1TXDA

Crystal structure of the dh/ph domains of leukemia-associated rhogef
Total Genus 127
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
127
sequence length
373
structure length
352
Chain Sequence
PPNWQQLVSREVLLGLKPCEIKRQEVINELFYTERAHVRTLKVLDQVFYQRVSREGILSPSELRKIFSNLEDILQLHIGLNEQMKAVRKRNETSVIDQIGEDLLTWFSGPGEEKLKHAAATFCSNQPFALEMIKSRQKKDSRFQTFVQDAESNPLCRRLQLKDIIPTQMQRLTKYPLLLDNIAKYTEWPTEREKVKKAADHCRQILNFVNQAVKEAENKQRLEDYQRRLDTSSLVEELRNLDLTKRKMIHEGPLVWKVNRDKTIDLYTLLLEDILVLLQKQDDRLVLRCTFSPVIKLSTVLVRQVATNKALFVISMSDNGAQIYELVAQTVSEKTVWQDLICRMAASVKEQS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural determinants of RhoA binding and nucleotide exchange in leukemia-associated Rho guanine-nucleotide exchange factor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords Rho guanine nucleotide exchange factor 12
total genus 127
structure length 352
sequence length 373
ec nomenclature
pdb deposition date 2004-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00621 RhoGEF RhoGEF domain
A PF17838 PH_16 PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.900.10 Mainly Alpha Up-down Bundle Dbl Homology Domain; Chain A Dbl homology (DH) domain 1txdA01
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1txdA02
3CIKA 3PVUA 2KUPA 1MK7B 1FGZA 2YT0A 3TFMA 1AQCA 4GZUA 3WA0A 1EVHA 1WVHA 4WSFA 3TCAA 2R09A 1H4RA 1KZGA 2PZ1A 1GC6A 2LKOA 2YRYA 3D8DA 2XQNM 4DX8A 1NI2A 3JV3A 3TVVA 2P8VA 4GPTB 1J19A 3UZTA 4K2PA 2GCLA 3PG7A 4D0NB 2IYBA 4GN1A 5D27A 3P7ZA 2KR9A 1ZC4B 2CAYA 2DA0A 1X1FA 2I5FA 5LONB 3KZ1A 1BAKA 2CY5A 3PZDA 4MK0A 1K5DB 2DHKA 2AL6A 4EKUA 2YS5A 4K81A 2EC1A 1EF1A 3SUZA 1WI1A 3V5WA 4WVFB 1FHWA 2M14A 2J0KA 2BCJA 1MAIA 3AU5A 3SYXA 1NU2A 4K17A 1UPRA 4KVGB 2EJ8A 1DYNA 1LW3A 4HAZB 1IRSA 2J0MA 1MIZB 4ZRJA 2D9YA 4DBBA 2FJLA 1U5GA 2NMBA 4NSWA 4GYVA 4HB2B 3BJIA 3N7CA 4Z2MB 2L2IA 5J3YA 3KY9A 5D3VA 5DHFB 1U29A 3F5RA 1MK9B 1K5GB 2I1JA 2MDXA 5C5BA 2G35A 2DN6A 3ML4A 4HATB 4Z2NA 3F0WA 4HAXB 5D3XA 1N3HA 4MT7A 5C16A 3D8FA 1W1DA 3MPXA 1UNQA 5KCVA 1BTKA 1ISNA 4NY0A 3EO2A 5C79A 1DDMA 1GG3A 5DHAB 4IAPA 3TW1A 2HTHB 4F7UP 1EGXA 3QWMA 4XWXA 4A6FB 3O96A 4EMOA 3RCPA 2W2XC 1BWNA 2HE7A 3MDBC 3KRXA 2KGXB 3AJ4A 4HHVA 2JP2A 1I2HA 4TKNA 1ZM0A 1XR0B 1PMSA 4YL8A 3HQCA 4KHAA 4DX90 2J59M 2K00A 1V61A 4DXAB 1U27A 4Y94A 2ELBA 2DKQA 1WG7A 2Z0PA 2COCA 4IFSA 1E5WA 2COAA 2GCJA 1V5UA 3QBVB 2YVCA 3BINA 3GYOA 2Y7BA 4F7HA 2Y8FA 1UPQA 2YF0A 2LYDA 2AEHA 3A98B 2COFA 3PVWA 1LB1A 1X05A 2ZPYA 4GMVA 1MKEA 1U2BA 4ZRIA 2GJYA 4HB4B 2YS1A 4YONA 2ADZA 5GOWB 2H7EA 3DXCA 2J0JA 5J3QA 5KQ4A 4KHBB 4GMXB 1FGYA 2MWNB 3G9WA 3NSUA 2V76A 4B6HA 1U5FA 4HAWB 3CXBB 4A6KA 2RNRB 3QIJA 1FAOA 1ZSQA 1KZ7A 2QKLA 2DHJA 1OMWA 2Z0QA 2YS3A 2DX5A 1Y19B 4H8SA 1ZVRA 1UNPA 3FM8C 1Q67A 1RJ2A 1FOEA 4HB3B 2D9ZA 1J0WA 5FI1A 4A5KA 5DI9B 4EJNA 1TXDA 3ZDTA 1U5DA 1Z87A 4GOUA 5JP4A 2NZ8B 2DYNA 3VOQA 2CY4A 1W1HA 3HW2B 4F7GA 2RUKB 2RGNB 3ODWA 3KSYA 2P0HA 2DTCA 4CHJA 2KCJA 2LULA 3PVLA 1P3RA 2LG1A 2CODA 1W1GA 3DXDA 2VKIA 3ULCA 1P6SA 1OQNA 2Z0OA 1NTVA 2H7DA 5HE1A 3P6AA 