5JLJB

Crystal structure of kpt8602 in complex with crm1-ran-ranbp1
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
136
structure length
126
Chain Sequence
FEPVMEEDEEVLYKVRAKLFRFDADAKEWKERGTGDCKFLKNKKTNKVRILMRRDKTLKICANHIIAPEYTLKPNVGSDRSWVYACTADIAEGEAEAFTFAIRFGSKENADKFKEEFEKAQEINKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein transport
molecule keywords GTP-binding nuclear protein Ran
publication title Next-generation XPO1 inhibitor shows improved efficacy and in vivo tolerability in hematological malignancies.
pubmed doi rcsb
source organism Homo sapiens
total genus 33
structure length 126
sequence length 136
ec nomenclature
pdb deposition date 2016-04-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00638 Ran_BP1 RanBP1 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 5jljB00
3DXEA 1GC7A 4HATB 1WGUA 3TO1A 1X86A 2GJYA 2JP2A 1BWNA 3A98B 1XCGA 2P0HA 1ZC4B 2I5CA 2H7EA 2OTXA 2D9WA 5JLJB 2V76A 2NMBA 4KVGB 2DTCA 2UZSA 4WSFA 1TXDA 1XX0A 3A8QA 2EC1A 3NSUA 2YVCA 4MY6A 4L6EA 3P6AA 4C0AA 1MKEA 1TJ6A 2ELBA 2RUKB 5D3XA 2HE7A 2DN6A 2ELAA 5HE1A 2D11A 3FSSA 4HDQA 1ZC3B 3M1IB 1DDMA 5CLLB 3LJUX 4TKNA 2H7DA 4HAWB 2J59M 4HAVB 4MT7A 1OQNA 3TW1A 1K5DB 3VIAA 1FGZA 1WVHA 1J19A 2ZPYA 1B55A 2ROZB 2DKQA 1WJMA 4A6KA 4YONA 2M38A 2R0DA 1LB1A 2FJLA 4HB0B 1MIZB 1V5MA 1OY2A 2QKMA 5JHHA 2Y8FA 2DYNA 1U5DA 1I2HA 3PG7A 5D27A 1FOEA 5DI9B 2P0DA 5HE3A 1EGXA 4GMVA 1H10A 2Z0QA 1WGQA 3BINA 4NSWA 1ZSQA 2LG1A 1KI1B 4EJNA 5DIFB 5DHAB 3TFMA 4P7IA 3FEHA 2YS1A 3PVUA 3ZVRA 1IRSA 4IOYX 1H4RA 2NZ8B 4HDOA 4CYEA 1X11A 5C16A 1X1FA 2MWNB 2DFKA 4K2OA 2D4QA 3WA0A 5C5BB 4Z2NA 3HW2B 2PZ1A 2EMTA 2COAA 1GC6A 2IFSA 3N7CA 1BAKA 4ZRIA 1AQCA 4A6FB 2I5FA 3SV1A 2YRYA 4XWXA 1FHOA 2K2UA 4Z2MB 3GYPA 3ODXA 2COCA 3U8ZA 1U5FA 2AL6A 2D9XA 3D8DA 1QQGA 2D9YA 2YT0A 2KUPA 3HQCA 1ZVRA 5J3TA 5KQ1A 4KAXB 2DHIA 3PEGA 3TCAA 5HE2A 3D8EA 2DX1A 2YS3A 4KHAA 4BBKA 4IFSA 4DXAB 2IYBA 2L1CA 1XD4A 3QIJA 1NI2A 2E2XA 1U27A 1NTVA 1EF1A 3ZDTA 4HAXB 4K2PA 2DKPA 4KHOA 3KRWA 3BJIA 1TQZA 1MK9B 2Q13A 1FGYA 1KZ7A 2P0FA 1BTNA 2MDXA 2UVMA 3ULCA 3V5WA 1UEFA 1PMSA 3UZTA 1X1GA 2DYQA 3G9WA 1DROA 2DHJA 2I1KA 5CLQB 1FHWA 3A8PA 3OANA 3MDBC 2L2IA 1UNQA 1P5TA 1KZGA 1WJ1A 2DLWA 3TVVA 3SUZA 4A5KA 1EAZA 1U5GA 2HTHB 1E5WA 4F7GA 1W1HA 3SNHA 1M7RA 2ROVA 1PLSA 3KSYA 3SO6A 4WVFB 4GZUA 3ULBA 4GPTB 2G35A 3PP2A 3ML4A 1ZM0A 4K81A 1UNPA 1NU2A 2D9VA 3O96A 2J0JA 4YL8A 4F7HA 4CHMA 1EVHA 4WJ7A 3FM8C 1RJ2A 1J0WA 3AU5A 2RVBB 4HB3B 4GN1A 4NY0A 1Y5OA 2M14A 2LULA 1X05A 1OMWA 3SYXA 1I7AA 1N3HA 2Z0OA 4DBBA 5C5BA 2GS0A 5FI0A 5C79A 2ADZA 3AU4A 3ODWA 4F7UP 2VKIA 4K17A 5JP4A 2Z0PA 1FAOA 2W2XD 4A6FA 3CXBB 3QBVB 1P6SA 2W2WA 1NTYA 3P7ZA 1UNRA 3QWMA 1SGHA 2Y8GA 2CAYA 2K2JA 3WYFB 1FHXA 2RSGA 5HE0A 2DX5A 2EJ8A 5KCVA 1K5GB 2KCJA 3PVLA 3GYOA 3DXCA 4HB2B 2MFQA 2P8VA 4EMOA 1U2BA 3T06A 4ZRKA 2CODA 2DHKA 5GOWB 1UPRA 3IVFA 1M7EA 1WG7A 1U5EA 3F0WA 1WI1A 1MAIA 2D2QA 1Q67A 2N0YA 3PZDA 3KRXA 5C6RA 