1TXDA

Crystal structure of the dh/ph domains of leukemia-associated rhogef
Total Genus 127
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
127
sequence length
373
structure length
352
Chain Sequence
PPNWQQLVSREVLLGLKPCEIKRQEVINELFYTERAHVRTLKVLDQVFYQRVSREGILSPSELRKIFSNLEDILQLHIGLNEQMKAVRKRNETSVIDQIGEDLLTWFSGPGEEKLKHAAATFCSNQPFALEMIKSRQKKDSRFQTFVQDAESNPLCRRLQLKDIIPTQMQRLTKYPLLLDNIAKYTEWPTEREKVKKAADHCRQILNFVNQAVKEAENKQRLEDYQRRLDTSSLVEELRNLDLTKRKMIHEGPLVWKVNRDKTIDLYTLLLEDILVLLQKQDDRLVLRCTFSPVIKLSTVLVRQVATNKALFVISMSDNGAQIYELVAQTVSEKTVWQDLICRMAASVKEQS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural determinants of RhoA binding and nucleotide exchange in leukemia-associated Rho guanine-nucleotide exchange factor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords Rho guanine nucleotide exchange factor 12
total genus 127
structure length 352
sequence length 373
ec nomenclature
pdb deposition date 2004-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00621 RhoGEF RhoGEF domain
A PF17838 PH_16 PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.900.10 Mainly Alpha Up-down Bundle Dbl Homology Domain; Chain A Dbl homology (DH) domain 1txdA01
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1txdA02
4A6FA 2EJ8A 2ADZA 1FHXA 2QKMA 4GPTB 4WJ7A 2VSZA 1U5DA 1V89A 3MDBC 4A6FB 1DDMA 2M14A 1X1GA 1AQCA 1FOEA 2D9YA 3QWMA 4GN1A 5LOPB 4IFSA 3A8PA 4F7UP 2G35A 1MIZB 1P6SA 1Y19B 3BINA 3TW1A 5C79A 1SHCA 1OMWA 3AU4A 1U5GA 1K5DB 5D3XA 1GC6A 2KR9A 1I7AA 4DX8A 1NI2A 1V5MA 2D9ZA 3SYXA 2YSZA 1XX0A 1OY2A 1MK9B 1P3RA 5L81A 1V61A 4C0AA 4EJNA 2QKLA 4HDQA 2D10A 4XWXA 3VOQA 1PFJA 3U7DA 5D3YA 1FGYA 4KVGB 2EMSA 1FGZA 1UEFA 3SV1A 5C5BA 1FAOA 5C6RA 1LB1A 1U29A 5D27A 1ZC3B 4D0OA 3D8EA 4HDOA 2EMTA 3FEHA 2Y7BA 1IRSA 4YL8A 2DFKA 2K2JA 5D3WA 3VIAA 1E5WA 1WGQA 2DA0A 4HB4B 2MWNB 2D11A 1QC6A 1NTVA 2Z0QA 4P7IA 4WSFA 1Z87A 3KY9A 1MPHA 1V88A 2DX1A 3TCAA 4CYEA 1AWEA 2DLWA 4K17A 2N23A 2LOXA 2W2XC 2MFQA 2I1JA 1ZM0A 2ELBA 2RNRB 2V76A 4DX90 4K2OA 3ML4A 4A6HA 4A6KA 3FSSA 2COCA 4GOUA 1GG3A 2LKOA 3X23A 2HE7A 4IOYX 3D8FA 2J0MA 5KQ1A 5HE3A 4NSWA 4DXAB 1Y5OA 3GF9A 5J3TA 2UVMA 4HATB 4L6EA 4PQ0A 4CHMA 4GMVA 4GYVA 1WJMA 1XODA 2YT0A 3PG7A 3KZ1A 2Z0OA 2COFA 2D4QA 2X18A 1ISNA 3DXEA 3ZVRA 1Q67A 1WGUA 2KGXB 4MK0A 1ZSQA 3V5WA 2Q13A 1BAKA 1I2HA 5EFXA 4IAPA 2DKPA 1RRPB 2I1KA 2FJLA 4B6HA 5HE1A 2RLOA 2I5CA 2Y8GA 2BCJA 3QIJA 1MAIA 2H7DA 1EVHA 4H8SA 1EF1A 4Z2NA 2DHJA 1XCGA 1W1GA 3KRXA 3HQCA 3CXBB 1KZGA 4D0NB 2ROVA 1XD4A 1BTNA 4F7HA 1WI1A 3ULBA 3AJ4A 2VRWB 3QBVB 2ELAA 1BWNA 3P6AA 1KI1B 2MKRA 1J19A 1EAZA 2YS3A 5DI9B 1DBHA 5C5BB 3D8DA 3TO1A 1NTYA 5J3YA 3PZDA 4ZRJA 2D2QA 1DDWA 5CLLB 1V5PA 4KHAA 3HW2B 3RCPA 1LW3A 2J59M 2M38A 3TFMA 2NZ8B 2DX5A 2JP2A 1UNRA 5JP4A 5HE2A 1EGXA 2L1CA 2CY5A 1XKEA 5C16A 3F5RA 2D9XA 2XQNM 4HHVA 2COAA 5FI1A 4BBKA 1F5XA 5D3VA 4NY0A 1M7EA 3EO2A 4MY6A 1H10A 4HAYB 1DROA 2AEHA 3SNHA 2J0KA 4KHOA 3O96A 1FB8A 4HB3B 5KQ4A 3UZTA 2K2UA 3FM8C 2ZPYA 2W2WA 4K2PA 2D9WA 1WG7A 5DHAB 2OTXA 5JLJB 3BJIA 4HAVB 1V5UA 2UZRA 