5DHAB

Crystal structure of cpeb4 nes reverse mutant peptide in complex with crm1-ran-ranbp1
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
136
structure length
127
Chain Sequence
FEPVTMEEDEEVLYKVRAKLFRFDADAKEWKERGTGDCKFLKNKKTNKVRILMRRDKTLKICANHIIAPEYTLKPNVGSDRSWVYACTADIAEGEAEAFTFAIRFGSKENADKFKEEFEKAQEINKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords GTP-binding nuclear protein Ran
publication title Structural determinants of nuclear export signal orientation in binding to exportin CRM1.
pubmed doi rcsb
source organism Homo sapiens
total genus 32
structure length 127
sequence length 136
ec nomenclature
pdb deposition date 2015-08-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00638 Ran_BP1 RanBP1 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 5dhaB00
3ULBA 4PQ0A 1U5GA 4EJNA 4F7UP 4WSFA 3FSSA 2YRYA 1FHXA 1I2HA 3FEHA 1U5FA 2M38A 4WVFB 1FAOA 1OMWA 1ISNA 3ODXA 2VSZA 5CLLB 1WJMA 1WGUA 1MPHA 4K81A 3IVFA 1WVHA 1V89A 2EMTA 2Q13A 1DDVA 2OTXA 2RSGA 1X86A 2QKMA 3DXDA 4CHJA 3KSYA 3SYXA 3V5WA 5C16A 2YS5A 4GXBA 4HATB 1KZGA 4KHAA 1X1GA 1K5DB 2CRFA 2YT1A 4A6HA 5C5BA 2RLOA 3PVUA 4F7HA 2X18A 3D8DA 5HE0A 2GS0A 1RRPB 1UEFA 2R09A 4CHMA 2CODA 3P6AA 1Y5OA 2DA0A 4MT7A 4HAWB 5DIFB 2D10A 2DN6A 2D11A 1XX0A 2GCLA 2DFKA 3A98B 1KI1B 1TXDA 2IYBA 1Q67A 2DHIA 4ZRIA 3ZDTA 2PZ1A 1FGZA 2YF0A 1FHOA 2UZSA 1I7AA 2EMSA 4WJ7A 1M7RA 2K2JA 3D8FA 3F0WA 4GMVA 1UPQA 2EC1A 4TYZA 2CAYA 1W1DA 1NTYA 2Y8FA 1B55A 1H10A 5LONB 2P0FA 3TVVA 4Z2NA 2LG1A 1OQNA 2LKOA 1BTKA 5HE2A 1ZM0A 2K00A 1ZC3B 2I5CA 3PEGA 3VIAA 2P8VA 3ODOA 2IFSA 3SNHA 3QIJA 3SUZA 1EF1A 2Z0OA 1DROA 4HHVA 1J19A 2D2QA 4A6KA 1UNQA 2KCJA 2ELAA 2RNRB 3F5RA 2Y8GA 2DHKA 4HB0B 3TO1A 3OANA 3WA0A 4HB4B 1PLSA 2Z0QA 1E5WA 4MY6A 2XQNM 5J3YA 2L1CA 1QQGA 1XODA 2QKLA 3WYFB 2FJLA 4ZRJA 1MKEA 3LJUX 5KQ4A 3UZTA 2K2UA 2N0YA 5DHAB 1M7EA 4HDQA 1V88A 4KVGB 3A8PA 2G35A 2D4QA 2L2IA 1P3RA 2RUKB 3A8QA 2ELBA 3PP2A 3QWMA 1GG3A 2YVCA 3T06A 5DH9B 5D3WA 5LOPB 4F7GA 4K2PA 2YT0A 1H4RA 3HK0A 2OQBA 1FOEA 1WJ1A 1WI1A 1UPRA 4ZRKA 4GN1A 4HB2B 1Z87A 3ML4A 4GPTB 4HAVB 1PFJA 3BINA 5DI9B 2GCJA 3KRWA 1MK9B 2V76A 1NTVA 5J3QA 4HDOA 3CIKA 2N23A 3AJ4A 1J0WA 1RJ2A 2DTCA 1W1HA 3M1IB 3ODWA 1V61A 5C5BB 2YSZA 1DYNA 2J0JA 2UVMA 1DBHA 3DXCA 2P0HA 4DBBA 1AWEA 2MKRA 3X23A 3ZVRA 3AU5A 4KAXB 3AU4A 1WG7A 3KZ1A 2CY4A 1ZVRA 3TCAA 5KQ1A 1EGXA 1MIXA 3PG7A 4L6EA 1K5GB 4IFSA 5D3VA 3NSUA 5JP4A 3GYOA 2DKQA 4XWXA 1LB1A 1DDMA 3U8ZA 1V5PA 5HE3A 1EVHA 3SV1A 3MDBC 1UNPA 2CY5A 1X11A 2M14A 2DX5A 1U5EA 5JLJB 2J0MA 1FB8A 2I1JA 1OY2A 3PVWA 2H7DA 2GJYA 4YL8A 2DYQA 4B6HA 2MWNB 1ZSQA 4H8SA 5J3TA 1QC6A 1WGQA 5KCVA 4GMXB 1U5DA 1BAKA 5GOWB 4KHBB 3O96A 1MAIA 4NSWA 4Y94A 3RCPA 3PZDA 4BBKA 1IRSA 2LYDA 1Y19B 2J59M 1W1GA 3N7CA 2HE7A 4HAZB 4GZUA 2VKIA 2H7EA 4HAXB 4HAYB 1U27A 1KZ7A 4HAUB 4A5KA 4K2OA 2LOXA 4DX8A 2DYNA 1U2BA 2W2XD 2W2XC 2UZRA 3DXEA 2RGNB 3PVLA 5HE1A 2AEHA 1BWNA 2D9WA 1P6SA 2DHJA 5D3XA 4TKNA 1TQZA 