1P3RA 2MKRA 5EFXA 1SHCA 1U29A 2CY4A 1V61A 2XQNM 2K00A 2RLOA 4CHJA 1FB8A 4HAYB 5D3YA 2CY5A 1DDWA 2YS5A 1XR0B 2RGNB 2COFA 3PVWA 2Y7BA 2D9ZA 1Z87A 4KHBB 2LOXA 4HAUB 3F5RA 2D10A 2OQBA 3AJ4A 1MIXA 1BTKA 2EMSA 2W2XC 4GMXB 4TYZA 2GCLA 5DH9B 3PSCA 4EKUA 4Y94A 5KQ4A 5D3WA 1V5PA 2YSZA 1QC6A 5J3QA 1UPQA 2RNRB 1W1DA 4A6HA 2N23A 2DA0A 3ODOA 4PQ0A 1ISNA 2I1JA 1DBHA 1V5UA 5LOPB 2R09A 2VSZA 2VRWB 1XODA 4MK0A 2LKOA 1GG3A 1V89A 4IAPA 5J3YA 4HAZB 4PNKA 1AWEA 2LOZA 4GXBA 1MPHA 1V88A 1W1GA 2YT1A 4H8SA 1MK7B 2GCJA 2J0MA 2X18A 2YF0A 4HHVA 1DDVA 3VOQA 5JHGA 5LONB 3KZ1A 2CRFA 2LYDA 4DX90 3D8FA 3DXDA 4HB4B 1Y19B 5L81A 3HK0A 2UZRA 5D3VA 3MPXA 3X23A 4D0NB 3KY9A 2QKLA 4DX8A 1LW3A 3CIKA 1XKEA 4B6HA 2J0KA 5FI1A 1PFJA 1RRPB 2KGXB 3U7DA 4ZRJA 5DHFB 1DYNA 3RCPA 2BCJA 2AEHA
chains in the Genus database with same CATH superfamily
3DXEA 1GC7A 4HATB 4L1RA 1WGUA 3NWFA 3TO1A 4D6WA 1X86A 2GJYA 2K8EA 2JP2A 1BWNA 3A98B 1XCGA 2P0HA 1ZC4B 2I5CA 2H7EA 2OTXA 2D9WA 5JLJB 2V76A 4QJ3B 2NMBA 4KVGB 2DTCA 2UZSA 3NWAA 4WSFA 1TXDA 1XX0A 3A8QA 4GOUA 2EC1A 3NSUA 2YVCA 4MY6A 1T77A 4L6EA 3DCXA 3P6AA 4C0AA 1MKEA 2K49A 1TJ6A 2ELBA 2RUKB 5D3XA 2HE7A 2DN6A 2ELAA 5HE1A 2D11A 3FSSA 2KIGA 4HDQA 1ZC3B 3M1IB 1DDMA 5CLLB 3LJUX 4TKNA 2H7DA 4HAWB 2J59M 4HAVB 4MT7A 1OQNA 3TW1A 4KHBA 1K5DB 3OHMB 3VIAA 1FGZA 2Z14A 1WVHA 1J19A 2ZPYA 1B55A 2ROZB 2DKQA 1WJMA 4A6KA 4YONA 2M38A 2R0DA 1LB1A 2FJLA 4HB0B 1MIZB 1V5MA 2ZKMX 1OY2A 2QKMA 5JHHA 2Y8FA 2DYNA 1U5DA 1I2HA 3PG7A 4OSNA 5IRSA 5D27A 1FOEA 5DI9B 2P0DA 5HE3A 1EGXA 2YT2A 4GMVA 1H10A 2Z0QA 1WGQA 3BINA 4NSWA 1ZSQA 2LG1A 2FJUB 1KI1B 4EJNA 5DIFB 5DHAB 3TFMA 4P7IA 3FEHA 2YS1A 3PVUA 3ZVRA 1IRSA 4IOYX 1H4RA 2NZ8B 4HDOA 4CYEA 1X11A 2KIEA 5C16A 1X1FA 3A58A 2MWNB 2DFKA 4K2OA 2D4QA 3WA0A 5C5BB 4Z2NA 3HW2B 2PZ1A 2EMTA 2COAA 1GC6A 5LG4B 2IFSA 3N7CA 1BAKA 4ZRIA 1AQCA 2Z13A 4A6FB 3NWDA 2I5FA 3SV1A 2YRYA 4XWXA 1FHOA 2K2UA 4Z2MB 3GYPA 3ODXA 2COCA 3U8ZA 1U5FA 2AL6A 2D9XA 3D8DA 1QQGA 2KUQA 2D9YA 2YT0A 2KUPA 3HQCA 1ZVRA 5J3TA 5KQ1A 4KAXB 2DHIA 3PEGA 5I2SA 3TCAA 5HE2A 3D8EA 2DX1A 2YS3A 4KHAA 4BBKA 4IFSA 4DXAB 2IYBA 2L1CA 1XD4A 3QIJA 1NI2A 2E2XA 1U27A 1NTVA 1EF1A 3ZDTA 4HAXB 5M4YB 3HSAA 4K2PA 2DKPA 4KHOA 2GUMA 3KRWA 4DIXA 3BJIA 1TQZA 1MK9B 2Q13A 1FGYA 4OT1A 1KZ7A 3NW8A 2KR0A 2P0FA 1BTNA 2MDXA 2UVMA 3ULCA 3V5WA 1UEFA 4QXAB 1PMSA 3UZTA 1X1GA 2DYQA 3G9WA 1DROA 2DHJA 2I1KA 5CLQB 1FHWA 3A8PA 3OANA 3MDBC 2L2IA 1UNQA 1P5TA 1KZGA 1WJ1A 2DLWA 3TVVA 3SUZA 4A5KA 1EAZA 1U5GA 2HTHB 1E5WA 1ZYIA 4F7GA 1W1HA 3SNHA 1M7RA 2ROVA 1PLSA 3KSYA 3SO6A 4WVFB 4GZUA 3ULBA 4GPTB 2G35A 3PP2A 3ML4A 5I2MA 1ZM0A 4K81A 1UNPA 1NU2A 2RRFA 3FVCA 4GNKB 2D9VA 3O96A 2J0JA 4YL8A 4F7HA 4CHMA 1EVHA 4WJ7A 3FM8C 1RJ2A 1J0WA 3AU5A 2RVBB 4HB3B 4GN1A 4NY0A 1Y5OA 2M14A 2LULA 1X05A 1OMWA 3SYXA 1I7AA 1N3HA 2Z0OA 4DBBA 5C5BA 3HIEA 2GS0A 5FI0A 5C79A 2ADZA 3AU4A 3ODWA 4F7UP 2VKIA 4K17A 5JP4A 2Z0PA 1FAOA 2W2XD 4A6FA 3CXBB 3QBVB 1P6SA 2W2WA 1NTYA 3P7ZA 1UNRA 3QWMA 1SGHA 2Y8GA 