4Z2MB 1UNQA 3P7ZA 3G9WA 2DN6A 3MPXA 3T06A 4WVFB 1OQNA 4GZUA 5HE0A 2GJYA 2H7EA 2CODA 2YF0A 1ZC4B 4TKNA 5FI0A 2NMBA 2P0DA 4KAXB 3PP2A 1PLSA 1U2BA 4HAZB 2PZ1A 1MIXA 2AL6A 2RGNB 3U8ZA 2KUPA 2YVCA 2CY4A 4GMXB 5KCVA 1MKEA 3DXDA 1GC7A 2ROZB 5DHFB 3LJUX 4ZRKA 2E2XA 1DYNA 3AU5A 4HB2B 2GCJA 2OQBA 3WA0A 1BY1A 4HB0B 2YS5A 1X86A 1KZ7A 2MDXA 2GS0A 3A98B 1UNPA 1X05A 5DH9B 1NU2A 4PNKA 2HTHB 2Y8FA 3F0WA 1U5FA 1M7RA 3PSCA 2DKQA 2DYQA 2YRYA 4F7GA 5DIFB 2J0JA 2RUKB 1X1FA 2L2IA 2VKIA 4ZRIA 1TJ6A 1XR0B 2RSGA 4CHJA 2LOZA 2P8VA 1ZVRA 1J0WA 2GCLA 2D9VA 2R0DA 5JHGA 3ODXA 3ULCA 1RJ2A 4A5KA 3PVWA 4MT7A 1P5TA 3KRWA 1U5EA 2KCJA 1SGHA 2IYBA 1UPRA 5LONB 4K81A 1W1HA 2W2XD 2YT1A 4Y94A 1TQZA 2UZSA 1X11A 4KHBB 5CLQB 1H4RA 1WVHA 2K00A 3HK0A 3PEGA 4YONA 3DXCA 2RVBB 2DHIA 3M1IB 3ODOA 1PMSA 3ODWA 2R09A 2I5FA 3KSYA 4HAWB 1BTKA 2LULA 4EMOA 5GOWB 2DTCA 2DYNA 3WYFB 3N7CA 3TVVA 1TXDA 2CAYA 5JHHA 3GYPA 1FHOA 3PVLA 3PVUA 1B55A 2CRFA 4TYZA 1DDVA 4HAUB 1FHWA 1U27A 2IFSA 3OANA 3SO6A 1WJ1A 3IVFA 2DHKA 5J3QA 4HAXB 3NSUA 1N3HA 3CIKA 4GXBA 1UPQA 1K5GB 2LYDA 1QQGA 2YS1A 2P0HA 2Z0PA 4EKUA 3A8QA 2N0YA 1MK7B 2P0FA 2EC1A 3GYOA 3ZDTA 3JV3A 3SUZA 1W1DA 2LG1A 4DBBA
chains in the Genus database with same CATH superfamily
4A6FA 2EJ8A 2ADZA 1FHXA 2QKMA 2NBVA 4GPTB 2VSZA 4WJ7A 1U5DA 1V89A 3MDBC 4A6FB 1DDMA 2M14A 4DIXA 2KUQA 1X1GA 1AQCA 5M4YB 1FOEA 2D9YA 3QWMA 4GN1A 5LOPB 4IFSA 3A8PA 4F7UP 2G35A 1MIZB 1P6SA 1Y19B 3BINA 3TW1A 5C79A 1SHCA 1OMWA 3AU4A 1U5GA 1K5DB 5D3XA 1GC6A 2KR9A 1I7AA 1MI1A 4DX8A 1NI2A 1V5MA 2D9ZA 3SYXA 2YSZA 1XX0A 1OY2A 4HSIA 1MK9B 1P3RA 4CSQA 5L81A 4QJ3B 1V61A 4C0AA 4EJNA 2QKLA 4HDQA 2RRFA 2D10A 4XWXA 3VOQA 1PFJA 3U7DA 5D3YA 1FGYA 4KVGB 2EMSA 4OSNA 1FGZA 1UEFA 3SV1A 5C5BA 1FAOA 5C6RA 1LB1A 3FVCA 1U29A 5D27A 1ZC3B 4D0OA 3D8EA 4HDOA 2EMTA 3FEHA 2Y7BA 1IRSA 4YL8A 2DFKA 2K2JA 5D3WA 3VIAA 1E5WA 1WGQA 2DA0A 4HB4B 2MWNB 2D11A 1QC6A 1NTVA 2Z0QA 4P7IA 4WSFA 1Z87A 3KY9A 2KR0A 4OT1A 1T77A 1MPHA 1V88A 2DX1A 3TCAA 4CYEA 1AWEA 2DLWA 4K17A 2N23A 2LOXA 2W2XC 2MFQA 2I1JA 1ZM0A 2ELBA 2RNRB 2V76A 4DX90 4K2OA 3ML4A 4A6HA 4A6KA 3FSSA 2COCA 4GOUA 1GG3A 2LKOA 2KIEA 3X23A 2HE7A 4IOYX 3D8FA 2J0MA 5KQ1A 5HE3A 4NSWA 2K49A 4DXAB 1Y5OA 3GF9A 5J3TA 2UVMA 4HATB 4L6EA 4QXAB 4PQ0A 3NW8A 4CHMA 4GMVA 4GYVA 1WJMA 1XODA 2YT0A 3PG7A 3KZ1A 2Z0OA 2COFA 2D4QA 2X18A 1ISNA 3DXEA 3ZVRA 1Q67A 4GNKB 1WGUA 2KGXB 4MK0A 1ZSQA 3V5WA 2Q13A 1BAKA 1I2HA 5EFXA 4IAPA 2DKPA 1RRPB 2I1KA 2FJLA 4B6HA 5HE1A 2RLOA 2I5CA 2Y8GA 2BCJA 3QIJA 1MAIA 2H7DA 1EVHA 4H8SA 1EF1A 4Z2NA 2DHJA 1XCGA 1W1GA 3KRXA 3HQCA 3CXBB 1KZGA 4D0NB 2ROVA 1XD4A 1BTNA 4F7HA 1WI1A 3ULBA 3AJ4A 2VRWB 3QBVB 2ELAA 1BWNA 3P6AA 1KI1B 2MKRA 2KIGA 2R2YA 1J19A 1EAZA 2YS3A 5DI9B 1DBHA 5C5BB 3D8DA 3TO1A 1NTYA 5J3YA 3PZDA 2Z59A 4ZRJA 2D2QA 1DDWA 5CLLB 1V5PA 1ZYIA 4KHAA 3HW2B 3RCPA 1LW3A 2J59M 2M38A 3TFMA 2NZ8B 2DX5A 2JP2A 1UNRA 5JP4A 5HE2A 1EGXA 2L1CA 2CY5A 1XKEA 5C16A 3OHMB 3F5RA 2D9XA 2XQNM 3NWAA 4HHVA 5IRSA 2COAA 5FI1A 4BBKA 1F5XA 5D3VA 3DCXA 4NY0A 1M7EA 3HIEA 3EO2A 4MY6A 1H10A 4HAYB 1DROA 2AEHA 3SNHA 2J0KA 4KHOA 