2DKQA

Solution structure of the ptb domain of kiaa1075 protein from human
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
160
structure length
160
Chain Sequence
GSSGSSGMSTAADLLRQGAACSVLYLTSVETESLTGPQAVARASSAALSCSPRPTPAVVHFKVSAQGITLTDNQRKLFFRRHYPVNSITFSSTDPQDRRWTNPDGTTSKIFGFVAKKPGSPWENVCHLFAELDPDQPAGAIVTFITKVLLGQRKSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the PTB domain of KIAA1075 protein from human
rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords KIAA1075 protein
total genus 19
structure length 160
sequence length 160
ec nomenclature
pdb deposition date 2006-04-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08416 PTB Phosphotyrosine-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2dkqA01
2J59M 1DBHA 4HHVA 2GCLA 2QKLA 1M7EA 2EJ8A 1PFJA 3PVWA 4D0NB 4ZRKA 4PNKA 3AU5A 1UPQA 1U29A 3KRXA 2R0DA 1FOEA 4GZUA 3TVVA 2VSZA 2E2XA 3HK0A 4HB0B 2GCJA 2QKMA 3NSUA 4WVFB 2DYQA 1B55A 1I7AA 2ROVA 2Z0OA 3G9WA 1DROA 2DHKA 4DX90 5D27A 1XKEA 3KZ1A 2R09A 2D10A 3A98B 4EMOA 2G35A 2DKPA 1FGYA 2EMTA 2BCJA 2N0YA 4KAXB 1XX0A 3SYXA 1SGHA 1ZVRA 1BWNA 1N3HA 3U8ZA 2Y8GA 3ULBA 4ZRJA 2DX1A 4MK0A 4F7HA 2YS1A 1GC6A 1K5DB 2YVCA 1Z87A 4F7GA 2D2QA 2D9ZA 2XQNM 3PSCA 3ZVRA 2YRYA 1V88A 2ROZB 1BTKA 1W1GA 2KUPA 1OMWA 2V76A 3D8DA 3SV1A 1NI2A 1V89A 2RSGA 1K5GB 1TXDA 5JLJB 3A8QA 2DTCA 2MWNB 2RGNB 1EAZA 2MFQA 5DH9B 2JP2A 4NY0A 1UEFA 2ELBA 5DHAB 4CYEA 1X1GA 2P0FA 1WI1A 3SNHA 4XWXA 1DDWA 2I1KA 2D9WA 1WVHA 4HAUB 1X05A 1U5DA 3M1IB 3WA0A 3ODXA 1KZ7A 2LOZA 5GOWB 1ZC3B 1MK9B 1EF1A 2YT0A 2VKIA 4A6FB 1V5MA 4HAVB 4IAPA 1V5UA 1WJ1A 2IFSA 4HATB 1PMSA 4DXAB 1AQCA 2RNRB 3D8EA 2CAYA 4KHAA 4EKUA 2D4QA 4DX8A 4PQ0A 1FAOA 3WYFB 4BBKA 5JP4A 5FI1A 3QBVB 1XR0B 3ML4A 3TCAA 2D9YA 1FB8A 2H7EA 5CLQB 1MIXA 1J19A 1U2BA 1WGUA 4ZRIA 1X1FA 3MDBC 1RJ2A 2Z0PA 2FJLA 2J0JA 3VOQA 5J3QA 3ULCA 4MT7A 3ODWA 1UPRA 5D3WA 3A8PA 5C16A 4A6KA 2DA0A 2MKRA 1J0WA 3X23A 1UNQA 2K00A 5C5BA 2DYNA 1WGQA 1OQNA 2Y7BA 3QIJA 3DXDA 5KCVA 2MDXA 1FHXA 1XCGA 3V5WA 2M14A 3PG7A 2YT1A 3ZDTA 5D3YA 1MPHA 2K2UA 2W2XD 4IOYX 3D8FA 3DXCA 4A6FA 3N7CA 2NZ8B 2D11A 1EVHA 3O96A 4HDOA 2ELAA 4A5KA 4KHOA 4IFSA 5C6RA 1MAIA 2GJYA 4YL8A 1Q67A 3HQCA 4HDQA 5J3YA 1DDMA 1U5EA 2J0KA 5HE1A 4H8SA 2P0HA 1BAKA 2CY4A 1NTVA 4WJ7A 4C0AA 5J3TA 1EGXA 4CHMA 5HE3A 1U5GA 2CRFA 1RRPB 2HE7A 2AL6A 2H7DA 2ZPYA 3KSYA 1AWEA 2ADZA 3DXEA 1XD4A 5LOPB 1FGZA 2L2IA 1UNPA 1X11A 4P7IA 2RVBB 3FSSA 4NSWA 3SO6A 1UNRA 2LYDA 2UZSA 3PP2A 3P7ZA 2EMSA 5LONB 5DI9B 2DHIA 1ZSQA 3KRWA 5DIFB 4MY6A 5C5BB 5JHHA 3ODOA 2LG1A 1Y5OA 2CY5A 3KY9A 4YONA 5DHFB 2J0MA 3VIAA 2OTXA 1WG7A 2I5CA 4F7UP 4K2OA 2W2XC 4GXBA 2COAA 2EC1A 4A6HA 3QWMA 1MIZB 2RLOA 4HB4B 1W1DA 3F0WA 3LJUX 3FM8C 2KGXB 4K81A 3CXBB 2CODA 3BJIA 5KQ4A 4DBBA 2UVMA 3IVFA 3TFMA 3UZTA 1DDVA 1ZM0A 2HTHB 3MPXA 1M7RA 1U27A 3FEHA 2VRWB 5D3XA 3HW2B 4HAWB 4TKNA 1Y19B 3AJ4A 3PVUA 1PLSA 3PZDA 2D9VA 3OANA 2LKOA 1KI1B 1QC6A 2I1JA 1P6SA 1I2HA 2DFKA 1KZGA 