1TXDA

Crystal structure of the dh/ph domains of leukemia-associated rhogef
Total Genus 127
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
127
sequence length
373
structure length
352
Chain Sequence
PPNWQQLVSREVLLGLKPCEIKRQEVINELFYTERAHVRTLKVLDQVFYQRVSREGILSPSELRKIFSNLEDILQLHIGLNEQMKAVRKRNETSVIDQIGEDLLTWFSGPGEEKLKHAAATFCSNQPFALEMIKSRQKKDSRFQTFVQDAESNPLCRRLQLKDIIPTQMQRLTKYPLLLDNIAKYTEWPTEREKVKKAADHCRQILNFVNQAVKEAENKQRLEDYQRRLDTSSLVEELRNLDLTKRKMIHEGPLVWKVNRDKTIDLYTLLLEDILVLLQKQDDRLVLRCTFSPVIKLSTVLVRQVATNKALFVISMSDNGAQIYELVAQTVSEKTVWQDLICRMAASVKEQS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Rho guanine nucleotide exchange factor 12
publication title Structural determinants of RhoA binding and nucleotide exchange in leukemia-associated Rho guanine-nucleotide exchange factor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 127
structure length 352
sequence length 373
ec nomenclature
pdb deposition date 2004-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00621 RhoGEF RhoGEF domain
A PF17838 PH_16 PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.900.10 Mainly Alpha Up-down Bundle Dbl Homology Domain; Chain A Dbl homology (DH) domain 1txdA01
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1txdA02
4YL8A 1MPHA 2D2QA 4GMXB 2H7EA 3TCAA 1ZM0A 4HB2B 2BCJA 4HB0B 2YF0A 1NU2A 1F5XA 3CIKA 3M1IB 2V76A 3BJIA 5LONB 1U5FA 3LJUX 4HHVA 2EJ8A 5C5BB 1XODA 2K2UA 5L81A 4HATB 3IVFA 1DYNA 2D9WA 1Y5OA 1RRPB 2VRWB 3A8PA 3PSCA 3D8FA 3GF9A 3D8EA 5DHFB 3TVVA 2Z0PA 3DXEA 4NY0A 5C79A 1DDMA 1ZSQA 1XR0B 1P5TA 3AU4A 3PG7A 3ZDTA 2ZPYA 2KR9A 1ZC4B 3ULCA 1I2HA 4GXBA 1V5MA 2EC1A 2NZ8B 1OMWA 5KCVA 1EAZA 3SUZA 1XX0A 1B55A 1P3RA 2OTXA 1MIZB 4D0NB 3A98B 1AWEA 2PZ1A 3ML4A 1WJMA 2UZRA 2UVMA 1AQCA 2N0YA 2MFQA 3U7DA 4IOYX 5HE3A 2J0MA 4H8SA 3QIJA 5DHAB 2YRYA 4TYZA 2CY5A 2YT1A 1OQNA 2KGXB 2D9YA 2COCA 5FI0A 1H4RA 3FM8C 4HB4B 4MK0A 2GS0A 2I1JA 4HAZB 4IAPA 1FOEA 2J0JA 2Y8GA 2LG1A 2RNRB 1MK9B 4ZRKA 2W2XC 1J0WA 3RCPA 1ISNA 1X1GA 3SV1A 1BY1A 3SO6A 3VOQA 4F7HA 2DKPA 3PEGA 1SGHA 4F7GA 3TO1A 5FI1A 1IRSA 1TXDA 1WGQA 5J3YA 2XQNM 4B6HA 5DIFB 1BTNA 4GOUA 2QKMA 3FEHA 2N23A 1UNQA 3HK0A 1P6SA 1V61A 3PVLA 3HW2B 2I5CA 2P0DA 1DROA 2FJLA 3KSYA 3V5WA 1UPRA 2Q13A 4KVGB 2CAYA 4HDQA 5HE1A 5DI9B 2MKRA 3PVWA 2KCJA 1FGZA 2K2JA 4HAXB 5D3VA 3OANA 4DX8A 1MK7B 4HAWB 2R09A 3ULBA 1V5UA 2E2XA 4KAXB 1M7RA 2Z0OA 2MDXA 2DHKA 1U27A 3ODWA 4NSWA 1H10A 4ZRIA 2YVCA 1UNRA 1KZGA 1WJ1A 3JV3A 2W2WA 2QKLA 2P0HA 1PMSA 3AU5A 2H7DA 2W2XD 4GN1A 2AL6A 1V88A 2GCLA 2DTCA 1K5GB 3WA0A 1U29A 2COFA 2ROZB 2DN6A 4WJ7A 1Z87A 2Y8FA 5DH9B 2D9XA 2J59M 4PQ0A 5C6RA 1X11A 2J0KA 3A8QA 2DLWA 2HE7A 4HAYB 2RLOA 1FGYA 2M14A 1DBHA 2DA0A 5JHHA 1EGXA 1V5PA 3KY9A 1K5DB 2X18A 4WSFA 2CODA 3ODOA 2D10A 3QWMA 3F0WA 1GG3A 1PFJA 3F5RA 3ODXA 2ROVA 3QBVB 4GPTB 2I5FA 3KRXA 4L6EA 1W1DA 4Z2NA 4EKUA 3VIAA 1Y19B 4C0AA 2DX1A 2LKOA 2AEHA 2EMTA 1N3HA 4D0OA 1UEFA 2G35A 5J3TA 1FHXA 1MAIA 1PLSA 2CRFA 3TFMA 2HTHB 4K81A 2DKQA 4EMOA 2P0FA 2MWNB 3FSSA 4F7UP 4HB3B 2RGNB 4Z2MB 4A6FA 