2CAYA 2K2JA 4HSIA 3WYFB 1FHXA 2RSGA 5HE0A 2DX5A 2EJ8A 2Z4DA 1K5GB 5KCVA 2KCJA 3PVLA 3GYOA 3DXCA 4HB2B 2MFQA 2P8VA 2Z59A 4EMOA 1U2BA 3T06A 4ZRKA 3U12A 2CODA 2DHKA 5GOWB 1UPRA 3IVFA 1M7EA 1WG7A 1U5EA 3F0WA 1WI1A 1MAIA 2D2QA 1Q67A 2N0YA 3PZDA 3KRXA 5C6RA 1P3RA 2MKRA 5EFXA 1SHCA 1U29A 2CY4A 1V61A 4CSQA 2XQNM 2K00A 2RLOA 4CHJA 1FB8A 4HAYB 4QJ5B 5D3YA 2CY5A 1DDWA 2NBVA 2YS5A 1XR0B 2RGNB 2COFA 3PVWA 2Y7BA 2D9ZA 1Z87A 4KHBB 2LOXA 4HAUB 3F5RA 2D10A 2OQBA 3AJ4A 1MIXA 1MI1A 1BTKA 2EMSA 3B77A 2W2XC 4GMXB 4TYZA 2GCLA 5DH9B 3PSCA 4EKUA 4Y94A 5KQ4A 5D3WA 1V5PA 2YSZA 1QC6A 5J3QA 1UPQA 2RNRB 1W1DA 4A6HA 2N23A 2DA0A 3ODOA 4PQ0A 1ISNA 2I1JA 1DBHA 1V5UA 5LOPB 2R09A 2VSZA 2VRWB 1XODA 4MK0A 2LKOA 1GG3A 1V89A 4IAPA 2R2YA 5J3YA 4HAZB 4PNKA 1AWEA 2LOZA 4GXBA 1MPHA 1V88A 4QJ4B 1W1GA 2YT1A 4H8SA 1MK7B 2GCJA 2J0MA 2X18A 2YF0A 4HHVA 1DDVA 3VOQA 5JHGA 5LONB 3KZ1A 2CRFA 2LYDA 4DX90 3D8FA 3DXDA 4HB4B 1Y19B 5L81A 3HK0A 2UZRA 5D3VA 3MPXA 3X23A 4D0NB 3KY9A 2QKLA 4DX8A 1LW3A 3CIKA 1XKEA 4B6HA 2J0KA 5FI1A 1PFJA 1RRPB 2KGXB 3U7DA 4ZRJA 5DHFB 1DYNA 3RCPA 2BCJA 2AEHA
chains in the Genus database with same CATH topology
3DXEA 1GC7A 4HATB 1WGUA 3TO1A 1X86A 2GJYA 2JP2A 1BWNA 3A98B 1XCGA 2P0HA 1ZC4B 2I5CA 2H7EA 2OTXA 2D9WA 5JLJB 2V76A 2NMBA 4KVGB 2DTCA 2UZSA 4WSFA 1TXDA 1XX0A 3A8QA 2EC1A 3NSUA 2YVCA 4MY6A 4L6EA 3P6AA 4C0AA 1MKEA 1TJ6A 2ELBA 2RUKB 5D3XA 2HE7A 2DN6A 2ELAA 5HE1A 2D11A 3FSSA 4HDQA 1ZC3B 3M1IB 1DDMA 5CLLB 3LJUX 4TKNA 2H7DA 4HAWB 2J59M 4HAVB 4MT7A 1OQNA 3TW1A 1K5DB 3VIAA 1FGZA 1WVHA 1J19A 2ZPYA 1B55A 2ROZB 2DKQA 1WJMA 4A6KA 4YONA 2M38A 2R0DA 1LB1A 2FJLA 4HB0B 1MIZB 1V5MA 1OY2A 2QKMA 5JHHA 2Y8FA 2DYNA 1U5DA 1I2HA 3PG7A 5D27A 1FOEA 5DI9B 2P0DA 5HE3A 1EGXA 4GMVA 1H10A 2Z0QA 1WGQA 3BINA 4NSWA 1ZSQA 2LG1A 1KI1B 4EJNA 5DIFB 5DHAB 3TFMA 4P7IA 3FEHA 2YS1A 3PVUA 3ZVRA 1IRSA 4IOYX 1H4RA 2NZ8B 4HDOA 4CYEA 1X11A 5C16A 1X1FA 2MWNB 2DFKA 4K2OA 2D4QA 3WA0A 5C5BB 4Z2NA 3HW2B 2PZ1A 2EMTA 2COAA 1GC6A 2IFSA 3N7CA 1BAKA 4ZRIA 1AQCA 4A6FB 2I5FA 3SV1A 2YRYA 4XWXA 1FHOA 2K2UA 4Z2MB 3GYPA 3ODXA 2COCA 3U8ZA 1U5FA 2AL6A 2D9XA 3D8DA 1QQGA 2D9YA 2YT0A 2KUPA 3HQCA 1ZVRA 5J3TA 5KQ1A 4KAXB 2DHIA 3PEGA 3TCAA 5HE2A 3D8EA 2DX1A 2YS3A 4KHAA 4BBKA 4IFSA 4DXAB 2IYBA 2L1CA 1XD4A 3QIJA 1NI2A 2E2XA 1U27A 1NTVA 1EF1A 3ZDTA 4HAXB 4K2PA 2DKPA 4KHOA 3KRWA 3BJIA 1TQZA 1MK9B 2Q13A 1FGYA 1KZ7A 2P0FA 1BTNA 2MDXA 2UVMA 3ULCA 3V5WA 1UEFA 1PMSA 3UZTA 1X1GA 2DYQA 3G9WA 1DROA 2DHJA 2I1KA 5CLQB 1FHWA 3A8PA 3OANA 3MDBC 2L2IA 1UNQA 1P5TA 1KZGA 1WJ1A 2DLWA 3TVVA 3SUZA 4A5KA 1EAZA 1U5GA 2HTHB 1E5WA 4F7GA 1W1HA 3SNHA 1M7RA 2ROVA 1PLSA 3KSYA 3SO6A 4WVFB 4GZUA 3ULBA 4GPTB 2G35A 3PP2A 3ML4A 1ZM0A 4K81A 1UNPA 1NU2A 2D9VA 3O96A 2J0JA 4YL8A 4F7HA 4CHMA 1EVHA 4WJ7A 3FM8C 1RJ2A 1J0WA 3AU5A 2RVBB 4HB3B 4GN1A 4NY0A 1Y5OA 2M14A 2LULA 1X05A 1OMWA 3SYXA 1I7AA 1N3HA 2Z0OA 4DBBA 5C5BA 2GS0A 5FI0A 5C79A 2ADZA 3AU4A 3ODWA 4F7UP 2VKIA 4K17A 5JP4A 2Z0PA 1FAOA 2W2XD 4A6FA 3CXBB 