2DKQA

Solution structure of the ptb domain of kiaa1075 protein from human
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
160
structure length
160
Chain Sequence
GSSGSSGMSTAADLLRQGAACSVLYLTSVETESLTGPQAVARASSAALSCSPRPTPAVVHFKVSAQGITLTDNQRKLFFRRHYPVNSITFSSTDPQDRRWTNPDGTTSKIFGFVAKKPGSPWENVCHLFAELDPDQPAGAIVTFITKVLLGQRKSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords KIAA1075 protein
publication title Solution structure of the PTB domain of KIAA1075 protein from human
rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 19
structure length 160
sequence length 160
ec nomenclature
pdb deposition date 2006-04-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08416 PTB Phosphotyrosine-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2dkqA01
2AEHA 2GCLA 1V88A 3F0WA 1PFJA 2D4QA 4K81A 1GC6A 1P3RA 3ZVRA 2DA0A 4K17A 3SV1A 3RCPA 1U2BA 2QKMA 4TYZA 4F7HA 5J3TA 1V89A 5C16A 1MAIA 1MKEA 2Y8FA 5GOWB 5DHAB 2D2QA 5DHFB 3SNHA 4IOYX 2H7EA 5FI1A 1AWEA 3FM8C 1DDVA 1Y19B 3KZ1A 2ADZA 2J0JA 4PNKA 1WGQA 4MY6A 2YRYA 4PQ0A 5D3WA 1UPQA 1XR0B 2PZ1A 2GJYA 4HDOA 2GS0A 3D8DA 2H7DA 1U29A 5DIFB 2COAA 2VKIA 1WI1A 2R09A 2ROVA 4CYEA 2Z0QA 1IRSA 2ZPYA 4DBBA 2P0HA 1UNQA 1XX0A 3PVLA 3U8ZA 4Z2NA 4GN1A 1DROA 1SHCA 1EAZA 2XQNM 1LW3A 4WVFB 3VIAA 4KAXB 5KQ4A 2LKOA 1X1FA 2J0KA 3PEGA 2LOZA 3DXDA 2HTHB 1TJ6A 2D10A 2LULA 3M1IB 2MKRA 4B6HA 1H10A 3FSSA 2V76A 2IFSA 2E2XA 5C5BA 5CLQB 1DDMA 2RGNB 4L6EA 4TKNA 4DX90 4GMVA 2I1KA 1I2HA 1TXDA 3QIJA 1WGUA 2VRWB 1B55A 1DBHA 2I5CA 5KQ1A 2W2XC 1MK7B 1XKEA 4MT7A 2EMSA 2BCJA 2YT1A 1U5EA 2NZ8B 2DKQA 1U5DA 3D8FA 4KHOA 2LG1A 3PVWA 1J19A 1M7EA 3TO1A 1NI2A 3ULCA 3V5WA 1V5PA 1ZC4B 4K2OA 1LB1A 1FHOA 5JHHA 3GYOA 2L1CA 3DXCA 2QKLA 1AQCA 1V61A 4EJNA 4YONA 1KZGA 4A6FA 1ISNA 3FEHA 4A6KA 1UNRA 4IAPA 2D9VA 3ULBA 2CRFA 1DYNA 2LYDA 5KCVA 2HE7A 1ZC3B 2ELAA 4HB4B 2RVBB 1PLSA 2RNRB 1XD4A 3KY9A 4IFSA 1Y5OA 2I1JA 2J0MA 5D27A 2P8VA 1MIZB 1X11A 1WG7A 1ZSQA 2D9WA 2G35A 2RLOA 1RJ2A 1OMWA 1Z87A 2L2IA 4XWXA 2ROZB 3SYXA 1ZVRA 4HAYB 1BAKA 1DDWA 2NMBA 4ZRIA 1V5UA 3KRWA 3VOQA 2DTCA 1MK9B 3A8PA 3A8QA 4KHAA 4CHJA 2OTXA 2UZSA 2FJLA 2KGXB 1TQZA 2Q13A 3NSUA 1FHXA 3ML4A 1OQNA 2DYNA 1WJMA 4KHBB 2YS1A 2K2UA 4HAUB 5DH9B 2ELBA 5D3XA 4NSWA 5LOPB 2GCJA 3HW2B 5C6RA 4C0AA 5D3VA 3ODXA 1U5GA 1U5FA 4HATB 2K2JA 1BTNA 2DX5A 2KUPA 2P0DA 3MDBC 2YF0A 1MIXA 2UZRA 5DI9B 1KI1B 2DYQA 2D9XA 3SO6A 2DLWA 1QQGA 3QWMA 4GPTB 2M14A 3ODWA 3AU5A 1GG3A 5LONB 2MDXA 2DFKA 2N23A 3O96A 3U7DA 1GC7A 1WJ1A 3QBVB 3PG7A 3WA0A 5J3QA 4H8SA 1QC6A 2COCA 1OY2A 1U27A 2JP2A 3HK0A 2CODA 2CY5A 4HB0B 3TCAA 1M7RA 3TW1A 1V5MA 1W1DA 1SGHA 5C79A 1PMSA 1FGZA 2P0FA 1FGYA 1P5TA 1I7AA 4HAWB 1X86A 4DX8A 2J59M 2YSZA 3T06A 4KVGB 5HE3A 1W1HA 5JP4A 2Y7BA 4EMOA 1UEFA 3SUZA 5D3YA 3IVFA 2RUKB 5J3YA 2UVMA 2D9ZA 3ODOA 3BJIA 5C5BB 4P7IA 4BBKA 4Y94A 2YT0A 1BWNA 4EKUA 4K2PA 2CY4A 4NY0A 4ZRKA 4A6HA 3GYPA 3WYFB 3PP2A 2DHIA 2YS5A 1FHWA 2IYBA 2DHJA 2DX1A 1E5WA 1J0WA 