5J3TA

Crystal structure of s. pombe dcp2:dcp1:edc1 mrna decapping complex
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
126
structure length
126
Chain Sequence
EDENILRNAVNLQVLKFHYPEIESIIDIASHVAVYQFDVGSQKWLKTSIEGTFFLVKDQRARVGYVILNRNSPENLYLFINHPSNVHLVDRYLIHRTENQHVVGLWMFDPNDMSRIFNIVKESLLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords mRNA-decapping enzyme subunit 1
publication title Structure of the Dcp2-Dcp1 mRNA-decapping complex in the activated conformation.
pubmed doi rcsb
source organism Schizosaccharomyces pombe
total genus 31
structure length 126
sequence length 126
ec nomenclature
pdb deposition date 2016-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06058 DCP1 Dcp1-like decapping family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 5j3tA00
4PNKA 2MDXA 2DA0A 2DHIA 2Z0QA 1ZC4B 4EJNA 5L81A 2XQNM 4TKNA 5HE2A 1I7AA 4WVFB 5DI9B 5JHGA 4XWXA 1IRSA 2RUKB 1EGXA 4F7GA 5C16A 2D9VA 2D4QA 1V5PA 2P0HA 1Q67A 1UPRA 2P0FA 2PZ1A 1LB1A 3AU5A 2COFA 3A98B 3M1IB 2J0MA 5KQ4A 2YT1A 3T06A 3UZTA 3TO1A 5C5BA 4IAPA 5HE1A 1MIZB 3PP2A 1QC6A 1WGUA 4Z2NA 2COCA 1XKEA 2ELBA 1RJ2A 4IOYX 4PQ0A 2Z0OA 3PZDA 2DHKA 3TFMA 4HAYB 3PVWA 2QKMA 2W2WA 1SHCA 3DXEA 2H7EA 1ZVRA 4K81A 4KAXB 3PG7A 2UZRA 3KRXA 1PMSA 1BAKA 3KSYA 5JHHA 3BJIA 1I2HA 2G35A 2LYDA 3FEHA 3V5WA 2VRWB 3KY9A 4EMOA 4MT7A 1UNQA 4K17A 1WVHA 1XD4A 1OQNA 2DX5A 1FB8A 1MK7B 2NZ8B 3PEGA 4YONA 3HK0A 2YS1A 4A6FB 1DYNA 2YF0A 1X86A 3P6AA 2Y7BA 4NY0A 1MPHA 1PLSA 4H8SA 3DXDA 1X05A 4GZUA 1NTVA 3HW2B 4HDOA 2COAA 1U5DA 2D2QA 2Y8FA 4HAXB 3FSSA 4F7HA 1AWEA 2H7DA 1WJ1A 2FJLA 2LOXA 1M7EA 1P5TA 2D11A 3MDBC 4WSFA 1DDVA 1RRPB 2UVMA 2DYNA 1Y19B 4HAUB 2ROZB 3SYXA 4GN1A 1FOEA 2YSZA 2LULA 3A8QA 1GC6A 2X18A 1AQCA 5CLLB 2I1KA 3D8EA 3ULCA 4GMVA 2I5FA 1BWNA 3LJUX 1K5GB 4Z2MB 3NSUA 1DBHA 3ODXA 2YS5A 4HB3B 1DDWA 5JLJB 1FHOA 4HB0B 2K2UA 1FHXA 3U8ZA 1BTNA 2IFSA 4GMXB 2RGNB 1FAOA 3F5RA 5DHFB 4K2PA 2I5CA 1W1HA 3TW1A 4ZRIA 2ZPYA 1Y5OA 2DLWA 2RLOA 1TXDA 1UEFA 2OTXA 3BINA 4HDQA 2D9WA 2J0KA 1DROA 3MPXA 4KHBB 1EVHA 3PVLA 2K2JA 2YT0A 2W2XD 1GC7A 3CIKA 2M38A 5D3WA 1U5GA 2DKQA 4KHAA 2V76A 1LW3A 1U5EA 1ZM0A 1FGZA 3ODWA 1ISNA 3CXBB 1XX0A 2Z0PA 1SGHA 5J3YA 3FM8C 1KI1B 4YL8A 1K5DB 2HTHB 2L1CA 5D3XA 2JP2A 2BCJA 3N7CA 5C6RA 2K00A 3TCAA 2R09A 2YS3A 2KUPA 5J3TA 1W1DA 2DYQA 2CAYA 2EC1A 2Y8GA 1J0WA 2LKOA 3D8FA 1U27A 2MKRA 1B55A 3GYOA 1N3HA 3QBVB 1UNRA 2UZSA 1P3RA 1PFJA 1Z87A 1X1FA 3WA0A 2L2IA 2DTCA 1ZC3B 5D3YA 1V5MA 2N0YA 2CODA 1WI1A 3U7DA 4HAVB 1KZGA 4GXBA 1WG7A 5D3VA 4WJ7A 2EMTA 5CLQB 3A8PA 5FI0A 2YVCA 2NMBA 3OANA 5C5BB 4F7UP 3SNHA 1U5FA 2P0DA 4NSWA 2GJYA 2AL6A 2GS0A 2OQBA 1XCGA 5C79A 4HB2B 3SV1A 3VOQA 4DXAB 3ML4A 3IVFA 2ELAA 1UPQA 2IYBA 1J19A 3ZDTA 1WGQA 2RVBB 2DFKA 2RNRB 5EFXA 2HE7A 3TVVA 1V5UA 3DXCA 3P7ZA 4HATB 5LONB 2YRYA 2VKIA 2R0DA 4KHOA 3PVUA 4D0NB 4DX8A 2RSGA 1FHWA 3AU4A 4GPTB 4A6KA 4HAZB 1XR0B 1MIXA 4A6FA 1NTYA 5GOWB 1X1GA 2ROVA 4ZRJA 3WYFB 2KCJA 5FI1A 