5J3TA

Crystal structure of s. pombe dcp2:dcp1:edc1 mrna decapping complex
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
126
structure length
126
Chain Sequence
EDENILRNAVNLQVLKFHYPEIESIIDIASHVAVYQFDVGSQKWLKTSIEGTFFLVKDQRARVGYVILNRNSPENLYLFINHPSNVHLVDRYLIHRTENQHVVGLWMFDPNDMSRIFNIVKESLLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the Dcp2-Dcp1 mRNA-decapping complex in the activated conformation.
pubmed doi rcsb
source organism Schizosaccharomyces pombe
molecule tags Hydrolase
molecule keywords mRNA-decapping enzyme subunit 1
total genus 31
structure length 126
sequence length 126
ec nomenclature
pdb deposition date 2016-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06058 DCP1 Dcp1-like decapping family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 5j3tA00
4PNKA 3UZTA 1MIXA 3GYOA 2W2XD 3DXEA 3NSUA 3PG7A 1XCGA 1V61A 5CLLB 1DDMA 1FHWA 4HB2B 2MKRA 3D8DA 1EAZA 4K2PA 2DHIA 5KQ4A 2ADZA 4MK0A 2N23A 2VRWB 1DYNA 3F0WA 2G35A 3BINA 4P7IA 4EJNA 5D3VA 3OANA 4C0AA 1KZ7A 1XD4A 1P5TA 3VIAA 2PZ1A 1RJ2A 1FGZA 3TVVA 2I1JA 1TXDA 2CY4A 3GYPA 1LW3A 2YS1A 1XKEA 2COAA 3PEGA 1K5GB 1OMWA 4GZUA 2RNRB 5D3YA 3DXDA 3WYFB 2ZPYA 1Q67A 2IYBA 1XR0B 4F7GA 2EC1A 2ELBA 2YT1A 2CAYA 3WA0A 2OTXA 4GN1A 4HAWB 3FEHA 1I2HA 1W1HA 4KAXB 3V5WA 5J3TA 1UEFA 4GXBA 1GG3A 1DDVA 4TKNA 2NMBA 2J0MA 5HE1A 5FI0A 5JP4A 4K2OA 1V89A 3BJIA 1U27A 2P0DA 3TCAA 2CODA 3D8EA 1V5MA 4CHMA 4YL8A 1J19A 1BTKA 1NU2A 4CYEA 1TJ6A 5JLJB 4HAUB 1WJ1A 3T06A 4PQ0A 3PVLA 5D3XA 1FGYA 2H7EA 5D27A 4IAPA 1MPHA 1IRSA 2RVBB 3VOQA 2MWNB 2UZSA 1LB1A 3A8QA 2GCLA 3RCPA 3ZVRA 5KQ1A 4HB4B 1TQZA 2I5CA 2J59M 5C79A 2H7DA 2Y8GA 5C16A 2L2IA 3O96A 1Z87A 2AEHA 1EVHA 5C6RA 1AQCA 2RGNB 2RUKB 5DHFB 2DLWA 3F5RA 4EMOA 2Z0OA 3ODWA 2D9ZA 2GCJA 4HB0B 3SO6A 2YRYA 2JP2A 3AJ4A 1P6SA 2W2WA 4A6HA 2KCJA 2YS5A 4Z2MB 1WI1A 3PSCA 5FI1A 1ZVRA 4KHBB 1Y19B 3TFMA 2FJLA 2W2XC 2D2QA 1WGUA 1DROA 2COFA 3U7DA 2VSZA 2D4QA 2ROZB 1MK7B 4HB3B 2EMTA 2HTHB 3AU5A 4A6FA 4KHAA 2LOZA 1PFJA 3CXBB 2RSGA 2LG1A 3A8PA 3QIJA 4HDQA 2D9WA 4EKUA 2EMSA 3PVWA 4H8SA 5DH9B 1J0WA 1BTNA 1K5DB 3U8ZA 2RLOA 1W1DA 3KSYA 1U5FA 1X86A 2DA0A 2XQNM 4NSWA 2LKOA 2LULA 1U2BA 3ODXA 2DHKA 4DXAB 2DHJA 1I7AA 2KGXB 4F7HA 2KUPA 2YT0A 2QKMA 2V76A 2MDXA 3PVUA 3X23A 3A98B 1EF1A 5HE0A 3ML4A 4Z2NA 4GMVA 4WVFB 1V5UA 1ZC4B 1W1GA 1FHXA 1UNQA 1OY2A 2Z0QA 3PP2A 1H10A 2L1CA 1NTYA 5DI9B 2M38A 2NZ8B 1MIZB 3SYXA 2DTCA 1QQGA 1QC6A 4B6HA 3SUZA 2YSZA 3QWMA 4A6KA 1SHCA 2J0JA 1E5WA 1BWNA 5C5BB 2AL6A 1V88A 3FSSA 1KI1B 2Y7BA 1OQNA 2D11A 4WSFA 3N7CA 4KHOA 3HK0A 1NI2A 2DKQA 1Y5OA 4TYZA 2I5FA 1KZGA 5KCVA 2LOXA 4DX8A 3P6AA 3CIKA 4F7UP 1FB8A 2QKLA 1WVHA 3KZ1A 4A6FB 2CY5A 1P3RA 4A5KA 1V5PA 1PMSA 2K2JA 2X18A 4HAYB 2GJYA 4L6EA 2ELAA 1WG7A 3MDBC 4YONA 4MY6A 1U5DA 2MFQA 2DN6A 4XWXA 1XODA 4KVGB 1FOEA 4GPTB 1WGQA 2ROVA 1MAIA 1B55A 2K2UA 4K17A 1BAKA 2LYDA 1U5EA 2DYNA 5L81A 3IVFA 3D8FA 4HAZB 4DX90 2CRFA 3G9WA 3ULBA 4ZRKA 4HAXB 2COCA 1ISNA 