1ZM0A 2K00A 1BTKA 2OQBA 4YL8A 3DXEA 2KCJA 1FB8A 1N3HA 2RSGA 3LJUX 4HDQA 1MPHA 3G9WA 1FOEA 3PVUA 2VSZA 4DXAB 3MPXA 5JHGA 4HAVB 4A5KA 3PZDA 2EMTA 3AJ4A 2MFQA 5EFXA 2W2WA 2D9YA 2YS3A 4A6FB 4F7UP 2M38A 2Z0PA 2EJ8A 3AU4A 4MK0A 2YVCA 2AL6A 4GXBA 1W1GA 2DHKA 1FAOA 4GMXB 3KSYA 5HE2A 5HE0A 1WVHA 4F7GA 1K5DB 1P6SA 2Z0OA 3A98B 3UZTA 2N0YA 3P6AA 3BINA 2EC1A 5CLLB 1Q67A 1XODA 2R0DA 3X23A 4D0NB 1UNPA 3CXBB 4CHMA 2COFA 1EGXA 1X05A 2CAYA 2I5FA 1H4RA 2D11A 5HE1A 1KZ7A 5L81A 2DN6A 4HHVA 1NTVA 1NU2A 1EF1A 1X1GA 1XCGA 3OANA 5FI0A 2DKPA 3F5RA 4WJ7A 4WSFA 1K5GB 1EVHA 3TVVA 2X18A 1UPRA 4HAXB 4ZRJA 3KRXA 3CIKA 3N7CA 2Y8GA 2MWNB 2LOXA 5JLJB 3D8EA 3P7ZA 3PSCA 4GZUA 2W2XD 1RRPB 3HQCA 4HB2B 1NTYA 3TFMA 4HB3B 4Z2MB 4HAZB 3ZDTA
chains in the Genus database with same CATH superfamily
2AEHA 2GCLA 1V88A 3F0WA 1ZYIA 1PFJA 2D4QA 3FVCA 4KHBA 4CSQA 4K81A 1GC6A 1P3RA 3ZVRA 2DA0A 4K17A 3SV1A 3RCPA 2GUMA 1U2BA 2QKMA 4TYZA 4F7HA 5J3TA 1V89A 5C16A 1MAIA 1MKEA 2Y8FA 5GOWB 5DHAB 2D2QA 5DHFB 3HSAA 3SNHA 4IOYX 2H7EA 5FI1A 1AWEA 3FM8C 1DDVA 1Y19B 3KZ1A 2ADZA 2J0JA 4PNKA 1WGQA 4MY6A 2YRYA 4PQ0A 5D3WA 1UPQA 3HIEA 1XR0B 4QJ5B 2PZ1A 2GJYA 4HDOA 2GS0A 3D8DA 2H7DA 1U29A 5DIFB 2COAA 2VKIA 1WI1A 2R09A 2ROVA 4CYEA 2Z0QA 1IRSA 2ZPYA 3OHMB 4DBBA 2P0HA 1UNQA 1XX0A 3PVLA 3U8ZA 4Z2NA 4GN1A 1DROA 1SHCA 1EAZA 2XQNM 1LW3A 4WVFB 3U12A 3VIAA 4KAXB 5KQ4A 2LKOA 1X1FA 2J0KA 3PEGA 2LOZA 3DXDA 2HTHB 1TJ6A 2D10A 2LULA 3M1IB 2MKRA 4B6HA 1H10A 3FSSA 3NWDA 4GOUA 2V76A 2IFSA 2E2XA 5C5BA 5CLQB 1DDMA 5I2SA 2RGNB 4L6EA 4TKNA 4DX90 4GMVA 2I1KA 1I2HA 1TXDA 3QIJA 1WGUA 2VRWB 1B55A 1DBHA 2KIGA 2I5CA 5KQ1A 2KR0A 4OSNA 2W2XC 4HSIA 1MK7B 1XKEA 4MT7A 2EMSA 2BCJA 2YT1A 1U5EA 4GNKB 2NZ8B 2DKQA 3DCXA 1U5DA 3D8FA 4KHOA 2LG1A 3PVWA 2RRFA 1J19A 1M7EA 3TO1A 1NI2A 3ULCA 3V5WA 1V5PA 1ZC4B 4K2OA 1LB1A 1FHOA 5JHHA 3GYOA 2L1CA 3DXCA 1T77A 1AQCA 2QKLA 2Z59A 1V61A 4EJNA 4YONA 2Z13A 1KZGA 4A6FA 1ISNA 2YT2A 3FEHA 4A6KA 1UNRA 4IAPA 2D9VA 4L1RA 3ULBA 2CRFA 1DYNA 2LYDA 5KCVA 2HE7A 1ZC3B 2ELAA 4HB4B 2RVBB 1PLSA 2RNRB 1XD4A 3KY9A 4IFSA 1Y5OA 2I1JA 2J0MA 5D27A 2P8VA 1MIZB 1X11A 1WG7A 1ZSQA 2D9WA 2G35A 2RLOA 1RJ2A 1OMWA 1Z87A 2L2IA 4XWXA 2ROZB 3SYXA 3NWFA 2Z4DA 1ZVRA 4HAYB 5LG4B 1BAKA 1DDWA 2NMBA 4ZRIA 1V5UA 3KRWA 3VOQA 2DTCA 1MK9B 3A8PA 3A8QA 4KHAA 4CHJA 2OTXA 2UZSA 5I2MA 2FJLA 2KGXB 1TQZA 2Q13A 3A58A 3NSUA 1FHXA 4QXAB 2KIEA 3ML4A 1OQNA 2DYNA 1WJMA 4KHBB 2YS1A 2K2UA 4HAUB 5DH9B 2ELBA 5D3XA 4NSWA 5LOPB 2GCJA 2R2YA 3HW2B 5C6RA 4C0AA 5D3VA 3ODXA 1U5GA 2Z14A 1U5FA 4HATB 2K2JA 1BTNA 2DX5A 2KUPA 2P0DA 3MDBC 2YF0A 1MIXA 2UZRA 5DI9B 1KI1B 2DYQA 2D9XA 3SO6A 2DLWA 1QQGA 3QWMA 4GPTB 2M14A 3ODWA 3AU5A 1GG3A 5LONB 2FJUB 5M4YB 2MDXA 2DFKA 2N23A 3O96A 3U7DA 1GC7A 1WJ1A 3QBVB 3PG7A 3WA0A 5J3QA 4H8SA 1QC6A 2COCA 1OY2A 1U27A 2JP2A 3HK0A 2CODA 2CY5A 4HB0B 3TCAA 1M7RA 3TW1A 1V5MA 1W1DA 1SGHA 5C79A 1PMSA 1FGZA 2P0FA 4QJ4B 1FGYA 1P5TA 1I7AA 4HAWB 1X86A 4DX8A 2J59M 2YSZA 3T06A 4KVGB 5HE3A 