1NI2A 2D9XA 3ODOA 3AJ4A 2D9YA 2CY5A 2AEHA 1H4RA 2QKLA 4EKUA 3VIAA 5D27A 4P7IA 2MWNB 2EJ8A 3ULBA 3KRWA 4C0AA 1V61A 3ZVRA 4HHVA 5KCVA 1V88A 2GCJA 1GG3A 4K2OA 4CHMA 4MK0A 2D9ZA 5KQ1A 2VSZA 3X23A 3QWMA 1ZSQA 3D8DA 4A6HA 1U29A 5DHAB 2P8VA 1TQZA 4DX90 1M7RA 1H10A 4ZRKA 3KZ1A 3SUZA 5HE3A 4A5KA 2W2XC 1EF1A 1E5WA 2D10A 2I1JA 1W1GA 1KZ7A 4MY6A 4CHJA 4Y94A 4KVGB 2KGXB 2J59M 2E2XA 5J3QA 2GCLA 2DHJA 2ADZA 1V89A 2DX1A 1TJ6A 3QIJA 2LOZA 1MKEA 2CY4A 1MAIA 2J0JA 2N23A 3HQCA 1OY2A 2M14A 1UNPA 1QQGA 4HB4B 1P6SA 2Q13A 5LOPB 1FGYA 1OMWA 3G9WA 1MK9B 2LG1A 3O96A 1X11A 4HAWB 4DBBA 3F0WA 1U2BA 1EAZA 5DIFB 5HE0A 2EMSA 4IFSA 5DH9B 1DDMA 3PSCA 3RCPA 2DKPA 3GYPA 2MFQA 2CRFA 3SO6A 5JP4A 1BTKA 2DN6A 1XODA 4B6HA 4L6EA 1NU2A 4TYZA 4CYEA 4BBKA 1WJMA
chains in the Genus database with same CATH superfamily
4PNKA 2MDXA 3FVCA 2DA0A 2DHIA 2Z0QA 1ZC4B 4EJNA 5L81A 2XQNM 4TKNA 5HE2A 3HIEA 1I7AA 4WVFB 2Z14A 5DI9B 5JHGA 4XWXA 1IRSA 2RUKB 1EGXA 4F7GA 5C16A 2D9VA 2D4QA 1V5PA 2P0HA 1Q67A 1UPRA 2P0FA 2PZ1A 1LB1A 3AU5A 2COFA 3A98B 3M1IB 5LG4B 2J0MA 5KQ4A 2YT1A 3T06A 3UZTA 3TO1A 5C5BA 4IAPA 5HE1A 1MIZB 3PP2A 1QC6A 4DIXA 1WGUA 4Z2NA 2COCA 1XKEA 2ELBA 1RJ2A 4IOYX 2KIEA 4PQ0A 2Z0OA 3PZDA 2DHKA 3HSAA 3TFMA 4HAYB 2K8EA 4CSQA 3PVWA 2QKMA 2W2WA 1SHCA 3DXEA 2H7EA 3OHMB 1ZVRA 4K81A 4KAXB 2UZRA 3PG7A 3KRXA 1PMSA 1BAKA 3KSYA 5JHHA 3BJIA 1I2HA 2G35A 2LYDA 3FEHA 3V5WA 2VRWB 3KY9A 4EMOA 4MT7A 1UNQA 4K17A 1WVHA 1XD4A 1OQNA 2DX5A 1FB8A 1MK7B 2NZ8B 3PEGA 4YONA 3HK0A 2YS1A 2KIGA 4QJ3B 4A6FB 1DYNA 2YF0A 1X86A 3P6AA 2Y7BA 4NY0A 1MPHA 1PLSA 4H8SA 3DXDA 1X05A 4GZUA 1NTVA 3HW2B 4HDOA 2COAA 1U5DA 2YT2A 2D2QA 4HSIA 2Y8FA 4HAXB 3FSSA 4QJ5B 4F7HA 1AWEA 2H7DA 1WJ1A 2FJLA 2LOXA 1M7EA 1P5TA 2D11A 3MDBC 4WSFA 1DDVA 1RRPB 2UVMA 2DYNA 1Y19B 4HAUB 2ROZB 3SYXA 2GUMA 4GN1A 1FOEA 2YSZA 2LULA 3A8QA 1GC6A 2X18A 1AQCA 5CLLB 2I1KA 3D8EA 3ULCA 4GMVA 2I5FA 1BWNA 3LJUX 1K5GB 4Z2MB 3NSUA 1DBHA 3ODXA 2YS5A 4HB3B 1DDWA 5JLJB 1FHOA 4HB0B 2K2UA 1FHXA 3U8ZA 5I2MA 1BTNA 2IFSA 4GMXB 2RGNB 1FAOA 3F5RA 5DHFB 4K2PA 2I5CA 1W1HA 3TW1A 4ZRIA 5IRSA 2ZPYA 1Y5OA 2DLWA 2RLOA 1TXDA 1UEFA 2OTXA 3BINA 4HDQA 2D9WA 2J0KA 1DROA 3MPXA 2NBVA 4KHBB 1EVHA 3PVLA 2K2JA 2YT0A 2W2XD 1GC7A 3CIKA 2M38A 5D3WA 1U5GA 2DKQA 4KHAA 2V76A 1LW3A 1U5EA 1ZM0A 1FGZA 3ODWA 1ISNA 3CXBB 1XX0A 2Z0PA 3DCXA 1SGHA 5J3YA 3FM8C 1KI1B 4YL8A 1K5DB 2HTHB 2L1CA 5D3XA 2JP2A 2R2YA 3A58A 2BCJA 3N7CA 5C6RA 2K00A 3TCAA 2R09A 2YS3A 2KUPA 5J3TA 1W1DA 2DYQA 2CAYA 2EC1A 2Y8GA 1J0WA 2LKOA 3D8FA 1U27A 4QXAB 2KUQA 2MKRA 1B55A 3GYOA 1N3HA 3QBVB 1UNRA 2UZSA 4QJ4B 1P3RA 1PFJA 1Z87A 1X1FA 3WA0A 2L2IA 2DTCA 1ZC3B 2Z59A 5D3YA 1V5MA 2N0YA 2CODA 1WI1A 3U7DA 5I2SA 4HAVB 1KZGA 4GXBA 1WG7A 5D3VA 4WJ7A 2EMTA 5CLQB 3A8PA 5FI0A 2YVCA 2NMBA 3OANA 5C5BB 4F7UP 3SNHA 1U5FA 2P0DA 4NSWA 2GJYA 2AL6A 2GS0A 2OQBA 1XCGA 5C79A 4HB2B 3SV1A 3VOQA 4DXAB 3ML4A 3IVFA 3B77A 2ELAA 1UPQA 2IYBA 2Z13A 1J19A 3ZDTA 1WGQA 2RVBB 2DFKA 2RNRB 5EFXA 2HE7A 3TVVA 1V5UA 