1RJ2A 1ZC3B 3MDBC 1W1HA 5JLJB 1U5DA 5KQ4A 2Z0QA 2D9VA 3GYOA 1WVHA 1DDWA 2P8VA 5GOWB 1TQZA 5JHGA 2L1CA 3DXDA 4CHMA 2UZSA 3D8DA 2IFSA 5D3YA 2D9ZA 4K2PA 5HE2A 4A5KA 4PNKA 1BWNA 5CLQB 4CHJA 2RVBB 4DXAB 2I1KA 3G9WA 2M38A 1SHCA 1UNPA 3TW1A 3UZTA 1NTYA 4WVFB 1MIXA 2OQBA 2ELBA 1V89A 2GCJA 5KQ1A 4DBBA 2KUPA 3BINA 2CY4A 4DX90 2DFKA 1U5EA 3MPXA 1EVHA 1LB1A 4KHAA 1FHWA 4YONA 4K2OA 1DDVA 2DX5A 3ZVRA 4GZUA 3SNHA 1WG7A 3WYFB 1I7AA 1XCGA 1U5GA 3KZ1A 4A6FB 2YS5A 2ELAA 3DXCA 1NTVA 5JP4A 1E5WA 5D3WA 4BBKA 1OY2A 1XKEA 2LYDA 1M7EA 1GC6A 2K00A 4GMVA 2D4QA 2LOZA 4HAUB 2RSGA 3N7CA 2R0DA 1X1FA 2D11A 4KHBB 1GC7A 2L2IA 2LOXA 1FHOA 2YS3A 4K17A 3PP2A 3O96A 2NMBA 3X23A 3HQCA 1ZVRA 4XWXA 4IFSA 1QC6A 1W1GA 5CLLB 5D3XA 5EFXA 1BTKA 3NSUA 2DHIA 3U8ZA 4MT7A 3CXBB 2YS1A 4A6HA 3SYXA 1TJ6A 1MKEA 4EJNA 1WI1A 2EMSA 4P7IA 1KZ7A 2COAA 1QQGA 3T06A 4ZRJA 1XD4A 1UPQA 1WGUA 1FAOA 3PZDA 3P7ZA 1Q67A 2DHJA 2LULA 2Y7BA 3AJ4A 5C5BA 4Y94A 5LOPB 4MY6A 5HE0A 1BAKA 3EO2A 1FB8A 2DYNA 2ADZA 1NI2A 5D27A 2YSZA 5J3QA 4TKNA 5C16A 4GYVA 2IYBA 1X86A 3GYPA 3P6AA 2YT0A 2JP2A 1J19A 4CYEA 2RUKB 2VSZA 1EF1A 2VKIA 4HDOA 2GJYA 1X05A 1LW3A 4A6KA 1KI1B 1U2BA 2DYQA 4HAVB 4KHOA 3PVUA 3KRWA
chains in the Genus database with same CATH superfamily
4YL8A 1MPHA 2D2QA 3OHMB 4GMXB 4QJ5B 2H7EA 3TCAA 4QXAB 1ZM0A 4HB2B 2BCJA 4HB0B 2YF0A 1NU2A 1F5XA 3CIKA 4OT1A 3M1IB 2V76A 3BJIA 5LONB 1U5FA 3LJUX 4HHVA 2EJ8A 5C5BB 1XODA 2K2UA 5L81A 4HATB 3IVFA 1DYNA 2D9WA 1Y5OA 1RRPB 2VRWB 3A8PA 3PSCA 3D8FA 3HSAA 3GF9A 3D8EA 5DHFB 3TVVA 2Z0PA 3DXEA 4NY0A 5C79A 1DDMA 1ZSQA 1XR0B 1P5TA 3AU4A 3PG7A 3ZDTA 2ZPYA 2KR9A 1ZC4B 3ULCA 1I2HA 4GXBA 1V5MA 2EC1A 2NZ8B 1OMWA 3NWFA 5KCVA 1EAZA 3SUZA 1XX0A 1B55A 1P3RA 2OTXA 1MIZB 4D0NB 3A98B 1AWEA 2PZ1A 3ML4A 1WJMA 2UZRA 2UVMA 1AQCA 2N0YA 2MFQA 3U7DA 4IOYX 5HE3A 2J0MA 4H8SA 3QIJA 5DHAB 2YRYA 4TYZA 2CY5A 2YT1A 4CSQA 1OQNA 2KGXB 2D9YA 2COCA 5FI0A 1H4RA 3FM8C 4HB4B 4MK0A 2GS0A 2I1JA 4HAZB 4IAPA 2ZKMX 1FOEA 2J0JA 2Y8GA 2LG1A 2RNRB 1MK9B 5I2SA 4ZRKA 2W2XC 1J0WA 2K8EA 2KIGA 3RCPA 1ISNA 1X1GA 3FVCA 3SV1A 1BY1A 2KUQA 3SO6A 3VOQA 1ZYIA 4F7HA 2DKPA 3PEGA 1SGHA 4F7GA 3TO1A 5FI1A 1IRSA 1TXDA 4QJ4B 2YT2A 1WGQA 5J3YA 2XQNM 1T77A 4B6HA 5DIFB 1BTNA 4GOUA 2QKMA 3FEHA 2N23A 1UNQA 3HK0A 1P6SA 3NWAA 1V61A 3PVLA 3HW2B 2I5CA 2P0DA 1DROA 2FJLA 4OSNA 3KSYA 3V5WA 1UPRA 2Q13A 4KVGB 5I2MA 2CAYA 4HDQA 5HE1A 5DI9B 2MKRA 3PVWA 2KCJA 1FGZA 2K2JA 4HAXB 5D3VA 3OANA 4DX8A 1MK7B 5IRSA 4HAWB 2R09A 3ULBA 1V5UA 2E2XA 4KAXB 1M7RA 2Z0OA 2MDXA 2DHKA 1U27A 3ODWA 4NSWA 1H10A 4ZRIA 2YVCA 1UNRA 1KZGA 1WJ1A 3JV3A 2W2WA 2QKLA 2P0HA 1PMSA 3AU5A 2H7DA 2W2XD 4GN1A 2AL6A 1V88A 2GCLA 2DTCA 1K5GB 3WA0A 1U29A 2COFA 2ROZB 2DN6A 4WJ7A 1Z87A 2Y8FA 5DH9B 2D9XA 2J59M 4PQ0A 5C6RA 1X11A 2J0KA 3A8QA 2DLWA 2HE7A 4HAYB 2RLOA 1FGYA 2M14A 1DBHA 2DA0A 5JHHA 1EGXA 1V5PA 3KY9A 1K5DB 2X18A 4WSFA 2CODA 3ODOA 2D10A 3QWMA 3F0WA 2KR0A 3U12A 1GG3A 1PFJA 3F5RA 3ODXA 2ROVA 3QBVB 4GPTB 2I5FA 3KRXA 4L6EA 1W1DA 4Z2NA 4EKUA 3VIAA 1Y19B 4C0AA 2DX1A 2LKOA 2AEHA 2EMTA 1N3HA 4D0OA 1UEFA 2G35A 3NW8A 5J3TA 1FHXA 1MAIA 1PLSA 