1DROA 3X23A 5JLJB 3IVFA 4BBKA 1FHXA 5HE2A 2RLOA 2YSZA 1X11A 3PEGA 2D10A 3U7DA 2DKPA 2Q13A 1I7AA 1MIXA 3PP2A 3GF9A 1U5EA 2UVMA 2UZRA 3VIAA 4ZRKA 2K2JA 1BTNA 3U8ZA 1EAZA 2IFSA 2ROVA 4HAVB 1FB8A 5DH9B 1TJ6A 1FHOA 4P7IA 1SGHA 5FI0A 2K2UA 2W2XD 1WJ1A 3A8QA 5JHHA 1OY2A 1MPHA 2RVBB 1V5MA 2N23A 4HDQA 5J3TA 3WYFB 1QQGA 2M38A 2ELAA 2VSZA 4KAXB 2QKMA 5C6RA 2D9WA 3ODXA 2LOZA 2Y8GA 5D3YA 3D8EA 4MY6A 1XX0A 1XD4A 5JHGA 1Y5OA 2W2WA 1P5TA 2P0DA 4HAUB 5HE0A 2D9VA 1B55A 1H10A 1AWEA 5CLLB 4K2OA 1M7RA 1QC6A 3DXEA 4IOYX 3TO1A 1RRPB 1ZC3B 4CHMA 1NTYA 1BY1A 3HK0A 3SO6A 2RSGA 2DFKA 1WGUA 4HDOA 2D4QA 3M1IB 5EFXA 4A6FA 1V88A 2OTXA 4TYZA 1SHCA 1TQZA 5KQ1A 3PSCA 1XODA 2VRWB 4D0OA 4L6EA 4A6HA 2DX1A 1V5PA 5LOPB 2N0YA 1WJMA 3A8PA 4PNKA 4WJ7A 2EMTA 2YT1A 3T06A 5DIFB 2MFQA 2OQBA 2ROZB 4HB0B 2GS0A 2DHIA 3LJUX 1GC7A 5C5BB 1KI1B 2D9XA 2X18A 1PLSA 1XCGA 2UZSA 3SNHA 3FSSA 1X1GA 5HE3A 3SV1A 2CRFA 2E2XA 5CLQB 3ULBA 1XKEA 2EMSA 5L81A 4KHOA 3GYPA 3KRWA 3OANA 2LOXA 2D11A 2DLWA 3AU4A 1UEFA 1V89A 4PQ0A 2I5CA 1DDWA 3ZVRA 2D2QA 2R0DA 4HAYB 3FEHA 2MKRA 4GXBA 2I1KA 4C0AA 2DYQA 1X86A 3ODOA 1DDVA 1M7EA 1UNRA 2L1CA 1F5XA 1PFJA 4CYEA 1WGQA 5D3WA 2P0FA 1DBHA
chains in the Genus database with same CATH superfamily
3CIKA 3PVUA 2KUPA 1MK7B 1FGZA 2YT0A 3TFMA 1AQCA 4GZUA 3WA0A 1EVHA 1WVHA 4WSFA 3TCAA 2R09A 1H4RA 1KZGA 2PZ1A 1GC6A 2KUQA 2LKOA 2YRYA 3D8DA 2XQNM 4DX8A 1NI2A 3JV3A 4QJ5B 3TVVA 2P8VA 4GPTB 1J19A 3UZTA 4K2PA 2GCLA 3PG7A 4D0NB 2IYBA 4GN1A 5D27A 3P7ZA 2KR9A 1ZC4B 2CAYA 2DA0A 1X1FA 2I5FA 5LONB 3KZ1A 1BAKA 2CY5A 3PZDA 4MK0A 1K5DB 2DHKA 4L1RA 2AL6A 4EKUA 2YS5A 4K81A 2EC1A 1EF1A 3SUZA 1WI1A 3V5WA 4WVFB 1FHWA 2M14A 2J0KA 3NW8A 2BCJA 1MAIA 3AU5A 3SYXA 1NU2A 4K17A 1UPRA 4KVGB 2EJ8A 1DYNA 1LW3A 4HAZB 1IRSA 2J0MA 1MIZB 4ZRJA 2D9YA 4DBBA 2FJLA 1U5GA 2NMBA 3NWAA 4NSWA 4GYVA 4HB2B 3BJIA 3N7CA 4Z2MB 2L2IA 5J3YA 3KY9A 5D3VA 5DHFB 1U29A 3F5RA 3HIEA 1MK9B 3HSAA 1K5GB 2I1JA 2MDXA 5C5BA 2G35A 2DN6A 3ML4A 4HATB 4Z2NA 3F0WA 4HAXB 2NBVA 5D3XA 1N3HA 4MT7A 3NWFA 5C16A 3D8FA 1W1DA 3MPXA 1UNQA 5KCVA 1BTKA 1ISNA 4NY0A 3EO2A 5C79A 1DDMA 1GG3A 5DHAB 4IAPA 3TW1A 2HTHB 4F7UP 1EGXA 3QWMA 4XWXA 4A6FB 3O96A 4EMOA 3RCPA 2W2XC 1BWNA 2HE7A 3MDBC 3KRXA 4OSNA 2KGXB 3AJ4A 4HHVA 2JP2A 1I2HA 4TKNA 1ZM0A 2KR0A 1XR0B 1PMSA 4YL8A 3HQCA 4KHAA 4DX90 2J59M 2K00A 1V61A 4DXAB 1U27A 4Y94A 2ELBA 2DKQA 1WG7A 2GUMA 2COCA 2Z0PA 4IFSA 1E5WA 2COAA 2GCJA 1V5UA 3QBVB 2YVCA 2K8EA 3BINA 3GYOA 3NWDA 2Y7BA 4F7HA 2Y8FA 1UPQA 2YF0A 2LYDA 2AEHA 2FJUB 3A98B 1ZYIA 2COFA 3PVWA 1LB1A 1X05A 2ZPYA 4GMVA 1MKEA 1U2BA 4ZRIA 2GJYA 4HB4B 2YS1A 4YONA 2ADZA 5GOWB 2RRFA 2H7EA 3DXCA 2J0JA 5J3QA 5KQ4A 4KHBB 4GMXB 1FGYA 2MWNB 3G9WA 3NSUA 2V76A 4B6HA 1U5FA 4HAWB 3CXBB 5I2SA 4A6KA 2KIEA 2RNRB 3QIJA 1FAOA 1ZSQA 1KZ7A 2QKLA 2DHJA 1OMWA 2Z0QA 2YS3A 2DX5A 1Y19B 4H8SA 1ZVRA 1UNPA 3FM8C 1Q67A 1RJ2A 1FOEA 1MI1A 4HB3B 2D9ZA 1J0WA 5FI1A 4A5KA 2K49A 5DI9B 5IRSA 4EJNA 5M4YB 1TXDA 3ZDTA 1U5DA 1Z87A 4GOUA 2Z13A 5JP4A 2NZ8B 2DYNA 4GNKB 3VOQA 2CY4A 1W1HA 3HW2B 4F7GA 4HSIA 2RUKB 2RGNB 3ODWA 3KSYA 2P0HA 2DTCA 4CHJA 