1W1HA 5JP4A 2Y7BA 4EMOA 1UEFA 3SUZA 5D3YA 3IVFA 2RUKB 5J3YA 2UVMA 2D9ZA 2KUQA 3ODOA 3BJIA 4D6WA 5C5BB 4P7IA 4BBKA 4Y94A 2YT0A 1BWNA 4EKUA 4K2PA 4QJ3B 2CY4A 4NY0A 4ZRKA 4A6HA 3GYPA 3WYFB 3PP2A 2DHIA 2YS5A 1FHWA 2IYBA 2DHJA 2DX1A 1E5WA 1J0WA 1ZM0A 2K00A 1BTKA 2OQBA 3B77A 4YL8A 3DXEA 2KCJA 1FB8A 1N3HA 2RSGA 3LJUX 4HDQA 1MPHA 5IRSA 3G9WA 1FOEA 3PVUA 2VSZA 4DXAB 3MPXA 5JHGA 4HAVB 4A5KA 3PZDA 2EMTA 3AJ4A 4DIXA 2MFQA 1MI1A 5EFXA 2W2WA 2D9YA 2YS3A 4A6FB 4F7UP 2M38A 2K49A 2Z0PA 2EJ8A 3AU4A 4MK0A 2YVCA 2AL6A 4GXBA 1W1GA 2DHKA 1FAOA 4GMXB 3KSYA 5HE2A 5HE0A 1WVHA 2ZKMX 4F7GA 1K5DB 1P6SA 2Z0OA 3A98B 2K8EA 3UZTA 2N0YA 3P6AA 3BINA 2EC1A 5CLLB 1Q67A 1XODA 2R0DA 3X23A 4D0NB 1UNPA 3CXBB 4CHMA 2COFA 1EGXA 1X05A 2CAYA 2I5FA 1H4RA 2D11A 5HE1A 4OT1A 1KZ7A 5L81A 2DN6A 4HHVA 1NTVA 1NU2A 1EF1A 1X1GA 1XCGA 3OANA 5FI0A 2DKPA 3F5RA 4WJ7A 4WSFA 1K5GB 1EVHA 3NW8A 3TVVA 2X18A 1UPRA 4HAXB 4ZRJA 3KRXA 3CIKA 3N7CA 2Y8GA 2MWNB 2LOXA 5JLJB 3D8EA 3P7ZA 3PSCA 4GZUA 2W2XD 1RRPB 3HQCA 4HB2B 3NWAA 2NBVA 1NTYA 3TFMA 4HB3B 4Z2MB 4HAZB 3ZDTA
chains in the Genus database with same CATH topology
2AEHA 2GCLA 1V88A 3F0WA 1PFJA 2D4QA 4K81A 1GC6A 1P3RA 3ZVRA 2DA0A 4K17A 3SV1A 3RCPA 1U2BA 2QKMA 4TYZA 4F7HA 5J3TA 1V89A 5C16A 1MAIA 1MKEA 2Y8FA 5GOWB 5DHAB 2D2QA 5DHFB 3SNHA 4IOYX 2H7EA 5FI1A 1AWEA 3FM8C 1DDVA 1Y19B 3KZ1A 2ADZA 2J0JA 4PNKA 1WGQA 4MY6A 2YRYA 4PQ0A 5D3WA 1UPQA 1XR0B 2PZ1A 2GJYA 4HDOA 2GS0A 3D8DA 2H7DA 1U29A 5DIFB 2COAA 2VKIA 1WI1A 2R09A 2ROVA 4CYEA 2Z0QA 1IRSA 2ZPYA 4DBBA 2P0HA 1UNQA 1XX0A 3PVLA 3U8ZA 4Z2NA 4GN1A 1DROA 1SHCA 1EAZA 2XQNM 1LW3A 4WVFB 3VIAA 4KAXB 5KQ4A 2LKOA 1X1FA 2J0KA 3PEGA 2LOZA 3DXDA 2HTHB 1TJ6A 2D10A 2LULA 3M1IB 2MKRA 4B6HA 1H10A 3FSSA 2V76A 2IFSA 2E2XA 5C5BA 5CLQB 1DDMA 2RGNB 4L6EA 4TKNA 4DX90 4GMVA 2I1KA 1I2HA 1TXDA 3QIJA 1WGUA 2VRWB 1B55A 1DBHA 2I5CA 5KQ1A 2W2XC 1MK7B 1XKEA 4MT7A 2EMSA 2BCJA 2YT1A 1U5EA 2NZ8B 2DKQA 1U5DA 3D8FA 4KHOA 2LG1A 3PVWA 1J19A 1M7EA 3TO1A 1NI2A 3ULCA 3V5WA 1V5PA 1ZC4B 4K2OA 1LB1A 1FHOA 5JHHA 3GYOA 2L1CA 3DXCA 2QKLA 1AQCA 1V61A 4EJNA 4YONA 1KZGA 4A6FA 1ISNA 3FEHA 4A6KA 1UNRA 4IAPA 2D9VA 3ULBA 2CRFA 1DYNA 2LYDA 5KCVA 2HE7A 1ZC3B 2ELAA 4HB4B 2RVBB 1PLSA 2RNRB 1XD4A 3KY9A 4IFSA 1Y5OA 2I1JA 2J0MA 5D27A 2P8VA 1MIZB 1X11A 1WG7A 1ZSQA 2D9WA 2G35A 2RLOA 1RJ2A 1OMWA 1Z87A 2L2IA 4XWXA 2ROZB 3SYXA 1ZVRA 4HAYB 1BAKA 1DDWA 2NMBA 4ZRIA 1V5UA 3KRWA 3VOQA 2DTCA 1MK9B 3A8PA 3A8QA 4KHAA 4CHJA 2OTXA 2UZSA 2FJLA 2KGXB 1TQZA 2Q13A 3NSUA 1FHXA 3ML4A 1OQNA 2DYNA 1WJMA 4KHBB 2YS1A 2K2UA 4HAUB 5DH9B 2ELBA 5D3XA 4NSWA 5LOPB 2GCJA 3HW2B 5C6RA 4C0AA 5D3VA 3ODXA 1U5GA 1U5FA 4HATB 2K2JA 1BTNA 2DX5A 2KUPA 2P0DA 3MDBC 2YF0A 1MIXA 2UZRA 5DI9B 1KI1B 2DYQA 2D9XA 3SO6A 2DLWA 1QQGA 3QWMA 4GPTB 2M14A 3ODWA 3AU5A 1GG3A 5LONB 2MDXA 2DFKA 2N23A 3O96A 3U7DA 1GC7A 1WJ1A 3QBVB 3PG7A 3WA0A 5J3QA 4H8SA 1QC6A 2COCA 1OY2A 1U27A 2JP2A 3HK0A 2CODA 2CY5A 4HB0B 3TCAA 1M7RA 3TW1A 1V5MA 1W1DA 1SGHA 5C79A 1PMSA 1FGZA 