3O96A 1FB8A 4HB3B 5KQ4A 3UZTA 2K2UA 2K8EA 3FM8C 2ZPYA 2FJUB 2W2WA 4K2PA 2D9WA 1WG7A 5DHAB 2OTXA 3HSAA 5JLJB 3BJIA 4HAVB 1V5UA 2UZRA 5I2SA 4Z2MB 1UNQA 3P7ZA 3G9WA 2DN6A 3MPXA 3T06A 4WVFB 4QJ5B 1OQNA 4GZUA 5HE0A 2GJYA 2H7EA 2CODA 2YF0A 1ZC4B 4TKNA 5FI0A 2NMBA 2P0DA 4KAXB 3PP2A 1PLSA 1U2BA 4HAZB 2PZ1A 1MIXA 2AL6A 2RGNB 3U8ZA 2KUPA 2YVCA 2CY4A 2Z13A 4GMXB 5KCVA 1MKEA 3DXDA 1GC7A 2ROZB 5DHFB 2Z14A 3LJUX 4ZRKA 2E2XA 1DYNA 3AU5A 4HB2B 2GCJA 2OQBA 3WA0A 4QJ4B 1BY1A 4HB0B 2YS5A 1X86A 1KZ7A 2MDXA 2GS0A 3A98B 1UNPA 1X05A 5LG4B 5DH9B 1NU2A 4PNKA 2HTHB 2Y8FA 3F0WA 1U5FA 1M7RA 3PSCA 2DKQA 2DYQA 2YRYA 4F7GA 5DIFB 2J0JA 2RUKB 1X1FA 2L2IA 2VKIA 3B77A 4ZRIA 1TJ6A 1XR0B 2RSGA 4CHJA 3NWFA 2LOZA 2P8VA 1ZVRA 1J0WA 2GCLA 2D9VA 5I2MA 2R0DA 5JHGA 3ODXA 4L1RA 3ULCA 1RJ2A 4A5KA 3PVWA 4MT7A 4D6WA 1P5TA 3KRWA 4KHBA 1U5EA 2KCJA 1SGHA 2IYBA 1UPRA 5LONB 4K81A 1W1HA 2W2XD 2YT1A 4Y94A 1TQZA 2UZSA 1X11A 4KHBB 3NWDA 2Z4DA 1H4RA 1WVHA 5CLQB 2K00A 3HK0A 3PEGA 4YONA 3DXCA 2RVBB 2DHIA 3M1IB 3ODOA 1PMSA 3ODWA 2ZKMX 2GUMA 2R09A 2I5FA 3KSYA 4HAWB 1BTKA 2LULA 4EMOA 5GOWB 2DTCA 3A58A 2DYNA 3WYFB 3N7CA 3TVVA 1TXDA 2CAYA 2YT2A 5JHHA 3GYPA 1FHOA 3PVLA 3PVUA 1B55A 2CRFA 4TYZA 1DDVA 4HAUB 1FHWA 1U27A 2IFSA 3OANA 3SO6A 1WJ1A 3IVFA 2DHKA 5J3QA 4HAXB 3NSUA 1N3HA 3U12A 3CIKA 1UPQA 2LYDA 1K5GB 4GXBA 1QQGA 2YS1A 2P0HA 2Z0PA 4EKUA 3A8QA 2N0YA 1MK7B 2P0FA 2EC1A 3GYOA 3ZDTA 3JV3A 3SUZA 1W1DA 2LG1A 4DBBA
chains in the Genus database with same CATH topology
4A6FA 2EJ8A 2ADZA 1FHXA 2QKMA 4GPTB 4WJ7A 2VSZA 1U5DA 1V89A 3MDBC 4A6FB 1DDMA 2M14A 1X1GA 1AQCA 1FOEA 2D9YA 3QWMA 4GN1A 5LOPB 4IFSA 3A8PA 4F7UP 2G35A 1MIZB 1P6SA 1Y19B 3BINA 3TW1A 5C79A 1SHCA 1OMWA 3AU4A 1U5GA 1K5DB 5D3XA 1GC6A 2KR9A 1I7AA 4DX8A 1NI2A 1V5MA 2D9ZA 3SYXA 2YSZA 1XX0A 1OY2A 1MK9B 1P3RA 5L81A 1V61A 4C0AA 4EJNA 2QKLA 4HDQA 2D10A 4XWXA 3VOQA 1PFJA 3U7DA 5D3YA 1FGYA 4KVGB 2EMSA 1FGZA 1UEFA 3SV1A 5C5BA 1FAOA 5C6RA 1LB1A 1U29A 5D27A 1ZC3B 4D0OA 3D8EA 4HDOA 2EMTA 3FEHA 2Y7BA 1IRSA 4YL8A 2DFKA 2K2JA 5D3WA 3VIAA 1E5WA 1WGQA 2DA0A 4HB4B 2MWNB 2D11A 1QC6A 1NTVA 2Z0QA 4P7IA 4WSFA 1Z87A 3KY9A 1MPHA 1V88A 2DX1A 3TCAA 4CYEA 1AWEA 2DLWA 4K17A 2N23A 2LOXA 2W2XC 2MFQA 2I1JA 1ZM0A 2ELBA 2RNRB 2V76A 4DX90 4K2OA 3ML4A 4A6HA 4A6KA 3FSSA 2COCA 4GOUA 1GG3A 2LKOA 3X23A 2HE7A 4IOYX 3D8FA 2J0MA 5KQ1A 5HE3A 4NSWA 4DXAB 1Y5OA 3GF9A 5J3TA 2UVMA 4HATB 4L6EA 4PQ0A 4CHMA 4GMVA 4GYVA 1WJMA 1XODA 2YT0A 3PG7A 3KZ1A 2Z0OA 2COFA 2D4QA 2X18A 1ISNA 3DXEA 3ZVRA 1Q67A 1WGUA 2KGXB 4MK0A 1ZSQA 3V5WA 2Q13A 1BAKA 1I2HA 5EFXA 4IAPA 2DKPA 1RRPB 2I1KA 2FJLA 4B6HA 5HE1A 2RLOA 2I5CA 2Y8GA 2BCJA 3QIJA 1MAIA 2H7DA 1EVHA 4H8SA 1EF1A 4Z2NA 2DHJA 1XCGA 1W1GA 3KRXA 3HQCA 3CXBB 1KZGA 4D0NB 2ROVA 1XD4A 1BTNA 4F7HA 1WI1A 3ULBA 3AJ4A 2VRWB 3QBVB 2ELAA 1BWNA 3P6AA 1KI1B 2MKRA 1J19A 1EAZA 2YS3A 5DI9B 1DBHA 5C5BB 3D8DA 3TO1A 1NTYA 5J3YA 3PZDA 4ZRJA 2D2QA 1DDWA 5CLLB 1V5PA 4KHAA 3HW2B 3RCPA 1LW3A 2J59M 2M38A 3TFMA 2NZ8B 2DX5A 2JP2A 1UNRA 5JP4A 5HE2A 1EGXA 2L1CA 2CY5A 1XKEA 5C16A 3F5RA 2D9XA 2XQNM 4HHVA 2COAA 5FI1A 4BBKA 1F5XA 