1U27A

Triglycine variant of the arno pleckstrin homology domain in complex with ins(1,3,4,5)p4
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
119
structure length
119
Chain Sequence
PDREGWLLKLGGGRVKTWKRRWFILTDNCLYYFEYTTDKEPRGIIPLENLSIREVDDPRKPNCFELYIPNNKGQLIKACKTEADGRVVEGNHMVYRISAPTQEEKDEWIKSIQAAVSVD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Lipid binding protein
molecule keywords Cytohesin 2
publication title Structural determinants of phosphoinositide selectivity in splice variants of Grp1 family PH domains
pubmed doi rcsb
source organism Mus musculus
total genus 22
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2004-07-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00169 PH PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1u27A00
2DN6A 4EJNA 5HE2A 1FHXA 3D8FA 4NSWA 1IRSA 1Q67A 1DYNA 2J0KA 4K2PA 5JP4A 1V5MA 3VOQA 1K5DB 2Z0OA 1KZ7A 2OQBA 5JLJB 1FHOA 5J3TA 5LONB 4IFSA 2YS5A 1X1FA 4GMVA 4XWXA 1WVHA 4Z2NA 1M7RA 2ROVA 3D8DA 1WJ1A 1FGZA 2DHJA 5J3QA 2GS0A 2D9VA 2HE7A 2I5FA 2RUKB 3A8QA 2ELBA 2GJYA 5DHAB 5KCVA 3TFMA 2COCA 1H10A 2CY4A 2FJLA 4EMOA 3M1IB 3SUZA 4D0NB 2K2UA 1PFJA 4BBKA 1MPHA 1ZC3B 2R09A 2J0MA 1GC6A 1WGQA 3BINA 5D3VA 2RSGA 2Q13A 1UNQA 3ULCA 1AWEA 2IFSA 2ADZA 4F7GA 2EMTA 4GXBA 4TKNA 2ZPYA 4HAUB 1WG7A 1DROA 3TW1A 3V5WA 5EFXA 4A6FA 1DBHA 1V61A 1WGUA 2D10A 3DXEA 4CHMA 2DFKA 2DA0A 1MKEA 4WSFA 1U2BA 2LKOA 4F7HA 2MFQA 2MKRA 2L2IA 3HW2B 2IYBA 3AU5A 2RNRB 3VIAA 2J59M 3AJ4A 5D3WA 2RLOA 5CLQB 1XKEA 2DTCA 5C16A 3UZTA 2X18A 4L6EA 1BTNA 2HTHB 1KZGA 2D9ZA 2DLWA 2KGXB 1EVHA 2DKQA 3ODWA 2CODA 4K81A 1UEFA 2GCJA 3PSCA 2EMSA 4KHBB 4WJ7A 2JP2A 2Z0PA 1I7AA 2DYNA 1J0WA 1MIZB 2YT1A 5FI0A 3DXDA 2P8VA 3OANA 3X23A 2R0DA 2YVCA 3MPXA 2LULA 3SV1A 3O96A 2KUPA 3HK0A 3PVWA 3DXCA 5C6RA 1P3RA 2VRWB 1UNPA 2N0YA 4GPTB 1W1DA 5DH9B 1MAIA 1QQGA 2YT0A 3ODOA 1P5TA 2UVMA 2D4QA 1BAKA 3A8PA 5DI9B 2N23A 4C0AA 4DBBA 1Y19B 1U5DA 1FOEA 1X1GA 2MDXA 5D3YA 1OMWA 1EAZA 4PQ0A 4NY0A 4A6KA 1V88A 3ZDTA 1W1HA 1UPRA 3MDBC 2D9YA 1UNRA 1FHWA 2EC1A 4A5KA 1SGHA 4HB0B 5D3XA 3TVVA 3G9WA 3LJUX 1NTYA 1ZVRA 1U5EA 1J19A 5DHFB 2DHIA 1GC7A 4GMXB 2K00A 3SNHA 1U27A 1ZC4B 1DDWA 3FM8C 2I1KA 2W2XD 1E5WA 1M7EA 5LOPB 3PP2A 2LYDA 1V89A 1XODA 5HE1A 3T06A 2H7EA 4ZRIA 5HE0A 4HAYB 2LOXA 3TO1A 4EKUA 1V5PA 2YS1A 2W2WA 1RRPB 3NSUA 2AL6A 2E2XA 1BWNA 4DX90 1LW3A 1X05A 4HAVB 5D27A 1P6SA 1TQZA 3U8ZA 3PG7A 3HQCA 1U29A 4A6FB 2DX1A 2COAA 5KQ4A 3N7CA 4HAXB 2G35A 1U5FA 4TYZA 1NI2A 3D8EA 5C5BA 2DYQA 5GOWB 3CXBB 2RGNB 4DXAB 4GN1A 4K2OA 1NTVA 2ELAA 3FSSA 3PZDA 4B6HA 2P0FA 1H4RA 1SHCA 1TXDA 1OQNA 4MY6A 4Z2MB 2LG1A 4PNKA 2NZ8B 1EF1A 1X86A 2W2XC 1DDMA 5J3YA 3SO6A 5L81A 4YL8A 3F0WA 3PEGA 2M14A 1N3HA 1MIXA 2M38A 1Z87A 1PLSA 2EJ8A 2NMBA 3KRWA 2P0DA 3ML4A 1W1GA 1MK7B 1KI1B 2COFA 1RJ2A 2L1CA 2UZRA 1B55A 1PMSA 2VSZA 3BJIA 3WA0A 4MT7A 2CRFA 2MWNB 2DX5A 4HDOA 1U5GA 5C79A 4YONA 3PVLA 3KRXA 1BTKA 4MK0A 2UZSA 4HATB 2D9WA 3QWMA 2CAYA 