A;  2W2X D;  2I1K A;  2NZ8 B;  3TVV A;  1FGZ A;  2I5C A;  2Y8F A;  3P7Z A;  2AL6 A;  1T77 A;  1PLS A;  1RRP B;  2RGN B;  1EVH A;  1V61 A;  5DH9 B;  4Z2N A;  2RNR B;  2DHI A;  1Z87 A;  1NTV A;  3PP2 A;  4OT1 A;  1KZG A;  1FHO A;  1DYN A;  3ODX A;  4TYZ A;  4MT7 A;  4DXA B;  1X11 A;  4TKN A;  2DKQ A;  2GS0 A;  3HIE A;  3G9W A;  1LW3 A;  4GNK B;  1SHC A;  1ZC4 B;  3PVW A;  3TCA A;  1BTK A;  2Z14 A;  5J3T A;  3M1I B;  2D9Z A;  2N0Y A;  5C6R A;  5EFX A;  4F7H A;  1W1G A;  2R0D A;  2CAY A;  1EGX A;  1FHW A;  2EMT A;  2L1C A;  2ZKM X;  2VSZ A;  2J0J A;  1GC6 A;  2RVB B;  2Z4D A;  3P6A A;  3BJI A;  3AU5 A;  4GMV A;  1U5G A;  4HAZ B;  2KGX B;  2LG1 A;  4EJN A;  4H8S A;  4ZRI A;  4KHA A;  1W1D A;  3HQC A;  4HB3 B;  2DHK A;  2DFK A;  5L81 A;  5HE2 A;  1U27 A;  1X05 A;  4IFS A;  2M38 A;  4P7I A;  1PFJ A;  3F0W A;  4L6E A;  1P3R A;  3HW2 B;  2Z13 A;  1K5G B;  2H7D A;  1MIX A;  1UPR A;  3QWM A;  2RLO A;  3D8F A;  1M7R A;  2YSZ A;  1NI2 A;  3FSS A;  2YS1 A;  3KY9 A;  2DYN A;  2YVC A;  4K2O A;  3SV1 A;  1WJM A;  2IYB A;  4A5K A;  2E2X A;  1V88 A;  3A8Q A;  3VIA A;  5D3Y A;  2DKP A;  4DX9 0;  4HB0 B;  2K49 A;  4DBB A;  2D10 A;  2N23 A;  3HK0 A;  4HAU B;  1B55 A;  5M4Y B;  2DYQ A;  2ELA A;  1BWN A;  3SUZ A;  4CHJ A;  4GPT B;  1MIZ B;  5LG4 B;  2VKI A;  4KAX B;  2EJ8 A;  1WVH A;  3DCX A;  3ODO A;  2QKL A;  1TJ6 A;  4HB4 B;  4HAT B;  4WJ7 A;  1FAO A;  2AEH A;  2X18 A;  4OSN A;  1UEF A;  1GG3 A;  4B6H A;  2K8E A;  2UVM A;  2KUP A;  3PSC A;  2FJU B;  3D8D A;  3DXC A;  1U2B A;  2COF A;  4ZRJ A;  4GZU A;  2KUQ A;  4DX8 A;  3NWF A;  5IRS A;  1WI1 A;  5D3W A;  2GCL A;  1X86 A;  4HAY B;  1UPQ A; 
#chains in the Genus database with same CATH homology
 2HTH B;  1U5D A;  5C5B B;  3TFM A;  4KHO A;  3TO1 A;  2D11 A;  4F7U P;  5JHH A;  3ULB A;  2LKO A;  2J59 M;  1GC7 A;  2Z0O A;  5JP4 A;  1ZVR A;  4CHM A;  4YL8 A;  5HE0 A;  1XR0 B;  3A98 B;  5JLJ B;  2D9V A;  5CLQ B;  1ISN A;  1WG7 A;  2I1J A;  5J3Y A;  5D3V A;  2DX5 A;  4HAV B;  1N3H A;  3PZD