2P0FA 1FGYA 1P5TA 1I7AA 4HAWB 1X86A 4DX8A 2J59M 2YSZA 3T06A 4KVGB 5HE3A 1W1HA 5JP4A 2Y7BA 4EMOA 1UEFA 3SUZA 5D3YA 3IVFA 2RUKB 5J3YA 2UVMA 2D9ZA 3ODOA 3BJIA 5C5BB 4P7IA 4BBKA 4Y94A 2YT0A 1BWNA 4EKUA 4K2PA 2CY4A 4NY0A 4ZRKA 4A6HA 3GYPA 3WYFB 3PP2A 2DHIA 2YS5A 1FHWA 2IYBA 2DHJA 2DX1A 1E5WA 1J0WA 1ZM0A 2K00A 1BTKA 2OQBA 4YL8A 3DXEA 2KCJA 1FB8A 1N3HA 2RSGA 3LJUX 4HDQA 1MPHA 3G9WA 1FOEA 3PVUA 2VSZA 4DXAB 3MPXA 5JHGA 4HAVB 4A5KA 3PZDA 2EMTA 3AJ4A 2MFQA 5EFXA 2W2WA 2D9YA 2YS3A 4A6FB 4F7UP 2M38A 2Z0PA 2EJ8A 3AU4A 4MK0A 2YVCA 2AL6A 4GXBA 1W1GA 2DHKA 1FAOA 4GMXB 3KSYA 5HE2A 5HE0A 1WVHA 4F7GA 1K5DB 1P6SA 2Z0OA 3A98B 3UZTA 2N0YA 3P6AA 3BINA 2EC1A 5CLLB 1Q67A 1XODA 2R0DA 3X23A 4D0NB 1UNPA 3CXBB 4CHMA 2COFA 1EGXA 1X05A 2CAYA 2I5FA 1H4RA 2D11A 5HE1A 1KZ7A 5L81A 2DN6A 4HHVA 1NTVA 1NU2A 1EF1A 1X1GA 1XCGA 3OANA 5FI0A 2DKPA 3F5RA 4WJ7A 4WSFA 1K5GB 1EVHA 3TVVA 2X18A 1UPRA 4HAXB 4ZRJA 3KRXA 3CIKA 3N7CA 2Y8GA 2MWNB 2LOXA 5JLJB 3D8EA 3P7ZA 3PSCA 4GZUA 2W2XD 1RRPB 3HQCA 4HB2B 1NTYA 3TFMA 4HB3B 4Z2MB 4HAZB 3ZDTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AEH A;  2GCL A;  1V88 A;  3F0W A;  1PFJ A;  2D4Q A;  4K81 A;  1GC6 A;  1P3R A;  3ZVR A;  2DA0 A;  4K17 A;  3SV1 A;  3RCP A;  1U2B A;  2QKM A;  4TYZ A;  4F7H A;  5J3T A;  1V89 A;  5C16 A;  1MAI A;  1MKE A;  2Y8F A;  5GOW B;  5DHA B;  2D2Q A;  5DHF B;  3SNH A;  4IOY X;  2H7E A;  5FI1 A;  1AWE A;  3FM8 C;  1DDV A;  1Y19 B;  3KZ1 A;  2ADZ A;  2J0J A;  4PNK A;  1WGQ A;  4MY6 A;  2YRY A;  4PQ0 A;  5D3W A;  1UPQ A;  1XR0 B;  2PZ1 A;  2GJY A;  4HDO A;  2GS0 A;  3D8D A;  2H7D A;  1U29 A;  5DIF B;  2COA A;  2VKI A;  1WI1 A;  2R09 A;  2ROV A;  4CYE A;  2Z0Q A;  1IRS A;  2ZPY A;  4DBB A;  2P0H A;  1UNQ A;  1XX0 A;  3PVL A;  3U8Z A;  4Z2N A;  4GN1 A;  1DRO A;  1SHC A;  1EAZ A;  2XQN M;  1LW3 A;  4WVF B;  3VIA A;  4KAX B;  5KQ4 A;  2LKO A;  1X1F A;  2J0K A;  3PEG A;  2LOZ A;  3DXD A;  2HTH B;  1TJ6 A;  2D10 A;  2LUL A;  3M1I B;  2MKR A;  4B6H A;  1H10 A;  3FSS A;  2V76 A;  2IFS A;  2E2X A;  5C5B A;  5CLQ B;  1DDM A;  2RGN B;  4L6E A;  4TKN A;  4DX9 0;  4GMV A;  2I1K A;  1I2H A;  1TXD A;  3QIJ A;  1WGU A;  2VRW B;  1B55 A;  1DBH A;  2I5C A;  5KQ1 A;  2W2X C;  1MK7 B;  1XKE A;  4MT7 A;  2EMS A;  2BCJ A;  2YT1 A;  1U5E A;  2NZ8 B;  2DKQ A;  1U5D A;  3D8F A;  4KHO A;  2LG1 A;  3PVW A;  1J19 A;  1M7E A;  3TO1 A;  1NI2 A;  3ULC A;  3V5W A;  1V5P A;  1ZC4 B;  4K2O A;  1LB1 A;  1FHO A;  5JHH A;  3GYO A;  2L1C A;  3DXC A;  2QKL A;  1AQC A;  1V61 A;  4EJN A;  4YON A;  1KZG A;  4A6F A;  1ISN A;  3FEH A;  4A6K A;  1UNR A;  4IAP A;  2D9V A;  3ULB A;  2CRF A;  1DYN A;  2LYD A;  5KCV A;  2HE7 A;  1ZC3 B;  2ELA A;  4HB4 B;  2RVB B;  1PLS A;  2RNR B;  1XD4 A;  3KY9 A;  4IFS A;  1Y5O A;  2I1J A;  2J0M A;  5D27 A;  2P8V A;  1MIZ B;  1X11 A;  1WG7 A;  1ZSQ A;  2D9W A;  2G35 A;  2RLO A;  1RJ2 A;  1OMW A;  1Z87 A;  2L2I A;  4XWX A;  2ROZ B;  3SYX A;  1ZVR A;  4HAY