3DXCA 3P7ZA 4HATB 5LONB 2YRYA 2VKIA 2K49A 2R0DA 4KHOA 3PVUA 4D0NB 4DX8A 2RSGA 1FHWA 3AU4A 4GPTB 4A6KA 4HAZB 1XR0B 1MIXA 4A6FA 1NTYA 5GOWB 1X1GA 2ROVA 4ZRJA 3WYFB 2KCJA 5FI1A 1NI2A 2D9XA 3ODOA 3AJ4A 2D9YA 2CY5A 2AEHA 2FJUB 1H4RA 2ZKMX 2QKLA 1MI1A 4EKUA 3NWAA 3VIAA 5D27A 4P7IA 4L1RA 2MWNB 2EJ8A 3ULBA 3KRWA 4C0AA 1V61A 3ZVRA 4HHVA 5KCVA 1V88A 2GCJA 1GG3A 1ZYIA 3NWDA 4K2OA 4CHMA 4MK0A 2D9ZA 5KQ1A 2VSZA 3X23A 3QWMA 1ZSQA 3D8DA 4A6HA 1U29A 2Z4DA 5DHAB 2P8VA 1TQZA 4DX90 1M7RA 1H10A 4ZRKA 3KZ1A 3SUZA 5HE3A 4A5KA 2KR0A 2W2XC 1EF1A 1E5WA 2D10A 2I1JA 1W1GA 1KZ7A 4MY6A 4CHJA 4Y94A 3NW8A 4GNKB 4KVGB 4OT1A 2KGXB 2J59M 2E2XA 5J3QA 2GCLA 2DHJA 2ADZA 1V89A 4D6WA 2DX1A 1TJ6A 3QIJA 2LOZA 1MKEA 2CY4A 1MAIA 2J0JA 2N23A 3HQCA 1OY2A 2M14A 1UNPA 1QQGA 5M4YB 3NWFA 2RRFA 4HB4B 1P6SA 2Q13A 5LOPB 4GOUA 1FGYA 1OMWA 3G9WA 1MK9B 2LG1A 3O96A 1X11A 3U12A 4HAWB 4KHBA 4DBBA 3F0WA 1U2BA 1EAZA 4OSNA 5DIFB 5HE0A 2EMSA 4IFSA 5DH9B 1DDMA 3PSCA 3RCPA 1T77A 2DKPA 3GYPA 2MFQA 2CRFA 3SO6A 5JP4A 1BTKA 2DN6A 1XODA 4B6HA 4L6EA 1NU2A 4TYZA 4CYEA 4BBKA 1WJMA
chains in the Genus database with same CATH topology
4PNKA 2MDXA 2DA0A 2DHIA 2Z0QA 1ZC4B 4EJNA 5L81A 2XQNM 4TKNA 5HE2A 1I7AA 4WVFB 5DI9B 5JHGA 4XWXA 1IRSA 2RUKB 1EGXA 4F7GA 5C16A 2D9VA 2D4QA 1V5PA 2P0HA 1Q67A 1UPRA 2P0FA 2PZ1A 1LB1A 3AU5A 2COFA 3A98B 3M1IB 2J0MA 5KQ4A 2YT1A 3T06A 3UZTA 3TO1A 5C5BA 4IAPA 5HE1A 1MIZB 3PP2A 1QC6A 1WGUA 4Z2NA 2COCA 1XKEA 2ELBA 1RJ2A 4IOYX 4PQ0A 2Z0OA 3PZDA 2DHKA 3TFMA 4HAYB 3PVWA 2QKMA 2W2WA 1SHCA 3DXEA 2H7EA 1ZVRA 4K81A 4KAXB 3PG7A 2UZRA 3KRXA 1PMSA 1BAKA 3KSYA 5JHHA 3BJIA 1I2HA 2G35A 2LYDA 3FEHA 3V5WA 2VRWB 3KY9A 4EMOA 4MT7A 1UNQA 4K17A 1WVHA 1XD4A 1OQNA 2DX5A 1FB8A 1MK7B 2NZ8B 3PEGA 4YONA 3HK0A 2YS1A 4A6FB 1DYNA 2YF0A 1X86A 3P6AA 2Y7BA 4NY0A 1MPHA 1PLSA 4H8SA 3DXDA 1X05A 4GZUA 1NTVA 3HW2B 4HDOA 2COAA 1U5DA 2D2QA 2Y8FA 4HAXB 3FSSA 4F7HA 1AWEA 2H7DA 1WJ1A 2FJLA 2LOXA 1M7EA 1P5TA 2D11A 3MDBC 4WSFA 1DDVA 1RRPB 2UVMA 2DYNA 1Y19B 4HAUB 2ROZB 3SYXA 4GN1A 1FOEA 2YSZA 2LULA 3A8QA 1GC6A 2X18A 1AQCA 5CLLB 2I1KA 3D8EA 3ULCA 4GMVA 2I5FA 1BWNA 3LJUX 1K5GB 4Z2MB 3NSUA 1DBHA 3ODXA 2YS5A 4HB3B 1DDWA 5JLJB 1FHOA 4HB0B 2K2UA 1FHXA 3U8ZA 1BTNA 2IFSA 4GMXB 2RGNB 1FAOA 3F5RA 5DHFB 4K2PA 2I5CA 1W1HA 3TW1A 4ZRIA 2ZPYA 1Y5OA 2DLWA 2RLOA 1TXDA 1UEFA 2OTXA 3BINA 4HDQA 2D9WA 2J0KA 1DROA 3MPXA 4KHBB 1EVHA 3PVLA 2K2JA 2YT0A 2W2XD 1GC7A 3CIKA 2M38A 5D3WA 1U5GA 2DKQA 4KHAA 2V76A 1LW3A 1U5EA 1ZM0A 1FGZA 3ODWA 1ISNA 3CXBB 1XX0A 2Z0PA 1SGHA 5J3YA 3FM8C 1KI1B 4YL8A 1K5DB 2HTHB 2L1CA 5D3XA 2JP2A 2BCJA 3N7CA 5C6RA 2K00A 3TCAA 2R09A 2YS3A 2KUPA 5J3TA 1W1DA 2DYQA 2CAYA 2EC1A 2Y8GA 1J0WA 2LKOA 3D8FA 1U27A 2MKRA 1B55A 3GYOA 1N3HA 3QBVB 1UNRA 2UZSA 1P3RA 1PFJA 1Z87A 1X1FA 3WA0A 2L2IA 2DTCA 1ZC3B 5D3YA 1V5MA 2N0YA 2CODA 1WI1A 3U7DA 4HAVB 1KZGA 4GXBA 1WG7A 5D3VA 4WJ7A 2EMTA 5CLQB 3A8PA 5FI0A 2YVCA 2NMBA 3OANA 5C5BB 4F7UP 3SNHA 1U5FA 2P0DA 4NSWA 2GJYA 2AL6A 2GS0A 2OQBA 