5JLJB

Crystal structure of kpt8602 in complex with crm1-ran-ranbp1
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
136
structure length
126
Chain Sequence
FEPVMEEDEEVLYKVRAKLFRFDADAKEWKERGTGDCKFLKNKKTNKVRILMRRDKTLKICANHIIAPEYTLKPNVGSDRSWVYACTADIAEGEAEAFTFAIRFGSKENADKFKEEFEKAQEINKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GTP-binding nuclear protein Ran
publication title Next-generation XPO1 inhibitor shows improved efficacy and in vivo tolerability in hematological malignancies.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
total genus 33
structure length 126
sequence length 136
ec nomenclature
pdb deposition date 2016-04-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00638 Ran_BP1 RanBP1 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 5jljB00
2ZPYA 2V76A 3WYFB 1RJ2A 4HDOA 2KUPA 2GJYA 2W2XD 1QQGA 2YRYA 2L2IA 2OQBA 3KZ1A 3RCPA 3ULCA 4CHMA 2LG1A 4CHJA 1OMWA 4Z2MB 5FI1A 4B6HA 4IOYX 1LW3A 3SYXA 1PFJA 1KZ7A 4GN1A 1PLSA 2ADZA 2GCJA 5KCVA 4IAPA 1NU2A 5D3WA 4HAVB 3LJUX 1H4RA 2K00A 1QC6A 2IFSA 3PSCA 1BTKA 2DFKA 4HB3B 5L81A 2LKOA 4KVGB 4TYZA 1AWEA 4KAXB 3TFMA 4WJ7A 1M7EA 3O96A 2GCLA 2P8VA 1U29A 1U5EA 4P7IA 2UZSA 2W2XC 5DI9B 1U2BA 4DX90 2DX5A 1BAKA 1ISNA 1B55A 1UPQA 2EMSA 5EFXA 3ODXA 2Y8FA 1ZC3B 1V5PA 4EJNA 1U27A 1WG7A 1GC7A 3DXDA 1XCGA 2W2WA 2DYNA 3NSUA 1X1GA 1Z87A 1FOEA 3ZDTA 1TJ6A 2M14A 2RGNB 5CLLB 3F0WA 2N23A 1X86A 1X1FA 3D8DA 2COFA 3U8ZA 3BINA 2AL6A 4MT7A 2YT0A 1DROA 2NZ8B 5HE3A 1V89A 2E2XA 1AQCA 2VSZA 3ODWA 2DHIA 1KZGA 2EMTA 1XODA 2YF0A 4NY0A 1EVHA 2Q13A 3QWMA 5C79A 3D8FA 4WVFB 2MWNB 2RLOA 2IYBA 1MIZB 2LOZA 5D27A 5DIFB 2J0JA 2D9ZA 5D3XA 2DKPA 3QIJA 4K2OA 2D9VA 3T06A 3ML4A 3UZTA 5CLQB 1XD4A 4HAXB 2RVBB 1K5GB 2Z0OA 1SGHA 5KQ4A 2Y7BA 4GMVA 2D2QA 2N0YA 2LOXA 2I5FA 4GZUA 4IFSA 5C6RA 4MK0A 1GG3A 4DXAB 1N3HA 2CRFA 3BJIA 5C5BB 4HATB 3FM8C 2P0DA 3P6AA 4YONA 3DXEA 3ULBA 1NTYA 1U5GA 1Y19B 4ZRKA 1J19A 3A98B 1Y5OA 2HE7A 2EC1A 2GS0A 1ZM0A 4BBKA 1XR0B 3TO1A 4MY6A 5J3YA 1PMSA 2K2JA 3GYPA 4KHAA 1UNRA 1WGQA 2I5CA 2QKLA 2BCJA 1IRSA 1V5MA 1W1GA 4K81A 2YS1A 4F7GA 5FI0A 4K17A 1DBHA 3QBVB 1EGXA 2HTHB 2NMBA 2R09A 2QKMA 1WVHA 4A5KA 1DDWA 2KGXB 2XQNM 5D3VA 4A6FB 4A6KA 2D11A 1Q67A 2RUKB 2I1JA 2MKRA 4K2PA 3F5RA 2PZ1A 3U7DA 2UZRA 3PZDA 3P7ZA 4HB2B 1EAZA 4NSWA 2DKQA 2MFQA 1E5WA 1ZVRA 1H10A 1TXDA 3MPXA 1FB8A 4ZRIA 1OQNA 1FGZA 3DXCA 3OANA 3A8PA 3D8EA 3N7CA 1MPHA 4YL8A 1WI1A 4TKNA 1M7RA 1EF1A 4CYEA 2H7DA 1MK7B 1FHOA 2YT1A 1P5TA 4ZRJA 1J0WA 1P6SA 3KSYA 4F7HA 2CY4A 2UVMA 4EKUA 4PNKA 2YS3A 2DYQA 2JP2A 3SUZA 4GXBA 3TCAA 1FAOA 2G35A 2Z0PA 4PQ0A 2ELBA 1ZC4B 2DX1A 4HAZB 1UPRA 2ROVA 5HE2A 5HE1A 2DN6A 4D0NB 1WGUA 2ELAA 2MDXA 1DDVA 1W1DA 2DHKA 4C0AA 1GC6A 3SV1A 3VOQA 1MAIA 2CODA 3CIKA 2Y8GA 4Y94A 2DA0A 2KCJA 4KHOA 5D3YA 5DHAB 1LB1A 3V5WA 3GYOA 5JLJB 4HHVA 4HAYB 2LULA 5J3TA 2RNRB 1MIXA 5GOWB 1UNQA 1FGYA 1BTNA 5LONB 2DTCA 4EMOA 3AU5A 4XWXA 4A6FA 3SNHA 2P0HA 2Z0QA 3TVVA 4HAUB 1FHXA 