2CRFA 3TFMA 2HTHB 4K81A 2DKQA 4EMOA 2P0FA 2MWNB 3FSSA 3B77A 4F7UP 4HB3B 2RGNB 4Z2MB 4A6FA 1RJ2A 1ZC3B 3MDBC 1W1HA 5JLJB 1U5DA 5KQ4A 2Z0QA 2D9VA 2Z59A 3GYOA 1WVHA 1DDWA 2P8VA 5GOWB 1TQZA 5JHGA 2L1CA 3DXDA 2NBVA 4CHMA 2UZSA 3D8DA 2IFSA 5D3YA 2D9ZA 4K2PA 5HE2A 4A5KA 2RRFA 4PNKA 1BWNA 5CLQB 4CHJA 2RVBB 4DXAB 2I1KA 3G9WA 2Z4DA 4KHBA 2M38A 1SHCA 1UNPA 3TW1A 3UZTA 1NTYA 5M4YB 4WVFB 1MIXA 2OQBA 2GUMA 2ELBA 1V89A 3A58A 2GCJA 5KQ1A 4L1RA 4DBBA 2KUPA 2R2YA 3BINA 2CY4A 4DX90 4QJ3B 2DFKA 1U5EA 3MPXA 1EVHA 1LB1A 4KHAA 1FHWA 4YONA 4K2OA 1DDVA 2DX5A 3ZVRA 4GZUA 3SNHA 1WG7A 3WYFB 1I7AA 3DCXA 1XCGA 1MI1A 1U5GA 3KZ1A 4A6FB 2YS5A 2ELAA 3DXCA 1NTVA 5JP4A 1E5WA 5D3WA 4BBKA 1OY2A 1XKEA 2LYDA 3NWDA 1M7EA 1GC6A 2K00A 4GMVA 2D4QA 2LOZA 4HAUB 2RSGA 3N7CA 2R0DA 1X1FA 2D11A 4KHBB 1GC7A 2L2IA 2LOXA 1FHOA 2YS3A 4K17A 3PP2A 3O96A 2NMBA 3X23A 3HQCA 1ZVRA 4XWXA 4IFSA 4DIXA 1QC6A 1W1GA 5CLLB 5D3XA 5EFXA 5LG4B 1BTKA 3NSUA 2DHIA 3U8ZA 4MT7A 3CXBB 2YS1A 4A6HA 4D6WA 3SYXA 1TJ6A 1MKEA 4EJNA 4HSIA 1WI1A 2EMSA 4P7IA 1KZ7A 2COAA 1QQGA 3T06A 4ZRJA 2KIEA 1XD4A 1UPQA 1WGUA 1FAOA 3PZDA 3P7ZA 1Q67A 2DHJA 4GNKB 2LULA 2Y7BA 3AJ4A 5C5BA 2Z13A 4Y94A 5LOPB 4MY6A 5HE0A 1BAKA 3EO2A 1FB8A 2DYNA 2Z14A 2ADZA 2FJUB 1NI2A 5D27A 2YSZA 5J3QA 4TKNA 5C16A 4GYVA 2IYBA 1X86A 3GYPA 3P6AA 2YT0A 2JP2A 1J19A 4CYEA 2RUKB 2VSZA 1EF1A 3HIEA 2VKIA 4HDOA 2GJYA 1X05A 1LW3A 4A6KA 1KI1B 1U2BA 2DYQA 4HAVB 2K49A 4KHOA 3PVUA 3KRWA
chains in the Genus database with same CATH topology
4YL8A 1MPHA 2D2QA 4GMXB 2H7EA 3TCAA 1ZM0A 4HB2B 2BCJA 4HB0B 2YF0A 1NU2A 1F5XA 3CIKA 3M1IB 2V76A 3BJIA 5LONB 1U5FA 3LJUX 4HHVA 2EJ8A 5C5BB 1XODA 2K2UA 5L81A 4HATB 3IVFA 1DYNA 2D9WA 1Y5OA 1RRPB 2VRWB 3A8PA 3PSCA 3D8FA 3GF9A 3D8EA 5DHFB 3TVVA 2Z0PA 3DXEA 4NY0A 5C79A 1DDMA 1ZSQA 1XR0B 1P5TA 3AU4A 3PG7A 3ZDTA 2ZPYA 2KR9A 1ZC4B 3ULCA 1I2HA 4GXBA 1V5MA 2EC1A 2NZ8B 1OMWA 5KCVA 1EAZA 3SUZA 1XX0A 1B55A 1P3RA 2OTXA 1MIZB 4D0NB 3A98B 1AWEA 2PZ1A 3ML4A 1WJMA 2UZRA 2UVMA 1AQCA 2N0YA 2MFQA 3U7DA 4IOYX 5HE3A 2J0MA 4H8SA 3QIJA 5DHAB 2YRYA 4TYZA 2CY5A 2YT1A 1OQNA 2KGXB 2D9YA 2COCA 5FI0A 1H4RA 3FM8C 4HB4B 4MK0A 2GS0A 2I1JA 4HAZB 4IAPA 1FOEA 2J0JA 2Y8GA 2LG1A 2RNRB 1MK9B 4ZRKA 2W2XC 1J0WA 3RCPA 1ISNA 1X1GA 3SV1A 1BY1A 3SO6A 3VOQA 4F7HA 2DKPA 3PEGA 1SGHA 4F7GA 3TO1A 5FI1A 1IRSA 1TXDA 1WGQA 5J3YA 2XQNM 4B6HA 5DIFB 1BTNA 4GOUA 2QKMA 3FEHA 2N23A 1UNQA 3HK0A 1P6SA 1V61A 3PVLA 3HW2B 2I5CA 2P0DA 1DROA 2FJLA 3KSYA 3V5WA 1UPRA 2Q13A 4KVGB 2CAYA 4HDQA 5HE1A 5DI9B 2MKRA 3PVWA 2KCJA 1FGZA 2K2JA 4HAXB 5D3VA 3OANA 4DX8A 1MK7B 4HAWB 2R09A 3ULBA 1V5UA 2E2XA 4KAXB 1M7RA 2Z0OA 2MDXA 2DHKA 1U27A 3ODWA 4NSWA 1H10A 4ZRIA 2YVCA 1UNRA 1KZGA 1WJ1A 3JV3A 2W2WA 2QKLA 2P0HA 1PMSA 3AU5A 2H7DA 2W2XD 4GN1A 2AL6A 1V88A 2GCLA 2DTCA 1K5GB 3WA0A 1U29A 2COFA 2ROZB 2DN6A 4WJ7A 1Z87A 2Y8FA 5DH9B 2D9XA 2J59M 4PQ0A 5C6RA 1X11A 2J0KA 3A8QA 2DLWA 2HE7A 4HAYB 2RLOA 1FGYA 2M14A 1DBHA 2DA0A 5JHHA 1EGXA 1V5PA 3KY9A 1K5DB 2X18A 4WSFA 2CODA 3ODOA 2D10A 3QWMA 3F0WA 1GG3A 1PFJA 3F5RA 3ODXA 2ROVA 3QBVB 4GPTB 2I5FA 3KRXA 4L6EA 1W1DA 4Z2NA 