1XCGA 5C79A 4HB2B 3SV1A 3VOQA 4DXAB 3ML4A 3IVFA 2ELAA 1UPQA 2IYBA 1J19A 3ZDTA 1WGQA 2RVBB 2DFKA 2RNRB 5EFXA 2HE7A 3TVVA 1V5UA 3DXCA 3P7ZA 4HATB 5LONB 2YRYA 2VKIA 2R0DA 4KHOA 3PVUA 4D0NB 4DX8A 2RSGA 1FHWA 3AU4A 4GPTB 4A6KA 4HAZB 1XR0B 1MIXA 4A6FA 1NTYA 5GOWB 1X1GA 2ROVA 4ZRJA 3WYFB 2KCJA 5FI1A 1NI2A 2D9XA 3ODOA 3AJ4A 2D9YA 2CY5A 2AEHA 1H4RA 2QKLA 4EKUA 3VIAA 5D27A 4P7IA 2MWNB 2EJ8A 3ULBA 3KRWA 4C0AA 1V61A 3ZVRA 4HHVA 5KCVA 1V88A 2GCJA 1GG3A 4K2OA 4CHMA 4MK0A 2D9ZA 5KQ1A 2VSZA 3X23A 3QWMA 1ZSQA 3D8DA 4A6HA 1U29A 5DHAB 2P8VA 1TQZA 4DX90 1M7RA 1H10A 4ZRKA 3KZ1A 3SUZA 5HE3A 4A5KA 2W2XC 1EF1A 1E5WA 2D10A 2I1JA 1W1GA 1KZ7A 4MY6A 4CHJA 4Y94A 4KVGB 2KGXB 2J59M 2E2XA 5J3QA 2GCLA 2DHJA 2ADZA 1V89A 2DX1A 1TJ6A 3QIJA 2LOZA 1MKEA 2CY4A 1MAIA 2J0JA 2N23A 3HQCA 1OY2A 2M14A 1UNPA 1QQGA 4HB4B 1P6SA 2Q13A 5LOPB 1FGYA 1OMWA 3G9WA 1MK9B 2LG1A 3O96A 1X11A 4HAWB 4DBBA 3F0WA 1U2BA 1EAZA 5DIFB 5HE0A 2EMSA 4IFSA 5DH9B 1DDMA 3PSCA 3RCPA 2DKPA 3GYPA 2MFQA 2CRFA 3SO6A 5JP4A 1BTKA 2DN6A 1XODA 4B6HA 4L6EA 1NU2A 4TYZA 4CYEA 4BBKA 1WJMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PNK A;  2MDX A;  2DA0 A;  2DHI A;  2Z0Q A;  1ZC4 B;  4EJN A;  5L81 A;  2XQN M;  4TKN A;  5HE2 A;  1I7A A;  4WVF B;  5DI9 B;  5JHG A;  4XWX A;  1IRS A;  2RUK B;  1EGX A;  4F7G A;  5C16 A;  2D9V A;  2D4Q A;  1V5P A;  2P0H A;  1Q67 A;  1UPR A;  2P0F A;  2PZ1 A;  1LB1 A;  3AU5 A;  2COF A;  3A98 B;  3M1I B;  2J0M A;  5KQ4 A;  2YT1 A;  3T06 A;  3UZT A;  3TO1 A;  5C5B A;  4IAP A;  5HE1 A;  1MIZ B;  3PP2 A;  1QC6 A;  1WGU A;  4Z2N A;  2COC A;  1XKE A;  2ELB A;  1RJ2 A;  4IOY X;  4PQ0 A;  2Z0O A;  3PZD A;  2DHK A;  3TFM A;  4HAY B;  3PVW A;  2QKM A;  2W2W A;  1SHC A;  3DXE A;  2H7E A;  1ZVR A;  4K81 A;  4KAX B;  3PG7 A;  2UZR A;  3KRX A;  1PMS A;  1BAK A;  3KSY A;  5JHH A;  3BJI A;  1I2H A;  2G35 A;  2LYD A;  3FEH A;  3V5W A;  2VRW B;  3KY9 A;  4EMO A;  4MT7 A;  1UNQ A;  4K17 A;  1WVH A;  1XD4 A;  1OQN A;  2DX5 A;  1FB8 A;  1MK7 B;  2NZ8 B;  3PEG A;  4YON A;  3HK0 A;  2YS1 A;  4A6F B;  1DYN A;  2YF0 A;  1X86 A;  3P6A A;  2Y7B A;  4NY0 A;  1MPH A;  1PLS A;  4H8S A;  3DXD A;  1X05 A;  4GZU A;  1NTV A;  3HW2 B;  4HDO A;  2COA A;  1U5D A;  2D2Q A;  2Y8F A;  4HAX B;  3FSS A;  4F7H A;  1AWE A;  2H7D A;  1WJ1 A;  2FJL A;  2LOX A;  1M7E A;  1P5T A;  2D11 A;  3MDB C;  4WSF A;  1DDV A;  1RRP B;  2UVM A;  2DYN A;  1Y19 B;  4HAU B;  2ROZ B;  3SYX A;  4GN1 A;  1FOE A;  2YSZ A;  2LUL A;  3A8Q A;  1GC6 A;  2X18 A;  1AQC A;  5CLL B;  2I1K A;  3D8E A;  3ULC A;  4GMV A;  2I5F A;  1BWN A;  3LJU X;  1K5G B;  4Z2M B;  3NSU A;  1DBH A;  3ODX A;  2YS5 A;  4HB3 B;  1DDW A;  5JLJ B;  1FHO A;  4HB0 B;  2K2U A;  1FHX A;  3U8Z A;  1BTN A;  2IFS A;  4GMX B;  2RGN B;  1FAO A;  3F5R A;  5DHF B;  4K2P A;  2I5C A;  1W1H A;  3TW1 A;  4ZRI A;  2ZPY A;  1Y5O A;  2DLW A;  2RLO A;  1TXD A;  1UEF A;  2OTX A;  3BIN A;  4HDQ A;  2D9W A;  2J0K A;  1DRO A;  3MPX A;  