5JP4A 1UNPA 2COCA 1WJMA 2R0DA 2X18A 3TW1A 2J0KA 3A8QA 3X23A 5J3QA 3HK0A 2I1KA 1SHCA 5C16A 2YS5A 2J0MA 3PVLA 1WJ1A 1U5DA 3PG7A 2DHJA 3MDBC 2YVCA 2H7EA 2LYDA 2OTXA 1UEFA 2VRWB 4WSFA 4KHBB 5DH9B 2D9YA 2D9WA 4HAWB 2FJLA 2CAYA 2K2UA 1DDMA 3FEHA 3KRWA 1NI2A 3HW2B 4HB0B 3WA0A 1K5DB 5JHGA 2P0FA 3HQCA 1DYNA 4GMXB 3KY9A 2ROZB 3PVUA 1I7AA 1V88A 3PP2A 1KI1B 1XX0A 3ZVRA 2VKIA 3CXBB 2M38A 4GPTB 1MKEA 1P3RA 3AJ4A 2COAA 1W1HA 1MK9B 3PVWA 3ODOA 2D4QA 3AU4A 2RSGA 3M1IB 5DHFB 4H8SA 2D9XA 4L6EA 1NTVA 1I2HA 3VIAA 5LOPB 2J59M 1V5UA 2DLWA 3PEGA 3SO6A 2YSZA 1ZSQA 2EJ8A 3G9WA 4F7UP 3IVFA 1RRPB 1V61A 5JHHA 4A6HA 5KQ1A 5C5BA 2L1CA 1X05A 2AEHA 1TQZA 4DX8A 1FHWA 3KRXA 1BWNA 5HE0A 2CY5A 4HB4B 2D10A 1OY2A 1XKEA 4HDQA 1U5FA 3FSSA 1X11A 4DBBA 4Z2NA
chains in the Genus database with same CATH superfamily
2ZPYA 2V76A 3WYFB 1RJ2A 2KIEA 4HDOA 2KUPA 2GJYA 2W2XD 4D6WA 1QQGA 2KR0A 2YRYA 2L2IA 2OQBA 3NW8A 3KZ1A 3RCPA 3ULCA 4CHMA 2LG1A 4CHJA 1OMWA 4Z2MB 5FI1A 4B6HA 4IOYX 4OSNA 1LW3A 3SYXA 1PFJA 1KZ7A 4GN1A 2Z59A 1PLSA 3DCXA 2ADZA 2GCJA 5KCVA 4IAPA 1NU2A 2Z14A 5D3WA 4HAVB 3LJUX 4KHBA 4GNKB 1H4RA 2K00A 1QC6A 4QJ4B 2IFSA 3PSCA 1BTKA 2DFKA 4HB3B 5L81A 2LKOA 4KVGB 4TYZA 1AWEA 4KAXB 3TFMA 4WJ7A 1M7EA 3O96A 2GCLA 2P8VA 1U29A 1U5EA 4P7IA 2UZSA 2W2XC 4L1RA 2NBVA 5DI9B 5I2MA 1U2BA 3U12A 4DX90 2DX5A 1BAKA 1ISNA 1B55A 1UPQA 2EMSA 5EFXA 3ODXA 2Y8FA 2KUQA 1ZC3B 1V5PA 4EJNA 3FVCA 1U27A 1WG7A 1GC7A 3DXDA 1XCGA 2W2WA 2DYNA 3NSUA 1X1GA 1Z87A 1FOEA 3ZDTA 1TJ6A 2M14A 4QJ5B 2RGNB 5CLLB 3F0WA 2K49A 2N23A 1X86A 1X1FA 3D8DA 2COFA 3NWAA 3U8ZA 3BINA 2AL6A 2FJUB 2RRFA 4MT7A 2YT0A 1DROA 2NZ8B 5HE3A 1V89A 2E2XA 1AQCA 2VSZA 3ODWA 2DHIA 1KZGA 2EMTA 1XODA 2YF0A 4NY0A 1EVHA 2Q13A 3QWMA 5C79A 3D8FA 2ZKMX 4WVFB 2MWNB 2RLOA 2IYBA 1MIZB 2LOZA 5D27A 5DIFB 2J0JA 2D9ZA 5D3XA 2DKPA 3QIJA 4K2OA 2D9VA 1ZYIA 3T06A 3ML4A 3UZTA 5CLQB 1XD4A 4HAXB 2RVBB 1K5GB 2Z0OA 1SGHA 5KQ4A 2Y7BA 4GMVA 2D2QA 2N0YA 2LOXA 2I5FA 4GZUA 4IFSA 5C6RA 4MK0A 1GG3A 4DXAB 1N3HA 2CRFA 3BJIA 5C5BB 1T77A 4HATB 3FM8C 2P0DA 3P6AA 4YONA 3DXEA 3ULBA 1NTYA 1U5GA 1Y19B 4ZRKA 1J19A 3A98B 1Y5OA 2HE7A 2EC1A 2GS0A 1ZM0A 4BBKA 1XR0B 3TO1A 4MY6A 5J3YA 1PMSA 2K2JA 2K8EA 3GYPA 4KHAA 1UNRA 1WGQA 2I5CA 2QKLA 2BCJA 1IRSA 1V5MA 1W1GA 4K81A 2YS1A 4F7GA 5FI0A 4K17A 1DBHA 3QBVB 1EGXA 2HTHB 2NMBA 2R09A 2QKMA 1WVHA 4A5KA 1DDWA 2KGXB 2XQNM 5D3VA 4A6FB 4A6KA 2D11A 1Q67A 2RUKB 2I1JA 2MKRA 4K2PA 3F5RA 2PZ1A 3U7DA 2UZRA 3PZDA 5M4YB 3P7ZA 4HB2B 1EAZA 4NSWA 2DKQA 2MFQA 1E5WA 1ZVRA 1H10A 1TXDA 3MPXA 1FB8A 4ZRIA 1OQNA 1FGZA 3DXCA 4OT1A 3OANA 3A8PA 3D8EA 3N7CA 1MPHA 4YL8A 1WI1A 4TKNA 1M7RA 1EF1A 4CYEA 2H7DA 1MK7B 1FHOA 2YT1A 1P5TA 4DIXA 4ZRJA 1J0WA 1P6SA 3KSYA 4F7HA 2CY4A 2UVMA 4QXAB 4EKUA 4PNKA 2YS3A 2DYQA 2JP2A 3SUZA 4GXBA 3TCAA 1FAOA 5I2SA 2G35A 2Z0PA 4PQ0A 2ELBA 1ZC4B 2DX1A 4HAZB 1UPRA 2ROVA 5HE2A 5HE1A 2DN6A 4D0NB 1WGUA 2ELAA 2MDXA 1DDVA 4HSIA 1W1DA 2DHKA 3NWFA 1GC6A 4C0AA 3SV1A 3VOQA 1MAIA 2CODA 3CIKA 4CSQA 