1V5MA 1FGYA 1LW3A 5CLQB 3FM8C 1NI2A 3U7DA 4IAPA 1AQCA 4PNKA 2HTHB 1BTNA 1EAZA 2Z0PA 2YS3A 2RVBB 1X05A 4MK0A 4NY0A 3PSCA 1ZC4B 4EKUA 2ROZB 1SHCA 1XD4A 3GYPA 1MIZB 2I5FA 2BCJA 1MK7B 5C6RA 4Z2MB 1TJ6A 2MDXA 2NMBA 4YONA 3P7ZA 5FI1A 1N3HA 2NZ8B 2AL6A 2ZPYA 5FI0A 4IOYX 5C79A 2MFQA 4A6FA 2COCA 2LOZA 1GC6A 3SO6A 1P5TA 3KRXA 1GC7A 2EJ8A 1DDWA 3D8EA 4HB3B 5D3YA 2ADZA 2JP2A 5JHGA 4EMOA 2I1KA 4KHOA 2ROVA 3VOQA 1XKEA 1NU2A 2COAA 1V5UA 1FHWA 1SGHA 4C0AA 2D9XA 1X1FA 4DX90 2Y7BA 3QBVB 3HW2B 1U29A 5L81A 5EFXA 3CXBB 2COFA 1XCGA 3G9WA 4A6FB 4D0NB 4DXAB 2P0DA 3HQCA 1UNRA 2YS1A 2D9VA 2DLWA 2D9ZA 4P7IA 2KUPA 3KY9A 3MPXA 5D27A 2VRWB 3TFMA 3BJIA 4K17A 2E2XA 2DKPA 2J0KA 3TW1A 1PMSA 5JHHA 2LULA 2D9YA 2R0DA 2KGXB 5DHFB 3ULCA 4CYEA 1XR0B 2DX1A 2W2WA
chains in the Genus database with same CATH superfamily
3ULBA 4PQ0A 1U5GA 4EJNA 4F7UP 4WSFA 3FSSA 2YRYA 1FHXA 1I2HA 3FEHA 1U5FA 2M38A 4WVFB 1FAOA 1OMWA 1ISNA 3ODXA 2VSZA 5CLLB 1WJMA 1WGUA 1MPHA 4K81A 3IVFA 2FJUB 1WVHA 1V89A 1T77A 2EMTA 2Q13A 1DDVA 2OTXA 2RSGA 1X86A 2QKMA 3DXDA 4CHJA 3KSYA 2KR0A 3OHMB 3SYXA 3V5WA 5C16A 2YS5A 4GXBA 4HATB 1KZGA 4KHAA 1X1GA 1K5DB 2CRFA 2YT1A 4A6HA 5C5BA 2RLOA 3PVUA 4F7HA 2X18A 3D8DA 5HE0A 2GS0A 2Z14A 1RRPB 1UEFA 2R09A 4CHMA 2CODA 3P6AA 1Y5OA 2DA0A 4MT7A 4HAWB 5DIFB 2D10A 2DN6A 4DIXA 2D11A 1XX0A 2GCLA 2DFKA 3A98B 1KI1B 1TXDA 2IYBA 1Q67A 2DHIA 4ZRIA 1MI1A 3ZDTA 2PZ1A 1FGZA 2YF0A 1FHOA 2UZSA 1I7AA 2EMSA 4WJ7A 4GOUA 1M7RA 2K2JA 3D8FA 3F0WA 4GMVA 1UPQA 2EC1A 4TYZA 2CAYA 1W1DA 1NTYA 2Y8FA 1B55A 1H10A 5LONB 2P0FA 3TVVA 4Z2NA 2LG1A 1OQNA 2LKOA 1BTKA 5HE2A 1ZM0A 2K00A 1ZC3B 2I5CA 3PEGA 3VIAA 2P8VA 3ODOA 2IFSA 3SNHA 3QIJA 3SUZA 1EF1A 2Z0OA 1DROA 4HHVA 5I2MA 1J19A 2D2QA 2ZKMX 1UNQA 2KCJA 4A6KA 2ELAA 1ZYIA 2RNRB 3F5RA 2Y8GA 2DHKA 4HB0B 3TO1A 3OANA 3WA0A 4HB4B 1PLSA 2Z0QA 1E5WA 4MY6A 2XQNM 5J3YA 2L1CA 1QQGA 1XODA 2QKLA 5LG4B 3WYFB 4OSNA 2FJLA 4ZRJA 1MKEA 3LJUX 5KQ4A 3UZTA 2K2UA 2N0YA 5DHAB 1M7EA 4HDQA 1V88A 4KVGB 3A8PA 2G35A 2D4QA 2L2IA 1P3RA 2RUKB 3A8QA 2ELBA 3PP2A 3U12A 3QWMA 1GG3A 3B77A 2YVCA 3NWFA 3T06A 5DH9B 5D3WA 5LOPB 4F7GA 2Z4DA 4K2PA 2YT0A 3HSAA 1H4RA 3HK0A 2OQBA 4L1RA 1FOEA 1WJ1A 1WI1A 3NWAA 1UPRA 4ZRKA 3NWDA 4GN1A 4HB2B 1Z87A 3ML4A 4GPTB 4HAVB 3DCXA 4QJ3B 1PFJA 3BINA 5DI9B 2GCJA 3KRWA 1MK9B 2V76A 1NTVA 5J3QA 2K8EA 4HDOA 3CIKA 2N23A 3AJ4A 1J0WA 1RJ2A 2DTCA 1W1HA 3M1IB 3ODWA 1V61A 5C5BB 2YSZA 1DYNA 2J0JA 2UVMA 1DBHA 3DXCA 2P0HA 4DBBA 2NBVA 1AWEA 2MKRA 3X23A 3ZVRA 3AU5A 4KAXB 4HSIA 3AU4A 1WG7A 3KZ1A 2CY4A 4CSQA 4KHBA 1ZVRA 3TCAA 5KQ1A 1EGXA 1MIXA 3PG7A 4L6EA 1K5GB 4IFSA 5D3VA 3NSUA 5JP4A 3GYOA 2DKQA 4OT1A 4XWXA 5IRSA 1LB1A 1DDMA 3U8ZA 1V5PA 5HE3A 1EVHA 3SV1A 3MDBC 1UNPA 2CY5A 1X11A 2M14A 2DX5A 4D6WA 1U5EA 5JLJB 2J0MA 1FB8A 2I1JA 1OY2A 3PVWA 2H7DA 2GJYA 4YL8A 2DYQA 4B6HA 2MWNB 1ZSQA 4H8SA 5J3TA 1QC6A 1WGQA 5KCVA 4GMXB 1U5DA 1BAKA 5GOWB 4KHBB 3O96A 1MAIA 2R2YA 4NSWA 4Y94A 3RCPA 3PZDA 4BBKA 1IRSA 2LYDA 1Y19B 2J59M 1W1GA 3N7CA 