3A98B 3P7ZA 3SYXA 5FI1A 2I1JA 4HAZB 4IOYX 1K5GB 3AU4A 3P6AA 2BCJA 2QKLA 3ULBA 1OY2A 2D2QA 4HB3B 4KHAA 1X11A 4ZRJA 5KQ1A 3CIKA 5JHHA 1EGXA 2D11A 1FAOA 2DKPA 3GYPA 1UPQA 3RCPA 1ZM0A 2RVBB 3KY9A 2VKIA 2I5CA 4K17A 1V5UA 4CHJA 3U7DA 1XX0A 2YS3A 4CYEA 1ZSQA 3F5RA 5CLLB 1AQCA 4KAXB 2YSZA 3PVUA 1MK9B 2V76A 1GG3A 4A6HA 1LB1A 2H7DA 4HB2B 2AEHA 2GCLA 4WVFB 2P0HA 4F7UP 2Z0QA 5DIFB 4KHOA 4HHVA 2Y7BA 1XCGA 2Y8FA 3ODXA 1I2HA 1Y5OA 2Y8GA 2CY5A 2D9XA 2XQNM 4ZRKA 4DX8A 3WYFB 1XR0B 2OTXA 2LOZA 2PZ1A 2YF0A 4IAPA 1QC6A 1WJMA 2YRYA 3ZVRA 5JHGA 2ROZB 1NU2A 3KZ1A 4HB4B 2QKMA 3KSYA 1DDVA 3TCAA 4GZUA 4KVGB 4HDQA 1FGYA 4H8SA 5HE3A 2DHKA 3QIJA 4P7IA 2KCJA 1FB8A 3GYOA 5C5BB 1TJ6A 2K2JA 3QBVB 1XD4A 3IVFA 1ISNA 4Y94A 1WI1A 3FEHA 4HAWB 2J0JA
chains in the Genus database with same CATH superfamily
2DN6A 4EJNA 5HE2A 1FHXA 3D8FA 4NSWA 1IRSA 1Q67A 1DYNA 2J0KA 4K2PA 5JP4A 1V5MA 3VOQA 1K5DB 2Z0OA 1KZ7A 1MI1A 2OQBA 3DCXA 5JLJB 1FHOA 5J3TA 5LONB 4IFSA 5LG4B 2YS5A 1X1FA 4GMVA 4XWXA 1WVHA 3B77A 4Z2NA 2YT2A 1M7RA 2ROVA 3D8DA 1WJ1A 1FGZA 2DHJA 5J3QA 2GS0A 2D9VA 2HE7A 2I5FA 2RUKB 3A8QA 2ELBA 4QJ3B 1ZYIA 2GJYA 5DHAB 5KCVA 3TFMA 2COCA 1H10A 2CY4A 2FJLA 4EMOA 3M1IB 3SUZA 4D0NB 2K2UA 1PFJA 4BBKA 1MPHA 1ZC3B 2R09A 2J0MA 1GC6A 1WGQA 3BINA 3A58A 5D3VA 2RSGA 2Q13A 1UNQA 3ULCA 1AWEA 2IFSA 2ADZA 4F7GA 2EMTA 4GXBA 4TKNA 2GUMA 2ZPYA 4HAUB 1WG7A 1DROA 3TW1A 3V5WA 5EFXA 1T77A 4A6FA 1DBHA 4GNKB 1V61A 1WGUA 2D10A 3DXEA 4CHMA 2DFKA 2DA0A 1MKEA 4WSFA 1U2BA 2LKOA 4F7HA 2RRFA 2MFQA 2MKRA 2L2IA 3HW2B 2IYBA 4OSNA 3NWAA 3AU5A 2RNRB 3VIAA 2J59M 3AJ4A 5D3WA 2RLOA 5CLQB 1XKEA 2FJUB 4DIXA 2DTCA 5C16A 3UZTA 2X18A 4L6EA 5I2SA 1BTNA 2HTHB 1KZGA 2D9ZA 2DLWA 2KGXB 1EVHA 2DKQA 3ODWA 2CODA 4K81A 1UEFA 2GCJA 3PSCA 2EMSA 2KIGA 4KHBB 4WJ7A 2JP2A 2Z0PA 1I7AA 2DYNA 1J0WA 1MIZB 3FVCA 2YT1A 2ZKMX 5FI0A 3DXDA 3U12A 2P8VA 3OANA 3X23A 2R0DA 4CSQA 2YVCA 3MPXA 2LULA 3SV1A 3O96A 2KUPA 3HK0A 3PVWA 3DXCA 5C6RA 1P3RA 2VRWB 1UNPA 2N0YA 4GPTB 1W1DA 5DH9B 1MAIA 1QQGA 2YT0A 3ODOA 1P5TA 2UVMA 2D4QA 1BAKA 3A8PA 5DI9B 2N23A 4C0AA 4DBBA 1Y19B 1U5DA 3HSAA 1FOEA 1X1GA 3NWDA 2MDXA 4QJ4B 5D3YA 1OMWA 1EAZA 4PQ0A 4NY0A 4A6KA 1V88A 3ZDTA 1W1HA 1UPRA 3MDBC 2D9YA 1UNRA 1FHWA 2EC1A 4A5KA 1SGHA 4HB0B 5D3XA 3TVVA 3G9WA 3NWFA 2R2YA 3LJUX 1NTYA 1ZVRA 1U5EA 1J19A 5DHFB 4HSIA 2DHIA 2Z59A 1GC7A 4GMXB 2K00A 3SNHA 1U27A 1ZC4B 1DDWA 3FM8C 5IRSA 2I1KA 2W2XD 2K49A 1E5WA 1M7EA 5LOPB 3PP2A 2LYDA 1V89A 1XODA 5HE1A 3T06A 3HIEA 2H7EA 4ZRIA 5HE0A 4HAYB 2LOXA 3TO1A 4EKUA 1V5PA 2YS1A 2W2WA 1RRPB 3NSUA 2AL6A 2E2XA 1BWNA 4DX90 1LW3A 1X05A 4HAVB 5D27A 1P6SA 1TQZA 3U8ZA 3PG7A 3HQCA 1U29A 4A6FB 2DX1A 2COAA 5KQ4A 3N7CA 4HAXB 4QJ5B 2Z4DA 2G35A 1U5FA 4TYZA 1NI2A 3D8EA 2K8EA 5C5BA 2DYQA 5GOWB 3CXBB 2RGNB 4DXAB 4GN1A 4K2OA 4OT1A 1NTVA 2ELAA 3FSSA 3PZDA 4B6HA 2P0FA 1H4RA 1SHCA 1TXDA 1OQNA 4MY6A 4Z2MB 2LG1A 4PNKA 2NZ8B 1EF1A 1X86A 2W2XC 1DDMA 5J3YA 3SO6A 5L81A 4YL8A 3F0WA 3PEGA 4L1RA 2M14A 1N3HA 1MIXA 2M38A 