5D3VA 4NY0A 1M7EA 3EO2A 4MY6A 1H10A 4HAYB 1DROA 2AEHA 3SNHA 2J0KA 4KHOA 3O96A 1FB8A 4HB3B 5KQ4A 3UZTA 2K2UA 3FM8C 2ZPYA 2W2WA 4K2PA 2D9WA 1WG7A 5DHAB 2OTXA 5JLJB 3BJIA 4HAVB 1V5UA 2UZRA 4Z2MB 1UNQA 3P7ZA 3G9WA 2DN6A 3MPXA 3T06A 4WVFB 1OQNA 4GZUA 5HE0A 2GJYA 2H7EA 2CODA 2YF0A 1ZC4B 4TKNA 5FI0A 2NMBA 2P0DA 4KAXB 3PP2A 1PLSA 1U2BA 4HAZB 2PZ1A 1MIXA 2AL6A 2RGNB 3U8ZA 2KUPA 2YVCA 2CY4A 4GMXB 5KCVA 1MKEA 3DXDA 1GC7A 2ROZB 5DHFB 3LJUX 4ZRKA 2E2XA 1DYNA 3AU5A 4HB2B 2GCJA 2OQBA 3WA0A 1BY1A 4HB0B 2YS5A 1X86A 1KZ7A 2MDXA 2GS0A 3A98B 1UNPA 1X05A 5DH9B 1NU2A 4PNKA 2HTHB 2Y8FA 3F0WA 1U5FA 1M7RA 3PSCA 2DKQA 2DYQA 2YRYA 4F7GA 5DIFB 2J0JA 2RUKB 1X1FA 2L2IA 2VKIA 4ZRIA 1TJ6A 1XR0B 2RSGA 4CHJA 2LOZA 2P8VA 1ZVRA 1J0WA 2GCLA 2D9VA 2R0DA 5JHGA 3ODXA 3ULCA 1RJ2A 4A5KA 3PVWA 4MT7A 1P5TA 3KRWA 1U5EA 2KCJA 1SGHA 2IYBA 1UPRA 5LONB 4K81A 1W1HA 2W2XD 2YT1A 4Y94A 1TQZA 2UZSA 1X11A 4KHBB 5CLQB 1H4RA 1WVHA 2K00A 3HK0A 3PEGA 4YONA 3DXCA 2RVBB 2DHIA 3M1IB 3ODOA 1PMSA 3ODWA 2R09A 2I5FA 3KSYA 4HAWB 1BTKA 2LULA 4EMOA 5GOWB 2DTCA 2DYNA 3WYFB 3N7CA 3TVVA 1TXDA 2CAYA 5JHHA 3GYPA 1FHOA 3PVLA 3PVUA 1B55A 2CRFA 4TYZA 1DDVA 4HAUB 1FHWA 1U27A 2IFSA 3OANA 3SO6A 1WJ1A 3IVFA 2DHKA 5J3QA 4HAXB 3NSUA 1N3HA 3CIKA 4GXBA 1UPQA 1K5GB 2LYDA 1QQGA 2YS1A 2P0HA 2Z0PA 4EKUA 3A8QA 2N0YA 1MK7B 2P0FA 2EC1A 3GYOA 3ZDTA 3JV3A 3SUZA 1W1DA 2LG1A 4DBBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A6F A;  2EJ8 A;  2ADZ A;  1FHX A;  2QKM A;  4GPT B;  4WJ7 A;  2VSZ A;  1U5D A;  1V89 A;  3MDB C;  4A6F B;  1DDM A;  2M14 A;  1X1G A;  1AQC A;  1FOE A;  2D9Y A;  3QWM A;  4GN1 A;  5LOP B;  4IFS A;  3A8P A;  4F7U P;  2G35 A;  1MIZ B;  1P6S A;  1Y19 B;  3BIN A;  3TW1 A;  5C79 A;  1SHC A;  1OMW A;  3AU4 A;  1U5G A;  1K5D B;  5D3X A;  1GC6 A;  2KR9 A;  1I7A A;  4DX8 A;  1NI2 A;  1V5M A;  2D9Z A;  3SYX A;  2YSZ A;  1XX0 A;  1OY2 A;  1MK9 B;  1P3R A;  5L81 A;  1V61 A;  4C0A A;  4EJN A;  2QKL A;  4HDQ A;  2D10 A;  4XWX A;  3VOQ A;  1PFJ A;  3U7D A;  5D3Y A;  1FGY A;  4KVG B;  2EMS A;  1FGZ A;  1UEF A;  3SV1 A;  5C5B A;  1FAO A;  5C6R A;  1LB1 A;  1U29 A;  5D27 A;  1ZC3 B;  4D0O A;  3D8E A;  4HDO A;  2EMT A;  3FEH A;  2Y7B A;  1IRS A;  4YL8 A;  2DFK A;  2K2J A;  5D3W A;  3VIA A;  1E5W A;  1WGQ A;  2DA0 A;  4HB4 B;  2MWN B;  2D11 A;  1QC6 A;  1NTV A;  2Z0Q A;  4P7I A;  4WSF A;  1Z87 A;  3KY9 A;  1MPH A;  1V88 A;  2DX1 A;  3TCA A;  4CYE A;  1AWE A;  2DLW A;  4K17 A;  2N23 A;  2LOX A;  2W2X C;  2MFQ A;  2I1J A;  1ZM0 A;  2ELB A;  2RNR B;  2V76 A;  4DX9 0;  4K2O A;  3ML4 A;  4A6H A;  4A6K A;  3FSS A;  2COC A;  4GOU A;  1GG3 A;  2LKO A;  3X23 A;  2HE7 A;  4IOY X;  3D8F A;  2J0M A;  5KQ1 A;  5HE3 A;  4NSW A;  4DXA B;  1Y5O A;  3GF9 A;  5J3T A;  2UVM A;  4HAT B;  4L6E A;  4PQ0 A;  4CHM A;  4GMV A;  4GYV A;  1WJM A;  1XOD A;  2YT0 A;  3PG7 A;  3KZ1 A;  2Z0O A;  2COF A;  2D4Q A;  2X18 A;  1ISN A;  3DXE A;  3ZVR A;  1Q67 A;  1WGU A;  2KGX B;  4MK0 A;  1ZSQ A;  3V5W A;  2Q13 A;  1BAK A;  1I2H A;  5EFX A;  4IAP A;  2DKP A;  1RRP B;  2I1K A;  2FJL A;  4B6H