3SV1A 5DIFB 1X1FA 2K00A 3TO1A 2DYQA 2D9XA 2N0YA 2R09A 1N3HA 3ULCA 4MT7A 3HQCA 4K81A 5J3YA 2EJ8A 5D3WA 1GC7A 4BBKA 1UPRA 2P0HA 3DXCA 1ZSQA 1UNPA 1M7RA 2J0KA 1SGHA 1M7EA 4HATB 5HE3A 3KRWA 4IFSA 1UNRA 5GOWB 1UPQA 2Z0PA 4IOYX 4DBBA 4Y94A 3SNHA 2IFSA 3KY9A 2P8VA 1PLSA 2D10A 2DX1A 2DFKA 1X11A 4D0NB 1U29A 2GS0A 3TW1A 4WJ7A 1WJMA 2BCJA 2R0DA 3HW2B 3PZDA 1GC6A 1X1GA 1XX0A 3LJUX 1MKEA 1DBHA 2Y8FA 1RRPB 2D9YA 4ZRIA 5JHGA 5LONB 2DX5A 5C5BA 2UVMA 3MPXA 2HE7A 3ZDTA 3M1IB 1U5GA 1H4RA 2YF0A 2DKPA 2Q13A 3KRXA 2I1KA 3ODOA 3FM8C 5CLQB 1AWEA 2VKIA 3QBVB 2YS3A 4HDOA 1FHOA 1DDWA 4ZRJA 2M14A 4CHJA 5EFXA 3P7ZA 1FAOA 2YVCA 1EGXA 5J3QA 2D9VA 5HE2A 1NTVA 1MK9B 1ZM0A 4HHVA 5JHHA 1X05A 5DHAB 2P0FA 2E2XA 4GMXB 4HAVB 2UZRA 1ZC3B 3AU4A 5LOPB 4NY0A 2OQBA
chains in the Genus database with same CATH superfamily
4PNKA 3UZTA 1MIXA 3GYOA 2W2XD 3DXEA 3NSUA 3PG7A 1XCGA 1V61A 5CLLB 1DDMA 1FHWA 4HB2B 2MKRA 3D8DA 1EAZA 4K2PA 2DHIA 5KQ4A 2ADZA 4MK0A 2N23A 2Z4DA 2VRWB 1DYNA 3F0WA 2G35A 3BINA 4P7IA 4EJNA 5D3VA 3OANA 4C0AA 2KR0A 1KZ7A 1XD4A 1P5TA 3VIAA 2PZ1A 1RJ2A 1FGZA 5IRSA 3TVVA 2I1JA 1TXDA 2CY4A 3GYPA 1LW3A 2YS1A 1XKEA 2COAA 2GUMA 3PEGA 1K5GB 1OMWA 4D6WA 4GZUA 2KUQA 2RNRB 5D3YA 3DXDA 3WYFB 2ZPYA 1Q67A 2IYBA 1XR0B 4F7GA 2EC1A 2ELBA 2YT1A 2CAYA 3WA0A 2OTXA 4GN1A 4HAWB 3FEHA 1I2HA 1W1HA 4KAXB 3V5WA 5J3TA 1UEFA 4GXBA 1GG3A 1DDVA 4TKNA 2NMBA 2J0MA 5HE1A 5FI0A 5JP4A 4K2OA 1V89A 3BJIA 4QJ5B 1U27A 2P0DA 3U12A 3TCAA 2CODA 3D8EA 1V5MA 4CHMA 4YL8A 1J19A 1BTKA 1NU2A 4CYEA 1TJ6A 5JLJB 4DIXA 4HAUB 1WJ1A 2K49A 3T06A 4PQ0A 3PVLA 5D3XA 1FGYA 2H7EA 5D27A 4IAPA 1MPHA 1IRSA 2RVBB 2YT2A 3VOQA 2MWNB 2UZSA 1LB1A 3A8QA 2GCLA 3RCPA 3ZVRA 5KQ1A 4HB4B 1TQZA 2I5CA 2J59M 5C79A 2H7DA 2Y8GA 5C16A 2L2IA 3O96A 1Z87A 2ZKMX 2AEHA 1EVHA 5C6RA 1AQCA 2RGNB 2RUKB 5DHFB 2DLWA 3F5RA 4EMOA 5M4YB 2Z0OA 3ODWA 2K8EA 2D9ZA 2GCJA 4HB0B 3SO6A 2YRYA 2JP2A 3AJ4A 1P6SA 2W2WA 4A6HA 2KCJA 2KIEA 5I2MA 2YS5A 4Z2MB 1WI1A 3PSCA 5FI1A 1ZVRA 4KHBB 1Y19B 3NWDA 3TFMA 2FJLA 2W2XC 2D2QA 4OT1A 1WGUA 1DROA 2COFA 3U7DA 2VSZA 2D4QA 2ROZB 1MK7B 4HB3B 3HSAA 2EMTA 2HTHB 3AU5A 4A6FA 4KHAA 2LOZA 1PFJA 3CXBB 2RSGA 2LG1A 3A8PA 3QIJA 4HDQA 2D9WA 4EKUA 3B77A 2EMSA 3PVWA 4H8SA 5DH9B 1J0WA 1BTNA 1K5DB 2Z59A 3U8ZA 2RLOA 3OHMB 1W1DA 3KSYA 1U5FA 1X86A 2DA0A 2FJUB 2XQNM 4NSWA 2LKOA 2LULA 1U2BA 3ODXA 2DHKA 4DXAB 2DHJA 1I7AA 2KGXB 4F7HA 2KUPA 2YT0A 2QKMA 4OSNA 2V76A 2MDXA 1MI1A 3PVUA 3A98B 3X23A 1EF1A 5HE0A 3ML4A 4Z2NA 4GMVA 4WVFB 1V5UA 1ZC4B 1W1GA 1FHXA 1UNQA 1OY2A 2Z0QA 3PP2A 1H10A 2L1CA 1NTYA 5DI9B 2M38A 2NZ8B 1MIZB 3SYXA 2DTCA 1QQGA 1QC6A 4B6HA 3SUZA 2YSZA 3QWMA 4A6KA 1SHCA 3NWAA 2J0JA 1E5WA 1BWNA 5C5BB 2AL6A 1V88A 3FSSA 2Z14A 1KI1B 2Y7BA 1OQNA 2D11A 4WSFA 3N7CA 4KHOA 3HK0A 1NI2A 2DKQA 1Y5OA 4TYZA 2I5FA 1KZGA 5KCVA 2LOXA 4DX8A 3NW8A 3P6AA 3CIKA 4QXAB 4HSIA 4F7UP 1FB8A 1ZYIA 2QKLA 1WVHA 3KZ1A 4A6FB 2CY5A 1P3RA 4A5KA 4GOUA 1V5PA 4KHBA 3FVCA 1PMSA 3DCXA 2K2JA 2X18A 4HAYB 2GJYA 4L6EA 2ELAA 