5FI0A 5D3VA 2KCJA 1LW3A 4CHJA 2YS3A 4L6EA 2UZRA 1W1HA 2I5FA 2YSZA 1V61A 4Z2NA 1SHCA 3F5RA 5KQ1A 4WSFA 3GYOA 4GN1A 2OQBA 5CLLB 2Y8FA 2YS5A 4K2PA 1IRSA 4EJNA 3PVLA 2GS0A 4HB3B 1FHWA 4KHBB 3P6AA 2NMBA 5EFXA 4Z2MB 1MKEA 1MK7B 2COCA 1GC7A 4GMVA 1QQGA 4HAYB 2P8VA 2W2WA 2Z0QA 1TJ6A 1ZC4B 1V5PA 1BTNA 4HAZB 3TO1A 1DYNA 4HAXB 1FHOA 3TW1A 3SUZA 2PZ1A 1NU2A 5HE0A 4K17A 2D9XA 1ISNA 2N23A 3PEGA 2L1CA 4GPTB 1LB1A 1E5WA 1GG3A 1U5FA 2DHJA 1XODA 3U7DA 2IYBA 2YF0A 4B6HA 2AEHA 4HB2B 4Y94A 2DN6A 2LULA 2M38A 4TYZA 2DX5A 1OY2A 5C79A 3BINA 1H10A 1TQZA 2K2JA 5L81A 4GMXB 2DLWA 3RCPA 2DKQA 3T06A 2X18A 3GYPA 1NTYA 3CIKA 2P0DA 2RUKB 5JHGA 1WJMA 1P3RA 1P5TA 2LOXA 4KVGB 5HE2A 2Q13A 2COFA 1X86A 3AU4A 1H4RA
chains in the Genus database with same CATH superfamily
2J59M 5IRSA 4HSIA 1DBHA 4HHVA 2GCLA 2QKLA 1M7EA 2EJ8A 1PFJA 3PVWA 4D0NB 4ZRKA 4PNKA 3AU5A 1UPQA 1U29A 3KRXA 2R0DA 1FOEA 4GZUA 3TVVA 2VSZA 2E2XA 5M4YB 3HK0A 4HB0B 2GCJA 2QKMA 3NSUA 4WVFB 2DYQA 1B55A 1I7AA 2ROVA 2Z0OA 3G9WA 1DROA 2DHKA 4DX90 5D27A 1XKEA 3KZ1A 2R09A 2D10A 3A98B 4EMOA 2G35A 2DKPA 1FGYA 3NWAA 2EMTA 2BCJA 2N0YA 2KIGA 4KAXB 1XX0A 3SYXA 1SGHA 1ZVRA 1BWNA 1N3HA 3U8ZA 2Y8GA 3ULBA 2RRFA 4ZRJA 2DX1A 4MK0A 4F7HA 2YS1A 1GC6A 1K5DB 2YVCA 1Z87A 4F7GA 2Z14A 2D2QA 2D9ZA 2XQNM 3PSCA 3ZVRA 2YRYA 1V88A 2ROZB 1BTKA 1W1GA 2KUPA 1OMWA 4KHBA 2V76A 3D8DA 3SV1A 1NI2A 1V89A 2RSGA 1K5GB 1TXDA 5JLJB 3A8QA 2DTCA 2MWNB 2RGNB 1EAZA 2MFQA 5DH9B 2JP2A 4NY0A 1UEFA 2ELBA 5DHAB 4CYEA 1X1GA 2P0FA 1WI1A 3NWDA 3SNHA 4XWXA 1DDWA 2I1KA 2D9WA 1WVHA 4HAUB 1X05A 1U5DA 3M1IB 3WA0A 3ODXA 1KZ7A 2LOZA 5GOWB 1ZC3B 1MK9B 1EF1A 2YT0A 2VKIA 4DIXA 4A6FB 1V5MA 4HAVB 4IAPA 1V5UA 1WJ1A 2IFSA 4HATB 1PMSA 4DXAB 1AQCA 2RNRB 3D8EA 2CAYA 4KHAA 4EKUA 2D4QA 4DX8A 4PQ0A 1FAOA 3WYFB 4BBKA 5JP4A 5FI1A 3QBVB 1XR0B 3ML4A 4QJ3B 3TCAA 2D9YA 1FB8A 2H7EA 5CLQB 1MIXA 1J19A 1U2BA 1WGUA 4ZRIA 1X1FA 3MDBC 1RJ2A 2Z0PA 2FJLA 2J0JA 3VOQA 5J3QA 3ULCA 5LG4B 4MT7A 3ODWA 2KIEA 2YT2A 1UPRA 5D3WA 3A8PA 5C16A 4A6KA 2DA0A 2MKRA 1J0WA 3X23A 4L1RA 1UNQA 2K00A 5C5BA 2DYNA 1WGQA 1OQNA 2Y7BA 3QIJA 4QJ4B 3DXDA 5KCVA 2MDXA 2KR0A 1FHXA 1XCGA 5I2MA 3V5WA 2M14A 3PG7A 2YT1A 3ZDTA 5D3YA 1MPHA 2GUMA 2K2UA 2W2XD 4IOYX 3D8FA 3DXCA 4A6FA 3N7CA 2NZ8B 2D11A 1EVHA 3O96A 4HDOA 2ELAA 4A5KA 4QJ5B 4KHOA 4IFSA 2K8EA 5C6RA 1MAIA 2GJYA 4YL8A 1Q67A 3OHMB 3HQCA 4HDQA 5J3YA 1DDMA 1U5EA 2J0KA 1T77A 3A58A 5HE1A 2P0HA 4H8SA 1BAKA 2CY4A 1NTVA 4WJ7A 4C0AA 5J3TA 1EGXA 4CHMA 5HE3A 2R2YA 1U5GA 2CRFA 1RRPB 2HE7A 2AL6A 2H7DA 2ZPYA 3KSYA 1AWEA 2ADZA 3DXEA 1XD4A 3HSAA 3DCXA 5LOPB 1FGZA 2L2IA 1UNPA 1X11A 4P7IA 2RVBB 3FSSA 4NSWA 3SO6A 3FVCA 1UNRA 2LYDA 2UZSA 3PP2A 3P7ZA 2EMSA 5LONB 5DI9B 2DHIA 1ZSQA 3KRWA 5DIFB 4MY6A 5C5BB 1ZYIA 5JHHA 3ODOA 3HIEA 2LG1A 1Y5OA 2CY5A 3KY9A 4YONA 5DHFB 2J0MA 3VIAA 2OTXA 1WG7A 2I5CA 4F7UP 4K2OA 2W2XC 4GXBA 3NWFA 2COAA 2EC1A 4A6HA 3QWMA 1MIZB 2RLOA 4HB4B 1W1DA 3U12A 3F0WA 3LJUX 3FM8C 2KGXB 4K81A 3CXBB 2CODA 3BJIA 4OSNA 