A;  5HE1 A;  2RLO A;  2I5C A;  2Y8G A;  2BCJ A;  3QIJ A;  1MAI A;  2H7D A;  1EVH A;  4H8S A;  1EF1 A;  4Z2N A;  2DHJ A;  1XCG A;  1W1G A;  3KRX A;  3HQC A;  3CXB B;  1KZG A;  4D0N B;  2ROV A;  1XD4 A;  1BTN A;  4F7H A;  1WI1 A;  3ULB A;  3AJ4 A;  2VRW B;  3QBV B;  2ELA A;  1BWN A;  3P6A A;  1KI1 B;  2MKR A;  1J19 A;  1EAZ A;  2YS3 A;  5DI9 B;  1DBH A;  5C5B B;  3D8D A;  3TO1 A;  1NTY A;  5J3Y A;  3PZD A;  4ZRJ A;  2D2Q A;  1DDW A;  5CLL B;  1V5P A;  4KHA A;  3HW2 B;  3RCP A;  1LW3 A;  2J59 M;  2M38 A;  3TFM A;  2NZ8 B;  2DX5 A;  2JP2 A;  1UNR A;  5JP4 A;  5HE2 A;  1EGX A;  2L1C A;  2CY5 A;  1XKE A;  5C16 A;  3F5R A;  2D9X A;  2XQN M;  4HHV A;  2COA A;  5FI1 A;  4BBK A;  1F5X A;  5D3V A;  4NY0 A;  1M7E A;  3EO2 A;  4MY6 A;  1H10 A;  4HAY B;  1DRO A;  2AEH A;  3SNH A;  2J0K A;  4KHO A;  3O96 A;  1FB8 A;  4HB3 B;  5KQ4 A;  3UZT A;  2K2U A;  3FM8 C;  2ZPY A;  2W2W A;  4K2P A;  2D9W A;  1WG7 A;  5DHA B;  2OTX A;  5JLJ B;  3BJI A;  4HAV B;  1V5U A;  2UZR A;  4Z2M B;  1UNQ A;  3P7Z A;  3G9W A;  2DN6 A;  3MPX A;  3T06 A;  4WVF B;  1OQN A;  4GZU A;  5HE0 A;  2GJY A;  2H7E A;  2COD A;  2YF0 A;  1ZC4 B;  4TKN A;  5FI0 A;  2NMB A;  2P0D A;  4KAX B;  3PP2 A;  1PLS A;  1U2B A;  4HAZ B;  2PZ1 A;  1MIX A;  2AL6 A;  2RGN B;  3U8Z A;  2KUP A;  2YVC A;  2CY4 A;  4GMX B;  5KCV A;  1MKE A;  3DXD A;  1GC7 A;  2ROZ B;  5DHF B;  3LJU X;  4ZRK A;  2E2X A;  1DYN A;  3AU5 A;  4HB2 B;  2GCJ A;  2OQB A;  3WA0 A;  1BY1 A;  4HB0 B;  2YS5 A;  1X86 A;  1KZ7 A;  2MDX A;  2GS0 A;  3A98 B;  1UNP A;  1X05 A;  5DH9 B;  1NU2 A;  4PNK A;  2HTH B;  2Y8F A;  3F0W A;  1U5F A;  1M7R A;  3PSC A;  2DKQ A;  2DYQ A;  2YRY A;  4F7G A;  5DIF B;  2J0J A;  2RUK B;  1X1F A;  2L2I A;  2VKI A;  4ZRI A;  1TJ6 A;  1XR0 B;  2RSG A;  4CHJ A;  2LOZ A;  2P8V A;  1ZVR A;  1J0W A;  2GCL A;  2D9V A;  2R0D A;  5JHG A;  3ODX A;  3ULC A;  1RJ2 A;  4A5K A;  3PVW A;  4MT7 A;  1P5T A;  3KRW A;  1U5E A;  2KCJ A;  1SGH A;  2IYB A;  1UPR A;  5LON B;  4K81 A;  1W1H A;  2W2X D;  2YT1 A;  4Y94 A;  1TQZ A;  2UZS A;  1X11 A;  4KHB B;  5CLQ B;  1H4R A;  1WVH A;  2K00 A;  3HK0 A;  3PEG A;  4YON A;  3DXC A;  2RVB B;  2DHI A;  3M1I B;  3ODO A;  1PMS A;  3ODW A;  2R09 A;  2I5F A;  3KSY A;  4HAW B;  1BTK A;  2LUL A;  4EMO A;  5GOW B;  2DTC A;  2DYN A;  3WYF B;  3N7C A;  3TVV A;  1TXD A;  2CAY A;  5JHH A;  3GYP A;  1FHO A;  3PVL A;  3PVU A;  1B55 A;  2CRF A;  4TYZ A;  1DDV A;  4HAU B;  1FHW A;  1U27 A;  2IFS A;  3OAN A;  3SO6 A;  1WJ1 A;  3IVF A;  2DHK A;  5J3Q A;  4HAX B;  3NSU A;  1N3H A;  3CIK A;  4GXB A;  1UPQ A;  1K5G B;  2LYD A;  1QQG A;  2YS1 A;  2P0H A;  2Z0P A;  4EKU A;  3A8Q A;  2N0Y A;  1MK7 B;  2P0F A;  2EC1 A;  3GYO A;  3ZDT A;  3JV3 A;  3SUZ A;  1W1D A;  2LG1 A;  4DBB A; 
#chains in the Genus database with same CATH topology
