1TXDA

Crystal structure of the dh/ph domains of leukemia-associated rhogef
Total Genus 127
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
127
sequence length
373
structure length
352
Chain Sequence
b'PPNWQQLVSREVLLGLKPCEIKRQEVINELFYTERAHVRTLKVLDQVFYQRVSREGILSPSELRKIFSNLEDILQLHIGLNEQMKAVRKRNETSVIDQIGEDLLTWFSGPGEEKLKHAAATFCSNQPFALEMIKSRQKKDSRFQTFVQDAESNPLCRRLQLKDIIPTQMQRLTKYPLLLDNIAKYTEWPTEREKVKKAADHCRQILNFVNQAVKEAENKQRLEDYQRRLDTSSLVEELRNLDLTKRKMIHEGPLVWKVNRDKTIDLYTLLLEDILVLLQKQDDRLVLRCTFSPVIKLSTVLVRQVATNKALFVISMSDNGAQIYELVAQTVSEKTVWQDLICRMAASVKEQS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Rho guanine nucleotide exchange factor 12
publication title Structural determinants of RhoA binding and nucleotide exchange in leukemia-associated Rho guanine-nucleotide exchange factor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 127
structure length 352
sequence length 373
ec nomenclature
pdb deposition date 2004-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00621 RhoGEF RhoGEF domain
A PF17838 PH_16 PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.900.10 Mainly Alpha Up-down Bundle Dbl Homology Domain; Chain A Dbl homology (DH) domain 1txdA01
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1txdA02
2YSZA 1UNQA 1F5XA 1V5MA 4CHMA 2QKLA 2CY5A 3PEGA 2RNRB 2K2JA 1MK7B 5J3TA 4DX8A 2Y8FA 3ULCA 2Z0QA 1WJMA 3JV3A 4HB3B 1J0WA 3PZDA 4K81A 4IOYX 3DXCA 2X18A 1K5DB 4KHAA 1NI2A 2LOZA 3PG7A 5FI1A 5FI0A 3TO1A 2V76A 1M7EA 1KZGA 2YVCA 5C5BB 2D11A 4KHBB 2J59M 4MY6A 2P0DA 3A8QA 1UPRA 2NMBA 1PFJA 2KGXB 5C79A 2I5CA 2AL6A 3GF9A 5C6RA 3TCAA 1KI1B 2CAYA 4IFSA 2P8VA 4WJ7A 2YS5A 1FGYA 4PQ0A 1BWNA 2DX5A 4KAXB 3CXBB 2UZRA 3M1IB 1XCGA 2RVBB 1V89A 4K2OA 1BAKA 3N7CA 1ZC3B 2IYBA 2J0KA 5HE1A 4GPTB 1GC6A 1UPQA 1N3HA 4BBKA 1NTYA 3ODOA 4HAUB 2MFQA 4K17A 1V88A 3KRXA 1Q67A 3PP2A 5LONB 2DX1A 4C0AA 4HAZB 3D8EA 3A98B 2W2XD 2L1CA 4A5KA 3KRWA 2RUKB 1UNPA 1MAIA 1MIXA 1TXDA 2UVMA 3ZDTA 3HK0A 4MT7A 4ZRIA 1X86A 2MWNB 3LJUX 2COAA 3OANA 1FHXA 2D9VA 4DXAB 1OY2A 1DROA 4ZRJA 3KSYA 2I5FA 1X11A 1X1GA 2ZPYA 1I2HA 2LG1A 5GOWB 2Z0OA 2GCLA 2COCA 2RGNB 2HTHB 1OMWA 1QC6A 3BJIA 2Z0PA 1I7AA 5DHAB 1P6SA 2D10A 2ELBA 4DBBA 5EFXA 2D9ZA 1IRSA 3DXDA 4GN1A 3GYPA 4P7IA 3QBVB 3KY9A 2BCJA 3HQCA 3FM8C 2D4QA 1PLSA 3ULBA 2CRFA 2JP2A 2YT1A 1RRPB 1FGZA 4CYEA 2NZ8B 4XWXA 4D0OA 3P7ZA 1XR0B 2J0MA 4CHJA 5D3VA 5KQ1A 2LOXA 3ODXA 5KCVA 2I1JA 3UZTA 2OTXA 1DDWA 4NSWA 4EMOA 1WGUA 1V5UA 2DN6A 2PZ1A 1K5GB 3F0WA 3U8ZA 2D9WA 2DFKA 1M7RA 5C5BA 4GZUA 1GG3A 2EJ8A 2ROVA 3NSUA 1V61A 2OQBA 4TKNA 2W2WA 3RCPA 4NY0A 2YRYA 2LULA 2DKPA 1SHCA 1ZSQA 3PVUA 2GCJA 2H7DA 3U7DA 4Y94A 3V5WA 2LKOA 3P6AA 4H8SA 4MK0A 3BINA 1V5PA 1NU2A 4GMVA 2E2XA 2N0YA 5D27A 4Z2MB 4YL8A 1U27A 3TVVA 2J0JA 2DHKA 2DHJA 5J3QA 1FB8A 5CLLB 1QQGA 3ZVRA 2I1KA 2COFA 5D3YA 5J3YA 4HDOA 5LOPB 2L2IA 4B6HA 1PMSA 4HB2B 3TFMA 5DHFB 2DLWA 1DDMA 5JLJB 3TW1A 2YS1A 2DYNA 1U29A 2P0FA 1DDVA 4HAWB 3D8FA 3MPXA 1X1FA 2VSZA 1EGXA 4PNKA 2QKMA 1U5EA 1FOEA 3AU4A 1XODA 4GMXB 1MPHA 2Y8GA 2GS0A 4KHOA 