2KCJA 2LULA 3PVLA 1P3RA 2LG1A 2CODA 1W1GA 3DXDA 2VKIA 3ULCA 1P6SA 1OQNA 2Z0OA 1NTVA 2H7DA 4QJ4B 5HE1A 3P6AA 1DROA 3X23A 5JLJB 3IVFA 4BBKA 1FHXA 5HE2A 2RLOA 2YSZA 3DCXA 1X11A 3PEGA 2D10A 3U7DA 2DKPA 2Q13A 1I7AA 1MIXA 3PP2A 3GF9A 1U5EA 2R2YA 2UVMA 2UZRA 3VIAA 4ZRKA 2K2JA 1BTNA 3U8ZA 1EAZA 2IFSA 2YT2A 3B77A 2ROVA 4HAVB 1FB8A 3OHMB 5DH9B 1TJ6A 1FHOA 4P7IA 1SGHA 5FI0A 4QXAB 2K2UA 2W2XD 1WJ1A 3A8QA 5JHHA 1OY2A 3FVCA 1MPHA 2RVBB 1V5MA 2N23A 4HDQA 5J3TA 3WYFB 1QQGA 2M38A 2ELAA 2VSZA 4KAXB 2QKMA 5C6RA 2D9WA 2KIGA 3ODXA 2LOZA 2Y8GA 5D3YA 1T77A 3D8EA 4MY6A 1XX0A 1XD4A 5JHGA 2Z14A 1Y5OA 2W2WA 1P5TA 2P0DA 4HAUB 5HE0A 2D9VA 1B55A 1H10A 3A58A 4OT1A 1AWEA 5CLLB 4K2OA 1M7RA 1QC6A 3DXEA 4IOYX 3TO1A 1RRPB 1ZC3B 4CHMA 1NTYA 1BY1A 2Z59A 3HK0A 5LG4B 3SO6A 2RSGA 2DFKA 1WGUA 4HDOA 2D4QA 3M1IB 5EFXA 4A6FA 1V88A 2OTXA 4TYZA 1SHCA 1TQZA 5KQ1A 3PSCA 1XODA 2VRWB 4D0OA 4L6EA 4DIXA 4A6HA 2DX1A 3U12A 1V5PA 5LOPB 2N0YA 2Z4DA 1WJMA 3A8PA 4KHBA 4PNKA 4WJ7A 2EMTA 2YT1A 3T06A 5DIFB 2MFQA 2OQBA 2ROZB 4CSQA 4HB0B 2GS0A 2DHIA 3LJUX 1GC7A 5C5BB 1KI1B 4QJ3B 2D9XA 2X18A 1PLSA 1XCGA 2UZSA 3SNHA 3FSSA 1X1GA 5HE3A 3SV1A 2CRFA 2E2XA 5CLQB 3ULBA 1XKEA 2EMSA 5L81A 4KHOA 3GYPA 3KRWA 3OANA 2LOXA 2D11A 2DLWA 3AU4A 5I2MA 1UEFA 1V89A 4D6WA 4PQ0A 2I5CA 1DDWA 3ZVRA 2D2QA 2R0DA 4HAYB 3FEHA 2MKRA 4GXBA 2I1KA 4C0AA 2DYQA 1X86A 3ODOA 1DDVA 1M7EA 1UNRA 2L1CA 1F5XA 1PFJA 4CYEA 1WGQA 2ZKMX 5D3WA 2P0FA 1DBHA
chains in the Genus database with same CATH topology
3CIKA 3PVUA 2KUPA 1MK7B 1FGZA 2YT0A 3TFMA 1AQCA 4GZUA 3WA0A 1EVHA 1WVHA 4WSFA 3TCAA 2R09A 1H4RA 1KZGA 2PZ1A 1GC6A 2LKOA 2YRYA 3D8DA 2XQNM 4DX8A 1NI2A 3JV3A 3TVVA 2P8VA 4GPTB 1J19A 3UZTA 4K2PA 2GCLA 3PG7A 4D0NB 2IYBA 4GN1A 5D27A 3P7ZA 2KR9A 1ZC4B 2CAYA 2DA0A 1X1FA 2I5FA 5LONB 3KZ1A 1BAKA 2CY5A 3PZDA 4MK0A 1K5DB 2DHKA 2AL6A 4EKUA 2YS5A 4K81A 2EC1A 1EF1A 3SUZA 1WI1A 3V5WA 4WVFB 1FHWA 2M14A 2J0KA 2BCJA 1MAIA 3AU5A 3SYXA 1NU2A 4K17A 1UPRA 4KVGB 2EJ8A 1DYNA 1LW3A 4HAZB 1IRSA 2J0MA 1MIZB 4ZRJA 2D9YA 4DBBA 2FJLA 1U5GA 2NMBA 4NSWA 4GYVA 4HB2B 3BJIA 3N7CA 4Z2MB 2L2IA 5J3YA 3KY9A 5D3VA 5DHFB 1U29A 3F5RA 1MK9B 1K5GB 2I1JA 2MDXA 5C5BA 2G35A 2DN6A 3ML4A 4HATB 4Z2NA 3F0WA 4HAXB 5D3XA 1N3HA 4MT7A 5C16A 3D8FA 1W1DA 3MPXA 1UNQA 5KCVA 1BTKA 1ISNA 4NY0A 3EO2A 5C79A 1DDMA 1GG3A 5DHAB 4IAPA 3TW1A 2HTHB 4F7UP 1EGXA 3QWMA 4XWXA 4A6FB 3O96A 4EMOA 3RCPA 2W2XC 1BWNA 2HE7A 3MDBC 3KRXA 2KGXB 3AJ4A 4HHVA 2JP2A 1I2HA 4TKNA 1ZM0A 1XR0B 1PMSA 4YL8A 3HQCA 4KHAA 4DX90 2J59M 2K00A 1V61A 4DXAB 1U27A 4Y94A 2ELBA 2DKQA 1WG7A 2Z0PA 2COCA 4IFSA 1E5WA 2COAA 2GCJA 1V5UA 3QBVB 2YVCA 3BINA 3GYOA 2Y7BA 4F7HA 2Y8FA 1UPQA 2YF0A 2LYDA 2AEHA 3A98B 2COFA 3PVWA 1LB1A 1X05A 2ZPYA 4GMVA 1MKEA 1U2BA 4ZRIA 2GJYA 4HB4B 2YS1A 4YONA 2ADZA 5GOWB 2H7EA 3DXCA 2J0JA 5J3QA 5KQ4A 4KHBB 4GMXB 1FGYA 2MWNB 3G9WA 3NSUA 2V76A 4B6HA 1U5FA 4HAWB 3CXBB 4A6KA 2RNRB 3QIJA 1FAOA 1ZSQA 1KZ7A 2QKLA 2DHJA 1OMWA 2Z0QA 2YS3A 2DX5A 1Y19B 4H8SA 1ZVRA 1UNPA 3FM8C 1Q67A 1RJ2A 1FOEA 4HB3B 2D9ZA 1J0WA 5FI1A 4A5KA 5DI9B 4EJNA 1TXDA 3ZDTA 1U5DA 1Z87A 4GOUA 5JP4A 