2Y8GA 4Y94A 2DA0A 2KCJA 4KHOA 5D3YA 5DHAB 1LB1A 3V5WA 2R2YA 3GYOA 2Z4DA 5JLJB 5LG4B 4HHVA 4HAYB 2LULA 5J3TA 2RNRB 1MIXA 5GOWB 1UNQA 1FGYA 5IRSA 1BTNA 5LONB 2DTCA 4EMOA 3AU5A 4XWXA 4A6FA 3SNHA 3B77A 2P0HA 2Z0QA 3TVVA 4HAUB 1FHXA 5JP4A 3A58A 1UNPA 2COCA 1WJMA 2R0DA 2X18A 3TW1A 2J0KA 3A8QA 3X23A 5J3QA 3HK0A 1MI1A 2I1KA 1SHCA 5C16A 2YS5A 2J0MA 3PVLA 1WJ1A 1U5DA 3HIEA 3PG7A 2DHJA 3MDBC 4QJ3B 2YVCA 2H7EA 2LYDA 2OTXA 1UEFA 2VRWB 4WSFA 4KHBB 5DH9B 2D9YA 2D9WA 4HAWB 2FJLA 4GOUA 2CAYA 2K2UA 1DDMA 3FEHA 3KRWA 1NI2A 3HSAA 3HW2B 4HB0B 3WA0A 1K5DB 5JHGA 2P0FA 3HQCA 2Z13A 1DYNA 4GMXB 3KY9A 2ROZB 3PVUA 1I7AA 1V88A 3NWDA 1KI1B 1XX0A 3PP2A 3ZVRA 2VKIA 3CXBB 2M38A 2YT2A 4GPTB 1MKEA 1P3RA 3AJ4A 2COAA 1W1HA 1MK9B 3PVWA 3ODOA 2D4QA 3AU4A 2RSGA 3M1IB 2KIGA 5DHFB 3OHMB 4H8SA 2D9XA 4L6EA 1NTVA 1I2HA 3VIAA 5LOPB 2J59M 1V5UA 2DLWA 3PEGA 3SO6A 2YSZA 1ZSQA 2EJ8A 3G9WA 4F7UP 3IVFA 1RRPB 1V61A 5JHHA 4A6HA 5KQ1A 5C5BA 2L1CA 1X05A 2AEHA 1TQZA 4DX8A 1FHWA 3KRXA 1BWNA 5HE0A 2CY5A 4HB4B 2D10A 1OY2A 1XKEA 4HDQA 1U5FA 2GUMA 3FSSA 1X11A 4DBBA 4Z2NA
chains in the Genus database with same CATH topology
2ZPYA 2V76A 3WYFB 1RJ2A 4HDOA 2KUPA 2GJYA 2W2XD 1QQGA 2YRYA 2L2IA 2OQBA 3KZ1A 3RCPA 3ULCA 4CHMA 2LG1A 4CHJA 1OMWA 4Z2MB 5FI1A 4B6HA 4IOYX 1LW3A 3SYXA 1PFJA 1KZ7A 4GN1A 1PLSA 2ADZA 2GCJA 5KCVA 4IAPA 1NU2A 5D3WA 4HAVB 3LJUX 1H4RA 2K00A 1QC6A 2IFSA 3PSCA 1BTKA 2DFKA 4HB3B 5L81A 2LKOA 4KVGB 4TYZA 1AWEA 4KAXB 3TFMA 4WJ7A 1M7EA 3O96A 2GCLA 2P8VA 1U29A 1U5EA 4P7IA 2UZSA 2W2XC 5DI9B 1U2BA 4DX90 2DX5A 1BAKA 1ISNA 1B55A 1UPQA 2EMSA 5EFXA 3ODXA 2Y8FA 1ZC3B 1V5PA 4EJNA 1U27A 1WG7A 1GC7A 3DXDA 1XCGA 2W2WA 2DYNA 3NSUA 1X1GA 1Z87A 1FOEA 3ZDTA 1TJ6A 2M14A 2RGNB 5CLLB 3F0WA 2N23A 1X86A 1X1FA 3D8DA 2COFA 3U8ZA 3BINA 2AL6A 4MT7A 2YT0A 1DROA 2NZ8B 5HE3A 1V89A 2E2XA 1AQCA 2VSZA 3ODWA 2DHIA 1KZGA 2EMTA 1XODA 2YF0A 4NY0A 1EVHA 2Q13A 3QWMA 5C79A 3D8FA 4WVFB 2MWNB 2RLOA 2IYBA 1MIZB 2LOZA 5D27A 5DIFB 2J0JA 2D9ZA 5D3XA 2DKPA 3QIJA 4K2OA 2D9VA 3T06A 3ML4A 3UZTA 5CLQB 1XD4A 4HAXB 2RVBB 1K5GB 2Z0OA 1SGHA 5KQ4A 2Y7BA 4GMVA 2D2QA 2N0YA 2LOXA 2I5FA 4GZUA 4IFSA 5C6RA 4MK0A 1GG3A 4DXAB 1N3HA 2CRFA 3BJIA 5C5BB 4HATB 3FM8C 2P0DA 3P6AA 4YONA 3DXEA 3ULBA 1NTYA 1U5GA 1Y19B 4ZRKA 1J19A 3A98B 1Y5OA 2HE7A 2EC1A 2GS0A 1ZM0A 4BBKA 1XR0B 3TO1A 4MY6A 5J3YA 1PMSA 2K2JA 3GYPA 4KHAA 1UNRA 1WGQA 2I5CA 2QKLA 2BCJA 1IRSA 1V5MA 1W1GA 4K81A 2YS1A 4F7GA 5FI0A 4K17A 1DBHA 3QBVB 1EGXA 2HTHB 2NMBA 2R09A 2QKMA 1WVHA 4A5KA 1DDWA 2KGXB 2XQNM 5D3VA 4A6FB 4A6KA 2D11A 1Q67A 2RUKB 2I1JA 2MKRA 4K2PA 3F5RA 2PZ1A 3U7DA 2UZRA 3PZDA 3P7ZA 4HB2B 1EAZA 4NSWA 2DKQA 2MFQA 1E5WA 1ZVRA 1H10A 1TXDA 3MPXA 1FB8A 4ZRIA 1OQNA 1FGZA 3DXCA 3OANA 3A8PA 3D8EA 3N7CA 1MPHA 4YL8A 1WI1A 4TKNA 1M7RA 1EF1A 4CYEA 2H7DA 1MK7B 1FHOA 2YT1A 1P5TA 4ZRJA 1J0WA 1P6SA 3KSYA 4F7HA 2CY4A 2UVMA 4EKUA 4PNKA 2YS3A 2DYQA 2JP2A 3SUZA 4GXBA 3TCAA 1FAOA 2G35A 2Z0PA 4PQ0A 2ELBA 1ZC4B 2DX1A 4HAZB 1UPRA 2ROVA 5HE2A 