4KHB B;  1EVH A;  3PVL A;  2K2J A;  2YT0 A;  2W2X D;  1GC7 A;  3CIK A;  2M38 A;  5D3W A;  1U5G A;  2DKQ A;  4KHA A;  2V76 A;  1LW3 A;  1U5E A;  1ZM0 A;  1FGZ A;  3ODW A;  1ISN A;  3CXB B;  1XX0 A;  2Z0P A;  1SGH A;  5J3Y A;  3FM8 C;  1KI1 B;  4YL8 A;  1K5D B;  2HTH B;  2L1C A;  5D3X A;  2JP2 A;  2BCJ A;  3N7C A;  5C6R A;  2K00 A;  3TCA A;  2R09 A;  2YS3 A;  2KUP A;  5J3T A;  1W1D A;  2DYQ A;  2CAY A;  2EC1 A;  2Y8G A;  1J0W A;  2LKO A;  3D8F A;  1U27 A;  2MKR A;  1B55 A;  3GYO A;  1N3H A;  3QBV B;  1UNR A;  2UZS A;  1P3R A;  1PFJ A;  1Z87 A;  1X1F A;  3WA0 A;  2L2I A;  2DTC A;  1ZC3 B;  5D3Y A;  1V5M A;  2N0Y A;  2COD A;  1WI1 A;  3U7D A;  4HAV B;  1KZG A;  4GXB A;  1WG7 A;  5D3V A;  4WJ7 A;  2EMT A;  5CLQ B;  3A8P A;  5FI0 A;  2YVC A;  2NMB A;  3OAN A;  5C5B B;  4F7U P;  3SNH A;  1U5F A;  2P0D A;  4NSW A;  2GJY A;  2AL6 A;  2GS0 A;  2OQB A;  1XCG A;  5C79 A;  4HB2 B;  3SV1 A;  3VOQ A;  4DXA B;  3ML4 A;  3IVF A;  2ELA A;  1UPQ A;  2IYB A;  1J19 A;  3ZDT A;  1WGQ A;  2RVB B;  2DFK A;  2RNR B;  5EFX A;  2HE7 A;  3TVV A;  1V5U A;  3DXC A;  3P7Z A;  4HAT B;  5LON B;  2YRY A;  2VKI A;  2R0D A;  4KHO A;  3PVU A;  4D0N B;  4DX8 A;  2RSG A;  1FHW A;  3AU4 A;  4GPT B;  4A6K A;  4HAZ B;  1XR0 B;  1MIX A;  4A6F A;  1NTY A;  5GOW B;  1X1G A;  2ROV A;  4ZRJ A;  3WYF B;  2KCJ A;  5FI1 A;  1NI2 A;  2D9X A;  3ODO A;  3AJ4 A;  2D9Y A;  2CY5 A;  2AEH A;  1H4R A;  2QKL A;  4EKU A;  3VIA A;  5D27 A;  4P7I A;  2MWN B;  2EJ8 A;  3ULB A;  3KRW A;  4C0A A;  1V61 A;  3ZVR A;  4HHV A;  5KCV A;  1V88 A;  2GCJ A;  1GG3 A;  4K2O A;  4CHM A;  4MK0 A;  2D9Z A;  5KQ1 A;  2VSZ A;  3X23 A;  3QWM A;  1ZSQ A;  3D8D A;  4A6H A;  1U29 A;  5DHA B;  2P8V A;  1TQZ A;  4DX9 0;  1M7R A;  1H10 A;  4ZRK A;  3KZ1 A;  3SUZ A;  5HE3 A;  4A5K A;  2W2X C;  1EF1 A;  1E5W A;  2D10 A;  2I1J A;  1W1G A;  1KZ7 A;  4MY6 A;  4CHJ A;  4Y94 A;  4KVG B;  2KGX B;  2J59 M;  2E2X A;  5J3Q A;  2GCL A;  2DHJ A;  2ADZ A;  1V89 A;  2DX1 A;  1TJ6 A;  3QIJ A;  2LOZ A;  1MKE A;  2CY4 A;  1MAI A;  2J0J A;  2N23 A;  3HQC A;  1OY2 A;  2M14 A;  1UNP A;  1QQG A;  4HB4 B;  1P6S A;  2Q13 A;  5LOP B;  1FGY A;  1OMW A;  3G9W A;  1MK9 B;  2LG1 A;  3O96 A;  1X11 A;  4HAW B;  4DBB A;  3F0W A;  1U2B A;  1EAZ A;  5DIF B;  5HE0 A;  2EMS A;  4IFS A;  5DH9 B;  1DDM A;  3PSC A;  3RCP A;  2DKP A;  3GYP A;  2MFQ A;  2CRF A;  3SO6 A;  5JP4 A;  1BTK A;  2DN6 A;  1XOD A;  4B6H A;  4L6E A;  1NU2 A;  4TYZ A;  4CYE A;  4BBK A;  1WJM A; 
#chains in the Genus database with same CATH topology