5KQ4A 4DBBA 2UVMA 3IVFA 3TFMA 3UZTA 1DDVA 1ZM0A 2HTHB 3MPXA 1M7RA 1U27A 3FEHA 4GOUA 5I2SA 2VRWB 1MI1A 5D3XA 3HW2B 4HAWB 4TKNA 1Y19B 3AJ4A 3PVUA 1PLSA 3PZDA 2D9VA 2K49A 3OANA 2LKOA 1KI1B 1QC6A 4CSQA 2I1JA 1P6SA 1I2HA 2DFKA 1KZGA 5FI0A 5D3VA 2KCJA 1LW3A 4CHJA 2YS3A 4L6EA 2UZRA 1W1HA 2I5FA 2YSZA 1V61A 4Z2NA 1SHCA 3F5RA 5KQ1A 4WSFA 3GYOA 4GN1A 2OQBA 5CLLB 2Y8FA 2YS5A 4K2PA 1IRSA 4EJNA 3PVLA 2GS0A 4HB3B 1FHWA 4KHBB 2NBVA 3P6AA 2NMBA 5EFXA 4Z2MB 1MKEA 1MK7B 2COCA 1GC7A 4GMVA 1QQGA 3B77A 4GNKB 4HAYB 2P8VA 2W2WA 2Z0QA 1TJ6A 1ZC4B 2Z59A 1V5PA 1BTNA 4HAZB 3TO1A 1DYNA 4HAXB 3NW8A 3TW1A 1FHOA 3SUZA 2PZ1A 1NU2A 5HE0A 4QXAB 4K17A 2Z13A 2D9XA 1ISNA 2N23A 3PEGA 2Z4DA 2ZKMX 2L1CA 4GPTB 1LB1A 1E5WA 1GG3A 1U5FA 2DHJA 2FJUB 1XODA 3U7DA 2IYBA 2YF0A 4B6HA 2AEHA 4HB2B 4Y94A 2DN6A 2LULA 2M38A 4TYZA 2DX5A 4D6WA 1OY2A 5C79A 4OT1A 3BINA 1H10A 1TQZA 2K2JA 5L81A 2KUQA 4GMXB 2DLWA 3RCPA 2DKQA 3T06A 2X18A 3GYPA 1NTYA 3CIKA 2P0DA 2RUKB 5JHGA 1WJMA 1P3RA 1P5TA 2LOXA 4KVGB 5HE2A 2Q13A 2COFA 1X86A 3AU4A 1H4RA
chains in the Genus database with same CATH topology
2J59M 1DBHA 4HHVA 2GCLA 2QKLA 1M7EA 2EJ8A 1PFJA 3PVWA 4D0NB 4ZRKA 4PNKA 3AU5A 1UPQA 1U29A 3KRXA 2R0DA 1FOEA 4GZUA 3TVVA 2VSZA 2E2XA 3HK0A 4HB0B 2GCJA 2QKMA 3NSUA 4WVFB 2DYQA 1B55A 1I7AA 2ROVA 2Z0OA 3G9WA 1DROA 2DHKA 4DX90 5D27A 1XKEA 3KZ1A 2R09A 2D10A 3A98B 4EMOA 2G35A 2DKPA 1FGYA 2EMTA 2BCJA 2N0YA 4KAXB 1XX0A 3SYXA 1SGHA 1ZVRA 1BWNA 1N3HA 3U8ZA 2Y8GA 3ULBA 4ZRJA 2DX1A 4MK0A 4F7HA 2YS1A 1GC6A 1K5DB 2YVCA 1Z87A 4F7GA 2D2QA 2D9ZA 2XQNM 3PSCA 3ZVRA 2YRYA 1V88A 2ROZB 1BTKA 1W1GA 2KUPA 1OMWA 2V76A 3D8DA 3SV1A 1NI2A 1V89A 2RSGA 1K5GB 1TXDA 5JLJB 3A8QA 2DTCA 2MWNB 2RGNB 1EAZA 2MFQA 5DH9B 2JP2A 4NY0A 1UEFA 2ELBA 5DHAB 4CYEA 1X1GA 2P0FA 1WI1A 3SNHA 4XWXA 1DDWA 2I1KA 2D9WA 1WVHA 4HAUB 1X05A 1U5DA 3M1IB 3WA0A 3ODXA 1KZ7A 2LOZA 5GOWB 1ZC3B 1MK9B 1EF1A 2YT0A 2VKIA 4A6FB 1V5MA 4HAVB 4IAPA 1V5UA 1WJ1A 2IFSA 4HATB 1PMSA 4DXAB 1AQCA 2RNRB 3D8EA 2CAYA 4KHAA 4EKUA 2D4QA 4DX8A 4PQ0A 1FAOA 3WYFB 4BBKA 5JP4A 5FI1A 3QBVB 1XR0B 3ML4A 3TCAA 2D9YA 1FB8A 2H7EA 5CLQB 1MIXA 1J19A 1U2BA 1WGUA 4ZRIA 1X1FA 3MDBC 1RJ2A 2Z0PA 2FJLA 2J0JA 3VOQA 5J3QA 3ULCA 4MT7A 3ODWA 1UPRA 5D3WA 3A8PA 5C16A 4A6KA 2DA0A 2MKRA 1J0WA 3X23A 1UNQA 2K00A 5C5BA 2DYNA 1WGQA 1OQNA 2Y7BA 3QIJA 3DXDA 5KCVA 2MDXA 1FHXA 1XCGA 3V5WA 2M14A 3PG7A 2YT1A 3ZDTA 5D3YA 1MPHA 2K2UA 2W2XD 4IOYX 3D8FA 3DXCA 4A6FA 3N7CA 2NZ8B 2D11A 1EVHA 3O96A 4HDOA 2ELAA 4A5KA 4KHOA 4IFSA 5C6RA 1MAIA 2GJYA 4YL8A 1Q67A 3HQCA 4HDQA 5J3YA 1DDMA 1U5EA 2J0KA 5HE1A 4H8SA 2P0HA 1BAKA 2CY4A 1NTVA 4WJ7A 4C0AA 5J3TA 1EGXA 4CHMA 5HE3A 1U5GA 2CRFA 1RRPB 2HE7A 2AL6A 2H7DA 2ZPYA 3KSYA 1AWEA 2ADZA 3DXEA 1XD4A 5LOPB 1FGZA 2L2IA 1UNPA 1X11A 4P7IA 2RVBB 3FSSA 4NSWA 3SO6A 1UNRA 2LYDA 2UZSA 3PP2A 3P7ZA 2EMSA 5LONB 5DI9B 2DHIA 1ZSQA 3KRWA 5DIFB 4MY6A 5C5BB 5JHHA 3ODOA 2LG1A 1Y5OA 2CY5A 3KY9A 4YONA 5DHFB 2J0MA 3VIAA 2OTXA 1WG7A 2I5CA 4F7UP 4K2OA 2W2XC 