5HE1A 2DN6A 4D0NB 1WGUA 2ELAA 2MDXA 1DDVA 1W1DA 2DHKA 4C0AA 1GC6A 3SV1A 3VOQA 1MAIA 2CODA 3CIKA 2Y8GA 4Y94A 2DA0A 2KCJA 4KHOA 5D3YA 5DHAB 1LB1A 3V5WA 3GYOA 5JLJB 4HHVA 4HAYB 2LULA 5J3TA 2RNRB 1MIXA 5GOWB 1UNQA 1FGYA 1BTNA 5LONB 2DTCA 4EMOA 3AU5A 4XWXA 4A6FA 3SNHA 2P0HA 2Z0QA 3TVVA 4HAUB 1FHXA 5JP4A 1UNPA 2COCA 1WJMA 2R0DA 2X18A 3TW1A 2J0KA 3A8QA 3X23A 5J3QA 3HK0A 2I1KA 1SHCA 5C16A 2YS5A 2J0MA 3PVLA 1WJ1A 1U5DA 3PG7A 2DHJA 3MDBC 2YVCA 2H7EA 2LYDA 2OTXA 1UEFA 2VRWB 4WSFA 4KHBB 5DH9B 2D9YA 2D9WA 4HAWB 2FJLA 2CAYA 2K2UA 1DDMA 3FEHA 3KRWA 1NI2A 3HW2B 4HB0B 3WA0A 1K5DB 5JHGA 2P0FA 3HQCA 1DYNA 4GMXB 3KY9A 2ROZB 3PVUA 1I7AA 1V88A 3PP2A 1KI1B 1XX0A 3ZVRA 2VKIA 3CXBB 2M38A 4GPTB 1MKEA 1P3RA 3AJ4A 2COAA 1W1HA 1MK9B 3PVWA 3ODOA 2D4QA 3AU4A 2RSGA 3M1IB 5DHFB 4H8SA 2D9XA 4L6EA 1NTVA 1I2HA 3VIAA 5LOPB 2J59M 1V5UA 2DLWA 3PEGA 3SO6A 2YSZA 1ZSQA 2EJ8A 3G9WA 4F7UP 3IVFA 1RRPB 1V61A 5JHHA 4A6HA 5KQ1A 5C5BA 2L1CA 1X05A 2AEHA 1TQZA 4DX8A 1FHWA 3KRXA 1BWNA 5HE0A 2CY5A 4HB4B 2D10A 1OY2A 1XKEA 4HDQA 1U5FA 3FSSA 1X11A 4DBBA 4Z2NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZPY A;  2V76 A;  3WYF B;  1RJ2 A;  4HDO A;  2KUP A;  2GJY A;  2W2X D;  1QQG A;  2YRY A;  2L2I A;  2OQB A;  3KZ1 A;  3RCP A;  3ULC A;  4CHM A;  2LG1 A;  4CHJ A;  1OMW A;  4Z2M B;  5FI1 A;  4B6H A;  4IOY X;  1LW3 A;  3SYX A;  1PFJ A;  1KZ7 A;  4GN1 A;  1PLS A;  2ADZ A;  2GCJ A;  5KCV A;  4IAP A;  1NU2 A;  5D3W A;  4HAV B;  3LJU X;  1H4R A;  2K00 A;  1QC6 A;  2IFS A;  3PSC A;  1BTK A;  2DFK A;  4HB3 B;  5L81 A;  2LKO A;  4KVG B;  4TYZ A;  1AWE A;  4KAX B;  3TFM A;  4WJ7 A;  1M7E A;  3O96 A;  2GCL A;  2P8V A;  1U29 A;  1U5E A;  4P7I A;  2UZS A;  2W2X C;  5DI9 B;  1U2B A;  4DX9 0;  2DX5 A;  1BAK A;  1ISN A;  1B55 A;  1UPQ A;  2EMS A;  5EFX A;  3ODX A;  2Y8F A;  1ZC3 B;  1V5P A;  4EJN A;  1U27 A;  1WG7 A;  1GC7 A;  3DXD A;  1XCG A;  2W2W A;  2DYN A;  3NSU A;  1X1G A;  1Z87 A;  1FOE A;  3ZDT A;  1TJ6 A;  2M14 A;  2RGN B;  5CLL B;  3F0W A;  2N23 A;  1X86 A;  1X1F A;  3D8D A;  2COF A;  3U8Z A;  3BIN A;  2AL6 A;  4MT7 A;  2YT0 A;  1DRO A;  2NZ8 B;  5HE3 A;  1V89 A;  2E2X A;  1AQC A;  2VSZ A;  3ODW A;  2DHI A;  1KZG A;  2EMT A;  1XOD A;  2YF0 A;  4NY0 A;  1EVH A;  2Q13 A;  3QWM A;  5C79 A;  3D8F A;  4WVF B;  2MWN B;  2RLO A;  2IYB A;  1MIZ B;  2LOZ A;  5D27 A;  5DIF B;  2J0J A;  2D9Z A;  5D3X A;  2DKP A;  3QIJ A;  4K2O A;  2D9V A;  3T06 A;  3ML4 A;  3UZT A;  5CLQ B;  1XD4 A;  4HAX B;  2RVB B;  1K5G B;  2Z0O A;  1SGH A;  5KQ4 A;  2Y7B A;  4GMV A;  2D2Q A;  2N0Y A;  2LOX A;  2I5F A;  4GZU A;  4IFS A;  5C6R A;  4MK0 A;  1GG3 A;  4DXA B;  1N3H A;  2CRF A;  3BJI A;  5C5B B;  4HAT B;  3FM8 C;  2P0D A;  3P6A A;  4YON A;  3DXE A;  3ULB A;  1NTY A;  1U5G A;  1Y19 B;  4ZRK A;  1J19 A;  3A98 B;  1Y5O A;  2HE7 A;  2EC1 A;  2GS0 A;  1ZM0 A;  4BBK A;  1XR0 B;  3TO1 A;  4MY6 A;  5J3Y A;  1PMS A;  2K2J A;  3GYP A;  4KHA A;  1UNR A;  1WGQ A;  