1Z87A 1PLSA 2EJ8A 2NMBA 3KRWA 2P0DA 3ML4A 1W1GA 1MK7B 1KI1B 2COFA 1RJ2A 2L1CA 2UZRA 1B55A 1PMSA 2VSZA 3BJIA 3WA0A 4MT7A 2KUQA 2CRFA 2MWNB 2DX5A 4HDOA 1U5GA 5C79A 4YONA 3PVLA 3KRXA 1BTKA 4QXAB 4MK0A 2UZSA 4HATB 2D9WA 3QWMA 2CAYA 3A98B 3P7ZA 3SYXA 5FI1A 2I1JA 4HAZB 4IOYX 1K5GB 3AU4A 3P6AA 5M4YB 2BCJA 2QKLA 3ULBA 1OY2A 2D2QA 4HB3B 4KHAA 1X11A 4ZRJA 5KQ1A 3CIKA 5JHHA 1EGXA 2D11A 1FAOA 2DKPA 3GYPA 4D6WA 1UPQA 3RCPA 1ZM0A 2RVBB 3KY9A 2VKIA 2I5CA 2KR0A 4K17A 1V5UA 4CHJA 2NBVA 3U7DA 1XX0A 2YS3A 4CYEA 1ZSQA 3F5RA 5CLLB 1AQCA 4KAXB 4GOUA 2YSZA 3PVUA 1MK9B 2V76A 1GG3A 4A6HA 1LB1A 2H7DA 4HB2B 2AEHA 2GCLA 4WVFB 2P0HA 4KHBA 4F7UP 2Z0QA 2KIEA 5DIFB 4KHOA 4HHVA 2Y7BA 3NW8A 1XCGA 2Y8FA 3ODXA 1I2HA 1Y5OA 2Y8GA 2CY5A 2D9XA 2XQNM 4ZRKA 4DX8A 3WYFB 1XR0B 2OTXA 2Z13A 2LOZA 2PZ1A 2YF0A 4IAPA 1QC6A 1WJMA 2YRYA 3ZVRA 5JHGA 2ROZB 5I2MA 1NU2A 3KZ1A 4HB4B 2QKMA 3KSYA 1DDVA 3TCAA 4GZUA 4KVGB 4HDQA 1FGYA 4H8SA 5HE3A 2DHKA 3QIJA 4P7IA 2KCJA 1FB8A 3GYOA 5C5BB 1TJ6A 2Z14A 2K2JA 3QBVB 1XD4A 3IVFA 1ISNA 4Y94A 1WI1A 3FEHA 3OHMB 4HAWB 2J0JA
chains in the Genus database with same CATH topology
2DN6A 4EJNA 5HE2A 1FHXA 3D8FA 4NSWA 1IRSA 1Q67A 1DYNA 2J0KA 4K2PA 5JP4A 1V5MA 3VOQA 1K5DB 2Z0OA 1KZ7A 2OQBA 5JLJB 1FHOA 5J3TA 5LONB 4IFSA 2YS5A 1X1FA 4GMVA 4XWXA 1WVHA 4Z2NA 1M7RA 2ROVA 3D8DA 1WJ1A 1FGZA 2DHJA 5J3QA 2GS0A 2D9VA 2HE7A 2I5FA 2RUKB 3A8QA 2ELBA 2GJYA 5DHAB 5KCVA 3TFMA 2COCA 1H10A 2CY4A 2FJLA 4EMOA 3M1IB 3SUZA 4D0NB 2K2UA 1PFJA 4BBKA 1MPHA 1ZC3B 2R09A 2J0MA 1GC6A 1WGQA 3BINA 5D3VA 2RSGA 2Q13A 1UNQA 3ULCA 1AWEA 2IFSA 2ADZA 4F7GA 2EMTA 4GXBA 4TKNA 2ZPYA 4HAUB 1WG7A 1DROA 3TW1A 3V5WA 5EFXA 4A6FA 1DBHA 1V61A 1WGUA 2D10A 3DXEA 4CHMA 2DFKA 2DA0A 1MKEA 4WSFA 1U2BA 2LKOA 4F7HA 2MFQA 2MKRA 2L2IA 3HW2B 2IYBA 3AU5A 2RNRB 3VIAA 2J59M 3AJ4A 5D3WA 2RLOA 5CLQB 1XKEA 2DTCA 5C16A 3UZTA 2X18A 4L6EA 1BTNA 2HTHB 1KZGA 2D9ZA 2DLWA 2KGXB 1EVHA 2DKQA 3ODWA 2CODA 4K81A 1UEFA 2GCJA 3PSCA 2EMSA 4KHBB 4WJ7A 2JP2A 2Z0PA 1I7AA 2DYNA 1J0WA 1MIZB 2YT1A 5FI0A 3DXDA 2P8VA 3OANA 3X23A 2R0DA 2YVCA 3MPXA 2LULA 3SV1A 3O96A 2KUPA 3HK0A 3PVWA 3DXCA 5C6RA 1P3RA 2VRWB 1UNPA 2N0YA 4GPTB 1W1DA 5DH9B 1MAIA 1QQGA 2YT0A 3ODOA 1P5TA 2UVMA 2D4QA 1BAKA 3A8PA 5DI9B 2N23A 4C0AA 4DBBA 1Y19B 1U5DA 1FOEA 1X1GA 2MDXA 5D3YA 1OMWA 1EAZA 4PQ0A 4NY0A 4A6KA 1V88A 3ZDTA 1W1HA 1UPRA 3MDBC 2D9YA 1UNRA 1FHWA 2EC1A 4A5KA 1SGHA 4HB0B 5D3XA 3TVVA 3G9WA 3LJUX 1NTYA 1ZVRA 1U5EA 1J19A 5DHFB 2DHIA 1GC7A 4GMXB 2K00A 3SNHA 1U27A 1ZC4B 1DDWA 3FM8C 2I1KA 2W2XD 1E5WA 1M7EA 5LOPB 3PP2A 2LYDA 1V89A 1XODA 5HE1A 3T06A 2H7EA 4ZRIA 5HE0A 4HAYB 2LOXA 3TO1A 4EKUA 1V5PA 2YS1A 2W2WA 1RRPB 3NSUA 2AL6A 2E2XA 1BWNA 4DX90 1LW3A 1X05A 4HAVB 5D27A 1P6SA 1TQZA 3U8ZA 3PG7A 3HQCA 1U29A 4A6FB 2DX1A 2COAA 5KQ4A 3N7CA 4HAXB 2G35A 1U5FA 4TYZA 1NI2A 3D8EA 5C5BA 2DYQA 5GOWB 3CXBB 2RGNB 4DXAB 4GN1A 4K2OA 1NTVA 2ELAA 3FSSA 3PZDA 4B6HA 2P0FA 1H4RA 1SHCA 1TXDA 1OQNA 4MY6A 4Z2MB 2LG1A 4PNKA 2NZ8B 1EF1A 1X86A 