1WG7A 3MDBC 4YONA 4MY6A 1U5DA 2MFQA 2DN6A 2KIGA 4XWXA 1XODA 4KVGB 1FOEA 4GPTB 1WGQA 2ROVA 1MAIA 1B55A 2K2UA 4K17A 1BAKA 2LYDA 1U5EA 2DYNA 5L81A 3IVFA 3D8FA 4HAZB 4DX90 2CRFA 3G9WA 3ULBA 4ZRKA 4HAXB 2COCA 1ISNA 3SV1A 5DIFB 1X1FA 2K00A 3TO1A 2DYQA 2D9XA 2N0YA 5I2SA 4QJ4B 3A58A 2R09A 1N3HA 3ULCA 4MT7A 3HQCA 4K81A 5J3YA 2EJ8A 5D3WA 1GC7A 4BBKA 1UPRA 2P0HA 3DXCA 1ZSQA 2Z13A 1UNPA 3HIEA 1M7RA 2J0KA 1SGHA 1M7EA 2RRFA 4HATB 5HE3A 3KRWA 4IFSA 4CSQA 1UNRA 5GOWB 1UPQA 2Z0PA 4IOYX 4DBBA 4Y94A 3SNHA 2IFSA 2R2YA 3KY9A 2P8VA 1PLSA 2D10A 2DX1A 2DFKA 1X11A 4D0NB 1U29A 2GS0A 5LG4B 3TW1A 4WJ7A 1WJMA 2BCJA 2R0DA 3HW2B 3PZDA 1GC6A 1X1GA 1XX0A 3LJUX 1MKEA 1DBHA 2NBVA 2Y8FA 1RRPB 2D9YA 4ZRIA 5JHGA 5LONB 2DX5A 5C5BA 2UVMA 3MPXA 2HE7A 3ZDTA 3M1IB 1U5GA 1H4RA 2YF0A 2DKPA 2Q13A 3KRXA 2I1KA 3ODOA 3FM8C 5CLQB 1AWEA 2VKIA 3QBVB 2YS3A 4HDOA 4QJ3B 1DDWA 1FHOA 4ZRJA 2M14A 4CHJA 5EFXA 3P7ZA 1FAOA 2YVCA 1EGXA 3NWFA 5J3QA 2D9VA 4L1RA 5HE2A 1NTVA 1MK9B 1ZM0A 4HHVA 1T77A 4GNKB 5JHHA 1X05A 5DHAB 2P0FA 2E2XA 4GMXB 4HAVB 2UZRA 1ZC3B 3AU4A 5LOPB 4NY0A 2OQBA
chains in the Genus database with same CATH topology
4PNKA 3UZTA 1MIXA 3GYOA 2W2XD 3DXEA 3NSUA 3PG7A 1XCGA 1V61A 5CLLB 1DDMA 1FHWA 4HB2B 2MKRA 3D8DA 1EAZA 4K2PA 2DHIA 5KQ4A 2ADZA 4MK0A 2N23A 2VRWB 1DYNA 3F0WA 2G35A 3BINA 4P7IA 4EJNA 5D3VA 3OANA 4C0AA 1KZ7A 1XD4A 1P5TA 3VIAA 2PZ1A 1RJ2A 1FGZA 3TVVA 2I1JA 1TXDA 2CY4A 3GYPA 1LW3A 2YS1A 1XKEA 2COAA 3PEGA 1K5GB 1OMWA 4GZUA 2RNRB 5D3YA 3DXDA 3WYFB 2ZPYA 1Q67A 2IYBA 1XR0B 4F7GA 2EC1A 2ELBA 2YT1A 2CAYA 3WA0A 2OTXA 4GN1A 4HAWB 3FEHA 1I2HA 1W1HA 4KAXB 3V5WA 5J3TA 1UEFA 4GXBA 1GG3A 1DDVA 4TKNA 2NMBA 2J0MA 5HE1A 5FI0A 5JP4A 4K2OA 1V89A 3BJIA 1U27A 2P0DA 3TCAA 2CODA 3D8EA 1V5MA 4CHMA 4YL8A 1J19A 1BTKA 1NU2A 4CYEA 1TJ6A 5JLJB 4HAUB 1WJ1A 3T06A 4PQ0A 3PVLA 5D3XA 1FGYA 2H7EA 5D27A 4IAPA 1MPHA 1IRSA 2RVBB 3VOQA 2MWNB 2UZSA 1LB1A 3A8QA 2GCLA 3RCPA 3ZVRA 5KQ1A 4HB4B 1TQZA 2I5CA 2J59M 5C79A 2H7DA 2Y8GA 5C16A 2L2IA 3O96A 1Z87A 2AEHA 1EVHA 5C6RA 1AQCA 2RGNB 2RUKB 5DHFB 2DLWA 3F5RA 4EMOA 2Z0OA 3ODWA 2D9ZA 2GCJA 4HB0B 3SO6A 2YRYA 2JP2A 3AJ4A 1P6SA 2W2WA 4A6HA 2KCJA 2YS5A 4Z2MB 1WI1A 3PSCA 5FI1A 1ZVRA 4KHBB 1Y19B 3TFMA 2FJLA 2W2XC 2D2QA 1WGUA 1DROA 2COFA 3U7DA 2VSZA 2D4QA 2ROZB 1MK7B 4HB3B 2EMTA 2HTHB 3AU5A 4A6FA 4KHAA 2LOZA 1PFJA 3CXBB 2RSGA 2LG1A 3A8PA 3QIJA 4HDQA 2D9WA 4EKUA 2EMSA 3PVWA 4H8SA 5DH9B 1J0WA 1BTNA 1K5DB 3U8ZA 2RLOA 1W1DA 3KSYA 1U5FA 1X86A 2DA0A 2XQNM 4NSWA 2LKOA 2LULA 1U2BA 3ODXA 2DHKA 4DXAB 2DHJA 1I7AA 2KGXB 4F7HA 2KUPA 2YT0A 2QKMA 2V76A 2MDXA 3PVUA 3X23A 3A98B 1EF1A 5HE0A 3ML4A 4Z2NA 4GMVA 4WVFB 1V5UA 1ZC4B 1W1GA 1FHXA 1UNQA 1OY2A 2Z0QA 3PP2A 1H10A 2L1CA 1NTYA 5DI9B 2M38A 2NZ8B 1MIZB 3SYXA 2DTCA 1QQGA 1QC6A 4B6HA 3SUZA 2YSZA 3QWMA 4A6KA 1SHCA 2J0JA 1E5WA 1BWNA 5C5BB 2AL6A 1V88A 3FSSA 1KI1B 2Y7BA 1OQNA 2D11A 4WSFA 3N7CA 4KHOA 3HK0A 1NI2A 2DKQA 1Y5OA 4TYZA 2I5FA 1KZGA 5KCVA 2LOXA 4DX8A 3P6AA 3CIKA 4F7UP 1FB8A 2QKLA 