 4PNK A;  2MDX A;  3FVC A;  2DA0 A;  2DHI A;  2Z0Q A;  1ZC4 B;  4EJN A;  5L81 A;  2XQN M;  4TKN A;  5HE2 A;  3HIE A;  1I7A A;  4WVF B;  2Z14 A;  5DI9 B;  5JHG A;  4XWX A;  1IRS A;  2RUK B;  1EGX A;  4F7G A;  5C16 A;  2D9V A;  2D4Q A;  1V5P A;  2P0H A;  1Q67 A;  1UPR A;  2P0F A;  2PZ1 A;  1LB1 A;  3AU5 A;  2COF A;  3A98 B;  3M1I B;  5LG4 B;  2J0M A;  5KQ4 A;  2YT1 A;  3T06 A;  3UZT A;  3TO1 A;  5C5B A;  4IAP A;  5HE1 A;  1MIZ B;  3PP2 A;  1QC6 A;  4DIX A;  1WGU A;  4Z2N A;  2COC A;  1XKE A;  2ELB A;  1RJ2 A;  4IOY X;  2KIE A;  4PQ0 A;  2Z0O A;  3PZD A;  2DHK A;  3HSA A;  3TFM A;  4HAY B;  2K8E A;  4CSQ A;  3PVW A;  2QKM A;  2W2W A;  1SHC A;  3DXE A;  2H7E A;  3OHM B;  1ZVR A;  4K81 A;  4KAX B;  2UZR A;  3PG7 A;  3KRX A;  1PMS A;  1BAK A;  3KSY A;  5JHH A;  3BJI A;  1I2H A;  2G35 A;  2LYD A;  3FEH A;  3V5W A;  2VRW B;  3KY9 A;  4EMO A;  4MT7 A;  1UNQ A;  4K17 A;  1WVH A;  1XD4 A;  1OQN A;  2DX5 A;  1FB8 A;  1MK7 B;  2NZ8 B;  3PEG A;  4YON A;  3HK0 A;  2YS1 A;  2KIG A;  4QJ3 B;  4A6F B;  1DYN A;  2YF0 A;  1X86 A;  3P6A A;  2Y7B A;  4NY0 A;  1MPH A;  1PLS A;  4H8S A;  3DXD A;  1X05 A;  4GZU A;  1NTV A;  3HW2 B;  4HDO A;  2COA A;  1U5D A;  2YT2 A;  2D2Q A;  4HSI A;  2Y8F A;  4HAX B;  3FSS A;  4QJ5 B;  4F7H A;  1AWE A;  2H7D A;  1WJ1 A;  2FJL A;  2LOX A;  1M7E A;  1P5T A;  2D11 A;  3MDB C;  4WSF A;  1DDV A;  1RRP B;  2UVM A;  2DYN A;  1Y19 B;  4HAU B;  2ROZ B;  3SYX A;  2GUM A;  4GN1 A;  1FOE A;  2YSZ A;  2LUL A;  3A8Q A;  1GC6 A;  2X18 A;  1AQC A;  5CLL B;  2I1K A;  3D8E A;  3ULC A;  4GMV A;  2I5F A;  1BWN A;  3LJU X;  1K5G B;  4Z2M B;  3NSU A;  1DBH A;  3ODX A;  2YS5 A;  4HB3 B;  1DDW A;  5JLJ B;  1FHO A;  4HB0 B;  2K2U A;  1FHX A;  3U8Z A;  5I2M A;  1BTN A;  2IFS A;  4GMX B;  2RGN B;  1FAO A;  3F5R A;  5DHF B;  4K2P A;  2I5C A;  1W1H A;  3TW1 A;  4ZRI A;  5IRS A;  2ZPY A;  1Y5O A;  2DLW A;  2RLO A;  1TXD A;  1UEF A;  2OTX A;  3BIN A;  4HDQ A;  2D9W A;  2J0K A;  1DRO A;  3MPX A;  2NBV A;  4KHB B;  1EVH A;  3PVL A;  2K2J A;  2YT0 A;  2W2X D;  1GC7 A;  3CIK A;  2M38 A;  5D3W A;  1U5G A;  2DKQ A;  4KHA A;  2V76 A;  1LW3 A;  1U5E A;  1ZM0 A;  1FGZ A;  3ODW A;  1ISN A;  3CXB B;  1XX0 A;  2Z0P A;  3DCX A;  1SGH A;  5J3Y A;  3FM8 C;  1KI1 B;  4YL8 A;  1K5D B;  2HTH B;  2L1C A;  5D3X A;  2JP2 A;  2R2Y A;  3A58 A;  2BCJ A;  3N7C A;  5C6R A;  2K00 A;  3TCA A;  2R09 A;  2YS3 A;  2KUP A;  5J3T A;  1W1D A;  2DYQ A;  2CAY A;  2EC1 A;  2Y8G A;  1J0W A;  2LKO A;  3D8F A;  1U27 A;  4QXA B;  2KUQ A;  2MKR A;  1B55 A;  3GYO A;  1N3H A;  3QBV B;  1UNR A;  2UZS A;  4QJ4 B;  1P3R A;  1PFJ A;  1Z87 A;  1X1F A;  3WA0 A;  2L2I A;  2DTC A;  1ZC3 B;  2Z59 A;  5D3Y A;  1V5M A;  2N0Y A;  2COD A;  1WI1 A;  3U7D A;  5I2S A;  4HAV B;  1KZG A;  4GXB A;  1WG7 A;  5D3V A;  4WJ7 A;  2EMT A;  5CLQ B;  3A8P A;  5FI0 A;  2YVC A;  2NMB A;  3OAN A;  5C5B B;  4F7U P;  3SNH A;  1U5F A;  2P0D A;  4NSW A;  2GJY A;  2AL6 A;  2GS0 A;  2OQB A;  1XCG A;  5C79 A;  4HB2 B;  3SV1 A;  3VOQ A;  4DXA B;  3ML4 A;  3IVF A;  3B77 A;  2ELA A;  1UPQ A;  2IYB A;  2Z13 A;  1J19 A;  3ZDT A;  1WGQ A;  2RVB B;  2DFK A;  2RNR B;  5EFX A;  2HE7 A;  3TVV A;  1V5U A;  3DXC A;  3P7Z A;  4HAT B;  5LON B;  2YRY A;  2VKI A;  2K49 A;  2R0D A;  4KHO A;  3PVU A;  4D0N B;  4DX8 A;  2RSG A;  1FHW A;  3AU4 A;  4GPT B;  