4EKUA 3VIAA 1Y19B 4C0AA 2DX1A 2LKOA 2AEHA 2EMTA 1N3HA 4D0OA 1UEFA 2G35A 5J3TA 1FHXA 1MAIA 1PLSA 2CRFA 3TFMA 2HTHB 4K81A 2DKQA 4EMOA 2P0FA 2MWNB 3FSSA 4F7UP 4HB3B 2RGNB 4Z2MB 4A6FA 1RJ2A 1ZC3B 3MDBC 1W1HA 5JLJB 1U5DA 5KQ4A 2Z0QA 2D9VA 3GYOA 1WVHA 1DDWA 2P8VA 5GOWB 1TQZA 5JHGA 2L1CA 3DXDA 4CHMA 2UZSA 3D8DA 2IFSA 5D3YA 2D9ZA 4K2PA 5HE2A 4A5KA 4PNKA 1BWNA 5CLQB 4CHJA 2RVBB 4DXAB 2I1KA 3G9WA 2M38A 1SHCA 1UNPA 3TW1A 3UZTA 1NTYA 4WVFB 1MIXA 2OQBA 2ELBA 1V89A 2GCJA 5KQ1A 4DBBA 2KUPA 3BINA 2CY4A 4DX90 2DFKA 1U5EA 3MPXA 1EVHA 1LB1A 4KHAA 1FHWA 4YONA 4K2OA 1DDVA 2DX5A 3ZVRA 4GZUA 3SNHA 1WG7A 3WYFB 1I7AA 1XCGA 1U5GA 3KZ1A 4A6FB 2YS5A 2ELAA 3DXCA 1NTVA 5JP4A 1E5WA 5D3WA 4BBKA 1OY2A 1XKEA 2LYDA 1M7EA 1GC6A 2K00A 4GMVA 2D4QA 2LOZA 4HAUB 2RSGA 3N7CA 2R0DA 1X1FA 2D11A 4KHBB 1GC7A 2L2IA 2LOXA 1FHOA 2YS3A 4K17A 3PP2A 3O96A 2NMBA 3X23A 3HQCA 1ZVRA 4XWXA 4IFSA 1QC6A 1W1GA 5CLLB 5D3XA 5EFXA 1BTKA 3NSUA 2DHIA 3U8ZA 4MT7A 3CXBB 2YS1A 4A6HA 3SYXA 1TJ6A 1MKEA 4EJNA 1WI1A 2EMSA 4P7IA 1KZ7A 2COAA 1QQGA 3T06A 4ZRJA 1XD4A 1UPQA 1WGUA 1FAOA 3PZDA 3P7ZA 1Q67A 2DHJA 2LULA 2Y7BA 3AJ4A 5C5BA 4Y94A 5LOPB 4MY6A 5HE0A 1BAKA 3EO2A 1FB8A 2DYNA 2ADZA 1NI2A 5D27A 2YSZA 5J3QA 4TKNA 5C16A 4GYVA 2IYBA 1X86A 3GYPA 3P6AA 2YT0A 2JP2A 1J19A 4CYEA 2RUKB 2VSZA 1EF1A 2VKIA 4HDOA 2GJYA 1X05A 1LW3A 4A6KA 1KI1B 1U2BA 2DYQA 4HAVB 4KHOA 3PVUA 3KRWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YL8 A;  1MPH A;  2D2Q A;  4GMX B;  2H7E A;  3TCA A;  1ZM0 A;  4HB2 B;  2BCJ A;  4HB0 B;  2YF0 A;  1NU2 A;  1F5X A;  3CIK A;  3M1I B;  2V76 A;  3BJI A;  5LON B;  1U5F A;  3LJU X;  4HHV A;  2EJ8 A;  5C5B B;  1XOD A;  2K2U A;  5L81 A;  4HAT B;  3IVF A;  1DYN A;  2D9W A;  1Y5O A;  1RRP B;  2VRW B;  3A8P A;  3PSC A;  3D8F A;  3GF9 A;  3D8E A;  5DHF B;  3TVV A;  2Z0P A;  3DXE A;  4NY0 A;  5C79 A;  1DDM A;  1ZSQ A;  1XR0 B;  1P5T A;  3AU4 A;  3PG7 A;  3ZDT A;  2ZPY A;  2KR9 A;  1ZC4 B;  3ULC A;  1I2H A;  4GXB A;  1V5M A;  2EC1 A;  2NZ8 B;  1OMW A;  5KCV A;  1EAZ A;  3SUZ A;  1XX0 A;  1B55 A;  1P3R A;  2OTX A;  1MIZ B;  4D0N B;  3A98 B;  1AWE A;  2PZ1 A;  3ML4 A;  1WJM A;  2UZR A;  2UVM A;  1AQC A;  2N0Y A;  2MFQ A;  3U7D A;  4IOY X;  5HE3 A;  2J0M A;  4H8S A;  3QIJ A;  5DHA B;  2YRY A;  4TYZ A;  2CY5 A;  2YT1 A;  1OQN A;  2KGX B;  2D9Y A;  2COC A;  5FI0 A;  1H4R A;  3FM8 C;  4HB4 B;  4MK0 A;  2GS0 A;  2I1J A;  4HAZ B;  4IAP A;  1FOE A;  2J0J A;  2Y8G A;  2LG1 A;  2RNR B;  1MK9 B;  4ZRK A;  2W2X C;  1J0W A;  3RCP A;  1ISN A;  1X1G A;  3SV1 A;  1BY1 A;  3SO6 A;  3VOQ A;  4F7H A;  2DKP A;  3PEG A;  1SGH A;  4F7G A;  3TO1 A;  5FI1 A;  1IRS A;  1TXD A;  1WGQ A;  5J3Y A;  2XQN M;  4B6H A;  5DIF B;  1BTN A;  4GOU A;  2QKM A;  3FEH A;  2N23 A;  1UNQ A;  3HK0 A;  1P6S A;  1V61 A;  3PVL A;  3HW2 B;  2I5C A;  2P0D A;  1DRO A;  2FJL A;  3KSY A;  3V5W A;  1UPR A;  2Q13 A;  4KVG B;  2CAY A;  4HDQ A;  5HE1 A;  5DI9 B;  2MKR A;  3PVW A;  2KCJ A;  1FGZ A;  2K2J A;  4HAX B;  5D3V A;  3OAN A;  4DX8 A;  1MK7 B;  4HAW B;  2R09 A;  3ULB A;  1V5U A;  2E2X A;  