2HE7A 4HAZB 4GZUA 2VKIA 2H7EA 4HAXB 2K49A 4HAYB 1U27A 1KZ7A 4HAUB 4A5KA 4K2OA 2LOXA 4DX8A 2DYNA 1U2BA 2W2XD 2W2XC 2UZRA 3DXEA 2RGNB 3PVLA 5HE1A 2AEHA 1BWNA 2D9WA 1P6SA 2DHJA 5D3XA 4TKNA 1TQZA 1V5MA 1FGYA 2Z13A 2YT2A 1LW3A 5CLQB 3FM8C 1NI2A 3U7DA 4IAPA 1AQCA 4PNKA 2HTHB 1BTNA 1EAZA 2Z0PA 2Z59A 5M4YB 2YS3A 2RVBB 1X05A 4MK0A 4NY0A 3PSCA 1ZC4B 4EKUA 2ROZB 1SHCA 1XD4A 3GYPA 1MIZB 2I5FA 2BCJA 1MK7B 5C6RA 4Z2MB 1TJ6A 2MDXA 2NMBA 2KIGA 4YONA 4GNKB 3P7ZA 5FI1A 1N3HA 2NZ8B 2AL6A 4QJ4B 2ZPYA 5FI0A 4IOYX 5C79A 4QXAB 2MFQA 4A6FA 2COCA 2LOZA 4QJ5B 1GC6A 3HIEA 2KIEA 3SO6A 1P5TA 1GC7A 3KRXA 5I2SA 2EJ8A 1DDWA 3D8EA 4HB3B 5D3YA 2GUMA 2ADZA 2JP2A 5JHGA 4EMOA 2I1KA 4KHOA 2ROVA 3VOQA 1XKEA 1NU2A 2COAA 1V5UA 1FHWA 1SGHA 4C0AA 2D9XA 1X1FA 4DX90 2Y7BA 3QBVB 3HW2B 1U29A 5L81A 5EFXA 3CXBB 2COFA 1XCGA 2KUQA 3NW8A 3G9WA 3A58A 4A6FB 4D0NB 4DXAB 2P0DA 3HQCA 1UNRA 2YS1A 2D9VA 2DLWA 2D9ZA 4P7IA 2KUPA 3KY9A 3MPXA 5D27A 2VRWB 3TFMA 3BJIA 4K17A 2E2XA 2DKPA 2J0KA 3TW1A 2RRFA 1PMSA 5JHHA 2LULA 2D9YA 2R0DA 2KGXB 5DHFB 3ULCA 4CYEA 1XR0B 2DX1A 3FVCA 2W2WA
chains in the Genus database with same CATH topology
3ULBA 4PQ0A 1U5GA 4EJNA 4F7UP 4WSFA 3FSSA 2YRYA 1FHXA 1I2HA 3FEHA 1U5FA 2M38A 4WVFB 1FAOA 1OMWA 1ISNA 3ODXA 2VSZA 5CLLB 1WJMA 1WGUA 1MPHA 4K81A 3IVFA 1WVHA 1V89A 2EMTA 2Q13A 1DDVA 2OTXA 2RSGA 1X86A 2QKMA 3DXDA 4CHJA 3KSYA 3SYXA 3V5WA 5C16A 2YS5A 4GXBA 4HATB 1KZGA 4KHAA 1X1GA 1K5DB 2CRFA 2YT1A 4A6HA 5C5BA 2RLOA 3PVUA 4F7HA 2X18A 3D8DA 5HE0A 2GS0A 1RRPB 1UEFA 2R09A 4CHMA 2CODA 3P6AA 1Y5OA 2DA0A 4MT7A 4HAWB 5DIFB 2D10A 2DN6A 2D11A 1XX0A 2GCLA 2DFKA 3A98B 1KI1B 1TXDA 2IYBA 1Q67A 2DHIA 4ZRIA 3ZDTA 2PZ1A 1FGZA 2YF0A 1FHOA 2UZSA 1I7AA 2EMSA 4WJ7A 1M7RA 2K2JA 3D8FA 3F0WA 4GMVA 1UPQA 2EC1A 4TYZA 2CAYA 1W1DA 1NTYA 2Y8FA 1B55A 1H10A 5LONB 2P0FA 3TVVA 4Z2NA 2LG1A 1OQNA 2LKOA 1BTKA 5HE2A 1ZM0A 2K00A 1ZC3B 2I5CA 3PEGA 3VIAA 2P8VA 3ODOA 2IFSA 3SNHA 3QIJA 3SUZA 1EF1A 2Z0OA 1DROA 4HHVA 1J19A 2D2QA 4A6KA 1UNQA 2KCJA 2ELAA 2RNRB 3F5RA 2Y8GA 2DHKA 4HB0B 3TO1A 3OANA 3WA0A 4HB4B 1PLSA 2Z0QA 1E5WA 4MY6A 2XQNM 5J3YA 2L1CA 1QQGA 1XODA 2QKLA 3WYFB 2FJLA 4ZRJA 1MKEA 3LJUX 5KQ4A 3UZTA 2K2UA 2N0YA 5DHAB 1M7EA 4HDQA 1V88A 4KVGB 3A8PA 2G35A 2D4QA 2L2IA 1P3RA 2RUKB 3A8QA 2ELBA 3PP2A 3QWMA 1GG3A 2YVCA 3T06A 5DH9B 5D3WA 5LOPB 4F7GA 4K2PA 2YT0A 1H4RA 3HK0A 2OQBA 1FOEA 1WJ1A 1WI1A 1UPRA 4ZRKA 4GN1A 4HB2B 1Z87A 3ML4A 4GPTB 4HAVB 1PFJA 3BINA 5DI9B 2GCJA 3KRWA 1MK9B 2V76A 1NTVA 5J3QA 4HDOA 3CIKA 2N23A 3AJ4A 1J0WA 1RJ2A 2DTCA 1W1HA 3M1IB 3ODWA 1V61A 5C5BB 2YSZA 1DYNA 2J0JA 2UVMA 1DBHA 3DXCA 2P0HA 4DBBA 1AWEA 2MKRA 3X23A 3ZVRA 3AU5A 4KAXB 3AU4A 1WG7A 3KZ1A 2CY4A 1ZVRA 3TCAA 5KQ1A 1EGXA 1MIXA 3PG7A 4L6EA 1K5GB 4IFSA 5D3VA 3NSUA 5JP4A 3GYOA 2DKQA 4XWXA 1LB1A 1DDMA 3U8ZA 1V5PA 5HE3A 1EVHA 3SV1A 3MDBC 1UNPA 2CY5A 1X11A 2M14A 2DX5A 1U5EA 5JLJB 2J0MA 1FB8A 2I1JA 1OY2A 3PVWA 2H7DA 2GJYA 4YL8A 2DYQA 4B6HA 2MWNB 1ZSQA 4H8SA 5J3TA 1QC6A 1WGQA 5KCVA 4GMXB 