4A6K A;  4HAZ B;  1XR0 B;  1MIX A;  4A6F A;  1NTY A;  5GOW B;  1X1G A;  2ROV A;  4ZRJ A;  3WYF B;  2KCJ A;  5FI1 A;  1NI2 A;  2D9X A;  3ODO A;  3AJ4 A;  2D9Y A;  2CY5 A;  2AEH A;  2FJU B;  1H4R A;  2ZKM X;  2QKL A;  1MI1 A;  4EKU A;  3NWA A;  3VIA A;  5D27 A;  4P7I A;  4L1R A;  2MWN B;  2EJ8 A;  3ULB A;  3KRW A;  4C0A A;  1V61 A;  3ZVR A;  4HHV A;  5KCV A;  1V88 A;  2GCJ A;  1GG3 A;  1ZYI A;  3NWD A;  4K2O A;  4CHM A;  4MK0 A;  2D9Z A;  5KQ1 A;  2VSZ A;  3X23 A;  3QWM A;  1ZSQ A;  3D8D A;  4A6H A;  1U29 A;  2Z4D A;  5DHA B;  2P8V A;  1TQZ A;  4DX9 0;  1M7R A;  1H10 A;  4ZRK A;  3KZ1 A;  3SUZ A;  5HE3 A;  4A5K A;  2KR0 A;  2W2X C;  1EF1 A;  1E5W A;  2D10 A;  2I1J A;  1W1G A;  1KZ7 A;  4MY6 A;  4CHJ A;  4Y94 A;  3NW8 A;  4GNK B;  4KVG B;  4OT1 A;  2KGX B;  2J59 M;  2E2X A;  5J3Q A;  2GCL A;  2DHJ A;  2ADZ A;  1V89 A;  4D6W A;  2DX1 A;  1TJ6 A;  3QIJ A;  2LOZ A;  1MKE A;  2CY4 A;  1MAI A;  2J0J A;  2N23 A;  3HQC A;  1OY2 A;  2M14 A;  1UNP A;  1QQG A;  5M4Y B;  3NWF A;  2RRF A;  4HB4 B;  1P6S A;  2Q13 A;  5LOP B;  4GOU A;  1FGY A;  1OMW A;  3G9W A;  1MK9 B;  2LG1 A;  3O96 A;  1X11 A;  3U12 A;  4HAW B;  4KHB A;  4DBB A;  3F0W A;  1U2B A;  1EAZ A;  4OSN A;  5DIF B;  5HE0 A;  2EMS A;  4IFS A;  5DH9 B;  1DDM A;  3PSC A;  3RCP A;  1T77 A;  2DKP A;  3GYP A;  2MFQ A;  2CRF A;  3SO6 A;  5JP4 A;  1BTK A;  2DN6 A;  1XOD A;  4B6H A;  4L6E A;  1NU2 A;  4TYZ A;  4CYE A;  4BBK A;  1WJM A; 
#chains in the Genus database with same CATH homology
 4PNK A;  2MDX A;  2DA0 A;  2DHI A;  2Z0Q A;  1ZC4 B;  4EJN A;  5L81 A;  2XQN M;  4TKN A;  5HE2 A;  1I7A A;  4WVF B;  5DI9 B;  5JHG A;  4XWX A;  1IRS A;  2RUK B;  1EGX A;  4F7G A;  5C16 A;  2D9V A;  2D4Q A;  1V5P A;  2P0H A;  1Q67 A;  1UPR A;  2P0F A;  2PZ1 A;  1LB1 A;  3AU5 A;  2COF A;  3A98 B;  3M1I B;  2J0M A;  5KQ4 A;  2YT1 A;  3T06 A;  3UZT A;  3TO1 A;  5C5B A;  4IAP A;  5HE1 A;  1MIZ B;  3PP2 A;  1QC6 A;  1WGU A;  4Z2N A;  2COC A;  1XKE A;  2ELB A;  1RJ2 A;  4IOY X;  4PQ0 A;  2Z0O A;  3PZD A;  2DHK A;  3TFM A;  4HAY B;  3PVW A;  2QKM A;  2W2W A;  1SHC A;  3DXE A;  2H7E A;  1ZVR A;  4K81 A;  4KAX B;  3PG7 A;  2UZR A;  3KRX A;  1PMS A;  1BAK A;  3KSY A;  5JHH A;  3BJI A;  1I2H A;  2G35 A;  2LYD A;  3FEH A;  3V5W A;  2VRW B;  3KY9 A;  4EMO A;  4MT7 A;  1UNQ A;  4K17 A;  1WVH A;  1XD4 A;  1OQN A;  2DX5 A;  1FB8 A;  1MK7 B;  2NZ8 B;  3PEG A;  4YON A;  3HK0 A;  2YS1 A;  4A6F B;  1DYN A;  2YF0 A;  1X86 A;  3P6A A;  2Y7B A;  4NY0 A;  1MPH A;  1PLS A;  4H8S A;  3DXD A;  1X05 A;  4GZU A;  1NTV A;  3HW2 B;  4HDO A;  2COA A;  1U5D A;  2D2Q A;  2Y8F A;  4HAX B;  3FSS A;  4F7H A;  1AWE A;  2H7D A;  1WJ1 A;  2FJL A;  2LOX A;  1M7E A;  1P5T A;  2D11 A;  3MDB C;  4WSF A;  1DDV A;  1RRP B;  2UVM A;  2DYN A;  1Y19 B;  4HAU B;  2ROZ B;  3SYX A;  4GN1 A;  1FOE A;  2YSZ A;  2LUL A;  3A8Q A;  1GC6 A;  2X18 A;  1AQC A;  5CLL B;  2I1K A;  3D8E A;  3ULC A;  4GMV