4KAX B;  1M7R A;  2Z0O A;  2MDX A;  2DHK A;  1U27 A;  3ODW A;  4NSW A;  1H10 A;  4ZRI A;  2YVC A;  1UNR A;  1KZG A;  1WJ1 A;  3JV3 A;  2W2W A;  2QKL A;  2P0H A;  1PMS A;  3AU5 A;  2H7D A;  2W2X D;  4GN1 A;  2AL6 A;  1V88 A;  2GCL A;  2DTC A;  1K5G B;  3WA0 A;  1U29 A;  2COF A;  2ROZ B;  2DN6 A;  4WJ7 A;  1Z87 A;  2Y8F A;  5DH9 B;  2D9X A;  2J59 M;  4PQ0 A;  5C6R A;  1X11 A;  2J0K A;  3A8Q A;  2DLW A;  2HE7 A;  4HAY B;  2RLO A;  1FGY A;  2M14 A;  1DBH A;  2DA0 A;  5JHH A;  1EGX A;  1V5P A;  3KY9 A;  1K5D B;  2X18 A;  4WSF A;  2COD A;  3ODO A;  2D10 A;  3QWM A;  3F0W A;  1GG3 A;  1PFJ A;  3F5R A;  3ODX A;  2ROV A;  3QBV B;  4GPT B;  2I5F A;  3KRX A;  4L6E A;  1W1D A;  4Z2N A;  4EKU A;  3VIA A;  1Y19 B;  4C0A A;  2DX1 A;  2LKO A;  2AEH A;  2EMT A;  1N3H A;  4D0O A;  1UEF A;  2G35 A;  5J3T A;  1FHX A;  1MAI A;  1PLS A;  2CRF A;  3TFM A;  2HTH B;  4K81 A;  2DKQ A;  4EMO A;  2P0F A;  2MWN B;  3FSS A;  4F7U P;  4HB3 B;  2RGN B;  4Z2M B;  4A6F A;  1RJ2 A;  1ZC3 B;  3MDB C;  1W1H A;  5JLJ B;  1U5D A;  5KQ4 A;  2Z0Q A;  2D9V A;  3GYO A;  1WVH A;  1DDW A;  2P8V A;  5GOW B;  1TQZ A;  5JHG A;  2L1C A;  3DXD A;  4CHM A;  2UZS A;  3D8D A;  2IFS A;  5D3Y A;  2D9Z A;  4K2P A;  5HE2 A;  4A5K A;  4PNK A;  1BWN A;  5CLQ B;  4CHJ A;  2RVB B;  4DXA B;  2I1K A;  3G9W A;  2M38 A;  1SHC A;  1UNP A;  3TW1 A;  3UZT A;  1NTY A;  4WVF B;  1MIX A;  2OQB A;  2ELB A;  1V89 A;  2GCJ A;  5KQ1 A;  4DBB A;  2KUP A;  3BIN A;  2CY4 A;  4DX9 0;  2DFK A;  1U5E A;  3MPX A;  1EVH A;  1LB1 A;  4KHA A;  1FHW A;  4YON A;  4K2O A;  1DDV A;  2DX5 A;  3ZVR A;  4GZU A;  3SNH A;  1WG7 A;  3WYF B;  1I7A A;  1XCG A;  1U5G A;  3KZ1 A;  4A6F B;  2YS5 A;  2ELA A;  3DXC A;  1NTV A;  5JP4 A;  1E5W A;  5D3W A;  4BBK A;  1OY2 A;  1XKE A;  2LYD A;  1M7E A;  1GC6 A;  2K00 A;  4GMV A;  2D4Q A;  2LOZ A;  4HAU B;  2RSG A;  3N7C A;  2R0D A;  1X1F A;  2D11 A;  4KHB B;  1GC7 A;  2L2I A;  2LOX A;  1FHO A;  2YS3 A;  4K17 A;  3PP2 A;  3O96 A;  2NMB A;  3X23 A;  3HQC A;  1ZVR A;  4XWX A;  4IFS A;  1QC6 A;  1W1G A;  5CLL B;  5D3X A;  5EFX A;  1BTK A;  3NSU A;  2DHI A;  3U8Z A;  4MT7 A;  3CXB B;  2YS1 A;  4A6H A;  3SYX A;  1TJ6 A;  1MKE A;  4EJN A;  1WI1 A;  2EMS A;  4P7I A;  1KZ7 A;  2COA A;  1QQG A;  3T06 A;  4ZRJ A;  1XD4 A;  1UPQ A;  1WGU A;  1FAO A;  3PZD A;  3P7Z A;  1Q67 A;  2DHJ A;  2LUL A;  2Y7B A;  3AJ4 A;  5C5B A;  4Y94 A;  5LOP B;  4MY6 A;  5HE0 A;  1BAK A;  3EO2 A;  1FB8 A;  2DYN A;  2ADZ A;  1NI2 A;  5D27 A;  2YSZ A;  5J3Q A;  4TKN A;  5C16 A;  4GYV A;  2IYB A;  1X86 A;  3GYP A;  3P6A A;  2YT0 A;  2JP2 A;  1J19 A;  4CYE A;  2RUK B;  2VSZ A;  1EF1 A;  2VKI A;  4HDO A;  2GJY A;  1X05 A;  1LW3 A;  4A6K A;  1KI1 B;  1U2B A;  2DYQ A;  4HAV B;  4KHO A;  3PVU A;  3KRW A; 
#chains in the Genus database with same CATH topology