1WVHA 3KZ1A 4A6FB 2CY5A 1P3RA 4A5KA 1V5PA 1PMSA 2K2JA 2X18A 4HAYB 2GJYA 4L6EA 2ELAA 1WG7A 3MDBC 4YONA 4MY6A 1U5DA 2MFQA 2DN6A 4XWXA 1XODA 4KVGB 1FOEA 4GPTB 1WGQA 2ROVA 1MAIA 1B55A 2K2UA 4K17A 1BAKA 2LYDA 1U5EA 2DYNA 5L81A 3IVFA 3D8FA 4HAZB 4DX90 2CRFA 3G9WA 3ULBA 4ZRKA 4HAXB 2COCA 1ISNA 3SV1A 5DIFB 1X1FA 2K00A 3TO1A 2DYQA 2D9XA 2N0YA 2R09A 1N3HA 3ULCA 4MT7A 3HQCA 4K81A 5J3YA 2EJ8A 5D3WA 1GC7A 4BBKA 1UPRA 2P0HA 3DXCA 1ZSQA 1UNPA 1M7RA 2J0KA 1SGHA 1M7EA 4HATB 5HE3A 3KRWA 4IFSA 1UNRA 5GOWB 1UPQA 2Z0PA 4IOYX 4DBBA 4Y94A 3SNHA 2IFSA 3KY9A 2P8VA 1PLSA 2D10A 2DX1A 2DFKA 1X11A 4D0NB 1U29A 2GS0A 3TW1A 4WJ7A 1WJMA 2BCJA 2R0DA 3HW2B 3PZDA 1GC6A 1X1GA 1XX0A 3LJUX 1MKEA 1DBHA 2Y8FA 1RRPB 2D9YA 4ZRIA 5JHGA 5LONB 2DX5A 5C5BA 2UVMA 3MPXA 2HE7A 3ZDTA 3M1IB 1U5GA 1H4RA 2YF0A 2DKPA 2Q13A 3KRXA 2I1KA 3ODOA 3FM8C 5CLQB 1AWEA 2VKIA 3QBVB 2YS3A 4HDOA 1FHOA 1DDWA 4ZRJA 2M14A 4CHJA 5EFXA 3P7ZA 1FAOA 2YVCA 1EGXA 5J3QA 2D9VA 5HE2A 1NTVA 1MK9B 1ZM0A 4HHVA 5JHHA 1X05A 5DHAB 2P0FA 2E2XA 4GMXB 4HAVB 2UZRA 1ZC3B 3AU4A 5LOPB 4NY0A 2OQBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PNK A;  3UZT A;  1MIX A;  3GYO A;  2W2X D;  3DXE A;  3NSU A;  3PG7 A;  1XCG A;  1V61 A;  5CLL B;  1DDM A;  1FHW A;  4HB2 B;  2MKR A;  3D8D A;  1EAZ A;  4K2P A;  2DHI A;  5KQ4 A;  2ADZ A;  4MK0 A;  2N23 A;  2VRW B;  1DYN A;  3F0W A;  2G35 A;  3BIN A;  4P7I A;  4EJN A;  5D3V A;  3OAN A;  4C0A A;  1KZ7 A;  1XD4 A;  1P5T A;  3VIA A;  2PZ1 A;  1RJ2 A;  1FGZ A;  3TVV A;  2I1J A;  1TXD A;  2CY4 A;  3GYP A;  1LW3 A;  2YS1 A;  1XKE A;  2COA A;  3PEG A;  1K5G B;  1OMW A;  4GZU A;  2RNR B;  5D3Y A;  3DXD A;  3WYF B;  2ZPY A;  1Q67 A;  2IYB A;  1XR0 B;  4F7G A;  2EC1 A;  2ELB A;  2YT1 A;  2CAY A;  3WA0 A;  2OTX A;  4GN1 A;  4HAW B;  3FEH A;  1I2H A;  1W1H A;  4KAX B;  3V5W A;  5J3T A;  1UEF A;  4GXB A;  1GG3 A;  1DDV A;  4TKN A;  2NMB A;  2J0M A;  5HE1 A;  5FI0 A;  5JP4 A;  4K2O A;  1V89 A;  3BJI A;  1U27 A;  2P0D A;  3TCA A;  2COD A;  3D8E A;  1V5M A;  4CHM A;  4YL8 A;  1J19 A;  1BTK A;  1NU2 A;  4CYE A;  1TJ6 A;  5JLJ B;  4HAU B;  1WJ1 A;  3T06 A;  4PQ0 A;  3PVL A;  5D3X A;  1FGY A;  2H7E A;  5D27 A;  4IAP A;  1MPH A;  1IRS A;  2RVB B;  3VOQ A;  2MWN B;  2UZS A;  1LB1 A;  3A8Q A;  2GCL A;  3RCP A;  3ZVR A;  5KQ1 A;  4HB4 B;  1TQZ A;  2I5C A;  2J59 M;  5C79 A;  2H7D A;  2Y8G A;  5C16 A;  2L2I A;  3O96 A;  1Z87 A;  2AEH A;  1EVH A;  5C6R A;  1AQC A;  2RGN B;  2RUK B;  5DHF B;  2DLW A;  3F5R A;  4EMO A;  2Z0O A;  3ODW A;  2D9Z A;  2GCJ A;  4HB0 B;  3SO6 A;  2YRY A;  2JP2 A;  3AJ4 A;  1P6S A;  2W2W A;  4A6H A;  2KCJ A;  2YS5 A;  4Z2M B;  1WI1 A;  3PSC A;  5FI1 A;  1ZVR A;  4KHB B;  1Y19 B;  3TFM A;  2FJL A;  2W2X C;  2D2Q A;  1WGU A;  1DRO A;  2COF A;  3U7D A;  2VSZ A;  2D4Q A;  2ROZ B;  1MK7 B;  4HB3 B;  2EMT A;  2HTH B;  3AU5 A;  4A6F A;  4KHA A;  2LOZ A;  1PFJ A;  3CXB B;  2RSG A;  2LG1 A;  3A8P A;  3QIJ A;  4HDQ A;  2D9W A;  