1U5DA 1BAKA 5GOWB 4KHBB 3O96A 1MAIA 4NSWA 4Y94A 3RCPA 3PZDA 4BBKA 1IRSA 2LYDA 1Y19B 2J59M 1W1GA 3N7CA 2HE7A 4HAZB 4GZUA 2VKIA 2H7EA 4HAXB 4HAYB 1U27A 1KZ7A 4HAUB 4A5KA 4K2OA 2LOXA 4DX8A 2DYNA 1U2BA 2W2XD 2W2XC 2UZRA 3DXEA 2RGNB 3PVLA 5HE1A 2AEHA 1BWNA 2D9WA 1P6SA 2DHJA 5D3XA 4TKNA 1TQZA 1V5MA 1FGYA 1LW3A 5CLQB 3FM8C 1NI2A 3U7DA 4IAPA 1AQCA 4PNKA 2HTHB 1BTNA 1EAZA 2Z0PA 2YS3A 2RVBB 1X05A 4MK0A 4NY0A 3PSCA 1ZC4B 4EKUA 2ROZB 1SHCA 1XD4A 3GYPA 1MIZB 2I5FA 2BCJA 1MK7B 5C6RA 4Z2MB 1TJ6A 2MDXA 2NMBA 4YONA 3P7ZA 5FI1A 1N3HA 2NZ8B 2AL6A 2ZPYA 5FI0A 4IOYX 5C79A 2MFQA 4A6FA 2COCA 2LOZA 1GC6A 3SO6A 1P5TA 3KRXA 1GC7A 2EJ8A 1DDWA 3D8EA 4HB3B 5D3YA 2ADZA 2JP2A 5JHGA 4EMOA 2I1KA 4KHOA 2ROVA 3VOQA 1XKEA 1NU2A 2COAA 1V5UA 1FHWA 1SGHA 4C0AA 2D9XA 1X1FA 4DX90 2Y7BA 3QBVB 3HW2B 1U29A 5L81A 5EFXA 3CXBB 2COFA 1XCGA 3G9WA 4A6FB 4D0NB 4DXAB 2P0DA 3HQCA 1UNRA 2YS1A 2D9VA 2DLWA 2D9ZA 4P7IA 2KUPA 3KY9A 3MPXA 5D27A 2VRWB 3TFMA 3BJIA 4K17A 2E2XA 2DKPA 2J0KA 3TW1A 1PMSA 5JHHA 2LULA 2D9YA 2R0DA 2KGXB 5DHFB 3ULCA 4CYEA 1XR0B 2DX1A 2W2WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ULB A;  4PQ0 A;  1U5G A;  4EJN A;  4F7U P;  4WSF A;  3FSS A;  2YRY A;  1FHX A;  1I2H A;  3FEH A;  1U5F A;  2M38 A;  4WVF B;  1FAO A;  1OMW A;  1ISN A;  3ODX A;  2VSZ A;  5CLL B;  1WJM A;  1WGU A;  1MPH A;  4K81 A;  3IVF A;  1WVH A;  1V89 A;  2EMT A;  2Q13 A;  1DDV A;  2OTX A;  2RSG A;  1X86 A;  2QKM A;  3DXD A;  4CHJ A;  3KSY A;  3SYX A;  3V5W A;  5C16 A;  2YS5 A;  4GXB A;  4HAT B;  1KZG A;  4KHA A;  1X1G A;  1K5D B;  2CRF A;  2YT1 A;  4A6H A;  5C5B A;  2RLO A;  3PVU A;  4F7H A;  2X18 A;  3D8D A;  5HE0 A;  2GS0 A;  1RRP B;  1UEF A;  2R09 A;  4CHM A;  2COD A;  3P6A A;  1Y5O A;  2DA0 A;  4MT7 A;  4HAW B;  5DIF B;  2D10 A;  2DN6 A;  2D11 A;  1XX0 A;  2GCL A;  2DFK A;  3A98 B;  1KI1 B;  1TXD A;  2IYB A;  1Q67 A;  2DHI A;  4ZRI A;  3ZDT A;  2PZ1 A;  1FGZ A;  2YF0 A;  1FHO A;  2UZS A;  1I7A A;  2EMS A;  4WJ7 A;  1M7R A;  2K2J A;  3D8F A;  3F0W A;  4GMV A;  1UPQ A;  2EC1 A;  4TYZ A;  2CAY A;  1W1D A;  1NTY A;  2Y8F A;  1B55 A;  1H10 A;  5LON B;  2P0F A;  3TVV A;  4Z2N A;  2LG1 A;  1OQN A;  2LKO A;  1BTK A;  5HE2 A;  1ZM0 A;  2K00 A;  1ZC3 B;  2I5C A;  3PEG A;  3VIA A;  2P8V A;  3ODO A;  2IFS A;  3SNH A;  3QIJ A;  3SUZ A;  1EF1 A;  2Z0O A;  1DRO A;  4HHV A;  1J19 A;  2D2Q A;  4A6K A;  1UNQ A;  2KCJ A;  2ELA A;  2RNR B;  3F5R A;  2Y8G A;  2DHK A;  4HB0 B;  3TO1 A;  3OAN A;  3WA0 A;  4HB4 B;  1PLS A;  2Z0Q A;  1E5W A;  4MY6 A;  2XQN M;  5J3Y A;  2L1C A;  1QQG A;  1XOD A;  2QKL A;  3WYF B;  2FJL A;  4ZRJ A;  1MKE A;  3LJU X;  5KQ4 A;  3UZT A;  2K2U A;  2N0Y A;  5DHA B;  1M7E A;  4HDQ A;  1V88 A;  4KVG B;  3A8P A;  2G35 A;  2D4Q A;  2L2I A;  1P3R A;  2RUK B;  3A8Q A;  2ELB A;  3PP2 A;  3QWM A;  1GG3 A;  2YVC A;  3T06 A;  5DH9 B;  5D3W A;  5LOP B;  4F7G A;  4K2P A;  2YT0 A;  1H4R A;  3HK0 A;  2OQB A;  1FOE A;  1WJ1 A;  1WI1 A;  