B;  1BAK A;  1DDW A;  2NMB A;  4ZRI A;  1V5U A;  3KRW A;  3VOQ A;  2DTC A;  1MK9 B;  3A8P A;  3A8Q A;  4KHA A;  4CHJ A;  2OTX A;  2UZS A;  2FJL A;  2KGX B;  1TQZ A;  2Q13 A;  3NSU A;  1FHX A;  3ML4 A;  1OQN A;  2DYN A;  1WJM A;  4KHB B;  2YS1 A;  2K2U A;  4HAU B;  5DH9 B;  2ELB A;  5D3X A;  4NSW A;  5LOP B;  2GCJ A;  3HW2 B;  5C6R A;  4C0A A;  5D3V A;  3ODX A;  1U5G A;  1U5F A;  4HAT B;  2K2J A;  1BTN A;  2DX5 A;  2KUP A;  2P0D A;  3MDB C;  2YF0 A;  1MIX A;  2UZR A;  5DI9 B;  1KI1 B;  2DYQ A;  2D9X A;  3SO6 A;  2DLW A;  1QQG A;  3QWM A;  4GPT B;  2M14 A;  3ODW A;  3AU5 A;  1GG3 A;  5LON B;  2MDX A;  2DFK A;  2N23 A;  3O96 A;  3U7D A;  1GC7 A;  1WJ1 A;  3QBV B;  3PG7 A;  3WA0 A;  5J3Q A;  4H8S A;  1QC6 A;  2COC A;  1OY2 A;  1U27 A;  2JP2 A;  3HK0 A;  2COD A;  2CY5 A;  4HB0 B;  3TCA A;  1M7R A;  3TW1 A;  1V5M A;  1W1D A;  1SGH A;  5C79 A;  1PMS A;  1FGZ A;  2P0F A;  1FGY A;  1P5T A;  1I7A A;  4HAW B;  1X86 A;  4DX8 A;  2J59 M;  2YSZ A;  3T06 A;  4KVG B;  5HE3 A;  1W1H A;  5JP4 A;  2Y7B A;  4EMO A;  1UEF A;  3SUZ A;  5D3Y A;  3IVF A;  2RUK B;  5J3Y A;  2UVM A;  2D9Z A;  3ODO A;  3BJI A;  5C5B B;  4P7I A;  4BBK A;  4Y94 A;  2YT0 A;  1BWN A;  4EKU A;  4K2P A;  2CY4 A;  4NY0 A;  4ZRK A;  4A6H A;  3GYP A;  3WYF B;  3PP2 A;  2DHI A;  2YS5 A;  1FHW A;  2IYB A;  2DHJ A;  2DX1 A;  1E5W A;  1J0W A;  1ZM0 A;  2K00 A;  1BTK A;  2OQB A;  4YL8 A;  3DXE A;  2KCJ A;  1FB8 A;  1N3H A;  2RSG A;  3LJU X;  4HDQ A;  1MPH A;  3G9W A;  1FOE A;  3PVU A;  2VSZ A;  4DXA B;  3MPX A;  5JHG A;  4HAV B;  4A5K A;  3PZD A;  2EMT A;  3AJ4 A;  2MFQ A;  5EFX A;  2W2W A;  2D9Y A;  2YS3 A;  4A6F B;  4F7U P;  2M38 A;  2Z0P A;  2EJ8 A;  3AU4 A;  4MK0 A;  2YVC A;  2AL6 A;  4GXB A;  1W1G A;  2DHK A;  1FAO A;  4GMX B;  3KSY A;  5HE2 A;  5HE0 A;  1WVH A;  4F7G A;  1K5D B;  1P6S A;  2Z0O A;  3A98 B;  3UZT A;  2N0Y A;  3P6A A;  3BIN A;  2EC1 A;  5CLL B;  1Q67 A;  1XOD A;  2R0D A;  3X23 A;  4D0N B;  1UNP A;  3CXB B;  4CHM A;  2COF A;  1EGX A;  1X05 A;  2CAY A;  2I5F A;  1H4R A;  2D11 A;  5HE1 A;  1KZ7 A;  5L81 A;  2DN6 A;  4HHV A;  1NTV A;  1NU2 A;  1EF1 A;  1X1G A;  1XCG A;  3OAN A;  5FI0 A;  2DKP A;  3F5R A;  4WJ7 A;  4WSF A;  1K5G B;  1EVH A;  3TVV A;  2X18 A;  1UPR A;  4HAX B;  4ZRJ A;  3KRX A;  3CIK A;  3N7C A;  2Y8G A;  2MWN B;  2LOX A;  5JLJ B;  3D8E A;  3P7Z A;  3PSC A;  4GZU A;  2W2X D;  1RRP B;  3HQC A;  4HB2 B;  1NTY A;  3TFM A;  4HB3 B;  4Z2M B;  4HAZ B;  3ZDT A; 
#chains in the Genus database with same CATH topology