4GXBA 2COAA 2EC1A 4A6HA 3QWMA 1MIZB 2RLOA 4HB4B 1W1DA 3F0WA 3LJUX 3FM8C 2KGXB 4K81A 3CXBB 2CODA 3BJIA 5KQ4A 4DBBA 2UVMA 3IVFA 3TFMA 3UZTA 1DDVA 1ZM0A 2HTHB 3MPXA 1M7RA 1U27A 3FEHA 2VRWB 5D3XA 3HW2B 4HAWB 4TKNA 1Y19B 3AJ4A 3PVUA 1PLSA 3PZDA 2D9VA 3OANA 2LKOA 1KI1B 1QC6A 2I1JA 1P6SA 1I2HA 2DFKA 1KZGA 5FI0A 5D3VA 2KCJA 1LW3A 4CHJA 2YS3A 4L6EA 2UZRA 1W1HA 2I5FA 2YSZA 1V61A 4Z2NA 1SHCA 3F5RA 5KQ1A 4WSFA 3GYOA 4GN1A 2OQBA 5CLLB 2Y8FA 2YS5A 4K2PA 1IRSA 4EJNA 3PVLA 2GS0A 4HB3B 1FHWA 4KHBB 3P6AA 2NMBA 5EFXA 4Z2MB 1MKEA 1MK7B 2COCA 1GC7A 4GMVA 1QQGA 4HAYB 2P8VA 2W2WA 2Z0QA 1TJ6A 1ZC4B 1V5PA 1BTNA 4HAZB 3TO1A 1DYNA 4HAXB 1FHOA 3TW1A 3SUZA 2PZ1A 1NU2A 5HE0A 4K17A 2D9XA 1ISNA 2N23A 3PEGA 2L1CA 4GPTB 1LB1A 1E5WA 1GG3A 1U5FA 2DHJA 1XODA 3U7DA 2IYBA 2YF0A 4B6HA 2AEHA 4HB2B 4Y94A 2DN6A 2LULA 2M38A 4TYZA 2DX5A 1OY2A 5C79A 3BINA 1H10A 1TQZA 2K2JA 5L81A 4GMXB 2DLWA 3RCPA 2DKQA 3T06A 2X18A 3GYPA 1NTYA 3CIKA 2P0DA 2RUKB 5JHGA 1WJMA 1P3RA 1P5TA 2LOXA 4KVGB 5HE2A 2Q13A 2COFA 1X86A 3AU4A 1H4RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2J59 M;  1DBH A;  4HHV A;  2GCL A;  2QKL A;  1M7E A;  2EJ8 A;  1PFJ A;  3PVW A;  4D0N B;  4ZRK A;  4PNK A;  3AU5 A;  1UPQ A;  1U29 A;  3KRX A;  2R0D A;  1FOE A;  4GZU A;  3TVV A;  2VSZ A;  2E2X A;  3HK0 A;  4HB0 B;  2GCJ A;  2QKM A;  3NSU A;  4WVF B;  2DYQ A;  1B55 A;  1I7A A;  2ROV A;  2Z0O A;  3G9W A;  1DRO A;  2DHK A;  4DX9 0;  5D27 A;  1XKE A;  3KZ1 A;  2R09 A;  2D10 A;  3A98 B;  4EMO A;  2G35 A;  2DKP A;  1FGY A;  2EMT A;  2BCJ A;  2N0Y A;  4KAX B;  1XX0 A;  3SYX A;  1SGH A;  1ZVR A;  1BWN A;  1N3H A;  3U8Z A;  2Y8G A;  3ULB A;  4ZRJ A;  2DX1 A;  4MK0 A;  4F7H A;  2YS1 A;  1GC6 A;  1K5D B;  2YVC A;  1Z87 A;  4F7G A;  2D2Q A;  2D9Z A;  2XQN M;  3PSC A;  3ZVR A;  2YRY A;  1V88 A;  2ROZ B;  1BTK A;  1W1G A;  2KUP A;  1OMW A;  2V76 A;  3D8D A;  3SV1 A;  1NI2 A;  1V89 A;  2RSG A;  1K5G B;  1TXD A;  5JLJ B;  3A8Q A;  2DTC A;  2MWN B;  2RGN B;  1EAZ A;  2MFQ A;  5DH9 B;  2JP2 A;  4NY0 A;  1UEF A;  2ELB A;  5DHA B;  4CYE A;  1X1G A;  2P0F A;  1WI1 A;  3SNH A;  4XWX A;  1DDW A;  2I1K A;  2D9W A;  1WVH A;  4HAU B;  1X05 A;  1U5D A;  3M1I B;  3WA0 A;  3ODX A;  1KZ7 A;  2LOZ A;  5GOW B;  1ZC3 B;  1MK9 B;  1EF1 A;  2YT0 A;  2VKI A;  4A6F B;  1V5M A;  4HAV B;  4IAP A;  1V5U A;  1WJ1 A;  2IFS A;  4HAT B;  1PMS A;  4DXA B;  1AQC A;  2RNR B;  3D8E A;  2CAY A;  4KHA A;  4EKU A;  2D4Q A;  4DX8 A;  4PQ0 A;  1FAO A;  3WYF B;  4BBK A;  5JP4 A;  5FI1 A;  3QBV B;  1XR0 B;  3ML4 A;  3TCA A;  2D9Y A;  1FB8 A;  2H7E A;  5CLQ B;  1MIX A;  1J19 A;  1U2B A;  1WGU A;  4ZRI A;  1X1F A;  3MDB C;  1RJ2 A;  2Z0P A;  2FJL A;  2J0J A;  3VOQ A;  5J3Q A;  3ULC A;  4MT7 A;  3ODW A;  1UPR A;  5D3W A;  3A8P A;  5C16 A;  4A6K A;  2DA0 A;  2MKR A;  1J0W A;  3X23 A;  1UNQ A;  2K00 A;  5C5B A;  2DYN A;  1WGQ A;  1OQN A;  2Y7B A;  3QIJ A;  3DXD A;  5KCV A;  2MDX A;  1FHX A;  1XCG A;  