 4YL8 A;  1MPH A;  2D2Q A;  3OHM B;  4GMX B;  4QJ5 B;  2H7E A;  3TCA A;  4QXA B;  1ZM0 A;  4HB2 B;  2BCJ A;  4HB0 B;  2YF0 A;  1NU2 A;  1F5X A;  3CIK A;  4OT1 A;  3M1I B;  2V76 A;  3BJI A;  5LON B;  1U5F A;  3LJU X;  4HHV A;  2EJ8 A;  5C5B B;  1XOD A;  2K2U A;  5L81 A;  4HAT B;  3IVF A;  1DYN A;  2D9W A;  1Y5O A;  1RRP B;  2VRW B;  3A8P A;  3PSC A;  3D8F A;  3HSA A;  3GF9 A;  3D8E A;  5DHF B;  3TVV A;  2Z0P A;  3DXE A;  4NY0 A;  5C79 A;  1DDM A;  1ZSQ A;  1XR0 B;  1P5T A;  3AU4 A;  3PG7 A;  3ZDT A;  2ZPY A;  2KR9 A;  1ZC4 B;  3ULC A;  1I2H A;  4GXB A;  1V5M A;  2EC1 A;  2NZ8 B;  1OMW A;  3NWF A;  5KCV A;  1EAZ A;  3SUZ A;  1XX0 A;  1B55 A;  1P3R A;  2OTX A;  1MIZ B;  4D0N B;  3A98 B;  1AWE A;  2PZ1 A;  3ML4 A;  1WJM A;  2UZR A;  2UVM A;  1AQC A;  2N0Y A;  2MFQ A;  3U7D A;  4IOY X;  5HE3 A;  2J0M A;  4H8S A;  3QIJ A;  5DHA B;  2YRY A;  4TYZ A;  2CY5 A;  2YT1 A;  4CSQ A;  1OQN A;  2KGX B;  2D9Y A;  2COC A;  5FI0 A;  1H4R A;  3FM8 C;  4HB4 B;  4MK0 A;  2GS0 A;  2I1J A;  4HAZ B;  4IAP A;  2ZKM X;  1FOE A;  2J0J A;  2Y8G A;  2LG1 A;  2RNR B;  1MK9 B;  5I2S A;  4ZRK A;  2W2X C;  1J0W A;  2K8E A;  2KIG A;  3RCP A;  1ISN A;  1X1G A;  3FVC A;  3SV1 A;  1BY1 A;  2KUQ A;  3SO6 A;  3VOQ A;  1ZYI A;  4F7H A;  2DKP A;  3PEG A;  1SGH A;  4F7G A;  3TO1 A;  5FI1 A;  1IRS A;  1TXD A;  4QJ4 B;  2YT2 A;  1WGQ A;  5J3Y A;  2XQN M;  1T77 A;  4B6H A;  5DIF B;  1BTN A;  4GOU A;  2QKM A;  3FEH A;  2N23 A;  1UNQ A;  3HK0 A;  1P6S A;  3NWA A;  1V61 A;  3PVL A;  3HW2 B;  2I5C A;  2P0D A;  1DRO A;  2FJL A;  4OSN A;  3KSY A;  3V5W A;  1UPR A;  2Q13 A;  4KVG B;  5I2M A;  2CAY A;  4HDQ A;  5HE1 A;  5DI9 B;  2MKR A;  3PVW A;  2KCJ A;  1FGZ A;  2K2J A;  4HAX B;  5D3V A;  3OAN A;  4DX8 A;  1MK7 B;  5IRS A;  4HAW B;  2R09 A;  3ULB A;  1V5U A;  2E2X A;  4KAX B;  1M7R A;  2Z0O A;  2MDX A;  2DHK A;  1U27 A;  3ODW A;  4NSW A;  1H10 A;  4ZRI A;  2YVC A;  1UNR A;  1KZG A;  1WJ1 A;  3JV3 A;  2W2W A;  2QKL A;  2P0H A;  1PMS A;  3AU5 A;  2H7D A;  2W2X D;  4GN1 A;  2AL6 A;  1V88 A;  2GCL A;  2DTC A;  1K5G B;  3WA0 A;  1U29 A;  2COF A;  2ROZ B;  2DN6 A;  4WJ7 A;  1Z87 A;  2Y8F A;  5DH9 B;  2D9X A;  2J59 M;  4PQ0 A;  5C6R A;  1X11 A;  2J0K A;  3A8Q A;  2DLW A;  2HE7 A;  4HAY B;  2RLO A;  1FGY A;  2M14 A;  1DBH A;  2DA0 A;  5JHH A;  1EGX A;  1V5P A;  3KY9 A;  1K5D B;  2X18 A;  4WSF A;  2COD A;  3ODO A;  2D10 A;  3QWM A;  3F0W A;  2KR0 A;  3U12 A;  1GG3 A;  1PFJ A;  3F5R A;  3ODX A;  2ROV A;  3QBV B;  4GPT B;  2I5F A;  3KRX A;  4L6E A;  1W1D A;  4Z2N A;  4EKU A;  3VIA A;  1Y19 B;  4C0A A;  2DX1 A;  2LKO A;  2AEH A;  2EMT A;  1N3H A;  4D0O A;  1UEF A;  2G35 A;  3NW8 A;  5J3T A;  1FHX A;  1MAI A;  1PLS A;  2CRF A;  3TFM A;  2HTH B;  4K81 A;  2DKQ A;  4EMO A;  2P0F A;  2MWN B;  3FSS A;  3B77 A;  4F7U P;  4HB3 B;  2RGN B;  4Z2M B;  4A6F A;  1RJ2 A;  1ZC3 B;  3MDB C;  1W1H A;  5JLJ B;  1U5D A;  5KQ4 A;  2Z0Q A;  2D9V A;  2Z59 A;  3GYO A;  1WVH A;  1DDW A;  2P8V A;  5GOW B;  1TQZ A;  5JHG A;  2L1C A;  3DXD A;  2NBV A;  4CHM A;  2UZS A;  3D8D A;  2IFS A;  5D3Y A;  2D9Z A;  4K2P A;  5HE2 A;  4A5K A;  2RRF A;  4PNK A;  1BWN A;  5CLQ B;  4CHJ A;  2RVB B;  4DXA B;  2I1K A;  3G9W A;  2Z4D A;  4KHB A;  2M38 A;  1SHC A;  1UNP A;  3TW1 A;  3UZT