A;  5FI1 A;  2DN6 A;  4NSW A;  1I7A A;  4GXB A;  4EMO A;  1P6S A;  2ROV A;  2COC A;  5C79 A;  4HDO A;  2CY4 A;  1UNQ A;  1AQC A;  2H7E A;  2YS5 A;  2RUK B;  3U7D A;  1UNP A;  2YS3 A;  1Y5O A;  1TXD A;  3MDB C;  1PMS A;  5D27 A;  3CIK A;  4Y94 A;  1E5W A;  3PG7 A;  2P0H A;  2IFS A;  1UNR A;  2J0M A;  5DI9 B;  4ZRK A;  4K2P A;  2ELB A;  4A6K A;  3NSU A;  3SNH A;  3KZ1 A;  4A6F A;  2YF0 A;  3CXB B;  1H10 A;  1DBH A;  2JP2 A;  2ROZ B;  2OQB A;  2OTX A;  2COD A;  2ZPY A;  4HHV A;  1QC6 A;  2L2I A;  1FOE A;  1TQZ A;  1MKE A;  1J19 A;  5KQ1 A;  2Z0P A;  4PNK A;  2K2J A;  1MK9 B;  1SGH A;  3PVL A;  1I2H A;  1OMW A;  3PVU A;  3VOQ A;  3X23 A;  4HDQ A;  1QQG A;  2HE7 A;  3LJU X;  3ZVR A;  5J3Q A;  4HAX B;  3KRX A;  1Q67 A;  4BBK A;  1Y19 B;  2D4Q A;  2MKR A;  3UZT A;  4IAP A;  1XD4 A;  2P8V A;  1WJ1 A;  1MAI A;  5LON B;  2G35 A;  5DHA B;  3OAN A;  2ADZ A;  1LB1 A;  2XQN M;  2GCJ A;  3ZDT A;  1EF1 A;  3IVF A;  1U29 A;  4GMX B;  2MFQ A;  1OQN A;  3ML4 A;  2V76 A;  3ULC A;  2VRW B;  1DRO A;  3V5W A;  5D3X A;  1IRS A;  4WVF B;  3U8Z A;  4A6H A;  4IOY X;  1WGQ A;  2BCJ A;  4Z2M B;  2EMS A;  1BTN A;  3DXE A;  2LOZ A;  5C16 A;  2Y8G A;  1X1F A;  1DDV A;  1RJ2 A;  4HAW B;  3FM8 C;  2FJL A;  2Q13 A;  2RSG A;  2DHJ A;  3RCP A;  3FEH A;  4F7G A;  2K00 A;  1DDM A;  1MPH A;  2DX1 A;  1P5T A;  1J0W A;  3F5R A;  4HB2 B;  4K17 A;  1XX0 A;  1EAZ A;  5JHG A;  4GN1 A;  3N7C A;  4YON A;  5DHF B;  2Z0Q A;  3WYF B;  4XWX A;  3QIJ A;  1ZC3 B;  1X1G A;  3QBV B;  3SO6 A;  3AU4 A;  1FGY A;  2YRY A;  2YT1 A;  2R09 A;  5GOW B;  1XCG A;  1OY2 A;  1FB8 A;  2LOX A;  2P0D A;  4D0N B;  2Y7B A;  1W1H A;  1XKE A;  1FHX A;  3D8E A;  2COA A;  5CLL B;  2NMB A;  5KQ4 A;  4MY6 A;  5HE3 A;  3GYP A;  4KVG B;  4NY0 A;  1NTY A;  3PEG A;  1KI1 B;  2D9Y A;  2GJY A;  1BAK A;  2KCJ A;  2DTC A;  1ZSQ A;  2M14 A;  2K2U A;  3KSY A;  2UZS A;  5DIF B;  3MPX A;  4K81 A;  3ODW A;  2CRF A;  2PZ1 A;  2DLW A;  3TW1 A;  1DDW A;  3BIN A;  1M7E A;  2D2Q A;  2MWN B;  1V5P A;  2I5F