3V5W A;  2M14 A;  3PG7 A;  2YT1 A;  3ZDT A;  5D3Y A;  1MPH A;  2K2U A;  2W2X D;  4IOY X;  3D8F A;  3DXC A;  4A6F A;  3N7C A;  2NZ8 B;  2D11 A;  1EVH A;  3O96 A;  4HDO A;  2ELA A;  4A5K A;  4KHO A;  4IFS A;  5C6R A;  1MAI A;  2GJY A;  4YL8 A;  1Q67 A;  3HQC A;  4HDQ A;  5J3Y A;  1DDM A;  1U5E A;  2J0K A;  5HE1 A;  4H8S A;  2P0H A;  1BAK A;  2CY4 A;  1NTV A;  4WJ7 A;  4C0A A;  5J3T A;  1EGX A;  4CHM A;  5HE3 A;  1U5G A;  2CRF A;  1RRP B;  2HE7 A;  2AL6 A;  2H7D A;  2ZPY A;  3KSY A;  1AWE A;  2ADZ A;  3DXE A;  1XD4 A;  5LOP B;  1FGZ A;  2L2I A;  1UNP A;  1X11 A;  4P7I A;  2RVB B;  3FSS A;  4NSW A;  3SO6 A;  1UNR A;  2LYD A;  2UZS A;  3PP2 A;  3P7Z A;  2EMS A;  5LON B;  5DI9 B;  2DHI A;  1ZSQ A;  3KRW A;  5DIF B;  4MY6 A;  5C5B B;  5JHH A;  3ODO A;  2LG1 A;  1Y5O A;  2CY5 A;  3KY9 A;  4YON A;  5DHF B;  2J0M A;  3VIA A;  2OTX A;  1WG7 A;  2I5C A;  4F7U P;  4K2O A;  2W2X C;  4GXB A;  2COA A;  2EC1 A;  4A6H A;  3QWM A;  1MIZ B;  2RLO A;  4HB4 B;  1W1D A;  3F0W A;  3LJU X;  3FM8 C;  2KGX B;  4K81 A;  3CXB B;  2COD A;  3BJI A;  5KQ4 A;  4DBB A;  2UVM A;  3IVF A;  3TFM A;  3UZT A;  1DDV A;  1ZM0 A;  2HTH B;  3MPX A;  1M7R A;  1U27 A;  3FEH A;  2VRW B;  5D3X A;  3HW2 B;  4HAW B;  4TKN A;  1Y19 B;  3AJ4 A;  3PVU A;  1PLS A;  3PZD A;  2D9V A;  3OAN A;  2LKO A;  1KI1 B;  1QC6 A;  2I1J A;  1P6S A;  1I2H A;  2DFK A;  1KZG A;  5FI0 A;  5D3V A;  2KCJ A;  1LW3 A;  4CHJ A;  2YS3 A;  4L6E A;  2UZR A;  1W1H A;  2I5F A;  2YSZ A;  1V61 A;  4Z2N A;  1SHC A;  3F5R A;  5KQ1 A;  4WSF A;  3GYO A;  4GN1 A;  2OQB A;  5CLL B;  2Y8F A;  2YS5 A;  4K2P A;  1IRS A;  4EJN A;  3PVL A;  2GS0 A;  4HB3 B;  1FHW A;  4KHB B;  3P6A A;  2NMB A;  5EFX A;  4Z2M B;  1MKE A;  1MK7 B;  2COC A;  1GC7 A;  4GMV A;  1QQG A;  4HAY B;  2P8V A;  2W2W A;  2Z0Q A;  1TJ6 A;  1ZC4 B;  1V5P A;  1BTN A;  4HAZ B;  3TO1 A;  1DYN A;  4HAX B;  1FHO A;  3TW1 A;  3SUZ A;  2PZ1 A;  1NU2 A;  5HE0 A;  4K17 A;  2D9X A;  1ISN A;  2N23 A;  3PEG A;  2L1C A;  4GPT B;  1LB1 A;  1E5W A;  1GG3 A;  1U5F A;  2DHJ A;  1XOD A;  3U7D A;  2IYB A;  2YF0 A;  4B6H A;  2AEH A;  4HB2 B;  4Y94 A;  2DN6 A;  2LUL A;  2M38 A;  4TYZ A;  2DX5 A;  1OY2 A;  5C79 A;  3BIN A;  1H10 A;  1TQZ A;  2K2J A;  5L81 A;  4GMX B;  2DLW A;  3RCP A;  2DKQ A;  3T06 A;  2X18 A;  3GYP A;  1NTY A;  3CIK A;  2P0D A;  2RUK B;  5JHG A;  1WJM A;  1P3R A;  1P5T A;  2LOX A;  4KVG B;  5HE2 A;  2Q13 A;  2COF A;  1X86 A;  3AU4 A;  1H4R A; 
#chains in the Genus database with same CATH topology