2I5C A;  2QKL A;  2BCJ A;  1IRS A;  1V5M A;  1W1G A;  4K81 A;  2YS1 A;  4F7G A;  5FI0 A;  4K17 A;  1DBH A;  3QBV B;  1EGX A;  2HTH B;  2NMB A;  2R09 A;  2QKM A;  1WVH A;  4A5K A;  1DDW A;  2KGX B;  2XQN M;  5D3V A;  4A6F B;  4A6K A;  2D11 A;  1Q67 A;  2RUK B;  2I1J A;  2MKR A;  4K2P A;  3F5R A;  2PZ1 A;  3U7D A;  2UZR A;  3PZD A;  3P7Z A;  4HB2 B;  1EAZ A;  4NSW A;  2DKQ A;  2MFQ A;  1E5W A;  1ZVR A;  1H10 A;  1TXD A;  3MPX A;  1FB8 A;  4ZRI A;  1OQN A;  1FGZ A;  3DXC A;  3OAN A;  3A8P A;  3D8E A;  3N7C A;  1MPH A;  4YL8 A;  1WI1 A;  4TKN A;  1M7R A;  1EF1 A;  4CYE A;  2H7D A;  1MK7 B;  1FHO A;  2YT1 A;  1P5T A;  4ZRJ A;  1J0W A;  1P6S A;  3KSY A;  4F7H A;  2CY4 A;  2UVM A;  4EKU A;  4PNK A;  2YS3 A;  2DYQ A;  2JP2 A;  3SUZ A;  4GXB A;  3TCA A;  1FAO A;  2G35 A;  2Z0P A;  4PQ0 A;  2ELB A;  1ZC4 B;  2DX1 A;  4HAZ B;  1UPR A;  2ROV A;  5HE2 A;  5HE1 A;  2DN6 A;  4D0N B;  1WGU A;  2ELA A;  2MDX A;  1DDV A;  1W1D A;  2DHK A;  4C0A A;  1GC6 A;  3SV1 A;  3VOQ A;  1MAI A;  2COD A;  3CIK A;  2Y8G A;  4Y94 A;  2DA0 A;  2KCJ A;  4KHO A;  5D3Y A;  5DHA B;  1LB1 A;  3V5W A;  3GYO A;  5JLJ B;  4HHV A;  4HAY B;  2LUL A;  5J3T A;  2RNR B;  1MIX A;  5GOW B;  1UNQ A;  1FGY A;  1BTN A;  5LON B;  2DTC A;  4EMO A;  3AU5 A;  4XWX A;  4A6F A;  3SNH A;  2P0H A;  2Z0Q A;  3TVV A;  4HAU B;  1FHX A;  5JP4 A;  1UNP A;  2COC A;  1WJM A;  2R0D A;  2X18 A;  3TW1 A;  2J0K A;  3A8Q A;  3X23 A;  5J3Q A;  3HK0 A;  2I1K A;  1SHC A;  5C16 A;  2YS5 A;  2J0M A;  3PVL A;  1WJ1 A;  1U5D A;  3PG7 A;  2DHJ A;  3MDB C;  2YVC A;  2H7E A;  2LYD A;  2OTX A;  1UEF A;  2VRW B;  4WSF A;  4KHB B;  5DH9 B;  2D9Y A;  2D9W A;  4HAW B;  2FJL A;  2CAY A;  2K2U A;  1DDM A;  3FEH A;  3KRW A;  1NI2 A;  3HW2 B;  4HB0 B;  3WA0 A;  1K5D B;  5JHG A;  2P0F A;  3HQC A;  1DYN A;  4GMX B;  3KY9 A;  2ROZ B;  3PVU A;  1I7A A;  1V88 A;  3PP2 A;  1KI1 B;  1XX0 A;  3ZVR A;  2VKI A;  3CXB B;  2M38 A;  4GPT B;  1MKE A;  1P3R A;  3AJ4 A;  2COA A;  1W1H A;  1MK9 B;  3PVW A;  3ODO A;  2D4Q A;  3AU4 A;  2RSG A;  3M1I B;  5DHF B;  4H8S A;  2D9X A;  4L6E A;  1NTV A;  1I2H A;  3VIA A;  5LOP B;  2J59 M;  1V5U A;  2DLW A;  3PEG A;  3SO6 A;  2YSZ A;  1ZSQ A;  2EJ8 A;  3G9W A;  4F7U P;  3IVF A;  1RRP B;  1V61 A;  5JHH A;  4A6H A;  5KQ1 A;  5C5B A;  2L1C A;  1X05 A;  2AEH A;  1TQZ A;  4DX8 A;  1FHW A;  3KRX A;  1BWN A;  5HE0 A;  2CY5 A;  4HB4 B;  2D10 A;  1OY2 A;  1XKE A;  4HDQ A;  1U5F A;  3FSS A;  1X11 A;  4DBB A;  4Z2N A; 
#chains in the Genus database with same CATH topology