1UPR A;  4ZRK A;  4GN1 A;  4HB2 B;  1Z87 A;  3ML4 A;  4GPT B;  4HAV B;  1PFJ A;  3BIN A;  5DI9 B;  2GCJ A;  3KRW A;  1MK9 B;  2V76 A;  1NTV A;  5J3Q A;  4HDO A;  3CIK A;  2N23 A;  3AJ4 A;  1J0W A;  1RJ2 A;  2DTC A;  1W1H A;  3M1I B;  3ODW A;  1V61 A;  5C5B B;  2YSZ A;  1DYN A;  2J0J A;  2UVM A;  1DBH A;  3DXC A;  2P0H A;  4DBB A;  1AWE A;  2MKR A;  3X23 A;  3ZVR A;  3AU5 A;  4KAX B;  3AU4 A;  1WG7 A;  3KZ1 A;  2CY4 A;  1ZVR A;  3TCA A;  5KQ1 A;  1EGX A;  1MIX A;  3PG7 A;  4L6E A;  1K5G B;  4IFS A;  5D3V A;  3NSU A;  5JP4 A;  3GYO A;  2DKQ A;  4XWX A;  1LB1 A;  1DDM A;  3U8Z A;  1V5P A;  5HE3 A;  1EVH A;  3SV1 A;  3MDB C;  1UNP A;  2CY5 A;  1X11 A;  2M14 A;  2DX5 A;  1U5E A;  5JLJ B;  2J0M A;  1FB8 A;  2I1J A;  1OY2 A;  3PVW A;  2H7D A;  2GJY A;  4YL8 A;  2DYQ A;  4B6H A;  2MWN B;  1ZSQ A;  4H8S A;  5J3T A;  1QC6 A;  1WGQ A;  5KCV A;  4GMX B;  1U5D A;  1BAK A;  5GOW B;  4KHB B;  3O96 A;  1MAI A;  4NSW A;  4Y94 A;  3RCP A;  3PZD A;  4BBK A;  1IRS A;  2LYD A;  1Y19 B;  2J59 M;  1W1G A;  3N7C A;  2HE7 A;  4HAZ B;  4GZU A;  2VKI A;  2H7E A;  4HAX B;  4HAY B;  1U27 A;  1KZ7 A;  4HAU B;  4A5K A;  4K2O A;  2LOX A;  4DX8 A;  2DYN A;  1U2B A;  2W2X D;  2W2X C;  2UZR A;  3DXE A;  2RGN B;  3PVL A;  5HE1 A;  2AEH A;  1BWN A;  2D9W A;  1P6S A;  2DHJ A;  5D3X A;  4TKN A;  1TQZ A;  1V5M A;  1FGY A;  1LW3 A;  5CLQ B;  3FM8 C;  1NI2 A;  3U7D A;  4IAP A;  1AQC A;  4PNK A;  2HTH B;  1BTN A;  1EAZ A;  2Z0P A;  2YS3 A;  2RVB B;  1X05 A;  4MK0 A;  4NY0 A;  3PSC A;  1ZC4 B;  4EKU A;  2ROZ B;  1SHC A;  1XD4 A;  3GYP A;  1MIZ B;  2I5F A;  2BCJ A;  1MK7 B;  5C6R A;  4Z2M B;  1TJ6 A;  2MDX A;  2NMB A;  4YON A;  3P7Z A;  5FI1 A;  1N3H A;  2NZ8 B;  2AL6 A;  2ZPY A;  5FI0 A;  4IOY X;  5C79 A;  2MFQ A;  4A6F A;  2COC A;  2LOZ A;  1GC6 A;  3SO6 A;  1P5T A;  3KRX A;  1GC7 A;  2EJ8 A;  1DDW A;  3D8E A;  4HB3 B;  5D3Y A;  2ADZ A;  2JP2 A;  5JHG A;  4EMO A;  2I1K A;  4KHO A;  2ROV A;  3VOQ A;  1XKE A;  1NU2 A;  2COA A;  1V5U A;  1FHW A;  1SGH A;  4C0A A;  2D9X A;  1X1F A;  4DX9 0;  2Y7B A;  3QBV B;  3HW2 B;  1U29 A;  5L81 A;  5EFX A;  3CXB B;  2COF A;  1XCG A;  3G9W A;  4A6F B;  4D0N B;  4DXA B;  2P0D A;  3HQC A;  1UNR A;  2YS1 A;  2D9V A;  2DLW A;  2D9Z A;  4P7I A;  2KUP A;  3KY9 A;  3MPX A;  5D27 A;  2VRW B;  3TFM A;  3BJI A;  4K17 A;  2E2X A;  2DKP A;  2J0K A;  3TW1 A;  1PMS A;  5JHH A;  2LUL A;  2D9Y A;  2R0D A;  2KGX B;  5DHF B;  3ULC A;  4CYE A;  1XR0 B;  2DX1 A;  2W2W A; 
#chains in the Genus database with same CATH topology