5L81A 4IAPA 3MDBC 4A6FB 2EMTA 1XX0A 2AEHA 1XKEA 1WGQA 5DI9B 4HB0B 5DH9B 5JP4A 2DA0A 4F7GA 2LYDA 2K00A 1J19A 3QIJA 5HE0A 2HE7A 3GYOA 3F5RA 2YF0A 3O96A 2XQNM 1P5TA 1SGHA 1EVHA 1Z87A 2DKQA 2ELAA 4WSFA 1W1DA 3SNHA 2EMSA 1WJ1A 3SUZA 3HW2B 2M14A 4A6HA 4HB4B 5DIFB 1LW3A 2MKRA 2N23A 3AJ4A 1ZVRA 4HAXB 4F7UP 3ML4A 4L6EA 2Y7BA 2YS3A 1TQZA 4HDQA 5D3WA 3QWMA 2DTCA 1UNRA 1U5DA 2H7EA 4KVGB 3X23A 1FAOA 1EAZA 5JHGA 2RSGA 4K2PA 1AQCA 1WI1A 2G35A 3IVFA 4ZRKA 1EF1A 1ZM0A 3D8DA 2DYQA 1U2BA 4HATB 1UEFA 2CY4A 1H4RA 3AU5A 4HAVB 3EO2A 2W2XC 1LB1A 1NTVA 4A6KA 1XD4A 1GC7A 2Q13A 2K2UA 5JHHA 2EC1A 2DHIA 1P3RA 2KUPA 3FEHA 3PSCA 1E5WA 1ISNA 5D3XA 4Z2NA 2GJYA 1U5GA 1WG7A 2MDXA 1TJ6A 4GOUA 4YONA 1BY1A 5HE3A 3SYXA 1BTKA 4WVFB 3ODWA 2IFSA 3WA0A 1OQNA 1FHWA 3VOQA 1ZC4B 4EJNA 1Y19B 4TYZA 1B55A 1H10A 2ADZA 3SV1A 2R09A 3G9WA 1WVHA 3PVWA 2D2QA 4HAYB 4GXBA 4D0NB 1BTNA 5KQ4A 1W1GA 3A8PA 1KZ7A 1DBHA 3WYFB 2RLOA 4EKUA 2D9YA 3CIKA 4HHVA 3SO6A 1MKEA 2D9XA 1MIZB 2KR9A 5HE2A 1X05A 2VKIA 3PVLA 4A6FA 2KCJA 1AWEA 2ROZB 1Y5OA 2M38A 2YT0A 2UZSA 1DYNA 3T06A 1RJ2A 1MK9B 2VRWB 3DXEA 2R0DA 5C16A 1U5FA 2P0HA 3VIAA 4F7HA 2FJLA 1FHOA 3KZ1A 5CLQB 4GYVA 4DX90 3FSSA 1W1HA 2CODA
chains in the Genus database with same CATH superfamily
2YSZA 1UNQA 1F5XA 1V5MA 4CHMA 2QKLA 2CY5A 4D6WA 3PEGA 2RNRB 2K2JA 1MK7B 5J3TA 4DX8A 2Y8FA 5I2MA 3ULCA 2Z0QA 1WJMA 3JV3A 4HB3B 1J0WA 3PZDA 4K81A 4IOYX 3DXCA 2X18A 1K5DB 4KHAA 1NI2A 2LOZA 3PG7A 5FI1A 1T77A 5FI0A 3NWDA 3TO1A 2V76A 1M7EA 1KZGA 2YVCA 5C5BB 2Z59A 2D11A 4KHBB 2J59M 4MY6A 2P0DA 3A8QA 1UPRA 2NMBA 1PFJA 2KGXB 5C79A 2I5CA 2AL6A 3GF9A 5C6RA 3TCAA 1KI1B 2CAYA 4IFSA 2P8VA 4WJ7A 2YS5A 1FGYA 4PQ0A 1BWNA 2DX5A 4KAXB 3CXBB 2UZRA 3M1IB 1XCGA 2RVBB 1V89A 4K2OA 1BAKA 3N7CA 1ZC3B 4QJ3B 2IYBA 2J0KA 5HE1A 4GPTB 1GC6A 1UPQA 1N3HA 4BBKA 1NTYA 3ODOA 4HAUB 2MFQA 4K17A 1V88A 3KRXA 1Q67A 3PP2A 5LONB 5M4YB 2KIGA 2DX1A 4C0AA 5IRSA 4HAZB 3D8EA 3A98B 2W2XD 2L1CA 4A5KA 2K49A 3KRWA 2RUKB 1UNPA 3HIEA 1MAIA 1MIXA 1TXDA 3NWFA 2UVMA 3ZDTA 3HK0A 4MT7A 4ZRIA 1X86A 2MWNB 3LJUX 2COAA 3OANA 5I2SA 4L1RA 1FHXA 4QXAB 2D9VA 4DXAB 1OY2A 1DROA 4ZRJA 3KSYA 2I5FA 1X11A 1X1GA 2ZPYA 1I2HA 2LG1A 5GOWB 2Z0OA 2GCLA 2COCA 2RGNB 2HTHB 1OMWA 1QC6A 3BJIA 2Z0PA 1I7AA 5DHAB 2GUMA 1P6SA 2D10A 2ELBA 4DBBA 5EFXA 2D9ZA 1IRSA 3DXDA 4GN1A 3GYPA 4P7IA 3QBVB 3KY9A 2BCJA 3HQCA 3FM8C 2D4QA 1PLSA 3ULBA 2CRFA 2JP2A 2YT1A 1RRPB 1FGZA 4CYEA 2NZ8B 4XWXA 4D0OA 3P7ZA 1XR0B 2J0MA 3A58A 4CHJA 5D3VA 5KQ1A 2LOXA 3ODXA 5KCVA 2I1JA 3UZTA 2OTXA 1DDWA 4NSWA 4EMOA 1WGUA 1V5UA 2DN6A 2PZ1A 1K5GB 3F0WA 3U8ZA 2D9WA 2DFKA 1M7RA 5C5BA 4GZUA 4KHBA 1GG3A 2EJ8A 2ROVA 3NSUA 1V61A 2OQBA 2RRFA 4TKNA 2W2WA 3RCPA 4NY0A 2YRYA 2LULA 2DKPA 1SHCA 1ZSQA 3PVUA 2GCJA 2H7DA 3U7DA 4GNKB 4Y94A 3V5WA 2LKOA 3P6AA 4H8SA 4MK0A 3BINA 1V5PA 1NU2A 4GMVA 2E2XA 2N0YA 5D27A 4Z2MB 4YL8A 1U27A 3TVVA 2J0JA 2DHKA 2DHJA 5J3QA 1FB8A 5CLLB 4HSIA 1QQGA 3ZVRA 2I1KA 2COFA 5D3YA 5J3YA 4HDOA 5LOPB 2L2IA 4B6HA 1PMSA 2KIEA 4DIXA 2KUQA 4HB2B 3TFMA 5DHFB 2DLWA 4QJ4B 2K8EA 1DDMA 3U12A 5JLJB 3TW1A 2YS1A 2DYNA 1MI1A 1U29A 2P0FA 