A;  1NTY A;  5M4Y B;  4WVF B;  1MIX A;  2OQB A;  2GUM A;  2ELB A;  1V89 A;  3A58 A;  2GCJ A;  5KQ1 A;  4L1R A;  4DBB A;  2KUP A;  2R2Y A;  3BIN A;  2CY4 A;  4DX9 0;  4QJ3 B;  2DFK A;  1U5E A;  3MPX A;  1EVH A;  1LB1 A;  4KHA A;  1FHW A;  4YON A;  4K2O A;  1DDV A;  2DX5 A;  3ZVR A;  4GZU A;  3SNH A;  1WG7 A;  3WYF B;  1I7A A;  3DCX A;  1XCG A;  1MI1 A;  1U5G A;  3KZ1 A;  4A6F B;  2YS5 A;  2ELA A;  3DXC A;  1NTV A;  5JP4 A;  1E5W A;  5D3W A;  4BBK A;  1OY2 A;  1XKE A;  2LYD A;  3NWD A;  1M7E A;  1GC6 A;  2K00 A;  4GMV A;  2D4Q A;  2LOZ A;  4HAU B;  2RSG A;  3N7C A;  2R0D A;  1X1F A;  2D11 A;  4KHB B;  1GC7 A;  2L2I A;  2LOX A;  1FHO A;  2YS3 A;  4K17 A;  3PP2 A;  3O96 A;  2NMB A;  3X23 A;  3HQC A;  1ZVR A;  4XWX A;  4IFS A;  4DIX A;  1QC6 A;  1W1G A;  5CLL B;  5D3X A;  5EFX A;  5LG4 B;  1BTK A;  3NSU A;  2DHI A;  3U8Z A;  4MT7 A;  3CXB B;  2YS1 A;  4A6H A;  4D6W A;  3SYX A;  1TJ6 A;  1MKE A;  4EJN A;  4HSI A;  1WI1 A;  2EMS A;  4P7I A;  1KZ7 A;  2COA A;  1QQG A;  3T06 A;  4ZRJ A;  2KIE A;  1XD4 A;  1UPQ A;  1WGU A;  1FAO A;  3PZD A;  3P7Z A;  1Q67 A;  2DHJ A;  4GNK B;  2LUL A;  2Y7B A;  3AJ4 A;  5C5B A;  2Z13 A;  4Y94 A;  5LOP B;  4MY6 A;  5HE0 A;  1BAK A;  3EO2 A;  1FB8 A;  2DYN A;  2Z14 A;  2ADZ A;  2FJU B;  1NI2 A;  5D27 A;  2YSZ A;  5J3Q A;  4TKN A;  5C16 A;  4GYV A;  2IYB A;  1X86 A;  3GYP A;  3P6A A;  2YT0 A;  2JP2 A;  1J19 A;  4CYE A;  2RUK B;  2VSZ A;  1EF1 A;  3HIE A;  2VKI A;  4HDO A;  2GJY A;  1X05 A;  1LW3 A;  4A6K A;  1KI1 B;  1U2B A;  2DYQ A;  4HAV B;  2K49 A;  4KHO A;  3PVU A;  3KRW A; 
#chains in the Genus database with same CATH homology
 4YL8 A;  1MPH A;  2D2Q A;  4GMX B;  2H7E A;  3TCA A;  1ZM0 A;  4HB2 B;  2BCJ A;  4HB0 B;  2YF0 A;  1NU2 A;  1F5X A;  3CIK A;  3M1I B;  2V76 A;  3BJI A;  5LON B;  1U5F A;  3LJU X;  4HHV A;  2EJ8 A;  5C5B B;  1XOD A;  2K2U A;  5L81 A;  4HAT B;  3IVF A;  1DYN A;  2D9W A;  1Y5O A;  1RRP B;  2VRW B;  3A8P A;  3PSC A;  3D8F A;  3GF9 A;  3D8E A;  5DHF B;  3TVV A;  2Z0P A;  3DXE A;  4NY0 A;  5C79 A;  1DDM A;  1ZSQ A;  1XR0 B;  1P5T A;  3AU4 A;  3PG7 A;  3ZDT A;  2ZPY A;  2KR9 A;  1ZC4 B;  3ULC A;  1I2H A;  4GXB A;  1V5M A;  2EC1 A;  2NZ8 B;  1OMW A;  5KCV A;  1EAZ A;  3SUZ A;  1XX0 A;  1B55 A;  1P3R A;  2OTX A;  1MIZ B;  4D0N B;  3A98 B;  1AWE A;  2PZ1 A;  3ML4 A;  1WJM A;  2UZR A;  2UVM A;  1AQC A;  2N0Y A;  2MFQ A;  3U7D A;  4IOY X;  5HE3 A;  2J0M A;  4H8S A;  3QIJ A;  5DHA B;  2YRY A;  4TYZ A;  2CY5 A;  2YT1 A;  1OQN A;  2KGX B;  2D9Y A;  2COC A;  5FI0 A;  1H4R A;  3FM8 C;  4HB4 B;  4MK0 A;  2GS0 A;  2I1J A;  4HAZ B;  4IAP A;  1FOE A;  2J0J A;  2Y8G A;  2LG1 A;  2RNR B;  1MK9 B;  4ZRK A;  2W2X C;  1J0W A;  3RCP A;  1ISN A;  1X1G A;  3SV1 A;  1BY1 A;  3SO6 A;  3VOQ A;  4F7H A;  2DKP A;  3PEG A;  1SGH A;  4F7G A;  3TO1 A;  5FI1 A;  1IRS A;  1TXD A;  1WGQ A;  5J3Y A;  2XQN M;  4B6H A;  5DIF B;  1BTN A;  4GOU A;  2QKM A;  3FEH A;  2N23 A;  1UNQ A;  3HK0 A;  1P6S A;  1V61 A;  3PVL A;  3HW2 B;  2I5C A;  2P0D A;  1DRO A;  2FJL A;  