 4A6F A;  2EJ8 A;  2ADZ A;  1FHX A;  2QKM A;  2NBV A;  4GPT B;  2VSZ A;  4WJ7 A;  1U5D A;  1V89 A;  3MDB C;  4A6F B;  1DDM A;  2M14 A;  4DIX A;  2KUQ A;  1X1G A;  1AQC A;  5M4Y B;  1FOE A;  2D9Y A;  3QWM A;  4GN1 A;  5LOP B;  4IFS A;  3A8P A;  4F7U P;  2G35 A;  1MIZ B;  1P6S A;  1Y19 B;  3BIN A;  3TW1 A;  5C79 A;  1SHC A;  1OMW A;  3AU4 A;  1U5G A;  1K5D B;  5D3X A;  1GC6 A;  2KR9 A;  1I7A A;  1MI1 A;  4DX8 A;  1NI2 A;  1V5M A;  2D9Z A;  3SYX A;  2YSZ A;  1XX0 A;  1OY2 A;  4HSI A;  1MK9 B;  1P3R A;  4CSQ A;  5L81 A;  4QJ3 B;  1V61 A;  4C0A A;  4EJN A;  2QKL A;  4HDQ A;  2RRF A;  2D10 A;  4XWX A;  3VOQ A;  1PFJ A;  3U7D A;  5D3Y A;  1FGY A;  4KVG B;  2EMS A;  4OSN A;  1FGZ A;  1UEF A;  3SV1 A;  5C5B A;  1FAO A;  5C6R A;  1LB1 A;  3FVC A;  1U29 A;  5D27 A;  1ZC3 B;  4D0O A;  3D8E A;  4HDO A;  2EMT A;  3FEH A;  2Y7B A;  1IRS A;  4YL8 A;  2DFK A;  2K2J A;  5D3W A;  3VIA A;  1E5W A;  1WGQ A;  2DA0 A;  4HB4 B;  2MWN B;  2D11 A;  1QC6 A;  1NTV A;  2Z0Q A;  4P7I A;  4WSF A;  1Z87 A;  3KY9 A;  2KR0 A;  4OT1 A;  1T77 A;  1MPH A;  1V88 A;  2DX1 A;  3TCA A;  4CYE A;  1AWE A;  2DLW A;  4K17 A;  2N23 A;  2LOX A;  2W2X C;  2MFQ A;  2I1J A;  1ZM0 A;  2ELB A;  2RNR B;  2V76 A;  4DX9 0;  4K2O A;  3ML4 A;  4A6H A;  4A6K A;  3FSS A;  2COC A;  4GOU A;  1GG3 A;  2LKO A;  2KIE A;  3X23 A;  2HE7 A;  4IOY X;  3D8F A;  2J0M A;  5KQ1 A;  5HE3 A;  4NSW A;  2K49 A;  4DXA B;  1Y5O A;  3GF9 A;  5J3T A;  2UVM A;  4HAT B;  4L6E A;  4QXA B;  4PQ0 A;  3NW8 A;  4CHM A;  4GMV A;  4GYV A;  1WJM A;  1XOD A;  2YT0 A;  3PG7 A;  3KZ1 A;  2Z0O A;  2COF A;  2D4Q A;  2X18 A;  1ISN A;  3DXE A;  3ZVR A;  1Q67 A;  4GNK B;  1WGU A;  2KGX B;  4MK0 A;  1ZSQ A;  3V5W A;  2Q13 A;  1BAK A;  1I2H A;  5EFX A;  4IAP A;  2DKP A;  1RRP B;  2I1K A;  2FJL A;  4B6H A;  5HE1 A;  2RLO A;  2I5C A;  2Y8G A;  2BCJ A;  3QIJ A;  1MAI A;  2H7D A;  1EVH A;  4H8S A;  1EF1 A;  4Z2N A;  2DHJ A;  1XCG A;  1W1G A;  3KRX A;  3HQC A;  3CXB B;  1KZG A;  4D0N B;  2ROV A;  1XD4 A;  1BTN A;  4F7H A;  1WI1 A;  3ULB A;  3AJ4 A;  2VRW B;  3QBV B;  2ELA A;  1BWN A;  3P6A A;  1KI1 B;  2MKR A;  2KIG A;  2R2Y A;  1J19 A;  1EAZ A;  2YS3 A;  5DI9 B;  1DBH A;  5C5B B;  3D8D A;  3TO1 A;  1NTY A;  5J3Y A;  3PZD A;  2Z59 A;  4ZRJ A;  2D2Q A;  1DDW A;  5CLL B;  1V5P A;  1ZYI A;  4KHA A;  3HW2 B;  3RCP A;  1LW3 A;  2J59 M;  2M38 A;  3TFM A;  2NZ8 B;  2DX5 A;  2JP2 A;  1UNR A;  5JP4 A;  5HE2 A;  1EGX A;  2L1C A;  2CY5 A;  1XKE A;  5C16 A;  3OHM B;  3F5R A;  2D9X A;  2XQN M;  3NWA A;  4HHV A;  5IRS A;  2COA A;  5FI1 A;  4BBK A;  1F5X A;  5D3V A;  3DCX A;  4NY0 A;  1M7E A;  3HIE A;  3EO2 A;  4MY6 A;  1H10 A;  4HAY B;  1DRO A;  2AEH A;  3SNH A;  2J0K A;  4KHO A;  3O96 A;  1FB8 A;  4HB3 B;  5KQ4 A;  3UZT A;  2K2U A;  2K8E A;  3FM8 C;  2ZPY A;  2FJU B;  2W2W A;  4K2P A;  2D9W A;  1WG7 A;  5DHA B;  2OTX A;  3HSA A;  5JLJ B;  3BJI A;  4HAV B;  1V5U A;  2UZR A;  5I2S A;  4Z2M B;  1UNQ A;  3P7Z A;  3G9W A;  2DN6 A;  3MPX A;  3T06 A;  4WVF B;  4QJ5 B;  1OQN A;  4GZU A;  5HE0 A;  2GJY A;  2H7E A;  2COD A;  2YF0 A;  1ZC4 B;  4TKN A;  5FI0 A;  2NMB A;  2P0D A;  4KAX B;  3PP2 A;  1PLS A;  1U2B A;  4HAZ B;  2PZ1 A;  1MIX A;  2AL6 A;  2RGN B;  3U8Z A;  2KUP A;  2YVC A;  2CY4 A;  2Z13 A;  4GMX