3QBVB 1P6SA 2W2WA 1NTYA 3P7ZA 1UNRA 3QWMA 1SGHA 2Y8GA 2CAYA 2K2JA 3WYFB 1FHXA 2RSGA 5HE0A 2DX5A 2EJ8A 5KCVA 1K5GB 2KCJA 3PVLA 3GYOA 3DXCA 4HB2B 2MFQA 2P8VA 4EMOA 1U2BA 3T06A 4ZRKA 2CODA 2DHKA 5GOWB 1UPRA 3IVFA 1M7EA 1WG7A 1U5EA 3F0WA 1WI1A 1MAIA 2D2QA 1Q67A 2N0YA 3PZDA 3KRXA 5C6RA 1P3RA 2MKRA 5EFXA 1SHCA 1U29A 2CY4A 1V61A 2XQNM 2K00A 2RLOA 4CHJA 1FB8A 4HAYB 5D3YA 2CY5A 1DDWA 2YS5A 1XR0B 2RGNB 2COFA 3PVWA 2Y7BA 2D9ZA 1Z87A 4KHBB 2LOXA 4HAUB 3F5RA 2D10A 2OQBA 3AJ4A 1MIXA 1BTKA 2EMSA 2W2XC 4GMXB 4TYZA 2GCLA 5DH9B 3PSCA 4EKUA 4Y94A 5KQ4A 5D3WA 1V5PA 2YSZA 1QC6A 5J3QA 1UPQA 2RNRB 1W1DA 4A6HA 2N23A 2DA0A 3ODOA 4PQ0A 1ISNA 2I1JA 1DBHA 1V5UA 5LOPB 2R09A 2VSZA 2VRWB 1XODA 4MK0A 2LKOA 1GG3A 1V89A 4IAPA 5J3YA 4HAZB 4PNKA 1AWEA 2LOZA 4GXBA 1MPHA 1V88A 1W1GA 2YT1A 4H8SA 1MK7B 2GCJA 2J0MA 2X18A 2YF0A 4HHVA 1DDVA 3VOQA 5JHGA 5LONB 3KZ1A 2CRFA 2LYDA 4DX90 3D8FA 3DXDA 4HB4B 1Y19B 5L81A 3HK0A 2UZRA 5D3VA 3MPXA 3X23A 4D0NB 3KY9A 2QKLA 4DX8A 1LW3A 3CIKA 1XKEA 4B6HA 2J0KA 5FI1A 1PFJA 1RRPB 2KGXB 3U7DA 4ZRJA 5DHFB 1DYNA 3RCPA 2BCJA 2AEHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DXE A;  1GC7 A;  4HAT B;  1WGU A;  3TO1 A;  1X86 A;  2GJY A;  2JP2 A;  1BWN A;  3A98 B;  1XCG A;  2P0H A;  1ZC4 B;  2I5C A;  2H7E A;  2OTX A;  2D9W A;  5JLJ B;  2V76 A;  2NMB A;  4KVG B;  2DTC A;  2UZS A;  4WSF A;  1TXD A;  1XX0 A;  3A8Q A;  2EC1 A;  3NSU A;  2YVC A;  4MY6 A;  4L6E A;  3P6A A;  4C0A A;  1MKE A;  1TJ6 A;  2ELB A;  2RUK B;  5D3X A;  2HE7 A;  2DN6 A;  2ELA A;  5HE1 A;  2D11 A;  3FSS A;  4HDQ A;  1ZC3 B;  3M1I B;  1DDM A;  5CLL B;  3LJU X;  4TKN A;  2H7D A;  4HAW B;  2J59 M;  4HAV B;  4MT7 A;  1OQN A;  3TW1 A;  1K5D B;  3VIA A;  1FGZ A;  1WVH A;  1J19 A;  2ZPY A;  1B55 A;  2ROZ B;  2DKQ A;  1WJM A;  4A6K A;  4YON A;  2M38 A;  2R0D A;  1LB1 A;  2FJL A;  4HB0 B;  1MIZ B;  1V5M A;  1OY2 A;  2QKM A;  5JHH A;  2Y8F A;  2DYN A;  1U5D A;  1I2H A;  3PG7 A;  5D27 A;  1FOE A;  5DI9 B;  2P0D A;  5HE3 A;  1EGX A;  4GMV A;  1H10 A;  2Z0Q A;  1WGQ A;  3BIN A;  4NSW A;  1ZSQ A;  2LG1 A;  1KI1 B;  4EJN A;  5DIF B;  5DHA B;  3TFM A;  4P7I A;  3FEH A;  2YS1 A;  3PVU A;  3ZVR A;  1IRS A;  4IOY X;  1H4R A;  2NZ8 B;  4HDO A;  4CYE A;  1X11 A;  5C16 A;  1X1F A;  2MWN B;  2DFK A;  4K2O A;  2D4Q A;  3WA0 A;  5C5B B;  4Z2N A;  3HW2 B;  2PZ1 A;  2EMT A;  2COA A;  1GC6 A;  2IFS A;  3N7C A;  1BAK A;  4ZRI A;  1AQC A;  4A6F B;  2I5F A;  3SV1 A;  2YRY A;  4XWX A;  1FHO A;  2K2U A;  4Z2M B;  3GYP A;  3ODX A;  2COC A;  3U8Z A;  1U5F A;  2AL6 A;  2D9X A;  3D8D A;  1QQG A;  2D9Y A;  2YT0 A;  2KUP A;  3HQC A;  1ZVR A;  5J3T A;  5KQ1 A;  4KAX B;  2DHI A;  3PEG A;  3TCA A;  5HE2 A;  3D8E A;  2DX1 A;  2YS3 A;  4KHA A;  4BBK A;  4IFS A;  4DXA B;  2IYB A;  2L1C A;  1XD4 A;  3QIJ A;  1NI2 A;  2E2X A;  1U27 A;  1NTV A;  1EF1 A;  3ZDT A;  4HAX B;  4K2P A;  2DKP A;  4KHO A;  3KRW A;  3BJI A;  1TQZ A;  1MK9 B;  2Q13 A;  1FGY A;  1KZ7 A;  