2NZ8B 2DYNA 3VOQA 2CY4A 1W1HA 3HW2B 4F7GA 2RUKB 2RGNB 3ODWA 3KSYA 2P0HA 2DTCA 4CHJA 2KCJA 2LULA 3PVLA 1P3RA 2LG1A 2CODA 1W1GA 3DXDA 2VKIA 3ULCA 1P6SA 1OQNA 2Z0OA 1NTVA 2H7DA 5HE1A 3P6AA 1DROA 3X23A 5JLJB 3IVFA 4BBKA 1FHXA 5HE2A 2RLOA 2YSZA 1X11A 3PEGA 2D10A 3U7DA 2DKPA 2Q13A 1I7AA 1MIXA 3PP2A 3GF9A 1U5EA 2UVMA 2UZRA 3VIAA 4ZRKA 2K2JA 1BTNA 3U8ZA 1EAZA 2IFSA 2ROVA 4HAVB 1FB8A 5DH9B 1TJ6A 1FHOA 4P7IA 1SGHA 5FI0A 2K2UA 2W2XD 1WJ1A 3A8QA 5JHHA 1OY2A 1MPHA 2RVBB 1V5MA 2N23A 4HDQA 5J3TA 3WYFB 1QQGA 2M38A 2ELAA 2VSZA 4KAXB 2QKMA 5C6RA 2D9WA 3ODXA 2LOZA 2Y8GA 5D3YA 3D8EA 4MY6A 1XX0A 1XD4A 5JHGA 1Y5OA 2W2WA 1P5TA 2P0DA 4HAUB 5HE0A 2D9VA 1B55A 1H10A 1AWEA 5CLLB 4K2OA 1M7RA 1QC6A 3DXEA 4IOYX 3TO1A 1RRPB 1ZC3B 4CHMA 1NTYA 1BY1A 3HK0A 3SO6A 2RSGA 2DFKA 1WGUA 4HDOA 2D4QA 3M1IB 5EFXA 4A6FA 1V88A 2OTXA 4TYZA 1SHCA 1TQZA 5KQ1A 3PSCA 1XODA 2VRWB 4D0OA 4L6EA 4A6HA 2DX1A 1V5PA 5LOPB 2N0YA 1WJMA 3A8PA 4PNKA 4WJ7A 2EMTA 2YT1A 3T06A 5DIFB 2MFQA 2OQBA 2ROZB 4HB0B 2GS0A 2DHIA 3LJUX 1GC7A 5C5BB 1KI1B 2D9XA 2X18A 1PLSA 1XCGA 2UZSA 3SNHA 3FSSA 1X1GA 5HE3A 3SV1A 2CRFA 2E2XA 5CLQB 3ULBA 1XKEA 2EMSA 5L81A 4KHOA 3GYPA 3KRWA 3OANA 2LOXA 2D11A 2DLWA 3AU4A 1UEFA 1V89A 4PQ0A 2I5CA 1DDWA 3ZVRA 2D2QA 2R0DA 4HAYB 3FEHA 2MKRA 4GXBA 2I1KA 4C0AA 2DYQA 1X86A 3ODOA 1DDVA 1M7EA 1UNRA 2L1CA 1F5XA 1PFJA 4CYEA 1WGQA 5D3WA 2P0FA 1DBHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CIK A;  3PVU A;  2KUP A;  1MK7 B;  1FGZ A;  2YT0 A;  3TFM A;  1AQC A;  4GZU A;  3WA0 A;  1EVH A;  1WVH A;  4WSF A;  3TCA A;  2R09 A;  1H4R A;  1KZG A;  2PZ1 A;  1GC6 A;  2LKO A;  2YRY A;  3D8D A;  2XQN M;  4DX8 A;  1NI2 A;  3JV3 A;  3TVV A;  2P8V A;  4GPT B;  1J19 A;  3UZT A;  4K2P A;  2GCL A;  3PG7 A;  4D0N B;  2IYB A;  4GN1 A;  5D27 A;  3P7Z A;  2KR9 A;  1ZC4 B;  2CAY A;  2DA0 A;  1X1F A;  2I5F A;  5LON B;  3KZ1 A;  1BAK A;  2CY5 A;  3PZD A;  4MK0 A;  1K5D B;  2DHK A;  2AL6 A;  4EKU A;  2YS5 A;  4K81 A;  2EC1 A;  1EF1 A;  3SUZ A;  1WI1 A;  3V5W A;  4WVF B;  1FHW A;  2M14 A;  2J0K A;  2BCJ A;  1MAI A;  3AU5 A;  3SYX A;  1NU2 A;  4K17 A;  1UPR A;  4KVG B;  2EJ8 A;  1DYN A;  1LW3 A;  4HAZ B;  1IRS A;  2J0M A;  1MIZ B;  4ZRJ A;  2D9Y A;  4DBB A;  2FJL A;  1U5G A;  2NMB A;  4NSW A;  4GYV A;  4HB2 B;  3BJI A;  3N7C A;  4Z2M B;  2L2I A;  5J3Y A;  3KY9 A;  5D3V A;  5DHF B;  1U29 A;  3F5R A;  1MK9 B;  1K5G B;  2I1J A;  2MDX A;  5C5B A;  2G35 A;  2DN6 A;  3ML4 A;  4HAT B;  4Z2N A;  3F0W A;  4HAX B;  5D3X A;  1N3H A;  4MT7 A;  5C16 A;  3D8F A;  1W1D A;  3MPX A;  1UNQ A;  5KCV A;  1BTK A;  1ISN A;  4NY0 A;  3EO2 A;  5C79 A;  1DDM A;  1GG3 A;  5DHA B;  4IAP A;  3TW1 A;  2HTH B;  4F7U P;  1EGX A;  3QWM A;  4XWX A;  4A6F B;  3O96 A;  4EMO A;  3RCP A;  2W2X C;  1BWN A;  2HE7 A;  3MDB C;  3KRX A;  2KGX B;  3AJ4 A;  4HHV A;  2JP2 A;  1I2H A;  4TKN A;  1ZM0 A;  1XR0 B;  1PMS A;  4YL8 A;  3HQC A;  4KHA A;  4DX9 0;  2J59 M;  2K00 A;  1V61 A;  4DXA B;  1U27 A;  4Y94 A;  2ELB A;  2DKQ A;  1WG7 A;  2Z0P A;  2COC A;  4IFS A;  1E5W A;  2COA A;  2GCJ A;  1V5U