1DDVA 4HAWB 3D8FA 3MPXA 1X1FA 2VSZA 1EGXA 4PNKA 2QKMA 3NW8A 1U5EA 1FOEA 3AU4A 1XODA 4GMXB 1MPHA 2Y8GA 2GS0A 4KHOA 4CSQA 5L81A 4IAPA 3MDBC 4A6FB 2EMTA 1XX0A 2AEHA 1XKEA 1WGQA 5DI9B 4HB0B 5DH9B 5JP4A 2DA0A 4F7GA 2LYDA 2K00A 1J19A 3QIJA 5HE0A 2HE7A 2Z13A 3GYOA 3F5RA 2YF0A 3O96A 2XQNM 1P5TA 1SGHA 1EVHA 2Z4DA 1Z87A 2DKQA 2ELAA 4WSFA 1W1DA 3SNHA 2EMSA 1WJ1A 2FJUB 3DCXA 3SUZA 3HW2B 2M14A 4A6HA 4HB4B 5DIFB 2NBVA 1LW3A 2MKRA 2N23A 3AJ4A 4QJ5B 1ZVRA 4HAXB 4F7UP 3ML4A 4L6EA 2Y7BA 2YS3A 1TQZA 4HDQA 5D3WA 3QWMA 2DTCA 1UNRA 1U5DA 2H7EA 4KVGB 3X23A 1FAOA 1EAZA 5JHGA 2RSGA 4K2PA 1AQCA 2R2YA 1WI1A 2G35A 3B77A 3IVFA 4ZRKA 1EF1A 1ZM0A 3D8DA 2DYQA 4OT1A 1U2BA 4HATB 1UEFA 2CY4A 2YT2A 1H4RA 3AU5A 4HAVB 3FVCA 3EO2A 2W2XC 1LB1A 1NTVA 4A6KA 1XD4A 1GC7A 4OSNA 2Q13A 2K2UA 5JHHA 2EC1A 1ZYIA 2DHIA 1P3RA 2KUPA 3FEHA 3PSCA 1E5WA 3OHMB 1ISNA 5D3XA 4Z2NA 2GJYA 1U5GA 1WG7A 2MDXA 1TJ6A 4GOUA 4YONA 1BY1A 5HE3A 3HSAA 3SYXA 1BTKA 4WVFB 3ODWA 2IFSA 3WA0A 1OQNA 1FHWA 3VOQA 1ZC4B 4EJNA 1Y19B 4TYZA 1B55A 1H10A 5LG4B 2ADZA 3SV1A 2R09A 3G9WA 1WVHA 3PVWA 2D2QA 4HAYB 4GXBA 4D0NB 1BTNA 5KQ4A 1W1GA 3A8PA 1KZ7A 1DBHA 3WYFB 2RLOA 2KR0A 4EKUA 2D9YA 3CIKA 4HHVA 2ZKMX 3SO6A 1MKEA 2D9XA 1MIZB 2KR9A 5HE2A 1X05A 2VKIA 3NWAA 3PVLA 4A6FA 2KCJA 1AWEA 2ROZB 1Y5OA 2M38A 2YT0A 2UZSA 1DYNA 3T06A 1RJ2A 1MK9B 2Z14A 2VRWB 3DXEA 2R0DA 5C16A 1U5FA 2P0HA 3VIAA 4F7HA 2FJLA 1FHOA 3KZ1A 5CLQB 4GYVA 4DX90 3FSSA 1W1HA 2CODA
chains in the Genus database with same CATH topology
2YSZA 1UNQA 1F5XA 1V5MA 4CHMA 2QKLA 2CY5A 3PEGA 2RNRB 2K2JA 1MK7B 5J3TA 4DX8A 2Y8FA 3ULCA 2Z0QA 1WJMA 3JV3A 4HB3B 1J0WA 3PZDA 4K81A 4IOYX 3DXCA 2X18A 1K5DB 4KHAA 1NI2A 2LOZA 3PG7A 5FI1A 5FI0A 3TO1A 2V76A 1M7EA 1KZGA 2YVCA 5C5BB 2D11A 4KHBB 2J59M 4MY6A 2P0DA 3A8QA 1UPRA 2NMBA 1PFJA 2KGXB 5C79A 2I5CA 2AL6A 3GF9A 5C6RA 3TCAA 1KI1B 2CAYA 4IFSA 2P8VA 4WJ7A 2YS5A 1FGYA 4PQ0A 1BWNA 2DX5A 4KAXB 3CXBB 2UZRA 3M1IB 1XCGA 2RVBB 1V89A 4K2OA 1BAKA 3N7CA 1ZC3B 2IYBA 2J0KA 5HE1A 4GPTB 1GC6A 1UPQA 1N3HA 4BBKA 1NTYA 3ODOA 4HAUB 2MFQA 4K17A 1V88A 3KRXA 1Q67A 3PP2A 5LONB 2DX1A 4C0AA 4HAZB 3D8EA 3A98B 2W2XD 2L1CA 4A5KA 3KRWA 2RUKB 1UNPA 1MAIA 1MIXA 1TXDA 2UVMA 3ZDTA 3HK0A 4MT7A 4ZRIA 1X86A 2MWNB 3LJUX 2COAA 3OANA 1FHXA 2D9VA 4DXAB 1OY2A 1DROA 4ZRJA 3KSYA 2I5FA 1X11A 1X1GA 2ZPYA 1I2HA 2LG1A 5GOWB 2Z0OA 2GCLA 2COCA 2RGNB 2HTHB 1OMWA 1QC6A 3BJIA 2Z0PA 1I7AA 5DHAB 1P6SA 2D10A 2ELBA 4DBBA 5EFXA 2D9ZA 1IRSA 3DXDA 4GN1A 3GYPA 4P7IA 3QBVB 3KY9A 2BCJA 3HQCA 3FM8C 2D4QA 1PLSA 3ULBA 2CRFA 2JP2A 2YT1A 1RRPB 1FGZA 4CYEA 2NZ8B 4XWXA 4D0OA 3P7ZA 1XR0B 2J0MA 4CHJA 5D3VA 5KQ1A 2LOXA 3ODXA 5KCVA 2I1JA 3UZTA 2OTXA 1DDWA 4NSWA 4EMOA 1WGUA 1V5UA 2DN6A 2PZ1A 1K5GB 3F0WA 3U8ZA 2D9WA 2DFKA 1M7RA 5C5BA 4GZUA 1GG3A 2EJ8A 2ROVA 3NSUA 1V61A 2OQBA 4TKNA 2W2WA 3RCPA 4NY0A 2YRYA 2LULA 2DKPA 1SHCA 1ZSQA 3PVUA 2GCJA 2H7DA 3U7DA 4Y94A 3V5WA 2LKOA 3P6AA 4H8SA 4MK0A 3BINA 1V5PA 1NU2A 4GMVA 2E2XA 2N0YA 5D27A 4Z2MB 4YL8A 1U27A 3TVVA 2J0JA 2DHKA 2DHJA 5J3QA 1FB8A 5CLLB 1QQGA 3ZVRA 2I1KA 2COFA 5D3YA 5J3YA 4HDOA 5LOPB 2L2IA 4B6HA 