2P0F A;  1BTN A;  2MDX A;  2UVM A;  3ULC A;  3V5W A;  1UEF A;  1PMS A;  3UZT A;  1X1G A;  2DYQ A;  3G9W A;  1DRO A;  2DHJ A;  2I1K A;  5CLQ B;  1FHW A;  3A8P A;  3OAN A;  3MDB C;  2L2I A;  1UNQ A;  1P5T A;  1KZG A;  1WJ1 A;  2DLW A;  3TVV A;  3SUZ A;  4A5K A;  1EAZ A;  1U5G A;  2HTH B;  1E5W A;  4F7G A;  1W1H A;  3SNH A;  1M7R A;  2ROV A;  1PLS A;  3KSY A;  3SO6 A;  4WVF B;  4GZU A;  3ULB A;  4GPT B;  2G35 A;  3PP2 A;  3ML4 A;  1ZM0 A;  4K81 A;  1UNP A;  1NU2 A;  2D9V A;  3O96 A;  2J0J A;  4YL8 A;  4F7H A;  4CHM A;  1EVH A;  4WJ7 A;  3FM8 C;  1RJ2 A;  1J0W A;  3AU5 A;  2RVB B;  4HB3 B;  4GN1 A;  4NY0 A;  1Y5O A;  2M14 A;  2LUL A;  1X05 A;  1OMW A;  3SYX A;  1I7A A;  1N3H A;  2Z0O A;  4DBB A;  5C5B A;  2GS0 A;  5FI0 A;  5C79 A;  2ADZ A;  3AU4 A;  3ODW A;  4F7U P;  2VKI A;  4K17 A;  5JP4 A;  2Z0P A;  1FAO A;  2W2X D;  4A6F A;  3CXB B;  3QBV B;  1P6S A;  2W2W A;  1NTY A;  3P7Z A;  1UNR A;  3QWM A;  1SGH A;  2Y8G A;  2CAY A;  2K2J A;  3WYF B;  1FHX A;  2RSG A;  5HE0 A;  2DX5 A;  2EJ8 A;  5KCV A;  1K5G B;  2KCJ A;  3PVL A;  3GYO A;  3DXC A;  4HB2 B;  2MFQ A;  2P8V A;  4EMO A;  1U2B A;  3T06 A;  4ZRK A;  2COD A;  2DHK A;  5GOW B;  1UPR A;  3IVF A;  1M7E A;  1WG7 A;  1U5E A;  3F0W A;  1WI1 A;  1MAI A;  2D2Q A;  1Q67 A;  2N0Y A;  3PZD A;  3KRX A;  5C6R A;  1P3R A;  2MKR A;  5EFX A;  1SHC A;  1U29 A;  2CY4 A;  1V61 A;  2XQN M;  2K00 A;  2RLO A;  4CHJ A;  1FB8 A;  4HAY B;  5D3Y A;  2CY5 A;  1DDW A;  2YS5 A;  1XR0 B;  2RGN B;  2COF A;  3PVW A;  2Y7B A;  2D9Z A;  1Z87 A;  4KHB B;  2LOX A;  4HAU B;  3F5R A;  2D10 A;  2OQB A;  3AJ4 A;  1MIX A;  1BTK A;  2EMS A;  2W2X C;  4GMX B;  4TYZ A;  2GCL A;  5DH9 B;  3PSC A;  4EKU A;  4Y94 A;  5KQ4 A;  5D3W A;  1V5P A;  2YSZ A;  1QC6 A;  5J3Q A;  1UPQ A;  2RNR B;  1W1D A;  4A6H A;  2N23 A;  2DA0 A;  3ODO A;  4PQ0 A;  1ISN A;  2I1J A;  1DBH A;  1V5U A;  5LOP B;  2R09 A;  2VSZ A;  2VRW B;  1XOD A;  4MK0 A;  2LKO A;  1GG3 A;  1V89 A;  4IAP A;  5J3Y A;  4HAZ B;  4PNK A;  1AWE A;  2LOZ A;  4GXB A;  1MPH A;  1V88 A;  1W1G A;  2YT1 A;  4H8S A;  1MK7 B;  2GCJ A;  2J0M A;  2X18 A;  2YF0 A;  4HHV A;  1DDV A;  3VOQ A;  5JHG A;  5LON B;  3KZ1 A;  2CRF A;  2LYD A;  4DX9 0;  3D8F A;  3DXD A;  4HB4 B;  1Y19 B;  5L81 A;  3HK0 A;  2UZR A;  5D3V A;  3MPX A;  3X23 A;  4D0N B;  3KY9 A;  2QKL A;  4DX8 A;  1LW3 A;  3CIK A;  1XKE A;  4B6H A;  2J0K A;  5FI1 A;  1PFJ A;  1RRP B;  2KGX B;  3U7D A;  4ZRJ A;  5DHF B;  1DYN A;  3RCP A;  2BCJ A;  2AEH A; 
#chains in the Genus database with same CATH topology