A;  3QBV B;  2YVC A;  3BIN A;  3GYO A;  2Y7B A;  4F7H A;  2Y8F A;  1UPQ A;  2YF0 A;  2LYD A;  2AEH A;  3A98 B;  2COF A;  3PVW A;  1LB1 A;  1X05 A;  2ZPY A;  4GMV A;  1MKE A;  1U2B A;  4ZRI A;  2GJY A;  4HB4 B;  2YS1 A;  4YON A;  2ADZ A;  5GOW B;  2H7E A;  3DXC A;  2J0J A;  5J3Q A;  5KQ4 A;  4KHB B;  4GMX B;  1FGY A;  2MWN B;  3G9W A;  3NSU A;  2V76 A;  4B6H A;  1U5F A;  4HAW B;  3CXB B;  4A6K A;  2RNR B;  3QIJ A;  1FAO A;  1ZSQ A;  1KZ7 A;  2QKL A;  2DHJ A;  1OMW A;  2Z0Q A;  2YS3 A;  2DX5 A;  1Y19 B;  4H8S A;  1ZVR A;  1UNP A;  3FM8 C;  1Q67 A;  1RJ2 A;  1FOE A;  4HB3 B;  2D9Z A;  1J0W A;  5FI1 A;  4A5K A;  5DI9 B;  4EJN A;  1TXD A;  3ZDT A;  1U5D A;  1Z87 A;  4GOU A;  5JP4 A;  2NZ8 B;  2DYN A;  3VOQ A;  2CY4 A;  1W1H A;  3HW2 B;  4F7G A;  2RUK B;  2RGN B;  3ODW A;  3KSY A;  2P0H A;  2DTC A;  4CHJ A;  2KCJ A;  2LUL A;  3PVL A;  1P3R A;  2LG1 A;  2COD A;  1W1G A;  3DXD A;  2VKI A;  3ULC A;  1P6S A;  1OQN A;  2Z0O A;  1NTV A;  2H7D A;  5HE1 A;  3P6A A;  1DRO A;  3X23 A;  5JLJ B;  3IVF A;  4BBK A;  1FHX A;  5HE2 A;  2RLO A;  2YSZ A;  1X11 A;  3PEG A;  2D10 A;  3U7D A;  2DKP A;  2Q13 A;  1I7A A;  1MIX A;  3PP2 A;  3GF9 A;  1U5E A;  2UVM A;  2UZR A;  3VIA A;  4ZRK A;  2K2J A;  1BTN A;  3U8Z A;  1EAZ A;  2IFS A;  2ROV A;  4HAV B;  1FB8 A;  5DH9 B;  1TJ6 A;  1FHO A;  4P7I A;  1SGH A;  5FI0 A;  2K2U A;  2W2X D;  1WJ1 A;  3A8Q A;  5JHH A;  1OY2 A;  1MPH A;  2RVB B;  1V5M A;  2N23 A;  4HDQ A;  5J3T A;  3WYF B;  1QQG A;  2M38 A;  2ELA A;  2VSZ A;  4KAX B;  2QKM A;  5C6R A;  2D9W A;  3ODX A;  2LOZ A;  2Y8G A;  5D3Y A;  3D8E A;  4MY6 A;  1XX0 A;  1XD4 A;  5JHG A;  1Y5O A;  2W2W A;  1P5T A;  2P0D A;  4HAU B;  5HE0 A;  2D9V A;  1B55 A;  1H10 A;  1AWE A;  5CLL B;  4K2O A;  1M7R A;  1QC6 A;  3DXE A;  4IOY X;  3TO1 A;  1RRP B;  1ZC3 B;  4CHM A;  1NTY A;  1BY1 A;  3HK0 A;  3SO6 A;  2RSG A;  2DFK A;  1WGU A;  4HDO A;  2D4Q A;  3M1I B;  5EFX A;  4A6F A;  1V88 A;  2OTX A;  4TYZ A;  1SHC A;  1TQZ A;  5KQ1 A;  3PSC A;  1XOD A;  2VRW B;  4D0O A;  4L6E A;  4A6H A;  2DX1 A;  1V5P A;  5LOP B;  2N0Y A;  1WJM A;  3A8P A;  4PNK A;  4WJ7 A;  2EMT A;  2YT1 A;  3T06 A;  5DIF B;  2MFQ A;  2OQB A;  2ROZ B;  4HB0 B;  2GS0 A;  2DHI A;  3LJU X;  1GC7 A;  5C5B B;  1KI1 B;  2D9X A;  2X18 A;  1PLS A;  1XCG A;  2UZS A;  3SNH A;  3FSS A;  1X1G A;  5HE3 A;  3SV1 A;  2CRF A;  2E2X A;  5CLQ B;  3ULB A;  1XKE A;  2EMS A;  5L81 A;  4KHO A;  3GYP A;  3KRW A;  3OAN A;  2LOX A;  2D11 A;  2DLW A;  3AU4 A;  1UEF A;  1V89 A;  4PQ0 A;  2I5C A;  1DDW A;  3ZVR A;  2D2Q A;  2R0D A;  4HAY B;  3FEH A;  2MKR A;  4GXB A;  2I1K A;  4C0A A;  2DYQ A;  1X86 A;  3ODO A;  1DDV A;  1M7E A;  1UNR A;  2L1C A;  1F5X A;  1PFJ A;  4CYE A;  1WGQ A;  5D3W A;  2P0F A;  1DBH A; 
#chains in the Genus database with same CATH topology