A;  2I5F A;  1BWN A;  3LJU X;  1K5G B;  4Z2M B;  3NSU A;  1DBH A;  3ODX A;  2YS5 A;  4HB3 B;  1DDW A;  5JLJ B;  1FHO A;  4HB0 B;  2K2U A;  1FHX A;  3U8Z A;  1BTN A;  2IFS A;  4GMX B;  2RGN B;  1FAO A;  3F5R A;  5DHF B;  4K2P A;  2I5C A;  1W1H A;  3TW1 A;  4ZRI A;  2ZPY A;  1Y5O A;  2DLW A;  2RLO A;  1TXD A;  1UEF A;  2OTX A;  3BIN A;  4HDQ A;  2D9W A;  2J0K A;  1DRO A;  3MPX A;  4KHB B;  1EVH A;  3PVL A;  2K2J A;  2YT0 A;  2W2X D;  1GC7 A;  3CIK A;  2M38 A;  5D3W A;  1U5G A;  2DKQ A;  4KHA A;  2V76 A;  1LW3 A;  1U5E A;  1ZM0 A;  1FGZ A;  3ODW A;  1ISN A;  3CXB B;  1XX0 A;  2Z0P A;  1SGH A;  5J3Y A;  3FM8 C;  1KI1 B;  4YL8 A;  1K5D B;  2HTH B;  2L1C A;  5D3X A;  2JP2 A;  2BCJ A;  3N7C A;  5C6R A;  2K00 A;  3TCA A;  2R09 A;  2YS3 A;  2KUP A;  5J3T A;  1W1D A;  2DYQ A;  2CAY A;  2EC1 A;  2Y8G A;  1J0W A;  2LKO A;  3D8F A;  1U27 A;  2MKR A;  1B55 A;  3GYO A;  1N3H A;  3QBV B;  1UNR A;  2UZS A;  1P3R A;  1PFJ A;  1Z87 A;  1X1F A;  3WA0 A;  2L2I A;  2DTC A;  1ZC3 B;  5D3Y A;  1V5M A;  2N0Y A;  2COD A;  1WI1 A;  3U7D A;  4HAV B;  1KZG A;  4GXB A;  1WG7 A;  5D3V A;  4WJ7 A;  2EMT A;  5CLQ B;  3A8P A;  5FI0 A;  2YVC A;  2NMB A;  3OAN A;  5C5B B;  4F7U P;  3SNH A;  1U5F A;  2P0D A;  4NSW A;  2GJY A;  2AL6 A;  2GS0 A;  2OQB A;  1XCG A;  5C79 A;  4HB2 B;  3SV1 A;  3VOQ A;  4DXA B;  3ML4 A;  3IVF A;  2ELA A;  1UPQ A;  2IYB A;  1J19 A;  3ZDT A;  1WGQ A;  2RVB B;  2DFK A;  2RNR B;  5EFX A;  2HE7 A;  3TVV A;  1V5U A;  3DXC A;  3P7Z A;  4HAT B;  5LON B;  2YRY A;  2VKI A;  2R0D A;  4KHO A;  3PVU A;  4D0N B;  4DX8 A;  2RSG A;  1FHW A;  3AU4 A;  4GPT B;  4A6K A;  4HAZ B;  1XR0 B;  1MIX A;  4A6F A;  1NTY A;  5GOW B;  1X1G A;  2ROV A;  4ZRJ A;  3WYF B;  2KCJ A;  5FI1 A;  1NI2 A;  2D9X A;  3ODO A;  3AJ4 A;  2D9Y A;  2CY5 A;  2AEH A;  1H4R A;  2QKL A;  4EKU A;  3VIA A;  5D27 A;  4P7I A;  2MWN B;  2EJ8 A;  3ULB A;  3KRW A;  4C0A A;  1V61 A;  3ZVR A;  4HHV A;  5KCV A;  1V88 A;  2GCJ A;  1GG3 A;  4K2O A;  4CHM A;  4MK0 A;  2D9Z A;  5KQ1 A;  2VSZ A;  3X23 A;  3QWM A;  1ZSQ A;  3D8D A;  4A6H A;  1U29 A;  5DHA B;  2P8V A;  1TQZ A;  4DX9 0;  1M7R A;  1H10 A;  4ZRK A;  3KZ1 A;  3SUZ A;  5HE3 A;  4A5K A;  2W2X C;  1EF1 A;  1E5W A;  2D10 A;  2I1J A;  1W1G A;  1KZ7 A;  4MY6 A;  4CHJ A;  4Y94 A;  4KVG B;  2KGX B;  2J59 M;  2E2X A;  5J3Q A;  2GCL A;  2DHJ A;  2ADZ A;  1V89 A;  2DX1 A;  1TJ6 A;  3QIJ A;  2LOZ A;  1MKE A;  2CY4 A;  1MAI A;  2J0J A;  2N23 A;  3HQC A;  1OY2 A;  2M14 A;  1UNP A;  1QQG A;  4HB4 B;  1P6S A;  2Q13 A;  5LOP B;  1FGY A;  1OMW A;  3G9W A;  1MK9 B;  2LG1 A;  3O96 A;  1X11 A;  4HAW B;  4DBB A;  3F0W A;  1U2B A;  1EAZ A;  5DIF B;  5HE0 A;  2EMS A;  4IFS A;  5DH9 B;  1DDM A;  3PSC A;  3RCP A;  2DKP A;  3GYP A;  2MFQ A;  2CRF A;  3SO6 A;  5JP4 A;  1BTK A;  2DN6 A;  1XOD A;  4B6H A;  4L6E A;  1NU2 A;  4TYZ A;  4CYE A;  4BBK A;  1WJM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...