1PMSA 4HB2B 3TFMA 5DHFB 2DLWA 1DDMA 5JLJB 3TW1A 2YS1A 2DYNA 1U29A 2P0FA 1DDVA 4HAWB 3D8FA 3MPXA 1X1FA 2VSZA 1EGXA 4PNKA 2QKMA 1U5EA 1FOEA 3AU4A 1XODA 4GMXB 1MPHA 2Y8GA 2GS0A 4KHOA 5L81A 4IAPA 3MDBC 4A6FB 2EMTA 1XX0A 2AEHA 1XKEA 1WGQA 5DI9B 4HB0B 5DH9B 5JP4A 2DA0A 4F7GA 2LYDA 2K00A 1J19A 3QIJA 5HE0A 2HE7A 3GYOA 3F5RA 2YF0A 3O96A 2XQNM 1P5TA 1SGHA 1EVHA 1Z87A 2DKQA 2ELAA 4WSFA 1W1DA 3SNHA 2EMSA 1WJ1A 3SUZA 3HW2B 2M14A 4A6HA 4HB4B 5DIFB 1LW3A 2MKRA 2N23A 3AJ4A 1ZVRA 4HAXB 4F7UP 3ML4A 4L6EA 2Y7BA 2YS3A 1TQZA 4HDQA 5D3WA 3QWMA 2DTCA 1UNRA 1U5DA 2H7EA 4KVGB 3X23A 1FAOA 1EAZA 5JHGA 2RSGA 4K2PA 1AQCA 1WI1A 2G35A 3IVFA 4ZRKA 1EF1A 1ZM0A 3D8DA 2DYQA 1U2BA 4HATB 1UEFA 2CY4A 1H4RA 3AU5A 4HAVB 3EO2A 2W2XC 1LB1A 1NTVA 4A6KA 1XD4A 1GC7A 2Q13A 2K2UA 5JHHA 2EC1A 2DHIA 1P3RA 2KUPA 3FEHA 3PSCA 1E5WA 1ISNA 5D3XA 4Z2NA 2GJYA 1U5GA 1WG7A 2MDXA 1TJ6A 4GOUA 4YONA 1BY1A 5HE3A 3SYXA 1BTKA 4WVFB 3ODWA 2IFSA 3WA0A 1OQNA 1FHWA 3VOQA 1ZC4B 4EJNA 1Y19B 4TYZA 1B55A 1H10A 2ADZA 3SV1A 2R09A 3G9WA 1WVHA 3PVWA 2D2QA 4HAYB 4GXBA 4D0NB 1BTNA 5KQ4A 1W1GA 3A8PA 1KZ7A 1DBHA 3WYFB 2RLOA 4EKUA 2D9YA 3CIKA 4HHVA 3SO6A 1MKEA 2D9XA 1MIZB 2KR9A 5HE2A 1X05A 2VKIA 3PVLA 4A6FA 2KCJA 1AWEA 2ROZB 1Y5OA 2M38A 2YT0A 2UZSA 1DYNA 3T06A 1RJ2A 1MK9B 2VRWB 3DXEA 2R0DA 5C16A 1U5FA 2P0HA 3VIAA 4F7HA 2FJLA 1FHOA 3KZ1A 5CLQB 4GYVA 4DX90 3FSSA 1W1HA 2CODA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YSZ A;  1UNQ A;  1F5X A;  1V5M A;  4CHM A;  2QKL A;  2CY5 A;  3PEG A;  2RNR B;  2K2J A;  1MK7 B;  5J3T A;  4DX8 A;  2Y8F A;  3ULC A;  2Z0Q A;  1WJM A;  3JV3 A;  4HB3 B;  1J0W A;  3PZD A;  4K81 A;  4IOY X;  3DXC A;  2X18 A;  1K5D B;  4KHA A;  1NI2 A;  2LOZ A;  3PG7 A;  5FI1 A;  5FI0 A;  3TO1 A;  2V76 A;  1M7E A;  1KZG A;  2YVC A;  5C5B B;  2D11 A;  4KHB B;  2J59 M;  4MY6 A;  2P0D A;  3A8Q A;  1UPR A;  2NMB A;  1PFJ A;  2KGX B;  5C79 A;  2I5C A;  2AL6 A;  3GF9 A;  5C6R A;  3TCA A;  1KI1 B;  2CAY A;  4IFS A;  2P8V A;  4WJ7 A;  2YS5 A;  1FGY A;  4PQ0 A;  1BWN A;  2DX5 A;  4KAX B;  3CXB B;  2UZR A;  3M1I B;  1XCG A;  2RVB B;  1V89 A;  4K2O A;  1BAK A;  3N7C A;  1ZC3 B;  2IYB A;  2J0K A;  5HE1 A;  4GPT B;  1GC6 A;  1UPQ A;  1N3H A;  4BBK A;  1NTY A;  3ODO A;  4HAU B;  2MFQ A;  4K17 A;  1V88 A;  3KRX A;  1Q67 A;  3PP2 A;  5LON B;  2DX1 A;  4C0A A;  4HAZ B;  3D8E A;  3A98 B;  2W2X D;  2L1C A;  4A5K A;  3KRW A;  2RUK B;  1UNP A;  1MAI A;  1MIX A;  1TXD A;  2UVM A;  3ZDT A;  3HK0 A;  4MT7 A;  4ZRI A;  1X86 A;  2MWN B;  3LJU X;  2COA A;  3OAN A;  1FHX A;  2D9V A;  4DXA B;  1OY2 A;  1DRO A;  4ZRJ A;  3KSY A;  2I5F A;  1X11 A;  1X1G A;  2ZPY A;  1I2H A;  2LG1 A;  5GOW B;  2Z0O A;  2GCL A;  2COC A;  2RGN B;  2HTH B;  1OMW A;  1QC6 A;  3BJI A;  2Z0P A;  1I7A A;  5DHA B;  1P6S A;  2D10 A;  2ELB A;  4DBB A;  5EFX A;  2D9Z A;  1IRS A;  3DXD A;  4GN1 A;  3GYP A;  4P7I A;  3QBV B;  3KY9 A;  2BCJ A;  3HQC A;  3FM8 C;  2D4Q A;  1PLS A;  3ULB A;  2CRF A;  2JP2 A;  2YT1 A;  1RRP B;  1FGZ A;  4CYE A;  2NZ8 B;  4XWX A;  4D0O A;  3P7Z A;  1XR0 B;  2J0M A;  