 3CIK A;  3PVU A;  2KUP A;  1MK7 B;  1FGZ A;  2YT0 A;  3TFM A;  1AQC A;  4GZU A;  3WA0 A;  1EVH A;  1WVH A;  4WSF A;  3TCA A;  2R09 A;  1H4R A;  1KZG A;  2PZ1 A;  1GC6 A;  2KUQ A;  2LKO A;  2YRY A;  3D8D A;  2XQN M;  4DX8 A;  1NI2 A;  3JV3 A;  4QJ5 B;  3TVV A;  2P8V A;  4GPT B;  1J19 A;  3UZT A;  4K2P A;  2GCL A;  3PG7 A;  4D0N B;  2IYB A;  4GN1 A;  5D27 A;  3P7Z A;  2KR9 A;  1ZC4 B;  2CAY A;  2DA0 A;  1X1F A;  2I5F A;  5LON B;  3KZ1 A;  1BAK A;  2CY5 A;  3PZD A;  4MK0 A;  1K5D B;  2DHK A;  4L1R A;  2AL6 A;  4EKU A;  2YS5 A;  4K81 A;  2EC1 A;  1EF1 A;  3SUZ A;  1WI1 A;  3V5W A;  4WVF B;  1FHW A;  2M14 A;  2J0K A;  3NW8 A;  2BCJ A;  1MAI A;  3AU5 A;  3SYX A;  1NU2 A;  4K17 A;  1UPR A;  4KVG B;  2EJ8 A;  1DYN A;  1LW3 A;  4HAZ B;  1IRS A;  2J0M A;  1MIZ B;  4ZRJ A;  2D9Y A;  4DBB A;  2FJL A;  1U5G A;  2NMB A;  3NWA A;  4NSW A;  4GYV A;  4HB2 B;  3BJI A;  3N7C A;  4Z2M B;  2L2I A;  5J3Y A;  3KY9 A;  5D3V A;  5DHF B;  1U29 A;  3F5R A;  3HIE A;  1MK9 B;  3HSA A;  1K5G B;  2I1J A;  2MDX A;  5C5B A;  2G35 A;  2DN6 A;  3ML4 A;  4HAT B;  4Z2N A;  3F0W A;  4HAX B;  2NBV A;  5D3X A;  1N3H A;  4MT7 A;  3NWF A;  5C16 A;  3D8F A;  1W1D A;  3MPX A;  1UNQ A;  5KCV A;  1BTK A;  1ISN A;  4NY0 A;  3EO2 A;  5C79 A;  1DDM A;  1GG3 A;  5DHA B;  4IAP A;  3TW1 A;  2HTH B;  4F7U P;  1EGX A;  3QWM A;  4XWX A;  4A6F B;  3O96 A;  4EMO A;  3RCP A;  2W2X C;  1BWN A;  2HE7 A;  3MDB C;  3KRX A;  4OSN A;  2KGX B;  3AJ4 A;  4HHV A;  2JP2 A;  1I2H A;  4TKN A;  1ZM0 A;  2KR0 A;  1XR0 B;  1PMS A;  4YL8 A;  3HQC A;  4KHA A;  4DX9 0;  2J59 M;  2K00 A;  1V61 A;  4DXA B;  1U27 A;  4Y94 A;  2ELB A;  2DKQ A;  1WG7 A;  2GUM A;  2COC A;  2Z0P A;  4IFS A;  1E5W A;  2COA A;  2GCJ A;  1V5U A;  3QBV B;  2YVC A;  2K8E A;  3BIN A;  3GYO A;  3NWD A;  2Y7B A;  4F7H A;  2Y8F A;  1UPQ A;  2YF0 A;  2LYD A;  2AEH A;  2FJU B;  3A98 B;  1ZYI A;  2COF A;  3PVW A;  1LB1 A;  1X05 A;  2ZPY A;  4GMV A;  1MKE A;  1U2B A;  4ZRI A;  2GJY A;  4HB4 B;  2YS1 A;  4YON A;  2ADZ A;  5GOW B;  2RRF A;  2H7E A;  3DXC A;  2J0J A;  5J3Q A;  5KQ4 A;  4KHB B;  4GMX B;  1FGY A;  2MWN B;  3G9W A;  3NSU A;  2V76 A;  4B6H A;  1U5F A;  4HAW B;  3CXB B;  5I2S A;  4A6K A;  2KIE A;  2RNR B;  3QIJ A;  1FAO A;  1ZSQ A;  1KZ7 A;  2QKL A;  2DHJ A;  1OMW A;  2Z0Q A;  2YS3 A;  2DX5 A;  1Y19 B;  4H8S A;  1ZVR A;  1UNP A;  3FM8 C;  1Q67 A;  1RJ2 A;  1FOE A;  1MI1 A;  4HB3 B;  2D9Z A;  1J0W A;  5FI1 A;  4A5K A;  2K49 A;  5DI9 B;  5IRS A;  4EJN A;  5M4Y B;  1TXD A;  3ZDT A;  1U5D A;  1Z87 A;  4GOU A;  2Z13 A;  5JP4 A;  2NZ8 B;  2DYN A;  4GNK B;  3VOQ A;  2CY4 A;  1W1H A;  3HW2 B;  4F7G A;  4HSI A;  2RUK B;  2RGN B;  3ODW A;  3KSY A;  2P0H A;  2DTC A;  4CHJ A;  2KCJ A;  2LUL A;  3PVL A;  1P3R A;  2LG1 A;  2COD A;  1W1G A;  3DXD A;  2VKI A;  3ULC A;  1P6S A;  1OQN A;  2Z0O A;  1NTV A;  2H7D A;  4QJ4 B;  5HE1 A;  3P6A A;  1DRO A;  3X23 A;  5JLJ B;  3IVF A;  4BBK A;  1FHX A;  5HE2 A;  2RLO A;  2YSZ A;  3DCX A;  1X11 A;  3PEG A;  2D10 A;  3U7D A;  2DKP A;  2Q13 A;  1I7A A;  1MIX A;  3PP2 A;  3GF9 A;  1U5E A;  2R2Y A;  2UVM A;  2UZR A;  3VIA A;  4ZRK A;  2K2J A;  1BTN A;  3U8Z A;  1EAZ A;  2IFS A;  2YT2 A;  3B77 A;  2ROV A;  4HAV B;  1FB8 A;  3OHM B;  5DH9 B;  1TJ6 A;  1FHO A;  4P7I