4EKU A;  2EMS A;  3PVW A;  4H8S A;  5DH9 B;  1J0W A;  1BTN A;  1K5D B;  3U8Z A;  2RLO A;  1W1D A;  3KSY A;  1U5F A;  1X86 A;  2DA0 A;  2XQN M;  4NSW A;  2LKO A;  2LUL A;  1U2B A;  3ODX A;  2DHK A;  4DXA B;  2DHJ A;  1I7A A;  2KGX B;  4F7H A;  2KUP A;  2YT0 A;  2QKM A;  2V76 A;  2MDX A;  3PVU A;  3X23 A;  3A98 B;  1EF1 A;  5HE0 A;  3ML4 A;  4Z2N A;  4GMV A;  4WVF B;  1V5U A;  1ZC4 B;  1W1G A;  1FHX A;  1UNQ A;  1OY2 A;  2Z0Q A;  3PP2 A;  1H10 A;  2L1C A;  1NTY A;  5DI9 B;  2M38 A;  2NZ8 B;  1MIZ B;  3SYX A;  2DTC A;  1QQG A;  1QC6 A;  4B6H A;  3SUZ A;  2YSZ A;  3QWM A;  4A6K A;  1SHC A;  2J0J A;  1E5W A;  1BWN A;  5C5B B;  2AL6 A;  1V88 A;  3FSS A;  1KI1 B;  2Y7B A;  1OQN A;  2D11 A;  4WSF A;  3N7C A;  4KHO A;  3HK0 A;  1NI2 A;  2DKQ A;  1Y5O A;  4TYZ A;  2I5F A;  1KZG A;  5KCV A;  2LOX A;  4DX8 A;  3P6A A;  3CIK A;  4F7U P;  1FB8 A;  2QKL A;  1WVH A;  3KZ1 A;  4A6F B;  2CY5 A;  1P3R A;  4A5K A;  1V5P A;  1PMS A;  2K2J A;  2X18 A;  4HAY B;  2GJY A;  4L6E A;  2ELA A;  1WG7 A;  3MDB C;  4YON A;  4MY6 A;  1U5D A;  2MFQ A;  2DN6 A;  4XWX A;  1XOD A;  4KVG B;  1FOE A;  4GPT B;  1WGQ A;  2ROV A;  1MAI A;  1B55 A;  2K2U A;  4K17 A;  1BAK A;  2LYD A;  1U5E A;  2DYN A;  5L81 A;  3IVF A;  3D8F A;  4HAZ B;  4DX9 0;  2CRF A;  3G9W A;  3ULB A;  4ZRK A;  4HAX B;  2COC A;  1ISN A;  3SV1 A;  5DIF B;  1X1F A;  2K00 A;  3TO1 A;  2DYQ A;  2D9X A;  2N0Y A;  2R09 A;  1N3H A;  3ULC A;  4MT7 A;  3HQC A;  4K81 A;  5J3Y A;  2EJ8 A;  5D3W A;  1GC7 A;  4BBK A;  1UPR A;  2P0H A;  3DXC A;  1ZSQ A;  1UNP A;  1M7R A;  2J0K A;  1SGH A;  1M7E A;  4HAT B;  5HE3 A;  3KRW A;  4IFS A;  1UNR A;  5GOW B;  1UPQ A;  2Z0P A;  4IOY X;  4DBB A;  4Y94 A;  3SNH A;  2IFS A;  3KY9 A;  2P8V A;  1PLS A;  2D10 A;  2DX1 A;  2DFK A;  1X11 A;  4D0N B;  1U29 A;  2GS0 A;  3TW1 A;  4WJ7 A;  1WJM A;  2BCJ A;  2R0D A;  3HW2 B;  3PZD A;  1GC6 A;  1X1G A;  1XX0 A;  3LJU X;  1MKE A;  1DBH A;  2Y8F A;  1RRP B;  2D9Y A;  4ZRI A;  5JHG A;  5LON B;  2DX5 A;  5C5B A;  2UVM A;  3MPX A;  2HE7 A;  3ZDT A;  3M1I B;  1U5G A;  1H4R A;  2YF0 A;  2DKP A;  2Q13 A;  3KRX A;  2I1K A;  3ODO A;  3FM8 C;  5CLQ B;  1AWE A;  2VKI A;  3QBV B;  2YS3 A;  4HDO A;  1FHO A;  1DDW A;  4ZRJ A;  2M14 A;  4CHJ A;  5EFX A;  3P7Z A;  1FAO A;  2YVC A;  1EGX A;  5J3Q A;  2D9V A;  5HE2 A;  1NTV A;  1MK9 B;  1ZM0 A;  4HHV A;  5JHH A;  1X05 A;  5DHA B;  2P0F A;  2E2X A;  4GMX B;  4HAV B;  2UZR A;  1ZC3 B;  3AU4 A;  5LOP B;  4NY0 A;  2OQB A; 
#chains in the Genus database with same CATH topology