 3DXE A;  1GC7 A;  4HAT B;  4L1R A;  1WGU A;  3NWF A;  3TO1 A;  4D6W A;  1X86 A;  2GJY A;  2K8E A;  2JP2 A;  1BWN A;  3A98 B;  1XCG A;  2P0H A;  1ZC4 B;  2I5C A;  2H7E A;  2OTX A;  2D9W A;  5JLJ B;  2V76 A;  4QJ3 B;  2NMB A;  4KVG B;  2DTC A;  2UZS A;  3NWA A;  4WSF A;  1TXD A;  1XX0 A;  3A8Q A;  4GOU A;  2EC1 A;  3NSU A;  2YVC A;  4MY6 A;  1T77 A;  4L6E A;  3DCX A;  3P6A A;  4C0A A;  1MKE A;  2K49 A;  1TJ6 A;  2ELB A;  2RUK B;  5D3X A;  2HE7 A;  2DN6 A;  2ELA A;  5HE1 A;  2D11 A;  3FSS A;  2KIG A;  4HDQ A;  1ZC3 B;  3M1I B;  1DDM A;  5CLL B;  3LJU X;  4TKN A;  2H7D A;  4HAW B;  2J59 M;  4HAV B;  4MT7 A;  1OQN A;  3TW1 A;  4KHB A;  1K5D B;  3OHM B;  3VIA A;  1FGZ A;  2Z14 A;  1WVH A;  1J19 A;  2ZPY A;  1B55 A;  2ROZ B;  2DKQ A;  1WJM A;  4A6K A;  4YON A;  2M38 A;  2R0D A;  1LB1 A;  2FJL A;  4HB0 B;  1MIZ B;  1V5M A;  2ZKM X;  1OY2 A;  2QKM A;  5JHH A;  2Y8F A;  2DYN A;  1U5D A;  1I2H A;  3PG7 A;  4OSN A;  5IRS A;  5D27 A;  1FOE A;  5DI9 B;  2P0D A;  5HE3 A;  1EGX A;  2YT2 A;  4GMV A;  1H10 A;  2Z0Q A;  1WGQ A;  3BIN A;  4NSW A;  1ZSQ A;  2LG1 A;  2FJU B;  1KI1 B;  4EJN A;  5DIF B;  5DHA B;  3TFM A;  4P7I A;  3FEH A;  2YS1 A;  3PVU A;  3ZVR A;  1IRS A;  4IOY X;  1H4R A;  2NZ8 B;  4HDO A;  4CYE A;  1X11 A;  2KIE A;  5C16 A;  1X1F A;  3A58 A;  2MWN B;  2DFK A;  4K2O A;  2D4Q A;  3WA0 A;  5C5B B;  4Z2N A;  3HW2 B;  2PZ1 A;  2EMT A;  2COA A;  1GC6 A;  5LG4 B;  2IFS A;  3N7C A;  1BAK A;  4ZRI A;  1AQC A;  2Z13 A;  4A6F B;  3NWD A;  2I5F A;  3SV1 A;  2YRY A;  4XWX A;  1FHO A;  2K2U A;  4Z2M B;  3GYP A;  3ODX A;  2COC A;  3U8Z A;  1U5F A;  2AL6 A;  2D9X A;  3D8D A;  1QQG A;  2KUQ A;  2D9Y A;  2YT0 A;  2KUP A;  3HQC A;  1ZVR A;  5J3T A;  5KQ1 A;  4KAX B;  2DHI A;  3PEG A;  5I2S A;  3TCA A;  5HE2 A;  3D8E A;  2DX1 A;  2YS3 A;  4KHA A;  4BBK A;  4IFS A;  4DXA B;  2IYB A;  2L1C A;  1XD4 A;  3QIJ A;  1NI2 A;  2E2X A;  1U27 A;  1NTV A;  1EF1 A;  3ZDT A;  4HAX B;  5M4Y B;  3HSA A;  4K2P A;  2DKP A;  4KHO A;  2GUM A;  3KRW A;  4DIX A;  3BJI A;  1TQZ A;  1MK9 B;  2Q13 A;  1FGY A;  4OT1 A;  1KZ7 A;  3NW8 A;  2KR0 A;  2P0F A;  1BTN A;  2MDX A;  2UVM A;  3ULC A;  3V5W A;  1UEF A;  4QXA B;  1PMS A;  3UZT A;  1X1G A;  2DYQ A;  3G9W A;  1DRO A;  2DHJ A;  2I1K A;  5CLQ B;  1FHW A;  3A8P A;  3OAN A;  3MDB C;  2L2I A;  1UNQ A;  1P5T A;  1KZG A;  1WJ1 A;  2DLW A;  3TVV A;  3SUZ A;  4A5K A;  1EAZ A;  1U5G A;  2HTH B;  1E5W A;  1ZYI A;  4F7G A;  1W1H A;  3SNH A;  1M7R A;  2ROV A;  1PLS A;  3KSY A;  3SO6 A;  4WVF B;  4GZU A;  3ULB A;  4GPT B;  2G35 A;  3PP2 A;  3ML4 A;  5I2M A;  1ZM0 A;  4K81 A;  1UNP A;  1NU2 A;  2RRF A;  3FVC A;  4GNK B;  2D9V A;  3O96 A;  2J0J A;  4YL8 A;  4F7H A;  4CHM A;  1EVH A;  4WJ7 A;  3FM8 C;  1RJ2 A;  1J0W A;  3AU5 A;  2RVB B;  4HB3 B;  4GN1 A;  4NY0 A;  1Y5O A;  2M14 A;  2LUL A;  1X05 A;  1OMW A;  3SYX A;  1I7A A;  1N3H A;  2Z0O A;  4DBB A;  5C5B A;  3HIE A;  2GS0 A;  5FI0 A;  5C79 A;  2ADZ A;  3AU4 A;  3ODW A;  4F7U P;  2VKI A;  4K17 A;  5JP4 A;  2Z0P A;  1FAO A;  2W2X D;  4A6F A;  3CXB B;  3QBV B;  1P6S A;  2W2W A;  1NTY A;  3P7Z A;  1UNR A;  3QWM A;  1SGH A;  2Y8G A;  2CAY A;  2K2J A;  4HSI A;  3WYF B;  1FHX A;  2RSG A;  5HE0 A;  2DX5 A;  2EJ8 A;  2Z4D A;  1K5G B;  5KCV A;  2KCJ A;  3PVL A;  3GYO A;  3DXC A;  4HB2 B;  2MFQ A;  