 2ZPY A;  2V76 A;  3WYF B;  1RJ2 A;  2KIE A;  4HDO A;  2KUP A;  2GJY A;  2W2X D;  4D6W A;  1QQG A;  2KR0 A;  2YRY A;  2L2I A;  2OQB A;  3NW8 A;  3KZ1 A;  3RCP A;  3ULC A;  4CHM A;  2LG1 A;  4CHJ A;  1OMW A;  4Z2M B;  5FI1 A;  4B6H A;  4IOY X;  4OSN A;  1LW3 A;  3SYX A;  1PFJ A;  1KZ7 A;  4GN1 A;  2Z59 A;  1PLS A;  3DCX A;  2ADZ A;  2GCJ A;  5KCV A;  4IAP A;  1NU2 A;  2Z14 A;  5D3W A;  4HAV B;  3LJU X;  4KHB A;  4GNK B;  1H4R A;  2K00 A;  1QC6 A;  4QJ4 B;  2IFS A;  3PSC A;  1BTK A;  2DFK A;  4HB3 B;  5L81 A;  2LKO A;  4KVG B;  4TYZ A;  1AWE A;  4KAX B;  3TFM A;  4WJ7 A;  1M7E A;  3O96 A;  2GCL A;  2P8V A;  1U29 A;  1U5E A;  4P7I A;  2UZS A;  2W2X C;  4L1R A;  2NBV A;  5DI9 B;  5I2M A;  1U2B A;  3U12 A;  4DX9 0;  2DX5 A;  1BAK A;  1ISN A;  1B55 A;  1UPQ A;  2EMS A;  5EFX A;  3ODX A;  2Y8F A;  2KUQ A;  1ZC3 B;  1V5P A;  4EJN A;  3FVC A;  1U27 A;  1WG7 A;  1GC7 A;  3DXD A;  1XCG A;  2W2W A;  2DYN A;  3NSU A;  1X1G A;  1Z87 A;  1FOE A;  3ZDT A;  1TJ6 A;  2M14 A;  4QJ5 B;  2RGN B;  5CLL B;  3F0W A;  2K49 A;  2N23 A;  1X86 A;  1X1F A;  3D8D A;  2COF A;  3NWA A;  3U8Z A;  3BIN A;  2AL6 A;  2FJU B;  2RRF A;  4MT7 A;  2YT0 A;  1DRO A;  2NZ8 B;  5HE3 A;  1V89 A;  2E2X A;  1AQC A;  2VSZ A;  3ODW A;  2DHI A;  1KZG A;  2EMT A;  1XOD A;  2YF0 A;  4NY0 A;  1EVH A;  2Q13 A;  3QWM A;  5C79 A;  3D8F A;  2ZKM X;  4WVF B;  2MWN B;  2RLO A;  2IYB A;  1MIZ B;  2LOZ A;  5D27 A;  5DIF B;  2J0J A;  2D9Z A;  5D3X A;  2DKP A;  3QIJ A;  4K2O A;  2D9V A;  1ZYI A;  3T06 A;  3ML4 A;  3UZT A;  5CLQ B;  1XD4 A;  4HAX B;  2RVB B;  1K5G B;  2Z0O A;  1SGH A;  5KQ4 A;  2Y7B A;  4GMV A;  2D2Q A;  2N0Y A;  2LOX A;  2I5F A;  4GZU A;  4IFS A;  5C6R A;  4MK0 A;  1GG3 A;  4DXA B;  1N3H A;  2CRF A;  3BJI A;  5C5B B;  1T77 A;  4HAT B;  3FM8 C;  2P0D A;  3P6A A;  4YON A;  3DXE A;  3ULB A;  1NTY A;  1U5G A;  1Y19 B;  4ZRK A;  1J19 A;  3A98 B;  1Y5O A;  2HE7 A;  2EC1 A;  2GS0 A;  1ZM0 A;  4BBK A;  1XR0 B;  3TO1 A;  4MY6 A;  5J3Y A;  1PMS A;  2K2J A;  2K8E A;  3GYP A;  4KHA A;  1UNR A;  1WGQ A;  2I5C A;  2QKL A;  2BCJ A;  1IRS A;  1V5M A;  1W1G A;  4K81 A;  2YS1 A;  4F7G A;  5FI0 A;  4K17 A;  1DBH A;  3QBV B;  1EGX A;  2HTH B;  2NMB A;  2R09 A;  2QKM A;  1WVH A;  4A5K A;  1DDW A;  2KGX B;  2XQN M;  5D3V A;  4A6F B;  4A6K A;  2D11 A;  1Q67 A;  2RUK B;  2I1J A;  2MKR A;  4K2P A;  3F5R A;  2PZ1 A;  3U7D A;  2UZR A;  3PZD A;  5M4Y B;  3P7Z A;  4HB2 B;  1EAZ A;  4NSW A;  2DKQ A;  2MFQ A;  1E5W A;  1ZVR A;  1H10 A;  1TXD A;  3MPX A;  1FB8 A;  4ZRI A;  1OQN A;  1FGZ A;  3DXC A;  4OT1 A;  3OAN A;  3A8P A;  3D8E A;  3N7C A;  1MPH A;  4YL8 A;  1WI1 A;  4TKN A;  1M7R A;  1EF1 A;  4CYE A;  2H7D A;  1MK7 B;  1FHO A;  2YT1 A;  1P5T A;  4DIX A;  4ZRJ A;  1J0W A;  1P6S A;  3KSY A;  4F7H A;  2CY4 A;  2UVM A;  4QXA B;  4EKU A;  4PNK A;  2YS3 A;  2DYQ A;  2JP2 A;  3SUZ A;  4GXB A;  3TCA A;  1FAO A;  5I2S A;  2G35 A;  2Z0P A;  4PQ0 A;  2ELB A;  1ZC4 B;  2DX1 A;  4HAZ B;  1UPR A;  2ROV A;  5HE2 A;  5HE1 A;  2DN6 A;  4D0N B;  1WGU A;  2ELA A;  2MDX A;  1DDV A;  4HSI A;  1W1D A;  2DHK A;  3NWF A;  1GC6 A;  4C0A A;  3SV1 A;  3VOQ A;  1MAI A;  2COD A;  3CIK A;  4CSQ A;  2Y8G A;  4Y94 A;  2DA0 A;  2KCJ A;  4KHO A;  5D3Y A;  5DHA B;  1LB1 A;  3V5W A;  2R2Y A;  3GYO A;  2Z4D A;  5JLJ B;  5LG4 B;  4HHV A;  4HAY B;  