 4PNK A;  3UZT A;  1MIX A;  3GYO A;  2W2X D;  3DXE A;  3NSU A;  3PG7 A;  1XCG A;  1V61 A;  5CLL B;  1DDM A;  1FHW A;  4HB2 B;  2MKR A;  3D8D A;  1EAZ A;  4K2P A;  2DHI A;  5KQ4 A;  2ADZ A;  4MK0 A;  2N23 A;  2Z4D A;  2VRW B;  1DYN A;  3F0W A;  2G35 A;  3BIN A;  4P7I A;  4EJN A;  5D3V A;  3OAN A;  4C0A A;  2KR0 A;  1KZ7 A;  1XD4 A;  1P5T A;  3VIA A;  2PZ1 A;  1RJ2 A;  1FGZ A;  5IRS A;  3TVV A;  2I1J A;  1TXD A;  2CY4 A;  3GYP A;  1LW3 A;  2YS1 A;  1XKE A;  2COA A;  2GUM A;  3PEG A;  1K5G B;  1OMW A;  4D6W A;  4GZU A;  2KUQ A;  2RNR B;  5D3Y A;  3DXD A;  3WYF B;  2ZPY A;  1Q67 A;  2IYB A;  1XR0 B;  4F7G A;  2EC1 A;  2ELB A;  2YT1 A;  2CAY A;  3WA0 A;  2OTX A;  4GN1 A;  4HAW B;  3FEH A;  1I2H A;  1W1H A;  4KAX B;  3V5W A;  5J3T A;  1UEF A;  4GXB A;  1GG3 A;  1DDV A;  4TKN A;  2NMB A;  2J0M A;  5HE1 A;  5FI0 A;  5JP4 A;  4K2O A;  1V89 A;  3BJI A;  4QJ5 B;  1U27 A;  2P0D A;  3U12 A;  3TCA A;  2COD A;  3D8E A;  1V5M A;  4CHM A;  4YL8 A;  1J19 A;  1BTK A;  1NU2 A;  4CYE A;  1TJ6 A;  5JLJ B;  4DIX A;  4HAU B;  1WJ1 A;  2K49 A;  3T06 A;  4PQ0 A;  3PVL A;  5D3X A;  1FGY A;  2H7E A;  5D27 A;  4IAP A;  1MPH A;  1IRS A;  2RVB B;  2YT2 A;  3VOQ A;  2MWN B;  2UZS A;  1LB1 A;  3A8Q A;  2GCL A;  3RCP A;  3ZVR A;  5KQ1 A;  4HB4 B;  1TQZ A;  2I5C A;  2J59 M;  5C79 A;  2H7D A;  2Y8G A;  5C16 A;  2L2I A;  3O96 A;  1Z87 A;  2ZKM X;  2AEH A;  1EVH A;  5C6R A;  1AQC A;  2RGN B;  2RUK B;  5DHF B;  2DLW A;  3F5R A;  4EMO A;  5M4Y B;  2Z0O A;  3ODW A;  2K8E A;  2D9Z A;  2GCJ A;  4HB0 B;  3SO6 A;  2YRY A;  2JP2 A;  3AJ4 A;  1P6S A;  2W2W A;  4A6H A;  2KCJ A;  2KIE A;  5I2M A;  2YS5 A;  4Z2M B;  1WI1 A;  3PSC A;  5FI1 A;  1ZVR A;  4KHB B;  1Y19 B;  3NWD A;  3TFM A;  2FJL A;  2W2X C;  2D2Q A;  4OT1 A;  1WGU A;  1DRO A;  2COF A;  3U7D A;  2VSZ A;  2D4Q A;  2ROZ B;  1MK7 B;  4HB3 B;  3HSA A;  2EMT A;  2HTH B;  3AU5 A;  4A6F A;  4KHA A;  2LOZ A;  1PFJ A;  3CXB B;  2RSG A;  2LG1 A;  3A8P A;  3QIJ A;  4HDQ A;  2D9W A;  4EKU A;  3B77 A;  2EMS A;  3PVW A;  4H8S A;  5DH9 B;  1J0W A;  1BTN A;  1K5D B;  2Z59 A;  3U8Z A;  2RLO A;  3OHM B;  1W1D A;  3KSY A;  1U5F A;  1X86 A;  2DA0 A;  2FJU B;  2XQN M;  4NSW A;  2LKO A;  2LUL A;  1U2B A;  3ODX A;  2DHK A;  4DXA B;  2DHJ A;  1I7A A;  2KGX B;  4F7H A;  2KUP A;  2YT0 A;  2QKM A;  4OSN A;  2V76 A;  2MDX A;  1MI1 A;  3PVU A;  3A98 B;  3X23 A;  1EF1 A;  5HE0 A;  3ML4 A;  4Z2N A;  4GMV A;  4WVF B;  1V5U A;  1ZC4 B;  1W1G A;  1FHX A;  1UNQ A;  1OY2 A;  2Z0Q A;  3PP2 A;  1H10 A;  2L1C A;  1NTY A;  5DI9 B;  2M38 A;  2NZ8 B;  1MIZ B;  3SYX A;  2DTC A;  1QQG A;  1QC6 A;  4B6H A;  3SUZ A;  2YSZ A;  3QWM A;  4A6K A;  1SHC A;  3NWA A;  2J0J A;  1E5W A;  1BWN A;  5C5B B;  2AL6 A;  1V88 A;  3FSS A;  2Z14 A;  1KI1 B;  2Y7B A;  1OQN A;  2D11 A;  4WSF A;  3N7C A;  4KHO A;  3HK0 A;  1NI2 A;  2DKQ A;  1Y5O A;  4TYZ A;  2I5F A;  1KZG A;  5KCV A;  2LOX A;  4DX8 A;  3NW8 A;  3P6A A;  3CIK A;  4QXA B;  4HSI A;  4F7U P;  1FB8 A;  1ZYI A;  2QKL A;  1WVH A;  3KZ1 A;  4A6F B;  2CY5 A;  1P3R A;  4A5K A;  4GOU A;  1V5P A;  4KHB A;  3FVC A;  1PMS A;  3DCX A;  2K2J A;  2X18 A;  4HAY B;  2GJY A;  4L6E A;  2ELA A;  1WG7 A;  3MDB C;  4YON A;  4MY6 A;  1U5D A;  2MFQ A;  2DN6 A;  2KIG A;  4XWX A;  1XOD A;  4KVG B;  1FOE A;  4GPT B;  1WGQ A;  2ROV A;  1MAI A;  1B55 