4CHJ A;  5D3V A;  5KQ1 A;  2LOX A;  3ODX A;  5KCV A;  2I1J A;  3UZT A;  2OTX A;  1DDW A;  4NSW A;  4EMO A;  1WGU A;  1V5U A;  2DN6 A;  2PZ1 A;  1K5G B;  3F0W A;  3U8Z A;  2D9W A;  2DFK A;  1M7R A;  5C5B A;  4GZU A;  1GG3 A;  2EJ8 A;  2ROV A;  3NSU A;  1V61 A;  2OQB A;  4TKN A;  2W2W A;  3RCP A;  4NY0 A;  2YRY A;  2LUL A;  2DKP A;  1SHC A;  1ZSQ A;  3PVU A;  2GCJ A;  2H7D A;  3U7D A;  4Y94 A;  3V5W A;  2LKO A;  3P6A A;  4H8S A;  4MK0 A;  3BIN A;  1V5P A;  1NU2 A;  4GMV A;  2E2X A;  2N0Y A;  5D27 A;  4Z2M B;  4YL8 A;  1U27 A;  3TVV A;  2J0J A;  2DHK A;  2DHJ A;  5J3Q A;  1FB8 A;  5CLL B;  1QQG A;  3ZVR A;  2I1K A;  2COF A;  5D3Y A;  5J3Y A;  4HDO A;  5LOP B;  2L2I A;  4B6H A;  1PMS A;  4HB2 B;  3TFM A;  5DHF B;  2DLW A;  1DDM A;  5JLJ B;  3TW1 A;  2YS1 A;  2DYN A;  1U29 A;  2P0F A;  1DDV A;  4HAW B;  3D8F A;  3MPX A;  1X1F A;  2VSZ A;  1EGX A;  4PNK A;  2QKM A;  1U5E A;  1FOE A;  3AU4 A;  1XOD A;  4GMX B;  1MPH A;  2Y8G A;  2GS0 A;  4KHO A;  5L81 A;  4IAP A;  3MDB C;  4A6F B;  2EMT A;  1XX0 A;  2AEH A;  1XKE A;  1WGQ A;  5DI9 B;  4HB0 B;  5DH9 B;  5JP4 A;  2DA0 A;  4F7G A;  2LYD A;  2K00 A;  1J19 A;  3QIJ A;  5HE0 A;  2HE7 A;  3GYO A;  3F5R A;  2YF0 A;  3O96 A;  2XQN M;  1P5T A;  1SGH A;  1EVH A;  1Z87 A;  2DKQ A;  2ELA A;  4WSF A;  1W1D A;  3SNH A;  2EMS A;  1WJ1 A;  3SUZ A;  3HW2 B;  2M14 A;  4A6H A;  4HB4 B;  5DIF B;  1LW3 A;  2MKR A;  2N23 A;  3AJ4 A;  1ZVR A;  4HAX B;  4F7U P;  3ML4 A;  4L6E A;  2Y7B A;  2YS3 A;  1TQZ A;  4HDQ A;  5D3W A;  3QWM A;  2DTC A;  1UNR A;  1U5D A;  2H7E A;  4KVG B;  3X23 A;  1FAO A;  1EAZ A;  5JHG A;  2RSG A;  4K2P A;  1AQC A;  1WI1 A;  2G35 A;  3IVF A;  4ZRK A;  1EF1 A;  1ZM0 A;  3D8D A;  2DYQ A;  1U2B A;  4HAT B;  1UEF A;  2CY4 A;  1H4R A;  3AU5 A;  4HAV B;  3EO2 A;  2W2X C;  1LB1 A;  1NTV A;  4A6K A;  1XD4 A;  1GC7 A;  2Q13 A;  2K2U A;  5JHH A;  2EC1 A;  2DHI A;  1P3R A;  2KUP A;  3FEH A;  3PSC A;  1E5W A;  1ISN A;  5D3X A;  4Z2N A;  2GJY A;  1U5G A;  1WG7 A;  2MDX A;  1TJ6 A;  4GOU A;  4YON A;  1BY1 A;  5HE3 A;  3SYX A;  1BTK A;  4WVF B;  3ODW A;  2IFS A;  3WA0 A;  1OQN A;  1FHW A;  3VOQ A;  1ZC4 B;  4EJN A;  1Y19 B;  4TYZ A;  1B55 A;  1H10 A;  2ADZ A;  3SV1 A;  2R09 A;  3G9W A;  1WVH A;  3PVW A;  2D2Q A;  4HAY B;  4GXB A;  4D0N B;  1BTN A;  5KQ4 A;  1W1G A;  3A8P A;  1KZ7 A;  1DBH A;  3WYF B;  2RLO A;  4EKU A;  2D9Y A;  3CIK A;  4HHV A;  3SO6 A;  1MKE A;  2D9X A;  1MIZ B;  2KR9 A;  5HE2 A;  1X05 A;  2VKI A;  3PVL A;  4A6F A;  2KCJ A;  1AWE A;  2ROZ B;  1Y5O A;  2M38 A;  2YT0 A;  2UZS A;  1DYN A;  3T06 A;  1RJ2 A;  1MK9 B;  2VRW B;  3DXE A;  2R0D A;  5C16 A;  1U5F A;  2P0H A;  3VIA A;  4F7H A;  2FJL A;  1FHO A;  3KZ1 A;  5CLQ B;  4GYV A;  4DX9 0;  3FSS A;  1W1H A;  2COD A; 
#chains in the Genus database with same CATH topology