A;  3DXD A;  4A6F B;  2CY5 A;  5FI0 A;  4C0A A;  1K5D B;  1V5U A;  3T06 A;  1WGU A;  2QKM A;  3A8P A;  5HE1 A;  5KCV A;  4PQ0 A;  1KZ7 A;  1MK7 B;  4EKU A;  1V5M A;  5LOP B;  3WA0 A;  2LUL A;  4MK0 A;  2W2X C;  2MDX A;  1U5E A;  2LYD A;  1NU2 A;  4CYE A;  1AWE A;  4KHB B;  2W2W A;  5C5B A;  2YT0 A;  2EC1 A;  2J0K A;  2D9X A;  3AJ4 A;  1U5F A;  3SYX A;  4WSF A;  3O96 A;  1XOD A;  2DA0 A;  3KRW A;  1V89 A;  1ZM0 A;  2D9W A;  2UZR A;  3GYO A;  2P0F A;  1H4R A;  2W2X D;  2I1K A;  2NZ8 B;  3TVV A;  1FGZ A;  2I5C A;  2Y8F A;  3P7Z A;  2AL6 A;  1PLS A;  1RRP B;  2RGN B;  1EVH A;  1V61 A;  5DH9 B;  4Z2N A;  2RNR B;  2DHI A;  1Z87 A;  1NTV A;  3PP2 A;  1KZG A;  1FHO A;  1DYN A;  3ODX A;  4TYZ A;  4MT7 A;  4DXA B;  1X11 A;  4TKN A;  2DKQ A;  2GS0 A;  3G9W A;  1LW3 A;  1SHC A;  1ZC4 B;  3PVW A;  3TCA A;  1BTK A;  5J3T A;  3M1I B;  2D9Z A;  2N0Y A;  5C6R A;  5EFX A;  4F7H A;  1W1G A;  2R0D A;  2CAY A;  1EGX A;  1FHW A;  2EMT A;  2L1C A;  2VSZ A;  2J0J A;  1GC6 A;  2RVB B;  3P6A A;  3BJI A;  3AU5 A;  4GMV A;  1U5G A;  4HAZ B;  2KGX B;  2LG1 A;  4EJN A;  4H8S A;  4ZRI A;  4KHA A;  1W1D A;  3HQC A;  4HB3 B;  2DHK A;  2DFK A;  5L81 A;  5HE2 A;  1U27 A;  1X05 A;  4IFS A;  2M38 A;  4P7I A;  1PFJ A;  3F0W A;  4L6E A;  1P3R A;  3HW2 B;  1K5G B;  2H7D A;  1MIX A;  1UPR A;  3QWM A;  2RLO A;  3D8F A;  1M7R A;  2YSZ A;  1NI2 A;  3FSS A;  2YS1 A;  3KY9 A;  2DYN A;  2YVC A;  4K2O A;  3SV1 A;  1WJM A;  2IYB A;  4A5K A;  2E2X A;  1V88 A;  3A8Q A;  3VIA A;  5D3Y A;  2DKP A;  4DX9 0;  4HB0 B;  4DBB A;  2D10 A;  2N23 A;  3HK0 A;  4HAU B;  1B55 A;  2DYQ A;  2ELA A;  1BWN A;  3SUZ A;  4CHJ A;  4GPT B;  1MIZ B;  2VKI A;  4KAX B;  2EJ8 A;  1WVH A;  3ODO A;  2QKL A;  1TJ6 A;  4HB4 B;  4HAT B;  4WJ7 A;  1FAO A;  2AEH A;  2X18 A;  1UEF A;  1GG3 A;  4B6H A;  2UVM A;  2KUP A;  3PSC A;  3D8D A;  3DXC A;  1U2B A;  2COF A;  4ZRJ A;  4GZU A;  4DX8 A;  1WI1 A;  5D3W A;  2GCL A;  1X86 A;  4HAY B;  1UPQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...