 2J59 M;  5IRS A;  4HSI A;  1DBH A;  4HHV A;  2GCL A;  2QKL A;  1M7E A;  2EJ8 A;  1PFJ A;  3PVW A;  4D0N B;  4ZRK A;  4PNK A;  3AU5 A;  1UPQ A;  1U29 A;  3KRX A;  2R0D A;  1FOE A;  4GZU A;  3TVV A;  2VSZ A;  2E2X A;  5M4Y B;  3HK0 A;  4HB0 B;  2GCJ A;  2QKM A;  3NSU A;  4WVF B;  2DYQ A;  1B55 A;  1I7A A;  2ROV A;  2Z0O A;  3G9W A;  1DRO A;  2DHK A;  4DX9 0;  5D27 A;  1XKE A;  3KZ1 A;  2R09 A;  2D10 A;  3A98 B;  4EMO A;  2G35 A;  2DKP A;  1FGY A;  3NWA A;  2EMT A;  2BCJ A;  2N0Y A;  2KIG A;  4KAX B;  1XX0 A;  3SYX A;  1SGH A;  1ZVR A;  1BWN A;  1N3H A;  3U8Z A;  2Y8G A;  3ULB A;  2RRF A;  4ZRJ A;  2DX1 A;  4MK0 A;  4F7H A;  2YS1 A;  1GC6 A;  1K5D B;  2YVC A;  1Z87 A;  4F7G A;  2Z14 A;  2D2Q A;  2D9Z A;  2XQN M;  3PSC A;  3ZVR A;  2YRY A;  1V88 A;  2ROZ B;  1BTK A;  1W1G A;  2KUP A;  1OMW A;  4KHB A;  2V76 A;  3D8D A;  3SV1 A;  1NI2 A;  1V89 A;  2RSG A;  1K5G B;  1TXD A;  5JLJ B;  3A8Q A;  2DTC A;  2MWN B;  2RGN B;  1EAZ A;  2MFQ A;  5DH9 B;  2JP2 A;  4NY0 A;  1UEF A;  2ELB A;  5DHA B;  4CYE A;  1X1G A;  2P0F A;  1WI1 A;  3NWD A;  3SNH A;  4XWX A;  1DDW A;  2I1K A;  2D9W A;  1WVH A;  4HAU B;  1X05 A;  1U5D A;  3M1I B;  3WA0 A;  3ODX A;  1KZ7 A;  2LOZ A;  5GOW B;  1ZC3 B;  1MK9 B;  1EF1 A;  2YT0 A;  2VKI A;  4DIX A;  4A6F B;  1V5M A;  4HAV B;  4IAP A;  1V5U A;  1WJ1 A;  2IFS A;  4HAT B;  1PMS A;  4DXA B;  1AQC A;  2RNR B;  3D8E A;  2CAY A;  4KHA A;  4EKU A;  2D4Q A;  4DX8 A;  4PQ0 A;  1FAO A;  3WYF B;  4BBK A;  5JP4 A;  5FI1 A;  3QBV B;  1XR0 B;  3ML4 A;  4QJ3 B;  3TCA A;  2D9Y A;  1FB8 A;  2H7E A;  5CLQ B;  1MIX A;  1J19 A;  1U2B A;  1WGU A;  4ZRI A;  1X1F A;  3MDB C;  1RJ2 A;  2Z0P A;  2FJL A;  2J0J A;  3VOQ A;  5J3Q A;  3ULC A;  5LG4 B;  4MT7 A;  3ODW A;  2KIE A;  2YT2 A;  1UPR A;  5D3W A;  3A8P A;  5C16 A;  4A6K A;  2DA0 A;  2MKR A;  1J0W A;  3X23 A;  4L1R A;  1UNQ A;  2K00 A;  5C5B A;  2DYN A;  1WGQ A;  1OQN A;  2Y7B A;  3QIJ A;  4QJ4 B;  3DXD A;  5KCV A;  2MDX A;  2KR0 A;  1FHX A;  1XCG A;  5I2M A;  3V5W A;  2M14 A;  3PG7 A;  2YT1 A;  3ZDT A;  5D3Y A;  1MPH A;  2GUM A;  2K2U A;  2W2X D;  4IOY X;  3D8F A;  3DXC A;  4A6F A;  3N7C A;  2NZ8 B;  2D11 A;  1EVH A;  3O96 A;  4HDO A;  2ELA A;  4A5K A;  4QJ5 B;  4KHO A;  4IFS A;  2K8E A;  5C6R A;  1MAI A;  2GJY A;  4YL8 A;  1Q67 A;  3OHM B;  3HQC A;  4HDQ A;  5J3Y A;  1DDM A;  1U5E A;  2J0K A;  1T77 A;  3A58 A;  5HE1 A;  2P0H A;  4H8S A;  1BAK A;  2CY4 A;  1NTV A;  4WJ7 A;  4C0A A;  5J3T A;  1EGX A;  4CHM A;  5HE3 A;  2R2Y A;  1U5G A;  2CRF A;  1RRP B;  2HE7 A;  2AL6 A;  2H7D A;  2ZPY A;  3KSY A;  1AWE A;  2ADZ A;  3DXE A;  1XD4 A;  3HSA A;  3DCX A;  5LOP B;  1FGZ A;  2L2I A;  1UNP A;  1X11 A;  4P7I A;  2RVB B;  3FSS A;  4NSW A;  3SO6 A;  3FVC A;  1UNR A;  2LYD A;  2UZS A;  3PP2 A;  3P7Z A;  2EMS A;  5LON B;  5DI9 B;  2DHI A;  1ZSQ A;  3KRW A;  5DIF B;  4MY6 A;  5C5B B;  1ZYI A;  5JHH A;  3ODO A;  3HIE A;  2LG1 A;  1Y5O A;  2CY5 A;  3KY9 A;  4YON A;  5DHF B;  2J0M A;  3VIA A;  2OTX A;  1WG7 A;  2I5C A;  4F7U P;  4K2O A;  2W2X C;  4GXB A;  3NWF A;  2COA A;  2EC1 A;  4A6H A;  3QWM A;  1MIZ B;  2RLO A;  4HB4 B;  1W1D A;  3U12 A;  3F0W A;  3LJU X;  3FM8 C;  2KGX B;  4K81 A;  3CXB B;  2COD A;  3BJI A;  4OSN A;  5KQ4 A;  4DBB A;  2UVM A;  3IVF A;  3TFM A;  3UZT A;  1DDV A;  1ZM0 A;  2HTH B;  3MPX A;  1M7R A;  1U27 