2W2XC 1DDMA 5J3YA 3SO6A 5L81A 4YL8A 3F0WA 3PEGA 2M14A 1N3HA 1MIXA 2M38A 1Z87A 1PLSA 2EJ8A 2NMBA 3KRWA 2P0DA 3ML4A 1W1GA 1MK7B 1KI1B 2COFA 1RJ2A 2L1CA 2UZRA 1B55A 1PMSA 2VSZA 3BJIA 3WA0A 4MT7A 2CRFA 2MWNB 2DX5A 4HDOA 1U5GA 5C79A 4YONA 3PVLA 3KRXA 1BTKA 4MK0A 2UZSA 4HATB 2D9WA 3QWMA 2CAYA 3A98B 3P7ZA 3SYXA 5FI1A 2I1JA 4HAZB 4IOYX 1K5GB 3AU4A 3P6AA 2BCJA 2QKLA 3ULBA 1OY2A 2D2QA 4HB3B 4KHAA 1X11A 4ZRJA 5KQ1A 3CIKA 5JHHA 1EGXA 2D11A 1FAOA 2DKPA 3GYPA 1UPQA 3RCPA 1ZM0A 2RVBB 3KY9A 2VKIA 2I5CA 4K17A 1V5UA 4CHJA 3U7DA 1XX0A 2YS3A 4CYEA 1ZSQA 3F5RA 5CLLB 1AQCA 4KAXB 2YSZA 3PVUA 1MK9B 2V76A 1GG3A 4A6HA 1LB1A 2H7DA 4HB2B 2AEHA 2GCLA 4WVFB 2P0HA 4F7UP 2Z0QA 5DIFB 4KHOA 4HHVA 2Y7BA 1XCGA 2Y8FA 3ODXA 1I2HA 1Y5OA 2Y8GA 2CY5A 2D9XA 2XQNM 4ZRKA 4DX8A 3WYFB 1XR0B 2OTXA 2LOZA 2PZ1A 2YF0A 4IAPA 1QC6A 1WJMA 2YRYA 3ZVRA 5JHGA 2ROZB 1NU2A 3KZ1A 4HB4B 2QKMA 3KSYA 1DDVA 3TCAA 4GZUA 4KVGB 4HDQA 1FGYA 4H8SA 5HE3A 2DHKA 3QIJA 4P7IA 2KCJA 1FB8A 3GYOA 5C5BB 1TJ6A 2K2JA 3QBVB 1XD4A 3IVFA 1ISNA 4Y94A 1WI1A 3FEHA 4HAWB 2J0JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DN6 A;  4EJN A;  5HE2 A;  1FHX A;  3D8F A;  4NSW A;  1IRS A;  1Q67 A;  1DYN A;  2J0K A;  4K2P A;  5JP4 A;  1V5M A;  3VOQ A;  1K5D B;  2Z0O A;  1KZ7 A;  2OQB A;  5JLJ B;  1FHO A;  5J3T A;  5LON B;  4IFS A;  2YS5 A;  1X1F A;  4GMV A;  4XWX A;  1WVH A;  4Z2N A;  1M7R A;  2ROV A;  3D8D A;  1WJ1 A;  1FGZ A;  2DHJ A;  5J3Q A;  2GS0 A;  2D9V A;  2HE7 A;  2I5F A;  2RUK B;  3A8Q A;  2ELB A;  2GJY A;  5DHA B;  5KCV A;  3TFM A;  2COC A;  1H10 A;  2CY4 A;  2FJL A;  4EMO A;  3M1I B;  3SUZ A;  4D0N B;  2K2U A;  1PFJ A;  4BBK A;  1MPH A;  1ZC3 B;  2R09 A;  2J0M A;  1GC6 A;  1WGQ A;  3BIN A;  5D3V A;  2RSG A;  2Q13 A;  1UNQ A;  3ULC A;  1AWE A;  2IFS A;  2ADZ A;  4F7G A;  2EMT A;  4GXB A;  4TKN A;  2ZPY A;  4HAU B;  1WG7 A;  1DRO A;  3TW1 A;  3V5W A;  5EFX A;  4A6F A;  1DBH A;  1V61 A;  1WGU A;  2D10 A;  3DXE A;  4CHM A;  2DFK A;  2DA0 A;  1MKE A;  4WSF A;  1U2B A;  2LKO A;  4F7H A;  2MFQ A;  2MKR A;  2L2I A;  3HW2 B;  2IYB A;  3AU5 A;  2RNR B;  3VIA A;  2J59 M;  3AJ4 A;  5D3W A;  2RLO A;  5CLQ B;  1XKE A;  2DTC A;  5C16 A;  3UZT A;  2X18 A;  4L6E A;  1BTN A;  2HTH B;  1KZG A;  2D9Z A;  2DLW A;  2KGX B;  1EVH A;  2DKQ A;  3ODW A;  2COD A;  4K81 A;  1UEF A;  2GCJ A;  3PSC A;  2EMS A;  4KHB B;  4WJ7 A;  2JP2 A;  2Z0P A;  1I7A A;  2DYN A;  1J0W A;  1MIZ B;  2YT1 A;  5FI0 A;  3DXD A;  2P8V A;  3OAN A;  3X23 A;  2R0D A;  2YVC A;  3MPX A;  2LUL A;  3SV1 A;  3O96 A;  2KUP A;  3HK0 A;  3PVW A;  3DXC A;  5C6R A;  1P3R A;  2VRW B;  1UNP A;  2N0Y A;  4GPT B;  1W1D A;  5DH9 B;  1MAI A;  1QQG A;  2YT0 A;  3ODO A;  1P5T A;  2UVM A;  2D4Q A;  1BAK A;  3A8P A;  5DI9 B;  2N23 A;  4C0A A;  4DBB A;  1Y19 B;  1U5D A;  1FOE A;  1X1G A;  2MDX A;  5D3Y A;  1OMW A;  1EAZ A;  4PQ0 A;  4NY0 A;  4A6K A;  1V88 A;  3ZDT A;  1W1H A;  1UPR A;  3MDB C;  2D9Y A;  1UNR A;  