 2AEH A;  2GCL A;  1V88 A;  3F0W A;  1ZYI A;  1PFJ A;  2D4Q A;  3FVC A;  4KHB A;  4CSQ A;  4K81 A;  1GC6 A;  1P3R A;  3ZVR A;  2DA0 A;  4K17 A;  3SV1 A;  3RCP A;  2GUM A;  1U2B A;  2QKM A;  4TYZ A;  4F7H A;  5J3T A;  1V89 A;  5C16 A;  1MAI A;  1MKE A;  2Y8F A;  5GOW B;  5DHA B;  2D2Q A;  5DHF B;  3HSA A;  3SNH A;  4IOY X;  2H7E A;  5FI1 A;  1AWE A;  3FM8 C;  1DDV A;  1Y19 B;  3KZ1 A;  2ADZ A;  2J0J A;  4PNK A;  1WGQ A;  4MY6 A;  2YRY A;  4PQ0 A;  5D3W A;  1UPQ A;  3HIE A;  1XR0 B;  4QJ5 B;  2PZ1 A;  2GJY A;  4HDO A;  2GS0 A;  3D8D A;  2H7D A;  1U29 A;  5DIF B;  2COA A;  2VKI A;  1WI1 A;  2R09 A;  2ROV A;  4CYE A;  2Z0Q A;  1IRS A;  2ZPY A;  3OHM B;  4DBB A;  2P0H A;  1UNQ A;  1XX0 A;  3PVL A;  3U8Z A;  4Z2N A;  4GN1 A;  1DRO A;  1SHC A;  1EAZ A;  2XQN M;  1LW3 A;  4WVF B;  3U12 A;  3VIA A;  4KAX B;  5KQ4 A;  2LKO A;  1X1F A;  2J0K A;  3PEG A;  2LOZ A;  3DXD A;  2HTH B;  1TJ6 A;  2D10 A;  2LUL A;  3M1I B;  2MKR A;  4B6H A;  1H10 A;  3FSS A;  3NWD A;  4GOU A;  2V76 A;  2IFS A;  2E2X A;  5C5B A;  5CLQ B;  1DDM A;  5I2S A;  2RGN B;  4L6E A;  4TKN A;  4DX9 0;  4GMV A;  2I1K A;  1I2H A;  1TXD A;  3QIJ A;  1WGU A;  2VRW B;  1B55 A;  1DBH A;  2KIG A;  2I5C A;  5KQ1 A;  2KR0 A;  4OSN A;  2W2X C;  4HSI A;  1MK7 B;  1XKE A;  4MT7 A;  2EMS A;  2BCJ A;  2YT1 A;  1U5E A;  4GNK B;  2NZ8 B;  2DKQ A;  3DCX A;  1U5D A;  3D8F A;  4KHO A;  2LG1 A;  3PVW A;  2RRF A;  1J19 A;  1M7E A;  3TO1 A;  1NI2 A;  3ULC A;  3V5W A;  1V5P A;  1ZC4 B;  4K2O A;  1LB1 A;  1FHO A;  5JHH A;  3GYO A;  2L1C A;  3DXC A;  1T77 A;  1AQC A;  2QKL A;  2Z59 A;  1V61 A;  4EJN A;  4YON A;  2Z13 A;  1KZG A;  4A6F A;  1ISN A;  2YT2 A;  3FEH A;  4A6K A;  1UNR A;  4IAP A;  2D9V A;  4L1R A;  3ULB A;  2CRF A;  1DYN A;  2LYD A;  5KCV A;  2HE7 A;  1ZC3 B;  2ELA A;  4HB4 B;  2RVB B;  1PLS A;  2RNR B;  1XD4 A;  3KY9 A;  4IFS A;  1Y5O A;  2I1J A;  2J0M A;  5D27 A;  2P8V A;  1MIZ B;  1X11 A;  1WG7 A;  1ZSQ A;  2D9W A;  2G35 A;  2RLO A;  1RJ2 A;  1OMW A;  1Z87 A;  2L2I A;  4XWX A;  2ROZ B;  3SYX A;  3NWF A;  2Z4D A;  1ZVR A;  4HAY B;  5LG4 B;  1BAK A;  1DDW A;  2NMB A;  4ZRI A;  1V5U A;  3KRW A;  3VOQ A;  2DTC A;  1MK9 B;  3A8P A;  3A8Q A;  4KHA A;  4CHJ A;  2OTX A;  2UZS A;  5I2M A;  2FJL A;  2KGX B;  1TQZ A;  2Q13 A;  3A58 A;  3NSU A;  1FHX A;  4QXA B;  2KIE A;  3ML4 A;  1OQN A;  2DYN A;  1WJM A;  4KHB B;  2YS1 A;  2K2U A;  4HAU B;  5DH9 B;  2ELB A;  5D3X A;  4NSW A;  5LOP B;  2GCJ A;  2R2Y A;  3HW2 B;  5C6R A;  4C0A A;  5D3V A;  3ODX A;  1U5G A;  2Z14 A;  1U5F A;  4HAT B;  2K2J A;  1BTN A;  2DX5 A;  2KUP A;  2P0D A;  3MDB C;  2YF0 A;  1MIX A;  2UZR A;  5DI9 B;  1KI1 B;  2DYQ A;  2D9X A;  3SO6 A;  2DLW A;  1QQG A;  3QWM A;  4GPT B;  2M14 A;  3ODW A;  3AU5 A;  1GG3 A;  5LON B;  2FJU B;  5M4Y B;  2MDX A;  2DFK A;  2N23 A;  3O96 A;  3U7D A;  1GC7 A;  1WJ1 A;  3QBV B;  3PG7 A;  3WA0 A;  5J3Q A;  4H8S A;  1QC6 A;  2COC A;  1OY2 A;  1U27 A;  2JP2 A;  3HK0 A;  2COD A;  2CY5 A;  4HB0 B;  3TCA A;  1M7R A;  3TW1 A;  1V5M A;  1W1D A;  1SGH A;  5C79 A;  1PMS A;  1FGZ A;  2P0F A;  4QJ4 B;  1FGY A;  1P5T A;  1I7A A;  4HAW B;  1X86 A;  4DX8 A;  2J59 M;  2YSZ A;  3T06 A;  4KVG B;  5HE3 A;  1W1H A;  5JP4 A;  2Y7B A;  4EMO A;  1UEF A;  3SUZ A;  5D3Y A;  3IVF A;  2RUK B;  5J3Y A;  2UVM A;  2D9Z A;  2KUQ A;  3ODO A;  3BJI