2LUL A;  5J3T A;  2RNR B;  1MIX A;  5GOW B;  1UNQ A;  1FGY A;  5IRS A;  1BTN A;  5LON B;  2DTC A;  4EMO A;  3AU5 A;  4XWX A;  4A6F A;  3SNH A;  3B77 A;  2P0H A;  2Z0Q A;  3TVV A;  4HAU B;  1FHX A;  5JP4 A;  3A58 A;  1UNP A;  2COC A;  1WJM A;  2R0D A;  2X18 A;  3TW1 A;  2J0K A;  3A8Q A;  3X23 A;  5J3Q A;  3HK0 A;  1MI1 A;  2I1K A;  1SHC A;  5C16 A;  2YS5 A;  2J0M A;  3PVL A;  1WJ1 A;  1U5D A;  3HIE A;  3PG7 A;  2DHJ A;  3MDB C;  4QJ3 B;  2YVC A;  2H7E A;  2LYD A;  2OTX A;  1UEF A;  2VRW B;  4WSF A;  4KHB B;  5DH9 B;  2D9Y A;  2D9W A;  4HAW B;  2FJL A;  4GOU A;  2CAY A;  2K2U A;  1DDM A;  3FEH A;  3KRW A;  1NI2 A;  3HSA A;  3HW2 B;  4HB0 B;  3WA0 A;  1K5D B;  5JHG A;  2P0F A;  3HQC A;  2Z13 A;  1DYN A;  4GMX B;  3KY9 A;  2ROZ B;  3PVU A;  1I7A A;  1V88 A;  3NWD A;  1KI1 B;  1XX0 A;  3PP2 A;  3ZVR A;  2VKI A;  3CXB B;  2M38 A;  2YT2 A;  4GPT B;  1MKE A;  1P3R A;  3AJ4 A;  2COA A;  1W1H A;  1MK9 B;  3PVW A;  3ODO A;  2D4Q A;  3AU4 A;  2RSG A;  3M1I B;  2KIG A;  5DHF B;  3OHM B;  4H8S A;  2D9X A;  4L6E A;  1NTV A;  1I2H A;  3VIA A;  5LOP B;  2J59 M;  1V5U A;  2DLW A;  3PEG A;  3SO6 A;  2YSZ A;  1ZSQ A;  2EJ8 A;  3G9W A;  4F7U P;  3IVF A;  1RRP B;  1V61 A;  5JHH A;  4A6H A;  5KQ1 A;  5C5B A;  2L1C A;  1X05 A;  2AEH A;  1TQZ A;  4DX8 A;  1FHW A;  3KRX A;  1BWN A;  5HE0 A;  2CY5 A;  4HB4 B;  2D10 A;  1OY2 A;  1XKE A;  4HDQ A;  1U5F A;  2GUM A;  3FSS A;  1X11 A;  4DBB A;  4Z2N A; 
#chains in the Genus database with same CATH homology
 2ZPY A;  2V76 A;  3WYF B;  1RJ2 A;  4HDO A;  2KUP A;  2GJY A;  2W2X D;  1QQG A;  2YRY A;  2L2I A;  2OQB A;  3KZ1 A;  3RCP A;  3ULC A;  4CHM A;  2LG1 A;  4CHJ A;  1OMW A;  4Z2M B;  5FI1 A;  4B6H A;  4IOY X;  1LW3 A;  3SYX A;  1PFJ A;  1KZ7 A;  4GN1 A;  1PLS A;  2ADZ A;  2GCJ A;  5KCV A;  4IAP A;  1NU2 A;  5D3W A;  4HAV B;  3LJU X;  1H4R A;  2K00 A;  1QC6 A;  2IFS A;  3PSC A;  1BTK A;  2DFK A;  4HB3 B;  5L81 A;  2LKO A;  4KVG B;  4TYZ A;  1AWE A;  4KAX B;  3TFM A;  4WJ7 A;  1M7E A;  3O96 A;  2GCL A;  2P8V A;  1U29 A;  1U5E A;  4P7I A;  2UZS A;  2W2X C;  5DI9 B;  1U2B A;  4DX9 0;  2DX5 A;  1BAK A;  1ISN A;  1B55 A;  1UPQ A;  2EMS A;  5EFX A;  3ODX A;  2Y8F A;  1ZC3 B;  1V5P A;  4EJN A;  1U27 A;  1WG7 A;  1GC7 A;  3DXD A;  1XCG A;  2W2W A;  2DYN A;  3NSU A;  1X1G A;  1Z87 A;  1FOE A;  3ZDT A;  1TJ6 A;  2M14 A;  2RGN B;  5CLL B;  3F0W A;  2N23 A;  1X86 A;  1X1F A;  3D8D A;  2COF A;  3U8Z A;  3BIN A;  2AL6 A;  4MT7 A;  2YT0 A;  1DRO A;  2NZ8 B;  5HE3 A;  1V89 A;  2E2X A;  1AQC A;  2VSZ A;  3ODW A;  2DHI A;  1KZG A;  2EMT A;  1XOD A;  2YF0 A;  4NY0 A;  1EVH A;  2Q13 A;  3QWM A;  5C79 A;  3D8F A;  4WVF B;  2MWN B;  2RLO A;  2IYB A;  1MIZ B;  2LOZ A;  5D27 A;  5DIF B;  2J0J A;  2D9Z A;  5D3X A;  2DKP A;  3QIJ A;  4K2O A;  2D9V A;  3T06 A;  3ML4 A;  3UZT A;  5CLQ B;  1XD4 A;  4HAX B;  2RVB B;  1K5G B;  2Z0O A;  1SGH A;  5KQ4 A;  2Y7B A;  4GMV A;  2D2Q