1FHW A;  2EC1 A;  4A5K A;  1SGH A;  4HB0 B;  5D3X A;  3TVV A;  3G9W A;  3LJU X;  1NTY A;  1ZVR A;  1U5E A;  1J19 A;  5DHF B;  2DHI A;  1GC7 A;  4GMX B;  2K00 A;  3SNH A;  1U27 A;  1ZC4 B;  1DDW A;  3FM8 C;  2I1K A;  2W2X D;  1E5W A;  1M7E A;  5LOP B;  3PP2 A;  2LYD A;  1V89 A;  1XOD A;  5HE1 A;  3T06 A;  2H7E A;  4ZRI A;  5HE0 A;  4HAY B;  2LOX A;  3TO1 A;  4EKU A;  1V5P A;  2YS1 A;  2W2W A;  1RRP B;  3NSU A;  2AL6 A;  2E2X A;  1BWN A;  4DX9 0;  1LW3 A;  1X05 A;  4HAV B;  5D27 A;  1P6S A;  1TQZ A;  3U8Z A;  3PG7 A;  3HQC A;  1U29 A;  4A6F B;  2DX1 A;  2COA A;  5KQ4 A;  3N7C A;  4HAX B;  2G35 A;  1U5F A;  4TYZ A;  1NI2 A;  3D8E A;  5C5B A;  2DYQ A;  5GOW B;  3CXB B;  2RGN B;  4DXA B;  4GN1 A;  4K2O A;  1NTV A;  2ELA A;  3FSS A;  3PZD A;  4B6H A;  2P0F A;  1H4R A;  1SHC A;  1TXD A;  1OQN A;  4MY6 A;  4Z2M B;  2LG1 A;  4PNK A;  2NZ8 B;  1EF1 A;  1X86 A;  2W2X C;  1DDM A;  5J3Y A;  3SO6 A;  5L81 A;  4YL8 A;  3F0W A;  3PEG A;  2M14 A;  1N3H A;  1MIX A;  2M38 A;  1Z87 A;  1PLS A;  2EJ8 A;  2NMB A;  3KRW A;  2P0D A;  3ML4 A;  1W1G A;  1MK7 B;  1KI1 B;  2COF A;  1RJ2 A;  2L1C A;  2UZR A;  1B55 A;  1PMS A;  2VSZ A;  3BJI A;  3WA0 A;  4MT7 A;  2CRF A;  2MWN B;  2DX5 A;  4HDO A;  1U5G A;  5C79 A;  4YON A;  3PVL A;  3KRX A;  1BTK A;  4MK0 A;  2UZS A;  4HAT B;  2D9W A;  3QWM A;  2CAY A;  3A98 B;  3P7Z A;  3SYX A;  5FI1 A;  2I1J A;  4HAZ B;  4IOY X;  1K5G B;  3AU4 A;  3P6A A;  2BCJ A;  2QKL A;  3ULB A;  1OY2 A;  2D2Q A;  4HB3 B;  4KHA A;  1X11 A;  4ZRJ A;  5KQ1 A;  3CIK A;  5JHH A;  1EGX A;  2D11 A;  1FAO A;  2DKP A;  3GYP A;  1UPQ A;  3RCP A;  1ZM0 A;  2RVB B;  3KY9 A;  2VKI A;  2I5C A;  4K17 A;  1V5U A;  4CHJ A;  3U7D A;  1XX0 A;  2YS3 A;  4CYE A;  1ZSQ A;  3F5R A;  5CLL B;  1AQC A;  4KAX B;  2YSZ A;  3PVU A;  1MK9 B;  2V76 A;  1GG3 A;  4A6H A;  1LB1 A;  2H7D A;  4HB2 B;  2AEH A;  2GCL A;  4WVF B;  2P0H A;  4F7U P;  2Z0Q A;  5DIF B;  4KHO A;  4HHV A;  2Y7B A;  1XCG A;  2Y8F A;  3ODX A;  1I2H A;  1Y5O A;  2Y8G A;  2CY5 A;  2D9X A;  2XQN M;  4ZRK A;  4DX8 A;  3WYF B;  1XR0 B;  2OTX A;  2LOZ A;  2PZ1 A;  2YF0 A;  4IAP A;  1QC6 A;  1WJM A;  2YRY A;  3ZVR A;  5JHG A;  2ROZ B;  1NU2 A;  3KZ1 A;  4HB4 B;  2QKM A;  3KSY A;  1DDV A;  3TCA A;  4GZU A;  4KVG B;  4HDQ A;  1FGY A;  4H8S A;  5HE3 A;  2DHK A;  3QIJ A;  4P7I A;  2KCJ A;  1FB8 A;  3GYO A;  5C5B B;  1TJ6 A;  2K2J A;  3QBV B;  1XD4 A;  3IVF A;  1ISN A;  4Y94 A;  1WI1 A;  3FEH A;  4HAW B;  2J0J A; 
#chains in the Genus database with same CATH topology