3KSY A;  3V5W A;  1UPR A;  2Q13 A;  4KVG B;  2CAY A;  4HDQ A;  5HE1 A;  5DI9 B;  2MKR A;  3PVW A;  2KCJ A;  1FGZ A;  2K2J A;  4HAX B;  5D3V A;  3OAN A;  4DX8 A;  1MK7 B;  4HAW B;  2R09 A;  3ULB A;  1V5U A;  2E2X A;  4KAX B;  1M7R A;  2Z0O A;  2MDX A;  2DHK A;  1U27 A;  3ODW A;  4NSW A;  1H10 A;  4ZRI A;  2YVC A;  1UNR A;  1KZG A;  1WJ1 A;  3JV3 A;  2W2W A;  2QKL A;  2P0H A;  1PMS A;  3AU5 A;  2H7D A;  2W2X D;  4GN1 A;  2AL6 A;  1V88 A;  2GCL A;  2DTC A;  1K5G B;  3WA0 A;  1U29 A;  2COF A;  2ROZ B;  2DN6 A;  4WJ7 A;  1Z87 A;  2Y8F A;  5DH9 B;  2D9X A;  2J59 M;  4PQ0 A;  5C6R A;  1X11 A;  2J0K A;  3A8Q A;  2DLW A;  2HE7 A;  4HAY B;  2RLO A;  1FGY A;  2M14 A;  1DBH A;  2DA0 A;  5JHH A;  1EGX A;  1V5P A;  3KY9 A;  1K5D B;  2X18 A;  4WSF A;  2COD A;  3ODO A;  2D10 A;  3QWM A;  3F0W A;  1GG3 A;  1PFJ A;  3F5R A;  3ODX A;  2ROV A;  3QBV B;  4GPT B;  2I5F A;  3KRX A;  4L6E A;  1W1D A;  4Z2N A;  4EKU A;  3VIA A;  1Y19 B;  4C0A A;  2DX1 A;  2LKO A;  2AEH A;  2EMT A;  1N3H A;  4D0O A;  1UEF A;  2G35 A;  5J3T A;  1FHX A;  1MAI A;  1PLS A;  2CRF A;  3TFM A;  2HTH B;  4K81 A;  2DKQ A;  4EMO A;  2P0F A;  2MWN B;  3FSS A;  4F7U P;  4HB3 B;  2RGN B;  4Z2M B;  4A6F A;  1RJ2 A;  1ZC3 B;  3MDB C;  1W1H A;  5JLJ B;  1U5D A;  5KQ4 A;  2Z0Q A;  2D9V A;  3GYO A;  1WVH A;  1DDW A;  2P8V A;  5GOW B;  1TQZ A;  5JHG A;  2L1C A;  3DXD A;  4CHM A;  2UZS A;  3D8D A;  2IFS A;  5D3Y A;  2D9Z A;  4K2P A;  5HE2 A;  4A5K A;  4PNK A;  1BWN A;  5CLQ B;  4CHJ A;  2RVB B;  4DXA B;  2I1K A;  3G9W A;  2M38 A;  1SHC A;  1UNP A;  3TW1 A;  3UZT A;  1NTY A;  4WVF B;  1MIX A;  2OQB A;  2ELB A;  1V89 A;  2GCJ A;  5KQ1 A;  4DBB A;  2KUP A;  3BIN A;  2CY4 A;  4DX9 0;  2DFK A;  1U5E A;  3MPX A;  1EVH A;  1LB1 A;  4KHA A;  1FHW A;  4YON A;  4K2O A;  1DDV A;  2DX5 A;  3ZVR A;  4GZU A;  3SNH A;  1WG7 A;  3WYF B;  1I7A A;  1XCG A;  1U5G A;  3KZ1 A;  4A6F B;  2YS5 A;  2ELA A;  3DXC A;  1NTV A;  5JP4 A;  1E5W A;  5D3W A;  4BBK A;  1OY2 A;  1XKE A;  2LYD A;  1M7E A;  1GC6 A;  2K00 A;  4GMV A;  2D4Q A;  2LOZ A;  4HAU B;  2RSG A;  3N7C A;  2R0D A;  1X1F A;  2D11 A;  4KHB B;  1GC7 A;  2L2I A;  2LOX A;  1FHO A;  2YS3 A;  4K17 A;  3PP2 A;  3O96 A;  2NMB A;  3X23 A;  3HQC A;  1ZVR A;  4XWX A;  4IFS A;  1QC6 A;  1W1G A;  5CLL B;  5D3X A;  5EFX A;  1BTK A;  3NSU A;  2DHI A;  3U8Z A;  4MT7 A;  3CXB B;  2YS1 A;  4A6H A;  3SYX A;  1TJ6 A;  1MKE A;  4EJN A;  1WI1 A;  2EMS A;  4P7I A;  1KZ7 A;  2COA A;  1QQG A;  3T06 A;  4ZRJ A;  1XD4 A;  1UPQ A;  1WGU A;  1FAO A;  3PZD A;  3P7Z A;  1Q67 A;  2DHJ A;  2LUL A;  2Y7B A;  3AJ4 A;  5C5B A;  4Y94 A;  5LOP B;  4MY6 A;  5HE0 A;  1BAK A;  3EO2 A;  1FB8 A;  2DYN A;  2ADZ A;  1NI2 A;  5D27 A;  2YSZ A;  5J3Q A;  4TKN A;  5C16 A;  4GYV A;  2IYB A;  1X86 A;  3GYP A;  3P6A A;  2YT0 A;  2JP2 A;  1J19 A;  4CYE A;  2RUK B;  2VSZ A;  1EF1 A;  2VKI A;  4HDO A;  2GJY A;  1X05 A;  1LW3 A;  4A6K A;  1KI1 B;  1U2B A;  2DYQ A;  4HAV B;  4KHO A;  3PVU A;  3KRW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...