2P8V A;  2Z59 A;  4EMO A;  1U2B A;  3T06 A;  4ZRK A;  3U12 A;  2COD A;  2DHK A;  5GOW B;  1UPR A;  3IVF A;  1M7E A;  1WG7 A;  1U5E A;  3F0W A;  1WI1 A;  1MAI A;  2D2Q A;  1Q67 A;  2N0Y A;  3PZD A;  3KRX A;  5C6R A;  1P3R A;  2MKR A;  5EFX A;  1SHC A;  1U29 A;  2CY4 A;  1V61 A;  4CSQ A;  2XQN M;  2K00 A;  2RLO A;  4CHJ A;  1FB8 A;  4HAY B;  4QJ5 B;  5D3Y A;  2CY5 A;  1DDW A;  2NBV A;  2YS5 A;  1XR0 B;  2RGN B;  2COF A;  3PVW A;  2Y7B A;  2D9Z A;  1Z87 A;  4KHB B;  2LOX A;  4HAU B;  3F5R A;  2D10 A;  2OQB A;  3AJ4 A;  1MIX A;  1MI1 A;  1BTK A;  2EMS A;  3B77 A;  2W2X C;  4GMX B;  4TYZ A;  2GCL A;  5DH9 B;  3PSC A;  4EKU A;  4Y94 A;  5KQ4 A;  5D3W A;  1V5P A;  2YSZ A;  1QC6 A;  5J3Q A;  1UPQ A;  2RNR B;  1W1D A;  4A6H A;  2N23 A;  2DA0 A;  3ODO A;  4PQ0 A;  1ISN A;  2I1J A;  1DBH A;  1V5U A;  5LOP B;  2R09 A;  2VSZ A;  2VRW B;  1XOD A;  4MK0 A;  2LKO A;  1GG3 A;  1V89 A;  4IAP A;  2R2Y A;  5J3Y A;  4HAZ B;  4PNK A;  1AWE A;  2LOZ A;  4GXB A;  1MPH A;  1V88 A;  4QJ4 B;  1W1G A;  2YT1 A;  4H8S A;  1MK7 B;  2GCJ A;  2J0M A;  2X18 A;  2YF0 A;  4HHV A;  1DDV A;  3VOQ A;  5JHG A;  5LON B;  3KZ1 A;  2CRF A;  2LYD A;  4DX9 0;  3D8F A;  3DXD A;  4HB4 B;  1Y19 B;  5L81 A;  3HK0 A;  2UZR A;  5D3V A;  3MPX A;  3X23 A;  4D0N B;  3KY9 A;  2QKL A;  4DX8 A;  1LW3 A;  3CIK A;  1XKE A;  4B6H A;  2J0K A;  5FI1 A;  1PFJ A;  1RRP B;  2KGX B;  3U7D A;  4ZRJ A;  5DHF B;  1DYN A;  3RCP A;  2BCJ A;  2AEH A; 
#chains in the Genus database with same CATH homology
 3DXE A;  1GC7 A;  4HAT B;  1WGU A;  3TO1 A;  1X86 A;  2GJY A;  2JP2 A;  1BWN A;  3A98 B;  1XCG A;  2P0H A;  1ZC4 B;  2I5C A;  2H7E A;  2OTX A;  2D9W A;  5JLJ B;  2V76 A;  2NMB A;  4KVG B;  2DTC A;  2UZS A;  4WSF A;  1TXD A;  1XX0 A;  3A8Q A;  2EC1 A;  3NSU A;  2YVC A;  4MY6 A;  4L6E A;  3P6A A;  4C0A A;  1MKE A;  1TJ6 A;  2ELB A;  2RUK B;  5D3X A;  2HE7 A;  2DN6 A;  2ELA A;  5HE1 A;  2D11 A;  3FSS A;  4HDQ A;  1ZC3 B;  3M1I B;  1DDM A;  5CLL B;  3LJU X;  4TKN A;  2H7D A;  4HAW B;  2J59 M;  4HAV B;  4MT7 A;  1OQN A;  3TW1 A;  1K5D B;  3VIA A;  1FGZ A;  1WVH A;  1J19 A;  2ZPY A;  1B55 A;  2ROZ B;  2DKQ A;  1WJM A;  4A6K A;  4YON A;  2M38 A;  2R0D A;  1LB1 A;  2FJL A;  4HB0 B;  1MIZ B;  1V5M A;  1OY2 A;  2QKM A;  5JHH A;  2Y8F A;  2DYN A;  1U5D A;  1I2H A;  3PG7 A;  5D27 A;  1FOE A;  5DI9 B;  2P0D A;  5HE3 A;  1EGX A;  4GMV A;  1H10 A;  2Z0Q A;  1WGQ A;  3BIN A;  4NSW A;  1ZSQ A;  2LG1 A;  1KI1 B;  4EJN A;  5DIF B;  5DHA B;  3TFM A;  4P7I A;  3FEH A;  2YS1 A;  3PVU A;  3ZVR A;  1IRS A;  4IOY X;  1H4R A;  2NZ8 B;  4HDO A;  4CYE A;  1X11 A;  5C16 A;  1X1F A;  2MWN B;  2DFK A;  4K2O A;  2D4Q A;  3WA0 A;  5C5B B;  4Z2N A;  3HW2 B;  2PZ1 A;  2EMT A;  2COA A;  1GC6 A;  2IFS A;  3N7C A;  1BAK A;  4ZRI A;  1AQC A;  4A6F B;  2I5F A;  3SV1 A;  2YRY A;  4XWX A;  1FHO A;  2K2U A;  4Z2M B;  3GYP A;  3ODX A;  2COC A;  3U8Z A;  1U5F A;  2AL6 A;  2D9X A;  3D8D