A;  1SGH A;  5FI0 A;  4QXA B;  2K2U A;  2W2X D;  1WJ1 A;  3A8Q A;  5JHH A;  1OY2 A;  3FVC A;  1MPH A;  2RVB B;  1V5M A;  2N23 A;  4HDQ A;  5J3T A;  3WYF B;  1QQG A;  2M38 A;  2ELA A;  2VSZ A;  4KAX B;  2QKM A;  5C6R A;  2D9W A;  2KIG A;  3ODX A;  2LOZ A;  2Y8G A;  5D3Y A;  1T77 A;  3D8E A;  4MY6 A;  1XX0 A;  1XD4 A;  5JHG A;  2Z14 A;  1Y5O A;  2W2W A;  1P5T A;  2P0D A;  4HAU B;  5HE0 A;  2D9V A;  1B55 A;  1H10 A;  3A58 A;  4OT1 A;  1AWE A;  5CLL B;  4K2O A;  1M7R A;  1QC6 A;  3DXE A;  4IOY X;  3TO1 A;  1RRP B;  1ZC3 B;  4CHM A;  1NTY A;  1BY1 A;  2Z59 A;  3HK0 A;  5LG4 B;  3SO6 A;  2RSG A;  2DFK A;  1WGU A;  4HDO A;  2D4Q A;  3M1I B;  5EFX A;  4A6F A;  1V88 A;  2OTX A;  4TYZ A;  1SHC A;  1TQZ A;  5KQ1 A;  3PSC A;  1XOD A;  2VRW B;  4D0O A;  4L6E A;  4DIX A;  4A6H A;  2DX1 A;  3U12 A;  1V5P A;  5LOP B;  2N0Y A;  2Z4D A;  1WJM A;  3A8P A;  4KHB A;  4PNK A;  4WJ7 A;  2EMT A;  2YT1 A;  3T06 A;  5DIF B;  2MFQ A;  2OQB A;  2ROZ B;  4CSQ A;  4HB0 B;  2GS0 A;  2DHI A;  3LJU X;  1GC7 A;  5C5B B;  1KI1 B;  4QJ3 B;  2D9X A;  2X18 A;  1PLS A;  1XCG A;  2UZS A;  3SNH A;  3FSS A;  1X1G A;  5HE3 A;  3SV1 A;  2CRF A;  2E2X A;  5CLQ B;  3ULB A;  1XKE A;  2EMS A;  5L81 A;  4KHO A;  3GYP A;  3KRW A;  3OAN A;  2LOX A;  2D11 A;  2DLW A;  3AU4 A;  5I2M A;  1UEF A;  1V89 A;  4D6W A;  4PQ0 A;  2I5C A;  1DDW A;  3ZVR A;  2D2Q A;  2R0D A;  4HAY B;  3FEH A;  2MKR A;  4GXB A;  2I1K A;  4C0A A;  2DYQ A;  1X86 A;  3ODO A;  1DDV A;  1M7E A;  1UNR A;  2L1C A;  1F5X A;  1PFJ A;  4CYE A;  1WGQ A;  2ZKM X;  5D3W A;  2P0F A;  1DBH A; 
#chains in the Genus database with same CATH homology
 3CIK A;  3PVU A;  2KUP A;  1MK7 B;  1FGZ A;  2YT0 A;  3TFM A;  1AQC A;  4GZU A;  3WA0 A;  1EVH A;  1WVH A;  4WSF A;  3TCA A;  2R09 A;  1H4R A;  1KZG A;  2PZ1 A;  1GC6 A;  2LKO A;  2YRY A;  3D8D A;  2XQN M;  4DX8 A;  1NI2 A;  3JV3 A;  3TVV A;  2P8V A;  4GPT B;  1J19 A;  3UZT A;  4K2P A;  2GCL A;  3PG7 A;  4D0N B;  2IYB A;  4GN1 A;  5D27 A;  3P7Z A;  2KR9 A;  1ZC4 B;  2CAY A;  2DA0 A;  1X1F A;  2I5F A;  5LON B;  3KZ1 A;  1BAK A;  2CY5 A;  3PZD A;  4MK0 A;  1K5D B;  2DHK A;  2AL6 A;  4EKU A;  2YS5 A;  4K81 A;  2EC1 A;  1EF1 A;  3SUZ A;  1WI1 A;  3V5W A;  4WVF B;  1FHW A;  2M14 A;  2J0K A;  2BCJ A;  1MAI A;  3AU5 A;  3SYX A;  1NU2 A;  4K17 A;  1UPR A;  4KVG B;  2EJ8 A;  1DYN A;  1LW3 A;  4HAZ B;  1IRS A;  2J0M A;  1MIZ B;  4ZRJ A;  2D9Y A;  4DBB A;  2FJL A;  1U5G A;  2NMB A;  4NSW A;  4GYV A;  4HB2 B;  3BJI A;  3N7C A;  4Z2M B;  2L2I A;  5J3Y A;  3KY9 A;  5D3V A;  5DHF B;  1U29 A;  3F5R A;  1MK9 B;  1K5G B;  2I1J A;  2MDX A;  5C5B A;  2G35 A;  2DN6 A;  3ML4 A;  4HAT B;  4Z2N A;  3F0W A;  4HAX B;  5D3X A;  1N3H A;  4MT7 A;  5C16 A;  3D8F A;  1W1D A;  3MPX A;  1UNQ A;  5KCV A;  1BTK A;  1ISN A;  4NY0 A;  3EO2 A;  5C79 A;  1DDM A;  1GG3 A;  5DHA B;  4IAP A;  3TW1 A;  2HTH B;  4F7U P;  1EGX A;  3QWM A;  4XWX A;  4A6F B;  3O96 A;  4EMO A;  3RCP A;  2W2X C;  1BWN A;  2HE7 A;  3MDB C;  3KRX A;  2KGX B;  3AJ4 A;  4HHV A;  2JP2 A;  