 3ULB A;  4PQ0 A;  1U5G A;  4EJN A;  4F7U P;  4WSF A;  3FSS A;  2YRY A;  1FHX A;  1I2H A;  3FEH A;  1U5F A;  2M38 A;  4WVF B;  1FAO A;  1OMW A;  1ISN A;  3ODX A;  2VSZ A;  5CLL B;  1WJM A;  1WGU A;  1MPH A;  4K81 A;  3IVF A;  2FJU B;  1WVH A;  1V89 A;  1T77 A;  2EMT A;  2Q13 A;  1DDV A;  2OTX A;  2RSG A;  1X86 A;  2QKM A;  3DXD A;  4CHJ A;  3KSY A;  2KR0 A;  3OHM B;  3SYX A;  3V5W A;  5C16 A;  2YS5 A;  4GXB A;  4HAT B;  1KZG A;  4KHA A;  1X1G A;  1K5D B;  2CRF A;  2YT1 A;  4A6H A;  5C5B A;  2RLO A;  3PVU A;  4F7H A;  2X18 A;  3D8D A;  5HE0 A;  2GS0 A;  2Z14 A;  1RRP B;  1UEF A;  2R09 A;  4CHM A;  2COD A;  3P6A A;  1Y5O A;  2DA0 A;  4MT7 A;  4HAW B;  5DIF B;  2D10 A;  2DN6 A;  4DIX A;  2D11 A;  1XX0 A;  2GCL A;  2DFK A;  3A98 B;  1KI1 B;  1TXD A;  2IYB A;  1Q67 A;  2DHI A;  4ZRI A;  1MI1 A;  3ZDT A;  2PZ1 A;  1FGZ A;  2YF0 A;  1FHO A;  2UZS A;  1I7A A;  2EMS A;  4WJ7 A;  4GOU A;  1M7R A;  2K2J A;  3D8F A;  3F0W A;  4GMV A;  1UPQ A;  2EC1 A;  4TYZ A;  2CAY A;  1W1D A;  1NTY A;  2Y8F A;  1B55 A;  1H10 A;  5LON B;  2P0F A;  3TVV A;  4Z2N A;  2LG1 A;  1OQN A;  2LKO A;  1BTK A;  5HE2 A;  1ZM0 A;  2K00 A;  1ZC3 B;  2I5C A;  3PEG A;  3VIA A;  2P8V A;  3ODO A;  2IFS A;  3SNH A;  3QIJ A;  3SUZ A;  1EF1 A;  2Z0O A;  1DRO A;  4HHV A;  5I2M A;  1J19 A;  2D2Q A;  2ZKM X;  1UNQ A;  2KCJ A;  4A6K A;  2ELA A;  1ZYI A;  2RNR B;  3F5R A;  2Y8G A;  2DHK A;  4HB0 B;  3TO1 A;  3OAN A;  3WA0 A;  4HB4 B;  1PLS A;  2Z0Q A;  1E5W A;  4MY6 A;  2XQN M;  5J3Y A;  2L1C A;  1QQG A;  1XOD A;  2QKL A;  5LG4 B;  3WYF B;  4OSN A;  2FJL A;  4ZRJ A;  1MKE A;  3LJU X;  5KQ4 A;  3UZT A;  2K2U A;  2N0Y A;  5DHA B;  1M7E A;  4HDQ A;  1V88 A;  4KVG B;  3A8P A;  2G35 A;  2D4Q A;  2L2I A;  1P3R A;  2RUK B;  3A8Q A;  2ELB A;  3PP2 A;  3U12 A;  3QWM A;  1GG3 A;  3B77 A;  2YVC A;  3NWF A;  3T06 A;  5DH9 B;  5D3W A;  5LOP B;  4F7G A;  2Z4D A;  4K2P A;  2YT0 A;  3HSA A;  1H4R A;  3HK0 A;  2OQB A;  4L1R A;  1FOE A;  1WJ1 A;  1WI1 A;  3NWA A;  1UPR A;  4ZRK A;  3NWD A;  4GN1 A;  4HB2 B;  1Z87 A;  3ML4 A;  4GPT B;  4HAV B;  3DCX A;  4QJ3 B;  1PFJ A;  3BIN A;  5DI9 B;  2GCJ A;  3KRW A;  1MK9 B;  2V76 A;  1NTV A;  5J3Q A;  2K8E A;  4HDO A;  3CIK A;  2N23 A;  3AJ4 A;  1J0W A;  1RJ2 A;  2DTC A;  1W1H A;  3M1I B;  3ODW A;  1V61 A;  5C5B B;  2YSZ A;  1DYN A;  2J0J A;  2UVM A;  1DBH A;  3DXC A;  2P0H A;  4DBB A;  2NBV A;  1AWE A;  2MKR A;  3X23 A;  3ZVR A;  3AU5 A;  4KAX B;  4HSI A;  3AU4 A;  1WG7 A;  3KZ1 A;  2CY4 A;  4CSQ A;  4KHB A;  1ZVR A;  3TCA A;  5KQ1 A;  1EGX A;  1MIX A;  3PG7 A;  4L6E A;  1K5G B;  4IFS A;  5D3V A;  3NSU A;  5JP4 A;  3GYO A;  2DKQ A;  4OT1 A;  4XWX A;  5IRS A;  1LB1 A;  1DDM A;  3U8Z A;  1V5P A;  5HE3 A;  1EVH A;  3SV1 A;  3MDB C;  1UNP A;  2CY5 A;  1X11 A;  2M14 A;  2DX5 A;  4D6W A;  1U5E A;  5JLJ B;  2J0M A;  1FB8 A;  2I1J A;  1OY2 A;  3PVW A;  2H7D A;  2GJY A;  4YL8 A;  2DYQ A;  4B6H A;  2MWN B;  1ZSQ A;  4H8S A;  5J3T A;  1QC6 A;  1WGQ A;  5KCV A;  4GMX B;  1U5D A;  1BAK A;  5GOW B;  4KHB B;  3O96 A;  1MAI A;  2R2Y A;  4NSW A;  4Y94 A;  3RCP A;  3PZD A;  4BBK A;  1IRS A;  2LYD A;  1Y19 B;  2J59 M;  1W1G A;  3N7C A;  2HE7 A;  4HAZ B;  4GZU A;  2VKI A;  2H7E A;  4HAX B;  2K49 A;  4HAY B;  1U27 A;  1KZ7 A;  4HAU B;  4A5K A;  4K2O A;  2LOX A;  4DX8 A;  2DYN A;  1U2B A;  