 2YSZ A;  1UNQ A;  1F5X A;  1V5M A;  4CHM A;  2QKL A;  2CY5 A;  4D6W A;  3PEG A;  2RNR B;  2K2J A;  1MK7 B;  5J3T A;  4DX8 A;  2Y8F A;  5I2M A;  3ULC A;  2Z0Q A;  1WJM A;  3JV3 A;  4HB3 B;  1J0W A;  3PZD A;  4K81 A;  4IOY X;  3DXC A;  2X18 A;  1K5D B;  4KHA A;  1NI2 A;  2LOZ A;  3PG7 A;  5FI1 A;  1T77 A;  5FI0 A;  3NWD A;  3TO1 A;  2V76 A;  1M7E A;  1KZG A;  2YVC A;  5C5B B;  2Z59 A;  2D11 A;  4KHB B;  2J59 M;  4MY6 A;  2P0D A;  3A8Q A;  1UPR A;  2NMB A;  1PFJ A;  2KGX B;  5C79 A;  2I5C A;  2AL6 A;  3GF9 A;  5C6R A;  3TCA A;  1KI1 B;  2CAY A;  4IFS A;  2P8V A;  4WJ7 A;  2YS5 A;  1FGY A;  4PQ0 A;  1BWN A;  2DX5 A;  4KAX B;  3CXB B;  2UZR A;  3M1I B;  1XCG A;  2RVB B;  1V89 A;  4K2O A;  1BAK A;  3N7C A;  1ZC3 B;  4QJ3 B;  2IYB A;  2J0K A;  5HE1 A;  4GPT B;  1GC6 A;  1UPQ A;  1N3H A;  4BBK A;  1NTY A;  3ODO A;  4HAU B;  2MFQ A;  4K17 A;  1V88 A;  3KRX A;  1Q67 A;  3PP2 A;  5LON B;  5M4Y B;  2KIG A;  2DX1 A;  4C0A A;  5IRS A;  4HAZ B;  3D8E A;  3A98 B;  2W2X D;  2L1C A;  4A5K A;  2K49 A;  3KRW A;  2RUK B;  1UNP A;  3HIE A;  1MAI A;  1MIX A;  1TXD A;  3NWF A;  2UVM A;  3ZDT A;  3HK0 A;  4MT7 A;  4ZRI A;  1X86 A;  2MWN B;  3LJU X;  2COA A;  3OAN A;  5I2S A;  4L1R A;  1FHX A;  4QXA B;  2D9V A;  4DXA B;  1OY2 A;  1DRO A;  4ZRJ A;  3KSY A;  2I5F A;  1X11 A;  1X1G A;  2ZPY A;  1I2H A;  2LG1 A;  5GOW B;  2Z0O A;  2GCL A;  2COC A;  2RGN B;  2HTH B;  1OMW A;  1QC6 A;  3BJI A;  2Z0P A;  1I7A A;  5DHA B;  2GUM A;  1P6S A;  2D10 A;  2ELB A;  4DBB A;  5EFX A;  2D9Z A;  1IRS A;  3DXD A;  4GN1 A;  3GYP A;  4P7I A;  3QBV B;  3KY9 A;  2BCJ A;  3HQC A;  3FM8 C;  2D4Q A;  1PLS A;  3ULB A;  2CRF A;  2JP2 A;  2YT1 A;  1RRP B;  1FGZ A;  4CYE A;  2NZ8 B;  4XWX A;  4D0O A;  3P7Z A;  1XR0 B;  2J0M A;  3A58 A;  4CHJ A;  5D3V A;  5KQ1 A;  2LOX A;  3ODX A;  5KCV A;  2I1J A;  3UZT A;  2OTX A;  1DDW A;  4NSW A;  4EMO A;  1WGU A;  1V5U A;  2DN6 A;  2PZ1 A;  1K5G B;  3F0W A;  3U8Z A;  2D9W A;  2DFK A;  1M7R A;  5C5B A;  4GZU A;  4KHB A;  1GG3 A;  2EJ8 A;  2ROV A;  3NSU A;  1V61 A;  2OQB A;  2RRF A;  4TKN A;  2W2W A;  3RCP A;  4NY0 A;  2YRY A;  2LUL A;  2DKP A;  1SHC A;  1ZSQ A;  3PVU A;  2GCJ A;  2H7D A;  3U7D A;  4GNK B;  4Y94 A;  3V5W A;  2LKO A;  3P6A A;  4H8S A;  4MK0 A;  3BIN A;  1V5P A;  1NU2 A;  4GMV A;  2E2X A;  2N0Y A;  5D27 A;  4Z2M B;  4YL8 A;  1U27 A;  3TVV A;  2J0J A;  2DHK A;  2DHJ A;  5J3Q A;  1FB8 A;  5CLL B;  4HSI A;  1QQG A;  3ZVR A;  2I1K A;  2COF A;  5D3Y A;  5J3Y A;  4HDO A;  5LOP B;  2L2I A;  4B6H A;  1PMS A;  2KIE A;  4DIX A;  2KUQ A;  4HB2 B;  3TFM A;  5DHF B;  2DLW A;  4QJ4 B;  2K8E A;  1DDM A;  3U12 A;  5JLJ B;  3TW1 A;  2YS1 A;  2DYN A;  1MI1 A;  1U29 A;  2P0F A;  1DDV A;  4HAW B;  3D8F A;  3MPX A;  1X1F A;  2VSZ A;  1EGX A;  4PNK A;  2QKM A;  3NW8 A;  1U5E A;  1FOE A;  3AU4 A;  1XOD A;  4GMX B;  1MPH A;  2Y8G A;  2GS0 A;  4KHO A;  4CSQ A;  5L81 A;  4IAP A;  3MDB C;  4A6F B;  2EMT A;  1XX0 A;  2AEH A;  1XKE A;  1WGQ A;  5DI9 B;  4HB0 B;  5DH9 B;  5JP4 A;  2DA0 A;  4F7G A;  2LYD A;  2K00 A;  1J19 A;  3QIJ A;  5HE0 A;  2HE7 A;  2Z13 A;  3GYO A;  3F5R A;  2YF0 A;  3O96 A;  2XQN M;  1P5T A;  1SGH A;  1EVH A;  2Z4D A;  1Z87 A;  2DKQ A;  2ELA A;  4WSF A;  1W1D A;  3SNH A;  2EMS A;  1WJ1 A;  2FJU