A;  2K2U A;  4K17 A;  1BAK A;  2LYD A;  1U5E A;  2DYN A;  5L81 A;  3IVF A;  3D8F A;  4HAZ B;  4DX9 0;  2CRF A;  3G9W A;  3ULB A;  4ZRK A;  4HAX B;  2COC A;  1ISN A;  3SV1 A;  5DIF B;  1X1F A;  2K00 A;  3TO1 A;  2DYQ A;  2D9X A;  2N0Y A;  5I2S A;  4QJ4 B;  3A58 A;  2R09 A;  1N3H A;  3ULC A;  4MT7 A;  3HQC A;  4K81 A;  5J3Y A;  2EJ8 A;  5D3W A;  1GC7 A;  4BBK A;  1UPR A;  2P0H A;  3DXC A;  1ZSQ A;  2Z13 A;  1UNP A;  3HIE A;  1M7R A;  2J0K A;  1SGH A;  1M7E A;  2RRF A;  4HAT B;  5HE3 A;  3KRW A;  4IFS A;  4CSQ A;  1UNR A;  5GOW B;  1UPQ A;  2Z0P A;  4IOY X;  4DBB A;  4Y94 A;  3SNH A;  2IFS A;  2R2Y A;  3KY9 A;  2P8V A;  1PLS A;  2D10 A;  2DX1 A;  2DFK A;  1X11 A;  4D0N B;  1U29 A;  2GS0 A;  5LG4 B;  3TW1 A;  4WJ7 A;  1WJM A;  2BCJ A;  2R0D A;  3HW2 B;  3PZD A;  1GC6 A;  1X1G A;  1XX0 A;  3LJU X;  1MKE A;  1DBH A;  2NBV A;  2Y8F A;  1RRP B;  2D9Y A;  4ZRI A;  5JHG A;  5LON B;  2DX5 A;  5C5B A;  2UVM A;  3MPX A;  2HE7 A;  3ZDT A;  3M1I B;  1U5G A;  1H4R A;  2YF0 A;  2DKP A;  2Q13 A;  3KRX A;  2I1K A;  3ODO A;  3FM8 C;  5CLQ B;  1AWE A;  2VKI A;  3QBV B;  2YS3 A;  4HDO A;  4QJ3 B;  1DDW A;  1FHO A;  4ZRJ A;  2M14 A;  4CHJ A;  5EFX A;  3P7Z A;  1FAO A;  2YVC A;  1EGX A;  3NWF A;  5J3Q A;  2D9V A;  4L1R A;  5HE2 A;  1NTV A;  1MK9 B;  1ZM0 A;  4HHV A;  1T77 A;  4GNK B;  5JHH A;  1X05 A;  5DHA B;  2P0F A;  2E2X A;  4GMX B;  4HAV B;  2UZR A;  1ZC3 B;  3AU4 A;  5LOP B;  4NY0 A;  2OQB A; 
#chains in the Genus database with same CATH homology
 4PNK A;  3UZT A;  1MIX A;  3GYO A;  2W2X D;  3DXE A;  3NSU A;  3PG7 A;  1XCG A;  1V61 A;  5CLL B;  1DDM A;  1FHW A;  4HB2 B;  2MKR A;  3D8D A;  1EAZ A;  4K2P A;  2DHI A;  5KQ4 A;  2ADZ A;  4MK0 A;  2N23 A;  2VRW B;  1DYN A;  3F0W A;  2G35 A;  3BIN A;  4P7I A;  4EJN A;  5D3V A;  3OAN A;  4C0A A;  1KZ7 A;  1XD4 A;  1P5T A;  3VIA A;  2PZ1 A;  1RJ2 A;  1FGZ A;  3TVV A;  2I1J A;  1TXD A;  2CY4 A;  3GYP A;  1LW3 A;  2YS1 A;  1XKE A;  2COA A;  3PEG A;  1K5G B;  1OMW A;  4GZU A;  2RNR B;  5D3Y A;  3DXD A;  3WYF B;  2ZPY A;  1Q67 A;  2IYB A;  1XR0 B;  4F7G A;  2EC1 A;  2ELB A;  2YT1 A;  2CAY A;  3WA0 A;  2OTX A;  4GN1 A;  4HAW B;  3FEH A;  1I2H A;  1W1H A;  4KAX B;  3V5W A;  5J3T A;  1UEF A;  4GXB A;  1GG3 A;  1DDV A;  4TKN A;  2NMB A;  2J0M A;  5HE1 A;  5FI0 A;  5JP4 A;  4K2O A;  1V89 A;  3BJI A;  1U27 A;  2P0D A;  3TCA A;  2COD A;  3D8E A;  1V5M A;  4CHM A;  4YL8 A;  1J19 A;  1BTK A;  1NU2 A;  4CYE A;  1TJ6 A;  5JLJ B;  4HAU B;  1WJ1 A;  3T06 A;  4PQ0 A;  3PVL A;  5D3X A;  1FGY A;  2H7E A;  5D27 A;  4IAP A;  1MPH A;  1IRS A;  2RVB B;  3VOQ A;  2MWN B;  2UZS A;  1LB1 A;  3A8Q A;  2GCL A;  3RCP A;  3ZVR A;  5KQ1 A;  4HB4 B;  1TQZ A;  2I5C A;  2J59 M;  5C79 A;  2H7D A;  2Y8G A;  5C16 A;  2L2I A;  3O96 A;  1Z87 A;  2AEH A;  1EVH A;  5C6R A;  1AQC A;  2RGN B;  2RUK B;  5DHF B;  2DLW A;  3F5R A;  4EMO A;  2Z0O A;  3ODW A;  2D9Z A;  2GCJ A;  4HB0 B;  3SO6 