2W2X D;  2W2X C;  2UZR A;  3DXE A;  2RGN B;  3PVL A;  5HE1 A;  2AEH A;  1BWN A;  2D9W A;  1P6S A;  2DHJ A;  5D3X A;  4TKN A;  1TQZ A;  1V5M A;  1FGY A;  2Z13 A;  2YT2 A;  1LW3 A;  5CLQ B;  3FM8 C;  1NI2 A;  3U7D A;  4IAP A;  1AQC A;  4PNK A;  2HTH B;  1BTN A;  1EAZ A;  2Z0P A;  2Z59 A;  5M4Y B;  2YS3 A;  2RVB B;  1X05 A;  4MK0 A;  4NY0 A;  3PSC A;  1ZC4 B;  4EKU A;  2ROZ B;  1SHC A;  1XD4 A;  3GYP A;  1MIZ B;  2I5F A;  2BCJ A;  1MK7 B;  5C6R A;  4Z2M B;  1TJ6 A;  2MDX A;  2NMB A;  2KIG A;  4YON A;  4GNK B;  3P7Z A;  5FI1 A;  1N3H A;  2NZ8 B;  2AL6 A;  4QJ4 B;  2ZPY A;  5FI0 A;  4IOY X;  5C79 A;  4QXA B;  2MFQ A;  4A6F A;  2COC A;  2LOZ A;  4QJ5 B;  1GC6 A;  3HIE A;  2KIE A;  3SO6 A;  1P5T A;  1GC7 A;  3KRX A;  5I2S A;  2EJ8 A;  1DDW A;  3D8E A;  4HB3 B;  5D3Y A;  2GUM A;  2ADZ A;  2JP2 A;  5JHG A;  4EMO A;  2I1K A;  4KHO A;  2ROV A;  3VOQ A;  1XKE A;  1NU2 A;  2COA A;  1V5U A;  1FHW A;  1SGH A;  4C0A A;  2D9X A;  1X1F A;  4DX9 0;  2Y7B A;  3QBV B;  3HW2 B;  1U29 A;  5L81 A;  5EFX A;  3CXB B;  2COF A;  1XCG A;  2KUQ A;  3NW8 A;  3G9W A;  3A58 A;  4A6F B;  4D0N B;  4DXA B;  2P0D A;  3HQC A;  1UNR A;  2YS1 A;  2D9V A;  2DLW A;  2D9Z A;  4P7I A;  2KUP A;  3KY9 A;  3MPX A;  5D27 A;  2VRW B;  3TFM A;  3BJI A;  4K17 A;  2E2X A;  2DKP A;  2J0K A;  3TW1 A;  2RRF A;  1PMS A;  5JHH A;  2LUL A;  2D9Y A;  2R0D A;  2KGX B;  5DHF B;  3ULC A;  4CYE A;  1XR0 B;  2DX1 A;  3FVC A;  2W2W A; 
#chains in the Genus database with same CATH homology
 3ULB A;  4PQ0 A;  1U5G A;  4EJN A;  4F7U P;  4WSF A;  3FSS A;  2YRY A;  1FHX A;  1I2H A;  3FEH A;  1U5F A;  2M38 A;  4WVF B;  1FAO A;  1OMW A;  1ISN A;  3ODX A;  2VSZ A;  5CLL B;  1WJM A;  1WGU A;  1MPH A;  4K81 A;  3IVF A;  1WVH A;  1V89 A;  2EMT A;  2Q13 A;  1DDV A;  2OTX A;  2RSG A;  1X86 A;  2QKM A;  3DXD A;  4CHJ A;  3KSY A;  3SYX A;  3V5W A;  5C16 A;  2YS5 A;  4GXB A;  4HAT B;  1KZG A;  4KHA A;  1X1G A;  1K5D B;  2CRF A;  2YT1 A;  4A6H A;  5C5B A;  2RLO A;  3PVU A;  4F7H A;  2X18 A;  3D8D A;  5HE0 A;  2GS0 A;  1RRP B;  1UEF A;  2R09 A;  4CHM A;  2COD A;  3P6A A;  1Y5O A;  2DA0 A;  4MT7 A;  4HAW B;  5DIF B;  2D10 A;  2DN6 A;  2D11 A;  1XX0 A;  2GCL A;  2DFK A;  3A98 B;  1KI1 B;  1TXD A;  2IYB A;  1Q67 A;  2DHI A;  4ZRI A;  3ZDT A;  2PZ1 A;  1FGZ A;  2YF0 A;  1FHO A;  2UZS A;  1I7A A;  2EMS A;  4WJ7 A;  1M7R A;  2K2J A;  3D8F A;  3F0W A;  4GMV A;  1UPQ A;  2EC1 A;  4TYZ A;  2CAY A;  1W1D A;  1NTY A;  2Y8F A;  1B55 A;  1H10 A;  5LON B;  2P0F A;  3TVV A;  4Z2N A;  2LG1 A;  1OQN A;  2LKO A;  1BTK A;  5HE2 A;  1ZM0 A;  2K00 A;  1ZC3 B;  2I5C A;  3PEG A;  3VIA A;  2P8V A;  3ODO A;  2IFS A;  3SNH A;  3QIJ A;  3SUZ A;  1EF1 A;  2Z0O A;  1DRO A;  4HHV A;  1J19 A;  2D2Q A;  4A6K A;  1UNQ A;  2KCJ A;  2ELA A;  2RNR B;  3F5R A;  2Y8G A;  2DHK A;  4HB0 B;  3TO1 A;  3OAN A;  3WA0 A;  4HB4 B;  1PLS A;  2Z0Q A;  1E5W A;  4MY6 A;  2XQN M;  5J3Y A;  2L1C