1I2H A;  4TKN A;  1ZM0 A;  1XR0 B;  1PMS A;  4YL8 A;  3HQC A;  4KHA A;  4DX9 0;  2J59 M;  2K00 A;  1V61 A;  4DXA B;  1U27 A;  4Y94 A;  2ELB A;  2DKQ A;  1WG7 A;  2Z0P A;  2COC A;  4IFS A;  1E5W A;  2COA A;  2GCJ A;  1V5U A;  3QBV B;  2YVC A;  3BIN A;  3GYO A;  2Y7B A;  4F7H A;  2Y8F A;  1UPQ A;  2YF0 A;  2LYD A;  2AEH A;  3A98 B;  2COF A;  3PVW A;  1LB1 A;  1X05 A;  2ZPY A;  4GMV A;  1MKE A;  1U2B A;  4ZRI A;  2GJY A;  4HB4 B;  2YS1 A;  4YON A;  2ADZ A;  5GOW B;  2H7E A;  3DXC A;  2J0J A;  5J3Q A;  5KQ4 A;  4KHB B;  4GMX B;  1FGY A;  2MWN B;  3G9W A;  3NSU A;  2V76 A;  4B6H A;  1U5F A;  4HAW B;  3CXB B;  4A6K A;  2RNR B;  3QIJ A;  1FAO A;  1ZSQ A;  1KZ7 A;  2QKL A;  2DHJ A;  1OMW A;  2Z0Q A;  2YS3 A;  2DX5 A;  1Y19 B;  4H8S A;  1ZVR A;  1UNP A;  3FM8 C;  1Q67 A;  1RJ2 A;  1FOE A;  4HB3 B;  2D9Z A;  1J0W A;  5FI1 A;  4A5K A;  5DI9 B;  4EJN A;  1TXD A;  3ZDT A;  1U5D A;  1Z87 A;  4GOU A;  5JP4 A;  2NZ8 B;  2DYN A;  3VOQ A;  2CY4 A;  1W1H A;  3HW2 B;  4F7G A;  2RUK B;  2RGN B;  3ODW A;  3KSY A;  2P0H A;  2DTC A;  4CHJ A;  2KCJ A;  2LUL A;  3PVL A;  1P3R A;  2LG1 A;  2COD A;  1W1G A;  3DXD A;  2VKI A;  3ULC A;  1P6S A;  1OQN A;  2Z0O A;  1NTV A;  2H7D A;  5HE1 A;  3P6A A;  1DRO A;  3X23 A;  5JLJ B;  3IVF A;  4BBK A;  1FHX A;  5HE2 A;  2RLO A;  2YSZ A;  1X11 A;  3PEG A;  2D10 A;  3U7D A;  2DKP A;  2Q13 A;  1I7A A;  1MIX A;  3PP2 A;  3GF9 A;  1U5E A;  2UVM A;  2UZR A;  3VIA A;  4ZRK A;  2K2J A;  1BTN A;  3U8Z A;  1EAZ A;  2IFS A;  2ROV A;  4HAV B;  1FB8 A;  5DH9 B;  1TJ6 A;  1FHO A;  4P7I A;  1SGH A;  5FI0 A;  2K2U A;  2W2X D;  1WJ1 A;  3A8Q A;  5JHH A;  1OY2 A;  1MPH A;  2RVB B;  1V5M A;  2N23 A;  4HDQ A;  5J3T A;  3WYF B;  1QQG A;  2M38 A;  2ELA A;  2VSZ A;  4KAX B;  2QKM A;  5C6R A;  2D9W A;  3ODX A;  2LOZ A;  2Y8G A;  5D3Y A;  3D8E A;  4MY6 A;  1XX0 A;  1XD4 A;  5JHG A;  1Y5O A;  2W2W A;  1P5T A;  2P0D A;  4HAU B;  5HE0 A;  2D9V A;  1B55 A;  1H10 A;  1AWE A;  5CLL B;  4K2O A;  1M7R A;  1QC6 A;  3DXE A;  4IOY X;  3TO1 A;  1RRP B;  1ZC3 B;  4CHM A;  1NTY A;  1BY1 A;  3HK0 A;  3SO6 A;  2RSG A;  2DFK A;  1WGU A;  4HDO A;  2D4Q A;  3M1I B;  5EFX A;  4A6F A;  1V88 A;  2OTX A;  4TYZ A;  1SHC A;  1TQZ A;  5KQ1 A;  3PSC A;  1XOD A;  2VRW B;  4D0O A;  4L6E A;  4A6H A;  2DX1 A;  1V5P A;  5LOP B;  2N0Y A;  1WJM A;  3A8P A;  4PNK A;  4WJ7 A;  2EMT A;  2YT1 A;  3T06 A;  5DIF B;  2MFQ A;  2OQB A;  2ROZ B;  4HB0 B;  2GS0 A;  2DHI A;  3LJU X;  1GC7 A;  5C5B B;  1KI1 B;  2D9X A;  2X18 A;  1PLS A;  1XCG A;  2UZS A;  3SNH A;  3FSS A;  1X1G A;  5HE3 A;  3SV1 A;  2CRF A;  2E2X A;  5CLQ B;  3ULB A;  1XKE A;  2EMS A;  5L81 A;  4KHO A;  3GYP A;  3KRW A;  3OAN A;  2LOX A;  2D11 A;  2DLW A;  3AU4 A;  1UEF A;  1V89 A;  4PQ0 A;  2I5C A;  1DDW A;  3ZVR A;  2D2Q A;  2R0D A;  4HAY B;  3FEH A;  2MKR A;  4GXB A;  2I1K A;  4C0A A;  2DYQ A;  1X86 A;  3ODO A;  1DDV A;  1M7E A;  1UNR A;  2L1C A;  1F5X A;  1PFJ A;  4CYE A;  1WGQ A;  5D3W A;  2P0F A;  1DBH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...