A;  3FEH A;  4GOU A;  5I2S A;  2VRW B;  1MI1 A;  5D3X A;  3HW2 B;  4HAW B;  4TKN A;  1Y19 B;  3AJ4 A;  3PVU A;  1PLS A;  3PZD A;  2D9V A;  2K49 A;  3OAN A;  2LKO A;  1KI1 B;  1QC6 A;  4CSQ A;  2I1J A;  1P6S A;  1I2H A;  2DFK A;  1KZG A;  5FI0 A;  5D3V A;  2KCJ A;  1LW3 A;  4CHJ A;  2YS3 A;  4L6E A;  2UZR A;  1W1H A;  2I5F A;  2YSZ A;  1V61 A;  4Z2N A;  1SHC A;  3F5R A;  5KQ1 A;  4WSF A;  3GYO A;  4GN1 A;  2OQB A;  5CLL B;  2Y8F A;  2YS5 A;  4K2P A;  1IRS A;  4EJN A;  3PVL A;  2GS0 A;  4HB3 B;  1FHW A;  4KHB B;  2NBV A;  3P6A A;  2NMB A;  5EFX A;  4Z2M B;  1MKE A;  1MK7 B;  2COC A;  1GC7 A;  4GMV A;  1QQG A;  3B77 A;  4GNK B;  4HAY B;  2P8V A;  2W2W A;  2Z0Q A;  1TJ6 A;  1ZC4 B;  2Z59 A;  1V5P A;  1BTN A;  4HAZ B;  3TO1 A;  1DYN A;  4HAX B;  3NW8 A;  3TW1 A;  1FHO A;  3SUZ A;  2PZ1 A;  1NU2 A;  5HE0 A;  4QXA B;  4K17 A;  2Z13 A;  2D9X A;  1ISN A;  2N23 A;  3PEG A;  2Z4D A;  2ZKM X;  2L1C A;  4GPT B;  1LB1 A;  1E5W A;  1GG3 A;  1U5F A;  2DHJ A;  2FJU B;  1XOD A;  3U7D A;  2IYB A;  2YF0 A;  4B6H A;  2AEH A;  4HB2 B;  4Y94 A;  2DN6 A;  2LUL A;  2M38 A;  4TYZ A;  2DX5 A;  4D6W A;  1OY2 A;  5C79 A;  4OT1 A;  3BIN A;  1H10 A;  1TQZ A;  2K2J A;  5L81 A;  2KUQ A;  4GMX B;  2DLW A;  3RCP A;  2DKQ A;  3T06 A;  2X18 A;  3GYP A;  1NTY A;  3CIK A;  2P0D A;  2RUK B;  5JHG A;  1WJM A;  1P3R A;  1P5T A;  2LOX A;  4KVG B;  5HE2 A;  2Q13 A;  2COF A;  1X86 A;  3AU4 A;  1H4R A; 
#chains in the Genus database with same CATH homology
 2J59 M;  1DBH A;  4HHV A;  2GCL A;  2QKL A;  1M7E A;  2EJ8 A;  1PFJ A;  3PVW A;  4D0N B;  4ZRK A;  4PNK A;  3AU5 A;  1UPQ A;  1U29 A;  3KRX A;  2R0D A;  1FOE A;  4GZU A;  3TVV A;  2VSZ A;  2E2X A;  3HK0 A;  4HB0 B;  2GCJ A;  2QKM A;  3NSU A;  4WVF B;  2DYQ A;  1B55 A;  1I7A A;  2ROV A;  2Z0O A;  3G9W A;  1DRO A;  2DHK A;  4DX9 0;  5D27 A;  1XKE A;  3KZ1 A;  2R09 A;  2D10 A;  3A98 B;  4EMO A;  2G35 A;  2DKP A;  1FGY A;  2EMT A;  2BCJ A;  2N0Y A;  4KAX B;  1XX0 A;  3SYX A;  1SGH A;  1ZVR A;  1BWN A;  1N3H A;  3U8Z A;  2Y8G A;  3ULB A;  4ZRJ A;  2DX1 A;  4MK0 A;  4F7H A;  2YS1 A;  1GC6 A;  1K5D B;  2YVC A;  1Z87 A;  4F7G A;  2D2Q A;  2D9Z A;  2XQN M;  3PSC A;  3ZVR A;  2YRY A;  1V88 A;  2ROZ B;  1BTK A;  1W1G A;  2KUP A;  1OMW A;  2V76 A;  3D8D A;  3SV1 A;  1NI2 A;  1V89 A;  2RSG A;  1K5G B;  1TXD A;  5JLJ B;  3A8Q A;  2DTC A;  2MWN B;  2RGN B;  1EAZ A;  2MFQ A;  5DH9 B;  2JP2 A;  4NY0 A;  1UEF A;  2ELB A;  5DHA B;  4CYE A;  1X1G A;  2P0F A;  1WI1 A;  3SNH A;  4XWX A;  1DDW A;  2I1K A;  2D9W A;  1WVH A;  4HAU B;  1X05 A;  1U5D A;  3M1I B;  3WA0 A;  3ODX A;  1KZ7 A;  2LOZ A;  5GOW B;  1ZC3 B;  1MK9 B;  1EF1 A;  2YT0 A;  2VKI A;  4A6F B;  1V5M A;  4HAV B;  4IAP A;  1V5U A;  1WJ1 A;  2IFS A;  4HAT B;  1PMS A;  4DXA B;  1AQC A;  2RNR B;  3D8E A;  2CAY A;  4KHA A;  4EKU A;  2D4Q A;  4DX8 A;  4PQ0 A;  1FAO A;  3WYF B;  4BBK A;  5JP4 A;  5FI1 A;  3QBV B;  1XR0 