B;  5KCV A;  1MKE A;  3DXD A;  1GC7 A;  2ROZ B;  5DHF B;  2Z14 A;  3LJU X;  4ZRK A;  2E2X A;  1DYN A;  3AU5 A;  4HB2 B;  2GCJ A;  2OQB A;  3WA0 A;  4QJ4 B;  1BY1 A;  4HB0 B;  2YS5 A;  1X86 A;  1KZ7 A;  2MDX A;  2GS0 A;  3A98 B;  1UNP A;  1X05 A;  5LG4 B;  5DH9 B;  1NU2 A;  4PNK A;  2HTH B;  2Y8F A;  3F0W A;  1U5F A;  1M7R A;  3PSC A;  2DKQ A;  2DYQ A;  2YRY A;  4F7G A;  5DIF B;  2J0J A;  2RUK B;  1X1F A;  2L2I A;  2VKI A;  3B77 A;  4ZRI A;  1TJ6 A;  1XR0 B;  2RSG A;  4CHJ A;  3NWF A;  2LOZ A;  2P8V A;  1ZVR A;  1J0W A;  2GCL A;  2D9V A;  5I2M A;  2R0D A;  5JHG A;  3ODX A;  4L1R A;  3ULC A;  1RJ2 A;  4A5K A;  3PVW A;  4MT7 A;  4D6W A;  1P5T A;  3KRW A;  4KHB A;  1U5E A;  2KCJ A;  1SGH A;  2IYB A;  1UPR A;  5LON B;  4K81 A;  1W1H A;  2W2X D;  2YT1 A;  4Y94 A;  1TQZ A;  2UZS A;  1X11 A;  4KHB B;  3NWD A;  2Z4D A;  1H4R A;  1WVH A;  5CLQ B;  2K00 A;  3HK0 A;  3PEG A;  4YON A;  3DXC A;  2RVB B;  2DHI A;  3M1I B;  3ODO A;  1PMS A;  3ODW A;  2ZKM X;  2GUM A;  2R09 A;  2I5F A;  3KSY A;  4HAW B;  1BTK A;  2LUL A;  4EMO A;  5GOW B;  2DTC A;  3A58 A;  2DYN A;  3WYF B;  3N7C A;  3TVV A;  1TXD A;  2CAY A;  2YT2 A;  5JHH A;  3GYP A;  1FHO A;  3PVL A;  3PVU A;  1B55 A;  2CRF A;  4TYZ A;  1DDV A;  4HAU B;  1FHW A;  1U27 A;  2IFS A;  3OAN A;  3SO6 A;  1WJ1 A;  3IVF A;  2DHK A;  5J3Q A;  4HAX B;  3NSU A;  1N3H A;  3U12 A;  3CIK A;  1UPQ A;  2LYD A;  1K5G B;  4GXB A;  1QQG A;  2YS1 A;  2P0H A;  2Z0P A;  4EKU A;  3A8Q A;  2N0Y A;  1MK7 B;  2P0F A;  2EC1 A;  3GYO A;  3ZDT A;  3JV3 A;  3SUZ A;  1W1D A;  2LG1 A;  4DBB A; 
#chains in the Genus database with same CATH homology
 4A6F A;  2EJ8 A;  2ADZ A;  1FHX A;  2QKM A;  4GPT B;  4WJ7 A;  2VSZ A;  1U5D A;  1V89 A;  3MDB C;  4A6F B;  1DDM A;  2M14 A;  1X1G A;  1AQC A;  1FOE A;  2D9Y A;  3QWM A;  4GN1 A;  5LOP B;  4IFS A;  3A8P A;  4F7U P;  2G35 A;  1MIZ B;  1P6S A;  1Y19 B;  3BIN A;  3TW1 A;  5C79 A;  1SHC A;  1OMW A;  3AU4 A;  1U5G A;  1K5D B;  5D3X A;  1GC6 A;  2KR9 A;  1I7A A;  4DX8 A;  1NI2 A;  1V5M A;  2D9Z A;  3SYX A;  2YSZ A;  1XX0 A;  1OY2 A;  1MK9 B;  1P3R A;  5L81 A;  1V61 A;  4C0A A;  4EJN A;  2QKL A;  4HDQ A;  2D10 A;  4XWX A;  3VOQ A;  1PFJ A;  3U7D A;  5D3Y A;  1FGY A;  4KVG B;  2EMS A;  1FGZ A;  1UEF A;  3SV1 A;  5C5B A;  1FAO A;  5C6R A;  1LB1 A;  1U29 A;  5D27 A;  1ZC3 B;  4D0O A;  3D8E A;  4HDO A;  2EMT A;  3FEH A;  2Y7B A;  1IRS A;  4YL8 A;  2DFK A;  2K2J A;  5D3W A;  3VIA A;  1E5W A;  1WGQ A;  2DA0 A;  4HB4 B;  2MWN B;  2D11 A;  1QC6 A;  1NTV A;  2Z0Q A;  4P7I A;  4WSF A;  1Z87 A;  3KY9 A;  1MPH A;  1V88 A;  2DX1 A;  3TCA A;  4CYE A;  1AWE A;  2DLW A;  4K17 A;  2N23 A;  2LOX A;  2W2X C;  2MFQ A;  2I1J A;  1ZM0 A;  2ELB A;  2RNR B;  2V76 A;  4DX9 0;  4K2O A;  3ML4 A;  4A6H A;  4A6K A;  3FSS A;  2COC A;  4GOU A;  1GG3 A;  2LKO A;  3X23 A;  2HE7 A;  4IOY X;  3D8F A;  2J0M A;  5KQ1 A;  5HE3 A;  4NSW A;  4DXA B;  1Y5O A;  3GF9 A;  5J3T A;  2UVM A;  4HAT B;  4L6E A;  4PQ0 A;  4CHM A;  4GMV A;  4GYV A;  1WJM A;  1XOD A;  2YT0 A;  