A;  2N0Y A;  2LOX A;  2I5F A;  4GZU A;  4IFS A;  5C6R A;  4MK0 A;  1GG3 A;  4DXA B;  1N3H A;  2CRF A;  3BJI A;  5C5B B;  4HAT B;  3FM8 C;  2P0D A;  3P6A A;  4YON A;  3DXE A;  3ULB A;  1NTY A;  1U5G A;  1Y19 B;  4ZRK A;  1J19 A;  3A98 B;  1Y5O A;  2HE7 A;  2EC1 A;  2GS0 A;  1ZM0 A;  4BBK A;  1XR0 B;  3TO1 A;  4MY6 A;  5J3Y A;  1PMS A;  2K2J A;  3GYP A;  4KHA A;  1UNR A;  1WGQ A;  2I5C A;  2QKL A;  2BCJ A;  1IRS A;  1V5M A;  1W1G A;  4K81 A;  2YS1 A;  4F7G A;  5FI0 A;  4K17 A;  1DBH A;  3QBV B;  1EGX A;  2HTH B;  2NMB A;  2R09 A;  2QKM A;  1WVH A;  4A5K A;  1DDW A;  2KGX B;  2XQN M;  5D3V A;  4A6F B;  4A6K A;  2D11 A;  1Q67 A;  2RUK B;  2I1J A;  2MKR A;  4K2P A;  3F5R A;  2PZ1 A;  3U7D A;  2UZR A;  3PZD A;  3P7Z A;  4HB2 B;  1EAZ A;  4NSW A;  2DKQ A;  2MFQ A;  1E5W A;  1ZVR A;  1H10 A;  1TXD A;  3MPX A;  1FB8 A;  4ZRI A;  1OQN A;  1FGZ A;  3DXC A;  3OAN A;  3A8P A;  3D8E A;  3N7C A;  1MPH A;  4YL8 A;  1WI1 A;  4TKN A;  1M7R A;  1EF1 A;  4CYE A;  2H7D A;  1MK7 B;  1FHO A;  2YT1 A;  1P5T A;  4ZRJ A;  1J0W A;  1P6S A;  3KSY A;  4F7H A;  2CY4 A;  2UVM A;  4EKU A;  4PNK A;  2YS3 A;  2DYQ A;  2JP2 A;  3SUZ A;  4GXB A;  3TCA A;  1FAO A;  2G35 A;  2Z0P A;  4PQ0 A;  2ELB A;  1ZC4 B;  2DX1 A;  4HAZ B;  1UPR A;  2ROV A;  5HE2 A;  5HE1 A;  2DN6 A;  4D0N B;  1WGU A;  2ELA A;  2MDX A;  1DDV A;  1W1D A;  2DHK A;  4C0A A;  1GC6 A;  3SV1 A;  3VOQ A;  1MAI A;  2COD A;  3CIK A;  2Y8G A;  4Y94 A;  2DA0 A;  2KCJ A;  4KHO A;  5D3Y A;  5DHA B;  1LB1 A;  3V5W A;  3GYO A;  5JLJ B;  4HHV A;  4HAY B;  2LUL A;  5J3T A;  2RNR B;  1MIX A;  5GOW B;  1UNQ A;  1FGY A;  1BTN A;  5LON B;  2DTC A;  4EMO A;  3AU5 A;  4XWX A;  4A6F A;  3SNH A;  2P0H A;  2Z0Q A;  3TVV A;  4HAU B;  1FHX A;  5JP4 A;  1UNP A;  2COC A;  1WJM A;  2R0D A;  2X18 A;  3TW1 A;  2J0K A;  3A8Q A;  3X23 A;  5J3Q A;  3HK0 A;  2I1K A;  1SHC A;  5C16 A;  2YS5 A;  2J0M A;  3PVL A;  1WJ1 A;  1U5D A;  3PG7 A;  2DHJ A;  3MDB C;  2YVC A;  2H7E A;  2LYD A;  2OTX A;  1UEF A;  2VRW B;  4WSF A;  4KHB B;  5DH9 B;  2D9Y A;  2D9W A;  4HAW B;  2FJL A;  2CAY A;  2K2U A;  1DDM A;  3FEH A;  3KRW A;  1NI2 A;  3HW2 B;  4HB0 B;  3WA0 A;  1K5D B;  5JHG A;  2P0F A;  3HQC A;  1DYN A;  4GMX B;  3KY9 A;  2ROZ B;  3PVU A;  1I7A A;  1V88 A;  3PP2 A;  1KI1 B;  1XX0 A;  3ZVR A;  2VKI A;  3CXB B;  2M38 A;  4GPT B;  1MKE A;  1P3R A;  3AJ4 A;  2COA A;  1W1H A;  1MK9 B;  3PVW A;  3ODO A;  2D4Q A;  3AU4 A;  2RSG A;  3M1I B;  5DHF B;  4H8S A;  2D9X A;  4L6E A;  1NTV A;  1I2H A;  3VIA A;  5LOP B;  2J59 M;  1V5U A;  2DLW A;  3PEG A;  3SO6 A;  2YSZ A;  1ZSQ A;  2EJ8 A;  3G9W A;  4F7U P;  3IVF A;  1RRP B;  1V61 A;  5JHH A;  4A6H A;  5KQ1 A;  5C5B A;  2L1C A;  1X05 A;  2AEH A;  1TQZ A;  4DX8 A;  1FHW A;  3KRX A;  1BWN A;  5HE0 A;  2CY5 A;  4HB4 B;  2D10 A;  1OY2 A;  1XKE A;  4HDQ A;  1U5F A;  3FSS A;  1X11 A;  4DBB A;  4Z2N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...