B;  3ML4 A;  3TCA A;  2D9Y A;  1FB8 A;  2H7E A;  5CLQ B;  1MIX A;  1J19 A;  1U2B A;  1WGU A;  4ZRI A;  1X1F A;  3MDB C;  1RJ2 A;  2Z0P A;  2FJL A;  2J0J A;  3VOQ A;  5J3Q A;  3ULC A;  4MT7 A;  3ODW A;  1UPR A;  5D3W A;  3A8P A;  5C16 A;  4A6K A;  2DA0 A;  2MKR A;  1J0W A;  3X23 A;  1UNQ A;  2K00 A;  5C5B A;  2DYN A;  1WGQ A;  1OQN A;  2Y7B A;  3QIJ A;  3DXD A;  5KCV A;  2MDX A;  1FHX A;  1XCG A;  3V5W A;  2M14 A;  3PG7 A;  2YT1 A;  3ZDT A;  5D3Y A;  1MPH A;  2K2U A;  2W2X D;  4IOY X;  3D8F A;  3DXC A;  4A6F A;  3N7C A;  2NZ8 B;  2D11 A;  1EVH A;  3O96 A;  4HDO A;  2ELA A;  4A5K A;  4KHO A;  4IFS A;  5C6R A;  1MAI A;  2GJY A;  4YL8 A;  1Q67 A;  3HQC A;  4HDQ A;  5J3Y A;  1DDM A;  1U5E A;  2J0K A;  5HE1 A;  4H8S A;  2P0H A;  1BAK A;  2CY4 A;  1NTV A;  4WJ7 A;  4C0A A;  5J3T A;  1EGX A;  4CHM A;  5HE3 A;  1U5G A;  2CRF A;  1RRP B;  2HE7 A;  2AL6 A;  2H7D A;  2ZPY A;  3KSY A;  1AWE A;  2ADZ A;  3DXE A;  1XD4 A;  5LOP B;  1FGZ A;  2L2I A;  1UNP A;  1X11 A;  4P7I A;  2RVB B;  3FSS A;  4NSW A;  3SO6 A;  1UNR A;  2LYD A;  2UZS A;  3PP2 A;  3P7Z A;  2EMS A;  5LON B;  5DI9 B;  2DHI A;  1ZSQ A;  3KRW A;  5DIF B;  4MY6 A;  5C5B B;  5JHH A;  3ODO A;  2LG1 A;  1Y5O A;  2CY5 A;  3KY9 A;  4YON A;  5DHF B;  2J0M A;  3VIA A;  2OTX A;  1WG7 A;  2I5C A;  4F7U P;  4K2O A;  2W2X C;  4GXB A;  2COA A;  2EC1 A;  4A6H A;  3QWM A;  1MIZ B;  2RLO A;  4HB4 B;  1W1D A;  3F0W A;  3LJU X;  3FM8 C;  2KGX B;  4K81 A;  3CXB B;  2COD A;  3BJI A;  5KQ4 A;  4DBB A;  2UVM A;  3IVF A;  3TFM A;  3UZT A;  1DDV A;  1ZM0 A;  2HTH B;  3MPX A;  1M7R A;  1U27 A;  3FEH A;  2VRW B;  5D3X A;  3HW2 B;  4HAW B;  4TKN A;  1Y19 B;  3AJ4 A;  3PVU A;  1PLS A;  3PZD A;  2D9V A;  3OAN A;  2LKO A;  1KI1 B;  1QC6 A;  2I1J A;  1P6S A;  1I2H A;  2DFK A;  1KZG A;  5FI0 A;  5D3V A;  2KCJ A;  1LW3 A;  4CHJ A;  2YS3 A;  4L6E A;  2UZR A;  1W1H A;  2I5F A;  2YSZ A;  1V61 A;  4Z2N A;  1SHC A;  3F5R A;  5KQ1 A;  4WSF A;  3GYO A;  4GN1 A;  2OQB A;  5CLL B;  2Y8F A;  2YS5 A;  4K2P A;  1IRS A;  4EJN A;  3PVL A;  2GS0 A;  4HB3 B;  1FHW A;  4KHB B;  3P6A A;  2NMB A;  5EFX A;  4Z2M B;  1MKE A;  1MK7 B;  2COC A;  1GC7 A;  4GMV A;  1QQG A;  4HAY B;  2P8V A;  2W2W A;  2Z0Q A;  1TJ6 A;  1ZC4 B;  1V5P A;  1BTN A;  4HAZ B;  3TO1 A;  1DYN A;  4HAX B;  1FHO A;  3TW1 A;  3SUZ A;  2PZ1 A;  1NU2 A;  5HE0 A;  4K17 A;  2D9X A;  1ISN A;  2N23 A;  3PEG A;  2L1C A;  4GPT B;  1LB1 A;  1E5W A;  1GG3 A;  1U5F A;  2DHJ A;  1XOD A;  3U7D A;  2IYB A;  2YF0 A;  4B6H A;  2AEH A;  4HB2 B;  4Y94 A;  2DN6 A;  2LUL A;  2M38 A;  4TYZ A;  2DX5 A;  1OY2 A;  5C79 A;  3BIN A;  1H10 A;  1TQZ A;  2K2J A;  5L81 A;  4GMX B;  2DLW A;  3RCP A;  2DKQ A;  3T06 A;  2X18 A;  3GYP A;  1NTY A;  3CIK A;  2P0D A;  2RUK B;  5JHG A;  1WJM A;  1P3R A;  1P5T A;  2LOX A;  4KVG B;  5HE2 A;  2Q13 A;  2COF A;  1X86 A;  3AU4 A;  1H4R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...