 2DN6 A;  4EJN A;  5HE2 A;  1FHX A;  3D8F A;  4NSW A;  1IRS A;  1Q67 A;  1DYN A;  2J0K A;  4K2P A;  5JP4 A;  1V5M A;  3VOQ A;  1K5D B;  2Z0O A;  1KZ7 A;  1MI1 A;  2OQB A;  3DCX A;  5JLJ B;  1FHO A;  5J3T A;  5LON B;  4IFS A;  5LG4 B;  2YS5 A;  1X1F A;  4GMV A;  4XWX A;  1WVH A;  3B77 A;  4Z2N A;  2YT2 A;  1M7R A;  2ROV A;  3D8D A;  1WJ1 A;  1FGZ A;  2DHJ A;  5J3Q A;  2GS0 A;  2D9V A;  2HE7 A;  2I5F A;  2RUK B;  3A8Q A;  2ELB A;  4QJ3 B;  1ZYI A;  2GJY A;  5DHA B;  5KCV A;  3TFM A;  2COC A;  1H10 A;  2CY4 A;  2FJL A;  4EMO A;  3M1I B;  3SUZ A;  4D0N B;  2K2U A;  1PFJ A;  4BBK A;  1MPH A;  1ZC3 B;  2R09 A;  2J0M A;  1GC6 A;  1WGQ A;  3BIN A;  3A58 A;  5D3V A;  2RSG A;  2Q13 A;  1UNQ A;  3ULC A;  1AWE A;  2IFS A;  2ADZ A;  4F7G A;  2EMT A;  4GXB A;  4TKN A;  2GUM A;  2ZPY A;  4HAU B;  1WG7 A;  1DRO A;  3TW1 A;  3V5W A;  5EFX A;  1T77 A;  4A6F A;  1DBH A;  4GNK B;  1V61 A;  1WGU A;  2D10 A;  3DXE A;  4CHM A;  2DFK A;  2DA0 A;  1MKE A;  4WSF A;  1U2B A;  2LKO A;  4F7H A;  2RRF A;  2MFQ A;  2MKR A;  2L2I A;  3HW2 B;  2IYB A;  4OSN A;  3NWA A;  3AU5 A;  2RNR B;  3VIA A;  2J59 M;  3AJ4 A;  5D3W A;  2RLO A;  5CLQ B;  1XKE A;  2FJU B;  4DIX A;  2DTC A;  5C16 A;  3UZT A;  2X18 A;  4L6E A;  5I2S A;  1BTN A;  2HTH B;  1KZG A;  2D9Z A;  2DLW A;  2KGX B;  1EVH A;  2DKQ A;  3ODW A;  2COD A;  4K81 A;  1UEF A;  2GCJ A;  3PSC A;  2EMS A;  2KIG A;  4KHB B;  4WJ7 A;  2JP2 A;  2Z0P A;  1I7A A;  2DYN A;  1J0W A;  1MIZ B;  3FVC A;  2YT1 A;  2ZKM X;  5FI0 A;  3DXD A;  3U12 A;  2P8V A;  3OAN A;  3X23 A;  2R0D A;  4CSQ A;  2YVC A;  3MPX A;  2LUL A;  3SV1 A;  3O96 A;  2KUP A;  3HK0 A;  3PVW A;  3DXC A;  5C6R A;  1P3R A;  2VRW B;  1UNP A;  2N0Y A;  4GPT B;  1W1D A;  5DH9 B;  1MAI A;  1QQG A;  2YT0 A;  3ODO A;  1P5T A;  2UVM A;  2D4Q A;  1BAK A;  3A8P A;  5DI9 B;  2N23 A;  4C0A A;  4DBB A;  1Y19 B;  1U5D A;  3HSA A;  1FOE A;  1X1G A;  3NWD A;  2MDX A;  4QJ4 B;  5D3Y A;  1OMW A;  1EAZ A;  4PQ0 A;  4NY0 A;  4A6K A;  1V88 A;  3ZDT A;  1W1H A;  1UPR A;  3MDB C;  2D9Y A;  1UNR A;  1FHW A;  2EC1 A;  4A5K A;  1SGH A;  4HB0 B;  5D3X A;  3TVV A;  3G9W A;  3NWF A;  2R2Y A;  3LJU X;  1NTY A;  1ZVR A;  1U5E A;  1J19 A;  5DHF B;  4HSI A;  2DHI A;  2Z59 A;  1GC7 A;  4GMX B;  2K00 A;  3SNH A;  1U27 A;  1ZC4 B;  1DDW A;  3FM8 C;  5IRS A;  2I1K A;  2W2X D;  2K49 A;  1E5W A;  1M7E A;  5LOP B;  3PP2 A;  2LYD A;  1V89 A;  1XOD A;  5HE1 A;  3T06 A;  3HIE A;  2H7E A;  4ZRI A;  5HE0 A;  4HAY B;  2LOX A;  3TO1 A;  4EKU A;  1V5P A;  2YS1 A;  2W2W A;  1RRP B;  3NSU A;  2AL6 A;  2E2X A;  1BWN A;  4DX9 0;  1LW3 A;  1X05 A;  4HAV B;  5D27 A;  1P6S A;  1TQZ A;  3U8Z A;  3PG7 A;  3HQC A;  1U29 A;  4A6F B;  2DX1 A;  2COA A;  5KQ4 A;  3N7C A;  4HAX B;  4QJ5 B;  2Z4D A;  2G35 A;  1U5F A;  4TYZ A;  1NI2 A;  3D8E A;  2K8E A;  5C5B A;  2DYQ A;  5GOW B;  3CXB B;  2RGN B;  4DXA B;  4GN1 A;  4K2O A;  4OT1 A;  1NTV A;  2ELA A;  3FSS A;  3PZD A;  4B6H A;  2P0F A;  1H4R A;  1SHC A;  1TXD A;  1OQN A;  4MY6 A;  4Z2M B;  2LG1 A;  4PNK A;  2NZ8 B;  1EF1 A;  1X86 A;  2W2X C;  1DDM A;  5J3Y A;  3SO6 A;  5L81 A;  4YL8 A;  3F0W A;  3PEG A;  4L1R A;  2M14 A;  1N3H A;  1MIX A;  2M38 A;  1Z87 A;  1PLS A;  2EJ8 A;  2NMB A;  3KRW A;  2P0D A;  3ML4 A;  1W1G A;  1MK7 B;  1KI1 B;  2COF A;  1RJ2 A;  2L1C A;  2UZR A;  1B55 A;  