A;  1QQG A;  2D9Y A;  2YT0 A;  2KUP A;  3HQC A;  1ZVR A;  5J3T A;  5KQ1 A;  4KAX B;  2DHI A;  3PEG A;  3TCA A;  5HE2 A;  3D8E A;  2DX1 A;  2YS3 A;  4KHA A;  4BBK A;  4IFS A;  4DXA B;  2IYB A;  2L1C A;  1XD4 A;  3QIJ A;  1NI2 A;  2E2X A;  1U27 A;  1NTV A;  1EF1 A;  3ZDT A;  4HAX B;  4K2P A;  2DKP A;  4KHO A;  3KRW A;  3BJI A;  1TQZ A;  1MK9 B;  2Q13 A;  1FGY A;  1KZ7 A;  2P0F A;  1BTN A;  2MDX A;  2UVM A;  3ULC A;  3V5W A;  1UEF A;  1PMS A;  3UZT A;  1X1G A;  2DYQ A;  3G9W A;  1DRO A;  2DHJ A;  2I1K A;  5CLQ B;  1FHW A;  3A8P A;  3OAN A;  3MDB C;  2L2I A;  1UNQ A;  1P5T A;  1KZG A;  1WJ1 A;  2DLW A;  3TVV A;  3SUZ A;  4A5K A;  1EAZ A;  1U5G A;  2HTH B;  1E5W A;  4F7G A;  1W1H A;  3SNH A;  1M7R A;  2ROV A;  1PLS A;  3KSY A;  3SO6 A;  4WVF B;  4GZU A;  3ULB A;  4GPT B;  2G35 A;  3PP2 A;  3ML4 A;  1ZM0 A;  4K81 A;  1UNP A;  1NU2 A;  2D9V A;  3O96 A;  2J0J A;  4YL8 A;  4F7H A;  4CHM A;  1EVH A;  4WJ7 A;  3FM8 C;  1RJ2 A;  1J0W A;  3AU5 A;  2RVB B;  4HB3 B;  4GN1 A;  4NY0 A;  1Y5O A;  2M14 A;  2LUL A;  1X05 A;  1OMW A;  3SYX A;  1I7A A;  1N3H A;  2Z0O A;  4DBB A;  5C5B A;  2GS0 A;  5FI0 A;  5C79 A;  2ADZ A;  3AU4 A;  3ODW A;  4F7U P;  2VKI A;  4K17 A;  5JP4 A;  2Z0P A;  1FAO A;  2W2X D;  4A6F A;  3CXB B;  3QBV B;  1P6S A;  2W2W A;  1NTY A;  3P7Z A;  1UNR A;  3QWM A;  1SGH A;  2Y8G A;  2CAY A;  2K2J A;  3WYF B;  1FHX A;  2RSG A;  5HE0 A;  2DX5 A;  2EJ8 A;  5KCV A;  1K5G B;  2KCJ A;  3PVL A;  3GYO A;  3DXC A;  4HB2 B;  2MFQ A;  2P8V A;  4EMO A;  1U2B A;  3T06 A;  4ZRK A;  2COD A;  2DHK A;  5GOW B;  1UPR A;  3IVF A;  1M7E A;  1WG7 A;  1U5E A;  3F0W A;  1WI1 A;  1MAI A;  2D2Q A;  1Q67 A;  2N0Y A;  3PZD A;  3KRX A;  5C6R A;  1P3R A;  2MKR A;  5EFX A;  1SHC A;  1U29 A;  2CY4 A;  1V61 A;  2XQN M;  2K00 A;  2RLO A;  4CHJ A;  1FB8 A;  4HAY B;  5D3Y A;  2CY5 A;  1DDW A;  2YS5 A;  1XR0 B;  2RGN B;  2COF A;  3PVW A;  2Y7B A;  2D9Z A;  1Z87 A;  4KHB B;  2LOX A;  4HAU B;  3F5R A;  2D10 A;  2OQB A;  3AJ4 A;  1MIX A;  1BTK A;  2EMS A;  2W2X C;  4GMX B;  4TYZ A;  2GCL A;  5DH9 B;  3PSC A;  4EKU A;  4Y94 A;  5KQ4 A;  5D3W A;  1V5P A;  2YSZ A;  1QC6 A;  5J3Q A;  1UPQ A;  2RNR B;  1W1D A;  4A6H A;  2N23 A;  2DA0 A;  3ODO A;  4PQ0 A;  1ISN A;  2I1J A;  1DBH A;  1V5U A;  5LOP B;  2R09 A;  2VSZ A;  2VRW B;  1XOD A;  4MK0 A;  2LKO A;  1GG3 A;  1V89 A;  4IAP A;  5J3Y A;  4HAZ B;  4PNK A;  1AWE A;  2LOZ A;  4GXB A;  1MPH A;  1V88 A;  1W1G A;  2YT1 A;  4H8S A;  1MK7 B;  2GCJ A;  2J0M A;  2X18 A;  2YF0 A;  4HHV A;  1DDV A;  3VOQ A;  5JHG A;  5LON B;  3KZ1 A;  2CRF A;  2LYD A;  4DX9 0;  3D8F A;  3DXD A;  4HB4 B;  1Y19 B;  5L81 A;  3HK0 A;  2UZR A;  5D3V A;  3MPX A;  3X23 A;  4D0N B;  3KY9 A;  2QKL A;  4DX8 A;  1LW3 A;  3CIK A;  1XKE A;  4B6H A;  2J0K A;  5FI1 A;  1PFJ A;  1RRP B;  2KGX B;  3U7D A;  4ZRJ A;  5DHF B;  1DYN A;  3RCP A;  2BCJ A;  2AEH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...