B;  3DCX A;  3SUZ A;  3HW2 B;  2M14 A;  4A6H A;  4HB4 B;  5DIF B;  2NBV A;  1LW3 A;  2MKR A;  2N23 A;  3AJ4 A;  4QJ5 B;  1ZVR A;  4HAX B;  4F7U P;  3ML4 A;  4L6E A;  2Y7B A;  2YS3 A;  1TQZ A;  4HDQ A;  5D3W A;  3QWM A;  2DTC A;  1UNR A;  1U5D A;  2H7E A;  4KVG B;  3X23 A;  1FAO A;  1EAZ A;  5JHG A;  2RSG A;  4K2P A;  1AQC A;  2R2Y A;  1WI1 A;  2G35 A;  3B77 A;  3IVF A;  4ZRK A;  1EF1 A;  1ZM0 A;  3D8D A;  2DYQ A;  4OT1 A;  1U2B A;  4HAT B;  1UEF A;  2CY4 A;  2YT2 A;  1H4R A;  3AU5 A;  4HAV B;  3FVC A;  3EO2 A;  2W2X C;  1LB1 A;  1NTV A;  4A6K A;  1XD4 A;  1GC7 A;  4OSN A;  2Q13 A;  2K2U A;  5JHH A;  2EC1 A;  1ZYI A;  2DHI A;  1P3R A;  2KUP A;  3FEH A;  3PSC A;  1E5W A;  3OHM B;  1ISN A;  5D3X A;  4Z2N A;  2GJY A;  1U5G A;  1WG7 A;  2MDX A;  1TJ6 A;  4GOU A;  4YON A;  1BY1 A;  5HE3 A;  3HSA A;  3SYX A;  1BTK A;  4WVF B;  3ODW A;  2IFS A;  3WA0 A;  1OQN A;  1FHW A;  3VOQ A;  1ZC4 B;  4EJN A;  1Y19 B;  4TYZ A;  1B55 A;  1H10 A;  5LG4 B;  2ADZ A;  3SV1 A;  2R09 A;  3G9W A;  1WVH A;  3PVW A;  2D2Q A;  4HAY B;  4GXB A;  4D0N B;  1BTN A;  5KQ4 A;  1W1G A;  3A8P A;  1KZ7 A;  1DBH A;  3WYF B;  2RLO A;  2KR0 A;  4EKU A;  2D9Y A;  3CIK A;  4HHV A;  2ZKM X;  3SO6 A;  1MKE A;  2D9X A;  1MIZ B;  2KR9 A;  5HE2 A;  1X05 A;  2VKI A;  3NWA A;  3PVL A;  4A6F A;  2KCJ A;  1AWE A;  2ROZ B;  1Y5O A;  2M38 A;  2YT0 A;  2UZS A;  1DYN A;  3T06 A;  1RJ2 A;  1MK9 B;  2Z14 A;  2VRW B;  3DXE A;  2R0D A;  5C16 A;  1U5F A;  2P0H A;  3VIA A;  4F7H A;  2FJL A;  1FHO A;  3KZ1 A;  5CLQ B;  4GYV A;  4DX9 0;  3FSS A;  1W1H A;  2COD A; 
#chains in the Genus database with same CATH homology
 2YSZ A;  1UNQ A;  1F5X A;  1V5M A;  4CHM A;  2QKL A;  2CY5 A;  3PEG A;  2RNR B;  2K2J A;  1MK7 B;  5J3T A;  4DX8 A;  2Y8F A;  3ULC A;  2Z0Q A;  1WJM A;  3JV3 A;  4HB3 B;  1J0W A;  3PZD A;  4K81 A;  4IOY X;  3DXC A;  2X18 A;  1K5D B;  4KHA A;  1NI2 A;  2LOZ A;  3PG7 A;  5FI1 A;  5FI0 A;  3TO1 A;  2V76 A;  1M7E A;  1KZG A;  2YVC A;  5C5B B;  2D11 A;  4KHB B;  2J59 M;  4MY6 A;  2P0D A;  3A8Q A;  1UPR A;  2NMB A;  1PFJ A;  2KGX B;  5C79 A;  2I5C A;  2AL6 A;  3GF9 A;  5C6R A;  3TCA A;  1KI1 B;  2CAY A;  4IFS A;  2P8V A;  4WJ7 A;  2YS5 A;  1FGY A;  4PQ0 A;  1BWN A;  2DX5 A;  4KAX B;  3CXB B;  2UZR A;  3M1I B;  1XCG A;  2RVB B;  1V89 A;  4K2O A;  1BAK A;  3N7C A;  1ZC3 B;  2IYB A;  2J0K A;  5HE1 A;  4GPT B;  1GC6 A;  1UPQ A;  1N3H A;  4BBK A;  1NTY A;  3ODO A;  4HAU B;  2MFQ A;  4K17 A;  1V88 A;  3KRX A;  1Q67 A;  3PP2 A;  5LON B;  2DX1 A;  4C0A A;  4HAZ B;  3D8E A;  3A98 B;  2W2X D;  2L1C A;  4A5K A;  3KRW A;  2RUK B;  1UNP A;  1MAI A;  1MIX A;  1TXD A;  2UVM A;  3ZDT A;  3HK0 A;  4MT7 A;  4ZRI A;  1X86 A;  2MWN B;  3LJU X;  2COA A;  3OAN A;  1FHX A;  2D9V A;  4DXA B;  1OY2 A;  1DRO A;  4ZRJ A;  3KSY A;  2I5F A;  1X11 A;  1X1G A;  2ZPY A;  1I2H A;  2LG1 A;  5GOW B;  2Z0O A;  2GCL A;  2COC A;  2RGN B;  2HTH B;  1OMW A;  1QC6 A;  3BJI A;  2Z0P A;  1I7A A;  5DHA B;  1P6S A;  2D10 A;  2ELB A;  4DBB A;  5EFX A;  2D9Z A;  1IRS A;  