1PMS A;  2VSZ A;  3BJI A;  3WA0 A;  4MT7 A;  2KUQ A;  2CRF A;  2MWN B;  2DX5 A;  4HDO A;  1U5G A;  5C79 A;  4YON A;  3PVL A;  3KRX A;  1BTK A;  4QXA B;  4MK0 A;  2UZS A;  4HAT B;  2D9W A;  3QWM A;  2CAY A;  3A98 B;  3P7Z A;  3SYX A;  5FI1 A;  2I1J A;  4HAZ B;  4IOY X;  1K5G B;  3AU4 A;  3P6A A;  5M4Y B;  2BCJ A;  2QKL A;  3ULB A;  1OY2 A;  2D2Q A;  4HB3 B;  4KHA A;  1X11 A;  4ZRJ A;  5KQ1 A;  3CIK A;  5JHH A;  1EGX A;  2D11 A;  1FAO A;  2DKP A;  3GYP A;  4D6W A;  1UPQ A;  3RCP A;  1ZM0 A;  2RVB B;  3KY9 A;  2VKI A;  2I5C A;  2KR0 A;  4K17 A;  1V5U A;  4CHJ A;  2NBV A;  3U7D A;  1XX0 A;  2YS3 A;  4CYE A;  1ZSQ A;  3F5R A;  5CLL B;  1AQC A;  4KAX B;  4GOU A;  2YSZ A;  3PVU A;  1MK9 B;  2V76 A;  1GG3 A;  4A6H A;  1LB1 A;  2H7D A;  4HB2 B;  2AEH A;  2GCL A;  4WVF B;  2P0H A;  4KHB A;  4F7U P;  2Z0Q A;  2KIE A;  5DIF B;  4KHO A;  4HHV A;  2Y7B A;  3NW8 A;  1XCG A;  2Y8F A;  3ODX A;  1I2H A;  1Y5O A;  2Y8G A;  2CY5 A;  2D9X A;  2XQN M;  4ZRK A;  4DX8 A;  3WYF B;  1XR0 B;  2OTX A;  2Z13 A;  2LOZ A;  2PZ1 A;  2YF0 A;  4IAP A;  1QC6 A;  1WJM A;  2YRY A;  3ZVR A;  5JHG A;  2ROZ B;  5I2M A;  1NU2 A;  3KZ1 A;  4HB4 B;  2QKM A;  3KSY A;  1DDV A;  3TCA A;  4GZU A;  4KVG B;  4HDQ A;  1FGY A;  4H8S A;  5HE3 A;  2DHK A;  3QIJ A;  4P7I A;  2KCJ A;  1FB8 A;  3GYO A;  5C5B B;  1TJ6 A;  2Z14 A;  2K2J A;  3QBV B;  1XD4 A;  3IVF A;  1ISN A;  4Y94 A;  1WI1 A;  3FEH A;  3OHM B;  4HAW B;  2J0J A; 
#chains in the Genus database with same CATH homology
 2DN6 A;  4EJN A;  5HE2 A;  1FHX A;  3D8F A;  4NSW A;  1IRS A;  1Q67 A;  1DYN A;  2J0K A;  4K2P A;  5JP4 A;  1V5M A;  3VOQ A;  1K5D B;  2Z0O A;  1KZ7 A;  2OQB A;  5JLJ B;  1FHO A;  5J3T A;  5LON B;  4IFS A;  2YS5 A;  1X1F A;  4GMV A;  4XWX A;  1WVH A;  4Z2N A;  1M7R A;  2ROV A;  3D8D A;  1WJ1 A;  1FGZ A;  2DHJ A;  5J3Q A;  2GS0 A;  2D9V A;  2HE7 A;  2I5F A;  2RUK B;  3A8Q A;  2ELB A;  2GJY A;  5DHA B;  5KCV A;  3TFM A;  2COC A;  1H10 A;  2CY4 A;  2FJL A;  4EMO A;  3M1I B;  3SUZ A;  4D0N B;  2K2U A;  1PFJ A;  4BBK A;  1MPH A;  1ZC3 B;  2R09 A;  2J0M A;  1GC6 A;  1WGQ A;  3BIN A;  5D3V A;  2RSG A;  2Q13 A;  1UNQ A;  3ULC A;  1AWE A;  2IFS A;  2ADZ A;  4F7G A;  2EMT A;  4GXB A;  4TKN A;  2ZPY A;  4HAU B;  1WG7 A;  1DRO A;  3TW1 A;  3V5W A;  5EFX A;  4A6F A;  1DBH A;  1V61 A;  1WGU A;  2D10 A;  3DXE A;  4CHM A;  2DFK A;  2DA0 A;  1MKE A;  4WSF A;  1U2B A;  2LKO A;  4F7H A;  2MFQ A;  2MKR A;  2L2I A;  3HW2 B;  2IYB A;  3AU5 A;  2RNR B;  3VIA A;  2J59 M;  3AJ4 A;  5D3W A;  2RLO A;  5CLQ B;  1XKE A;  2DTC A;  5C16 A;  3UZT A;  2X18 A;  4L6E A;  1BTN A;  2HTH B;  1KZG A;  2D9Z A;  2DLW A;  2KGX B;  1EVH A;  2DKQ A;  3ODW A;  2COD A;  4K81 A;  1UEF A;  2GCJ A;  3PSC A;  2EMS A;  4KHB B;  4WJ7 A;  2JP2 A;  2Z0P A;  1I7A A;  2DYN A;  1J0W A;  1MIZ B;  2YT1 A;  5FI0 A;  3DXD A;  2P8V A;  3OAN A;  3X23 A;  2R0D A;  2YVC A;  3MPX A;  2LUL A;  3SV1 A;  3O96 A;  