A;  1QQG A;  1XOD A;  2QKL A;  3WYF B;  2FJL A;  4ZRJ A;  1MKE A;  3LJU X;  5KQ4 A;  3UZT A;  2K2U A;  2N0Y A;  5DHA B;  1M7E A;  4HDQ A;  1V88 A;  4KVG B;  3A8P A;  2G35 A;  2D4Q A;  2L2I A;  1P3R A;  2RUK B;  3A8Q A;  2ELB A;  3PP2 A;  3QWM A;  1GG3 A;  2YVC A;  3T06 A;  5DH9 B;  5D3W A;  5LOP B;  4F7G A;  4K2P A;  2YT0 A;  1H4R A;  3HK0 A;  2OQB A;  1FOE A;  1WJ1 A;  1WI1 A;  1UPR A;  4ZRK A;  4GN1 A;  4HB2 B;  1Z87 A;  3ML4 A;  4GPT B;  4HAV B;  1PFJ A;  3BIN A;  5DI9 B;  2GCJ A;  3KRW A;  1MK9 B;  2V76 A;  1NTV A;  5J3Q A;  4HDO A;  3CIK A;  2N23 A;  3AJ4 A;  1J0W A;  1RJ2 A;  2DTC A;  1W1H A;  3M1I B;  3ODW A;  1V61 A;  5C5B B;  2YSZ A;  1DYN A;  2J0J A;  2UVM A;  1DBH A;  3DXC A;  2P0H A;  4DBB A;  1AWE A;  2MKR A;  3X23 A;  3ZVR A;  3AU5 A;  4KAX B;  3AU4 A;  1WG7 A;  3KZ1 A;  2CY4 A;  1ZVR A;  3TCA A;  5KQ1 A;  1EGX A;  1MIX A;  3PG7 A;  4L6E A;  1K5G B;  4IFS A;  5D3V A;  3NSU A;  5JP4 A;  3GYO A;  2DKQ A;  4XWX A;  1LB1 A;  1DDM A;  3U8Z A;  1V5P A;  5HE3 A;  1EVH A;  3SV1 A;  3MDB C;  1UNP A;  2CY5 A;  1X11 A;  2M14 A;  2DX5 A;  1U5E A;  5JLJ B;  2J0M A;  1FB8 A;  2I1J A;  1OY2 A;  3PVW A;  2H7D A;  2GJY A;  4YL8 A;  2DYQ A;  4B6H A;  2MWN B;  1ZSQ A;  4H8S A;  5J3T A;  1QC6 A;  1WGQ A;  5KCV A;  4GMX B;  1U5D A;  1BAK A;  5GOW B;  4KHB B;  3O96 A;  1MAI A;  4NSW A;  4Y94 A;  3RCP A;  3PZD A;  4BBK A;  1IRS A;  2LYD A;  1Y19 B;  2J59 M;  1W1G A;  3N7C A;  2HE7 A;  4HAZ B;  4GZU A;  2VKI A;  2H7E A;  4HAX B;  4HAY B;  1U27 A;  1KZ7 A;  4HAU B;  4A5K A;  4K2O A;  2LOX A;  4DX8 A;  2DYN A;  1U2B A;  2W2X D;  2W2X C;  2UZR A;  3DXE A;  2RGN B;  3PVL A;  5HE1 A;  2AEH A;  1BWN A;  2D9W A;  1P6S A;  2DHJ A;  5D3X A;  4TKN A;  1TQZ A;  1V5M A;  1FGY A;  1LW3 A;  5CLQ B;  3FM8 C;  1NI2 A;  3U7D A;  4IAP A;  1AQC A;  4PNK A;  2HTH B;  1BTN A;  1EAZ A;  2Z0P A;  2YS3 A;  2RVB B;  1X05 A;  4MK0 A;  4NY0 A;  3PSC A;  1ZC4 B;  4EKU A;  2ROZ B;  1SHC A;  1XD4 A;  3GYP A;  1MIZ B;  2I5F A;  2BCJ A;  1MK7 B;  5C6R A;  4Z2M B;  1TJ6 A;  2MDX A;  2NMB A;  4YON A;  3P7Z A;  5FI1 A;  1N3H A;  2NZ8 B;  2AL6 A;  2ZPY A;  5FI0 A;  4IOY X;  5C79 A;  2MFQ A;  4A6F A;  2COC A;  2LOZ A;  1GC6 A;  3SO6 A;  1P5T A;  3KRX A;  1GC7 A;  2EJ8 A;  1DDW A;  3D8E A;  4HB3 B;  5D3Y A;  2ADZ A;  2JP2 A;  5JHG A;  4EMO A;  2I1K A;  4KHO A;  2ROV A;  3VOQ A;  1XKE A;  1NU2 A;  2COA A;  1V5U A;  1FHW A;  1SGH A;  4C0A A;  2D9X A;  1X1F A;  4DX9 0;  2Y7B A;  3QBV B;  3HW2 B;  1U29 A;  5L81 A;  5EFX A;  3CXB B;  2COF A;  1XCG A;  3G9W A;  4A6F B;  4D0N B;  4DXA B;  2P0D A;  3HQC A;  1UNR A;  2YS1 A;  2D9V A;  2DLW A;  2D9Z A;  4P7I A;  2KUP A;  3KY9 A;  3MPX A;  5D27 A;  2VRW B;  3TFM A;  3BJI A;  4K17 A;  2E2X A;  2DKP A;  2J0K A;  3TW1 A;  1PMS A;  5JHH A;  2LUL A;  2D9Y A;  2R0D A;  2KGX B;  5DHF B;  3ULC A;  4CYE A;  1XR0 B;  2DX1 A;  2W2W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...