A;  4D6W A;  5C5B B;  4P7I A;  4BBK A;  4Y94 A;  2YT0 A;  1BWN A;  4EKU A;  4K2P A;  4QJ3 B;  2CY4 A;  4NY0 A;  4ZRK A;  4A6H A;  3GYP A;  3WYF B;  3PP2 A;  2DHI A;  2YS5 A;  1FHW A;  2IYB A;  2DHJ A;  2DX1 A;  1E5W A;  1J0W A;  1ZM0 A;  2K00 A;  1BTK A;  2OQB A;  3B77 A;  4YL8 A;  3DXE A;  2KCJ A;  1FB8 A;  1N3H A;  2RSG A;  3LJU X;  4HDQ A;  1MPH A;  5IRS A;  3G9W A;  1FOE A;  3PVU A;  2VSZ A;  4DXA B;  3MPX A;  5JHG A;  4HAV B;  4A5K A;  3PZD A;  2EMT A;  3AJ4 A;  4DIX A;  2MFQ A;  1MI1 A;  5EFX A;  2W2W A;  2D9Y A;  2YS3 A;  4A6F B;  4F7U P;  2M38 A;  2K49 A;  2Z0P A;  2EJ8 A;  3AU4 A;  4MK0 A;  2YVC A;  2AL6 A;  4GXB A;  1W1G A;  2DHK A;  1FAO A;  4GMX B;  3KSY A;  5HE2 A;  5HE0 A;  1WVH A;  2ZKM X;  4F7G A;  1K5D B;  1P6S A;  2Z0O A;  3A98 B;  2K8E A;  3UZT A;  2N0Y A;  3P6A A;  3BIN A;  2EC1 A;  5CLL B;  1Q67 A;  1XOD A;  2R0D A;  3X23 A;  4D0N B;  1UNP A;  3CXB B;  4CHM A;  2COF A;  1EGX A;  1X05 A;  2CAY A;  2I5F A;  1H4R A;  2D11 A;  5HE1 A;  4OT1 A;  1KZ7 A;  5L81 A;  2DN6 A;  4HHV A;  1NTV A;  1NU2 A;  1EF1 A;  1X1G A;  1XCG A;  3OAN A;  5FI0 A;  2DKP A;  3F5R A;  4WJ7 A;  4WSF A;  1K5G B;  1EVH A;  3NW8 A;  3TVV A;  2X18 A;  1UPR A;  4HAX B;  4ZRJ A;  3KRX A;  3CIK A;  3N7C A;  2Y8G A;  2MWN B;  2LOX A;  5JLJ B;  3D8E A;  3P7Z A;  3PSC A;  4GZU A;  2W2X D;  1RRP B;  3HQC A;  4HB2 B;  3NWA A;  2NBV A;  1NTY A;  3TFM A;  4HB3 B;  4Z2M B;  4HAZ B;  3ZDT A; 
#chains in the Genus database with same CATH homology
 2AEH A;  2GCL A;  1V88 A;  3F0W A;  1PFJ A;  2D4Q A;  4K81 A;  1GC6 A;  1P3R A;  3ZVR A;  2DA0 A;  4K17 A;  3SV1 A;  3RCP A;  1U2B A;  2QKM A;  4TYZ A;  4F7H A;  5J3T A;  1V89 A;  5C16 A;  1MAI A;  1MKE A;  2Y8F A;  5GOW B;  5DHA B;  2D2Q A;  5DHF B;  3SNH A;  4IOY X;  2H7E A;  5FI1 A;  1AWE A;  3FM8 C;  1DDV A;  1Y19 B;  3KZ1 A;  2ADZ A;  2J0J A;  4PNK A;  1WGQ A;  4MY6 A;  2YRY A;  4PQ0 A;  5D3W A;  1UPQ A;  1XR0 B;  2PZ1 A;  2GJY A;  4HDO A;  2GS0 A;  3D8D A;  2H7D A;  1U29 A;  5DIF B;  2COA A;  2VKI A;  1WI1 A;  2R09 A;  2ROV A;  4CYE A;  2Z0Q A;  1IRS A;  2ZPY A;  4DBB A;  2P0H A;  1UNQ A;  1XX0 A;  3PVL A;  3U8Z A;  4Z2N A;  4GN1 A;  1DRO A;  1SHC A;  1EAZ A;  2XQN M;  1LW3 A;  4WVF B;  3VIA A;  4KAX B;  5KQ4 A;  2LKO A;  1X1F A;  2J0K A;  3PEG A;  2LOZ A;  3DXD A;  2HTH B;  1TJ6 A;  2D10 A;  2LUL A;  3M1I B;  2MKR A;  4B6H A;  1H10 A;  3FSS A;  2V76 A;  2IFS A;  2E2X A;  5C5B A;  5CLQ B;  1DDM A;  2RGN B;  4L6E A;  4TKN A;  4DX9 0;  4GMV A;  2I1K A;  1I2H A;  1TXD A;  3QIJ A;  1WGU A;  2VRW B;  1B55 A;  1DBH A;  2I5C A;  5KQ1 A;  2W2X C;  1MK7 B;  1XKE A;  4MT7 A;  2EMS A;  2BCJ A;  2YT1 A;  1U5E A;  2NZ8 B;  2DKQ A;  1U5D A;  3D8F A;  4KHO A;  2LG1 A;  3PVW A;  1J19 A;  1M7E A;  3TO1 A;  1NI2 A;  3ULC A;  3V5W A;  1V5P A;  1ZC4 B;  4K2O A;  1LB1 A;  1FHO A;  5JHH A;  3GYO A;  2L1C A;  3DXC A;  2QKL A;  1AQC A;  1V61 A;  4EJN A;  4YON A;  