A;  2YRY A;  2JP2 A;  3AJ4 A;  1P6S A;  2W2W A;  4A6H A;  2KCJ A;  2YS5 A;  4Z2M B;  1WI1 A;  3PSC A;  5FI1 A;  1ZVR A;  4KHB B;  1Y19 B;  3TFM A;  2FJL A;  2W2X C;  2D2Q A;  1WGU A;  1DRO A;  2COF A;  3U7D A;  2VSZ A;  2D4Q A;  2ROZ B;  1MK7 B;  4HB3 B;  2EMT A;  2HTH B;  3AU5 A;  4A6F A;  4KHA A;  2LOZ A;  1PFJ A;  3CXB B;  2RSG A;  2LG1 A;  3A8P A;  3QIJ A;  4HDQ A;  2D9W A;  4EKU A;  2EMS A;  3PVW A;  4H8S A;  5DH9 B;  1J0W A;  1BTN A;  1K5D B;  3U8Z A;  2RLO A;  1W1D A;  3KSY A;  1U5F A;  1X86 A;  2DA0 A;  2XQN M;  4NSW A;  2LKO A;  2LUL A;  1U2B A;  3ODX A;  2DHK A;  4DXA B;  2DHJ A;  1I7A A;  2KGX B;  4F7H A;  2KUP A;  2YT0 A;  2QKM A;  2V76 A;  2MDX A;  3PVU A;  3X23 A;  3A98 B;  1EF1 A;  5HE0 A;  3ML4 A;  4Z2N A;  4GMV A;  4WVF B;  1V5U A;  1ZC4 B;  1W1G A;  1FHX A;  1UNQ A;  1OY2 A;  2Z0Q A;  3PP2 A;  1H10 A;  2L1C A;  1NTY A;  5DI9 B;  2M38 A;  2NZ8 B;  1MIZ B;  3SYX A;  2DTC A;  1QQG A;  1QC6 A;  4B6H A;  3SUZ A;  2YSZ A;  3QWM A;  4A6K A;  1SHC A;  2J0J A;  1E5W A;  1BWN A;  5C5B B;  2AL6 A;  1V88 A;  3FSS A;  1KI1 B;  2Y7B A;  1OQN A;  2D11 A;  4WSF A;  3N7C A;  4KHO A;  3HK0 A;  1NI2 A;  2DKQ A;  1Y5O A;  4TYZ A;  2I5F A;  1KZG A;  5KCV A;  2LOX A;  4DX8 A;  3P6A A;  3CIK A;  4F7U P;  1FB8 A;  2QKL A;  1WVH A;  3KZ1 A;  4A6F B;  2CY5 A;  1P3R A;  4A5K A;  1V5P A;  1PMS A;  2K2J A;  2X18 A;  4HAY B;  2GJY A;  4L6E A;  2ELA A;  1WG7 A;  3MDB C;  4YON A;  4MY6 A;  1U5D A;  2MFQ A;  2DN6 A;  4XWX A;  1XOD A;  4KVG B;  1FOE A;  4GPT B;  1WGQ A;  2ROV A;  1MAI A;  1B55 A;  2K2U A;  4K17 A;  1BAK A;  2LYD A;  1U5E A;  2DYN A;  5L81 A;  3IVF A;  3D8F A;  4HAZ B;  4DX9 0;  2CRF A;  3G9W A;  3ULB A;  4ZRK A;  4HAX B;  2COC A;  1ISN A;  3SV1 A;  5DIF B;  1X1F A;  2K00 A;  3TO1 A;  2DYQ A;  2D9X A;  2N0Y A;  2R09 A;  1N3H A;  3ULC A;  4MT7 A;  3HQC A;  4K81 A;  5J3Y A;  2EJ8 A;  5D3W A;  1GC7 A;  4BBK A;  1UPR A;  2P0H A;  3DXC A;  1ZSQ A;  1UNP A;  1M7R A;  2J0K A;  1SGH A;  1M7E A;  4HAT B;  5HE3 A;  3KRW A;  4IFS A;  1UNR A;  5GOW B;  1UPQ A;  2Z0P A;  4IOY X;  4DBB A;  4Y94 A;  3SNH A;  2IFS A;  3KY9 A;  2P8V A;  1PLS A;  2D10 A;  2DX1 A;  2DFK A;  1X11 A;  4D0N B;  1U29 A;  2GS0 A;  3TW1 A;  4WJ7 A;  1WJM A;  2BCJ A;  2R0D A;  3HW2 B;  3PZD A;  1GC6 A;  1X1G A;  1XX0 A;  3LJU X;  1MKE A;  1DBH A;  2Y8F A;  1RRP B;  2D9Y A;  4ZRI A;  5JHG A;  5LON B;  2DX5 A;  5C5B A;  2UVM A;  3MPX A;  2HE7 A;  3ZDT A;  3M1I B;  1U5G A;  1H4R A;  2YF0 A;  2DKP A;  2Q13 A;  3KRX A;  2I1K A;  3ODO A;  3FM8 C;  5CLQ B;  1AWE A;  2VKI A;  3QBV B;  2YS3 A;  4HDO A;  1FHO A;  1DDW A;  4ZRJ A;  2M14 A;  4CHJ A;  5EFX A;  3P7Z A;  1FAO A;  2YVC A;  1EGX A;  5J3Q A;  2D9V A;  5HE2 A;  1NTV A;  1MK9 B;  1ZM0 A;  4HHV A;  5JHH A;  1X05 A;  5DHA B;  2P0F A;  2E2X A;  4GMX B;  4HAV B;  2UZR A;  1ZC3 B;  3AU4 A;  5LOP B;  4NY0 A;  2OQB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...