2KUP A;  3HK0 A;  3PVW A;  3DXC A;  5C6R A;  1P3R A;  2VRW B;  1UNP A;  2N0Y A;  4GPT B;  1W1D A;  5DH9 B;  1MAI A;  1QQG A;  2YT0 A;  3ODO A;  1P5T A;  2UVM A;  2D4Q A;  1BAK A;  3A8P A;  5DI9 B;  2N23 A;  4C0A A;  4DBB A;  1Y19 B;  1U5D A;  1FOE A;  1X1G A;  2MDX A;  5D3Y A;  1OMW A;  1EAZ A;  4PQ0 A;  4NY0 A;  4A6K A;  1V88 A;  3ZDT A;  1W1H A;  1UPR A;  3MDB C;  2D9Y A;  1UNR A;  1FHW A;  2EC1 A;  4A5K A;  1SGH A;  4HB0 B;  5D3X A;  3TVV A;  3G9W A;  3LJU X;  1NTY A;  1ZVR A;  1U5E A;  1J19 A;  5DHF B;  2DHI A;  1GC7 A;  4GMX B;  2K00 A;  3SNH A;  1U27 A;  1ZC4 B;  1DDW A;  3FM8 C;  2I1K A;  2W2X D;  1E5W A;  1M7E A;  5LOP B;  3PP2 A;  2LYD A;  1V89 A;  1XOD A;  5HE1 A;  3T06 A;  2H7E A;  4ZRI A;  5HE0 A;  4HAY B;  2LOX A;  3TO1 A;  4EKU A;  1V5P A;  2YS1 A;  2W2W A;  1RRP B;  3NSU A;  2AL6 A;  2E2X A;  1BWN A;  4DX9 0;  1LW3 A;  1X05 A;  4HAV B;  5D27 A;  1P6S A;  1TQZ A;  3U8Z A;  3PG7 A;  3HQC A;  1U29 A;  4A6F B;  2DX1 A;  2COA A;  5KQ4 A;  3N7C A;  4HAX B;  2G35 A;  1U5F A;  4TYZ A;  1NI2 A;  3D8E A;  5C5B A;  2DYQ A;  5GOW B;  3CXB B;  2RGN B;  4DXA B;  4GN1 A;  4K2O A;  1NTV A;  2ELA A;  3FSS A;  3PZD A;  4B6H A;  2P0F A;  1H4R A;  1SHC A;  1TXD A;  1OQN A;  4MY6 A;  4Z2M B;  2LG1 A;  4PNK A;  2NZ8 B;  1EF1 A;  1X86 A;  2W2X C;  1DDM A;  5J3Y A;  3SO6 A;  5L81 A;  4YL8 A;  3F0W A;  3PEG A;  2M14 A;  1N3H A;  1MIX A;  2M38 A;  1Z87 A;  1PLS A;  2EJ8 A;  2NMB A;  3KRW A;  2P0D A;  3ML4 A;  1W1G A;  1MK7 B;  1KI1 B;  2COF A;  1RJ2 A;  2L1C A;  2UZR A;  1B55 A;  1PMS A;  2VSZ A;  3BJI A;  3WA0 A;  4MT7 A;  2CRF A;  2MWN B;  2DX5 A;  4HDO A;  1U5G A;  5C79 A;  4YON A;  3PVL A;  3KRX A;  1BTK A;  4MK0 A;  2UZS A;  4HAT B;  2D9W A;  3QWM A;  2CAY A;  3A98 B;  3P7Z A;  3SYX A;  5FI1 A;  2I1J A;  4HAZ B;  4IOY X;  1K5G B;  3AU4 A;  3P6A A;  2BCJ A;  2QKL A;  3ULB A;  1OY2 A;  2D2Q A;  4HB3 B;  4KHA A;  1X11 A;  4ZRJ A;  5KQ1 A;  3CIK A;  5JHH A;  1EGX A;  2D11 A;  1FAO A;  2DKP A;  3GYP A;  1UPQ A;  3RCP A;  1ZM0 A;  2RVB B;  3KY9 A;  2VKI A;  2I5C A;  4K17 A;  1V5U A;  4CHJ A;  3U7D A;  1XX0 A;  2YS3 A;  4CYE A;  1ZSQ A;  3F5R A;  5CLL B;  1AQC A;  4KAX B;  2YSZ A;  3PVU A;  1MK9 B;  2V76 A;  1GG3 A;  4A6H A;  1LB1 A;  2H7D A;  4HB2 B;  2AEH A;  2GCL A;  4WVF B;  2P0H A;  4F7U P;  2Z0Q A;  5DIF B;  4KHO A;  4HHV A;  2Y7B A;  1XCG A;  2Y8F A;  3ODX A;  1I2H A;  1Y5O A;  2Y8G A;  2CY5 A;  2D9X A;  2XQN M;  4ZRK A;  4DX8 A;  3WYF B;  1XR0 B;  2OTX A;  2LOZ A;  2PZ1 A;  2YF0 A;  4IAP A;  1QC6 A;  1WJM A;  2YRY A;  3ZVR A;  5JHG A;  2ROZ B;  1NU2 A;  3KZ1 A;  4HB4 B;  2QKM A;  3KSY A;  1DDV A;  3TCA A;  4GZU A;  4KVG B;  4HDQ A;  1FGY A;  4H8S A;  5HE3 A;  2DHK A;  3QIJ A;  4P7I A;  2KCJ A;  1FB8 A;  3GYO A;  5C5B B;  1TJ6 A;  2K2J A;  3QBV B;  1XD4 A;  3IVF A;  1ISN A;  4Y94 A;  1WI1 A;  3FEH A;  4HAW B;  2J0J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...