3DXD A;  4GN1 A;  3GYP A;  4P7I A;  3QBV B;  3KY9 A;  2BCJ A;  3HQC A;  3FM8 C;  2D4Q A;  1PLS A;  3ULB A;  2CRF A;  2JP2 A;  2YT1 A;  1RRP B;  1FGZ A;  4CYE A;  2NZ8 B;  4XWX A;  4D0O A;  3P7Z A;  1XR0 B;  2J0M A;  4CHJ A;  5D3V A;  5KQ1 A;  2LOX A;  3ODX A;  5KCV A;  2I1J A;  3UZT A;  2OTX A;  1DDW A;  4NSW A;  4EMO A;  1WGU A;  1V5U A;  2DN6 A;  2PZ1 A;  1K5G B;  3F0W A;  3U8Z A;  2D9W A;  2DFK A;  1M7R A;  5C5B A;  4GZU A;  1GG3 A;  2EJ8 A;  2ROV A;  3NSU A;  1V61 A;  2OQB A;  4TKN A;  2W2W A;  3RCP A;  4NY0 A;  2YRY A;  2LUL A;  2DKP A;  1SHC A;  1ZSQ A;  3PVU A;  2GCJ A;  2H7D A;  3U7D A;  4Y94 A;  3V5W A;  2LKO A;  3P6A A;  4H8S A;  4MK0 A;  3BIN A;  1V5P A;  1NU2 A;  4GMV A;  2E2X A;  2N0Y A;  5D27 A;  4Z2M B;  4YL8 A;  1U27 A;  3TVV A;  2J0J A;  2DHK A;  2DHJ A;  5J3Q A;  1FB8 A;  5CLL B;  1QQG A;  3ZVR A;  2I1K A;  2COF A;  5D3Y A;  5J3Y A;  4HDO A;  5LOP B;  2L2I A;  4B6H A;  1PMS A;  4HB2 B;  3TFM A;  5DHF B;  2DLW A;  1DDM A;  5JLJ B;  3TW1 A;  2YS1 A;  2DYN A;  1U29 A;  2P0F A;  1DDV A;  4HAW B;  3D8F A;  3MPX A;  1X1F A;  2VSZ A;  1EGX A;  4PNK A;  2QKM A;  1U5E A;  1FOE A;  3AU4 A;  1XOD A;  4GMX B;  1MPH A;  2Y8G A;  2GS0 A;  4KHO A;  5L81 A;  4IAP A;  3MDB C;  4A6F B;  2EMT A;  1XX0 A;  2AEH A;  1XKE A;  1WGQ A;  5DI9 B;  4HB0 B;  5DH9 B;  5JP4 A;  2DA0 A;  4F7G A;  2LYD A;  2K00 A;  1J19 A;  3QIJ A;  5HE0 A;  2HE7 A;  3GYO A;  3F5R A;  2YF0 A;  3O96 A;  2XQN M;  1P5T A;  1SGH A;  1EVH A;  1Z87 A;  2DKQ A;  2ELA A;  4WSF A;  1W1D A;  3SNH A;  2EMS A;  1WJ1 A;  3SUZ A;  3HW2 B;  2M14 A;  4A6H A;  4HB4 B;  5DIF B;  1LW3 A;  2MKR A;  2N23 A;  3AJ4 A;  1ZVR A;  4HAX B;  4F7U P;  3ML4 A;  4L6E A;  2Y7B A;  2YS3 A;  1TQZ A;  4HDQ A;  5D3W A;  3QWM A;  2DTC A;  1UNR A;  1U5D A;  2H7E A;  4KVG B;  3X23 A;  1FAO A;  1EAZ A;  5JHG A;  2RSG A;  4K2P A;  1AQC A;  1WI1 A;  2G35 A;  3IVF A;  4ZRK A;  1EF1 A;  1ZM0 A;  3D8D A;  2DYQ A;  1U2B A;  4HAT B;  1UEF A;  2CY4 A;  1H4R A;  3AU5 A;  4HAV B;  3EO2 A;  2W2X C;  1LB1 A;  1NTV A;  4A6K A;  1XD4 A;  1GC7 A;  2Q13 A;  2K2U A;  5JHH A;  2EC1 A;  2DHI A;  1P3R A;  2KUP A;  3FEH A;  3PSC A;  1E5W A;  1ISN A;  5D3X A;  4Z2N A;  2GJY A;  1U5G A;  1WG7 A;  2MDX A;  1TJ6 A;  4GOU A;  4YON A;  1BY1 A;  5HE3 A;  3SYX A;  1BTK A;  4WVF B;  3ODW A;  2IFS A;  3WA0 A;  1OQN A;  1FHW A;  3VOQ A;  1ZC4 B;  4EJN A;  1Y19 B;  4TYZ A;  1B55 A;  1H10 A;  2ADZ A;  3SV1 A;  2R09 A;  3G9W A;  1WVH A;  3PVW A;  2D2Q A;  4HAY B;  4GXB A;  4D0N B;  1BTN A;  5KQ4 A;  1W1G A;  3A8P A;  1KZ7 A;  1DBH A;  3WYF B;  2RLO A;  4EKU A;  2D9Y A;  3CIK A;  4HHV A;  3SO6 A;  1MKE A;  2D9X A;  1MIZ B;  2KR9 A;  5HE2 A;  1X05 A;  2VKI A;  3PVL A;  4A6F A;  2KCJ A;  1AWE A;  2ROZ B;  1Y5O A;  2M38 A;  2YT0 A;  2UZS A;  1DYN A;  3T06 A;  1RJ2 A;  1MK9 B;  2VRW B;  3DXE A;  2R0D A;  5C16 A;  1U5F A;  2P0H A;  3VIA A;  4F7H A;  2FJL A;  1FHO A;  3KZ1 A;  5CLQ B;  4GYV A;  4DX9 0;  3FSS A;  1W1H A;  2COD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...