3PG7 A;  3KZ1 A;  2Z0O A;  2COF A;  2D4Q A;  2X18 A;  1ISN A;  3DXE A;  3ZVR A;  1Q67 A;  1WGU A;  2KGX B;  4MK0 A;  1ZSQ A;  3V5W A;  2Q13 A;  1BAK A;  1I2H A;  5EFX A;  4IAP A;  2DKP A;  1RRP B;  2I1K A;  2FJL A;  4B6H A;  5HE1 A;  2RLO A;  2I5C A;  2Y8G A;  2BCJ A;  3QIJ A;  1MAI A;  2H7D A;  1EVH A;  4H8S A;  1EF1 A;  4Z2N A;  2DHJ A;  1XCG A;  1W1G A;  3KRX A;  3HQC A;  3CXB B;  1KZG A;  4D0N B;  2ROV A;  1XD4 A;  1BTN A;  4F7H A;  1WI1 A;  3ULB A;  3AJ4 A;  2VRW B;  3QBV B;  2ELA A;  1BWN A;  3P6A A;  1KI1 B;  2MKR A;  1J19 A;  1EAZ A;  2YS3 A;  5DI9 B;  1DBH A;  5C5B B;  3D8D A;  3TO1 A;  1NTY A;  5J3Y A;  3PZD A;  4ZRJ A;  2D2Q A;  1DDW A;  5CLL B;  1V5P A;  4KHA A;  3HW2 B;  3RCP A;  1LW3 A;  2J59 M;  2M38 A;  3TFM A;  2NZ8 B;  2DX5 A;  2JP2 A;  1UNR A;  5JP4 A;  5HE2 A;  1EGX A;  2L1C A;  2CY5 A;  1XKE A;  5C16 A;  3F5R A;  2D9X A;  2XQN M;  4HHV A;  2COA A;  5FI1 A;  4BBK A;  1F5X A;  5D3V A;  4NY0 A;  1M7E A;  3EO2 A;  4MY6 A;  1H10 A;  4HAY B;  1DRO A;  2AEH A;  3SNH A;  2J0K A;  4KHO A;  3O96 A;  1FB8 A;  4HB3 B;  5KQ4 A;  3UZT A;  2K2U A;  3FM8 C;  2ZPY A;  2W2W A;  4K2P A;  2D9W A;  1WG7 A;  5DHA B;  2OTX A;  5JLJ B;  3BJI A;  4HAV B;  1V5U A;  2UZR A;  4Z2M B;  1UNQ A;  3P7Z A;  3G9W A;  2DN6 A;  3MPX A;  3T06 A;  4WVF B;  1OQN A;  4GZU A;  5HE0 A;  2GJY A;  2H7E A;  2COD A;  2YF0 A;  1ZC4 B;  4TKN A;  5FI0 A;  2NMB A;  2P0D A;  4KAX B;  3PP2 A;  1PLS A;  1U2B A;  4HAZ B;  2PZ1 A;  1MIX A;  2AL6 A;  2RGN B;  3U8Z A;  2KUP A;  2YVC A;  2CY4 A;  4GMX B;  5KCV A;  1MKE A;  3DXD A;  1GC7 A;  2ROZ B;  5DHF B;  3LJU X;  4ZRK A;  2E2X A;  1DYN A;  3AU5 A;  4HB2 B;  2GCJ A;  2OQB A;  3WA0 A;  1BY1 A;  4HB0 B;  2YS5 A;  1X86 A;  1KZ7 A;  2MDX A;  2GS0 A;  3A98 B;  1UNP A;  1X05 A;  5DH9 B;  1NU2 A;  4PNK A;  2HTH B;  2Y8F A;  3F0W A;  1U5F A;  1M7R A;  3PSC A;  2DKQ A;  2DYQ A;  2YRY A;  4F7G A;  5DIF B;  2J0J A;  2RUK B;  1X1F A;  2L2I A;  2VKI A;  4ZRI A;  1TJ6 A;  1XR0 B;  2RSG A;  4CHJ A;  2LOZ A;  2P8V A;  1ZVR A;  1J0W A;  2GCL A;  2D9V A;  2R0D A;  5JHG A;  3ODX A;  3ULC A;  1RJ2 A;  4A5K A;  3PVW A;  4MT7 A;  1P5T A;  3KRW A;  1U5E A;  2KCJ A;  1SGH A;  2IYB A;  1UPR A;  5LON B;  4K81 A;  1W1H A;  2W2X D;  2YT1 A;  4Y94 A;  1TQZ A;  2UZS A;  1X11 A;  4KHB B;  5CLQ B;  1H4R A;  1WVH A;  2K00 A;  3HK0 A;  3PEG A;  4YON A;  3DXC A;  2RVB B;  2DHI A;  3M1I B;  3ODO A;  1PMS A;  3ODW A;  2R09 A;  2I5F A;  3KSY A;  4HAW B;  1BTK A;  2LUL A;  4EMO A;  5GOW B;  2DTC A;  2DYN A;  3WYF B;  3N7C A;  3TVV A;  1TXD A;  2CAY A;  5JHH A;  3GYP A;  1FHO A;  3PVL A;  3PVU A;  1B55 A;  2CRF A;  4TYZ A;  1DDV A;  4HAU B;  1FHW A;  1U27 A;  2IFS A;  3OAN A;  3SO6 A;  1WJ1 A;  3IVF A;  2DHK A;  5J3Q A;  4HAX B;  3NSU A;  1N3H A;  3CIK A;  4GXB A;  1UPQ A;  1K5G B;  2LYD A;  1QQG A;  2YS1 A;  2P0H A;  2Z0P A;  4EKU A;  3A8Q A;  2N0Y A;  1MK7 B;  2P0F A;  2EC1 A;  3GYO A;  3ZDT A;  3JV3 A;  3SUZ A;  1W1D A;  2LG1 A;  4DBB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...