1KZG A;  4A6F A;  1ISN A;  3FEH A;  4A6K A;  1UNR A;  4IAP A;  2D9V A;  3ULB A;  2CRF A;  1DYN A;  2LYD A;  5KCV A;  2HE7 A;  1ZC3 B;  2ELA A;  4HB4 B;  2RVB B;  1PLS A;  2RNR B;  1XD4 A;  3KY9 A;  4IFS A;  1Y5O A;  2I1J A;  2J0M A;  5D27 A;  2P8V A;  1MIZ B;  1X11 A;  1WG7 A;  1ZSQ A;  2D9W A;  2G35 A;  2RLO A;  1RJ2 A;  1OMW A;  1Z87 A;  2L2I A;  4XWX A;  2ROZ B;  3SYX A;  1ZVR A;  4HAY B;  1BAK A;  1DDW A;  2NMB A;  4ZRI A;  1V5U A;  3KRW A;  3VOQ A;  2DTC A;  1MK9 B;  3A8P A;  3A8Q A;  4KHA A;  4CHJ A;  2OTX A;  2UZS A;  2FJL A;  2KGX B;  1TQZ A;  2Q13 A;  3NSU A;  1FHX A;  3ML4 A;  1OQN A;  2DYN A;  1WJM A;  4KHB B;  2YS1 A;  2K2U A;  4HAU B;  5DH9 B;  2ELB A;  5D3X A;  4NSW A;  5LOP B;  2GCJ A;  3HW2 B;  5C6R A;  4C0A A;  5D3V A;  3ODX A;  1U5G A;  1U5F A;  4HAT B;  2K2J A;  1BTN A;  2DX5 A;  2KUP A;  2P0D A;  3MDB C;  2YF0 A;  1MIX A;  2UZR A;  5DI9 B;  1KI1 B;  2DYQ A;  2D9X A;  3SO6 A;  2DLW A;  1QQG A;  3QWM A;  4GPT B;  2M14 A;  3ODW A;  3AU5 A;  1GG3 A;  5LON B;  2MDX A;  2DFK A;  2N23 A;  3O96 A;  3U7D A;  1GC7 A;  1WJ1 A;  3QBV B;  3PG7 A;  3WA0 A;  5J3Q A;  4H8S A;  1QC6 A;  2COC A;  1OY2 A;  1U27 A;  2JP2 A;  3HK0 A;  2COD A;  2CY5 A;  4HB0 B;  3TCA A;  1M7R A;  3TW1 A;  1V5M A;  1W1D A;  1SGH A;  5C79 A;  1PMS A;  1FGZ A;  2P0F A;  1FGY A;  1P5T A;  1I7A A;  4HAW B;  1X86 A;  4DX8 A;  2J59 M;  2YSZ A;  3T06 A;  4KVG B;  5HE3 A;  1W1H A;  5JP4 A;  2Y7B A;  4EMO A;  1UEF A;  3SUZ A;  5D3Y A;  3IVF A;  2RUK B;  5J3Y A;  2UVM A;  2D9Z A;  3ODO A;  3BJI A;  5C5B B;  4P7I A;  4BBK A;  4Y94 A;  2YT0 A;  1BWN A;  4EKU A;  4K2P A;  2CY4 A;  4NY0 A;  4ZRK A;  4A6H A;  3GYP A;  3WYF B;  3PP2 A;  2DHI A;  2YS5 A;  1FHW A;  2IYB A;  2DHJ A;  2DX1 A;  1E5W A;  1J0W A;  1ZM0 A;  2K00 A;  1BTK A;  2OQB A;  4YL8 A;  3DXE A;  2KCJ A;  1FB8 A;  1N3H A;  2RSG A;  3LJU X;  4HDQ A;  1MPH A;  3G9W A;  1FOE A;  3PVU A;  2VSZ A;  4DXA B;  3MPX A;  5JHG A;  4HAV B;  4A5K A;  3PZD A;  2EMT A;  3AJ4 A;  2MFQ A;  5EFX A;  2W2W A;  2D9Y A;  2YS3 A;  4A6F B;  4F7U P;  2M38 A;  2Z0P A;  2EJ8 A;  3AU4 A;  4MK0 A;  2YVC A;  2AL6 A;  4GXB A;  1W1G A;  2DHK A;  1FAO A;  4GMX B;  3KSY A;  5HE2 A;  5HE0 A;  1WVH A;  4F7G A;  1K5D B;  1P6S A;  2Z0O A;  3A98 B;  3UZT A;  2N0Y A;  3P6A A;  3BIN A;  2EC1 A;  5CLL B;  1Q67 A;  1XOD A;  2R0D A;  3X23 A;  4D0N B;  1UNP A;  3CXB B;  4CHM A;  2COF A;  1EGX A;  1X05 A;  2CAY A;  2I5F A;  1H4R A;  2D11 A;  5HE1 A;  1KZ7 A;  5L81 A;  2DN6 A;  4HHV A;  1NTV A;  1NU2 A;  1EF1 A;  1X1G A;  1XCG A;  3OAN A;  5FI0 A;  2DKP A;  3F5R A;  4WJ7 A;  4WSF A;  1K5G B;  1EVH A;  3TVV A;  2X18 A;  1UPR A;  4HAX B;  4ZRJ A;  3KRX A;  3CIK A;  3N7C A;  2Y8G A;  2MWN B;  2LOX A;  5JLJ B;  3D8E A;  3P7Z A;  3PSC A;  4GZU A;  2W2X D;  1RRP B;  3HQC A;  4HB2 B;  1NTY A;  3TFM A;  4HB3 B;  4Z2M B;  4HAZ B;  3ZDT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...