1U27A

Triglycine variant of the arno pleckstrin homology domain in complex with ins(1,3,4,5)p4
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
119
structure length
119
Chain Sequence
PDREGWLLKLGGGRVKTWKRRWFILTDNCLYYFEYTTDKEPRGIIPLENLSIREVDDPRKPNCFELYIPNNKGQLIKACKTEADGRVVEGNHMVYRISAPTQEEKDEWIKSIQAAVSVD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural determinants of phosphoinositide selectivity in splice variants of Grp1 family PH domains
pubmed doi rcsb
source organism Mus musculus
molecule tags Lipid binding protein
molecule keywords Cytohesin 2
total genus 22
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2004-07-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00169 PH PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1u27A00
1MKEA 2N0YA 1P5TA 2CY4A 1BTKA 3VOQA 4K81A 1LW3A 2CAYA 4EJNA 3ODOA 1OY2A 3LJUX 1DYNA 1ZVRA 4MY6A 5DH9B 1U2BA 2IYBA 2DX1A 3PEGA 4K2PA 2EJ8A 1PMSA 2GCLA 2YS3A 3PP2A 4GMXB 4WVFB 1U5EA 3P7ZA 1SHCA 1K5DB 3A98B 2GS0A 2DYQA 3G9WA 4K2OA 1MPHA 1DROA 2LG1A 2MKRA 3QBVB 1X05A 3O96A 2OTXA 1FHXA 3FM8C 3QIJA 3PVWA 5HE2A 1FB8A 1WJMA 4WJ7A 2DA0A 5GOWB 4MK0A 1RJ2A 2DKPA 2H7DA 5FI0A 3RCPA 3SUZA 1V5MA 3AU4A 4HAYB 3TFMA 3FEHA 3ODWA 4GMVA 2LOZA 3U8ZA 3T06A 5C6RA 1TXDA 1Y19B 4A6FB 5C5BA 1Q67A 2M38A 2YT1A 5DI9B 5HE1A 2LOXA 1V88A 1UNQA 1EF1A 5DIFB 3MDBC 4GZUA 2K2JA 1FAOA 3P6AA 2DYNA 1KI1B 3KRWA 3HK0A 2GCJA 2ELAA 1P3RA 1UNPA 4KVGB 4PQ0A 1U29A 1XR0B 2UVMA 3SYXA 2VRWB 5J3YA 2MDXA 2D11A 4GXBA 4KHAA 1H10A 1XD4A 2HTHB 3M1IB 2YT0A 2EMSA 2K2UA 3ML4A 1UNRA 1PLSA 2ADZA 4L6EA 2RSGA 2D9WA 4B6HA 3ULBA 4C0AA 3KZ1A 2J0KA 2CY5A 4F7UP 3WA0A 5D3XA 2AL6A 2H7EA 2DHKA 4HDOA 5D3YA 4IFSA 5C79A 2P0FA 4PNKA 2CODA 1DDVA 1NI2A 2YVCA 1X86A 2P0HA 1V89A 2RVBB 4GN1A 1DDMA 3V5WA 4A6HA 2RLOA 2DN6A 2ROZB 4YONA 4BBKA 1MIXA 3ULCA 2Z0PA 3TO1A 1U5GA 4XWXA 5L81A 5KQ4A 1X11A 4EKUA 2Z0QA 4ZRJA 4ZRIA 3CXBB 2COFA 2GJYA 1NU2A 1BTNA 1I7AA 4H8SA 2L1CA 2UZSA 2Q13A 4DX90 3D8DA 2NZ8B 1BAKA 1LB1A 2RUKB 2X18A 1W1DA 1MK7B 1WG7A 1FGYA 3HW2B 2YS5A 3D8EA 2EC1A 1X1GA 1BWNA 3N7CA 1V5UA 2D9XA 3PVUA 2K00A 2Y8FA 2D10A 2Y8GA 4DXAB 1DBHA 5KCVA 2P0DA 2R0DA 3NSUA 2RNRB 1N3HA 1UPRA 1OQNA 4HDQA 4IAPA 2D9ZA 2YS1A 5D3WA 4A6FA 3F0WA 4HB4B 3A8QA 2I5FA 2LULA 3SO6A 2I1JA 1P6SA 1DDWA 2R09A 2ZPYA 1W1GA 4TYZA 4Y94A 2VSZA 4P7IA 2Z0OA 2W2XD 3AJ4A 3TVVA 1QQGA 2W2WA 2M14A 2HE7A 4MT7A 2MWNB 2EMTA 3DXCA 4HB0B 1U5DA 4HHVA 3CIKA 3U7DA 2BCJA 4F7HA 2XQNM 2LYDA 2VKIA 4NSWA 2JP2A 5DHFB 4CHMA 3X23A 3ZVRA 2IFSA 4DBBA 5C16A 2YF0A 3SV1A 4KAXB 5JHHA 1Y5OA 3QWMA 1MIZB 4Z2NA 2DHJA 4A5KA 4HAUB 2KGXB 4HAXB 3TW1A 2D9YA 1W1HA 2LKOA 2P8VA 1XKEA 1UPQA 3GYPA 1J19A 1NTVA 2QKMA 1KZGA 4KHOA 2DLWA 1EAZA 1AWEA 2DX5A 1TJ6A 2I1KA 1Z87A 2DTCA 3KY9A 1M7RA 1WGUA 4Z2MB 4HB3B 3PSCA 3F5RA 1RRPB 2J0JA 2W2XC 1OMWA 1V61A 5EFXA 2L2IA 1WVHA 3DXDA 5LOPB 5LONB 3GYOA 3KRXA 1ISNA 1EGXA 1WGQA 2G35A 4D0NB 3ZDTA 1TQZA 2DKQA 2DHIA 1M7EA 5JHGA 3KSYA 4HB2B 2UZRA 5FI1A 1J0WA 2Y7BA 3MPXA 2N23A 2MFQA 3HQCA 1E5WA 2J59M 1XX0A 1ZC3B 4EMOA 4IOYX 1IRSA 2AEHA 3AU5A 1MK9B 3ODXA 5D27A 3WYFB 2KCJA 2DFKA 2QKLA 4HAWB 5HE0A 2D4QA 3VIAA 2D2QA 3A8PA 3PG7A 2CRFA 4NY0A 5J3QA 1H4RA 1I2HA 5DHAB 3BJIA 1NTYA 3DXEA 1MAIA 2J0MA 4KHBB 2ELBA 3FSSA 4A6KA 4DX8A 1KZ7A 1PFJA 3OANA 1UEFA 2COCA 5J3TA 1FHOA 5JP4A 3TCAA 4CYEA 2NMBA 1WJ1A 1U27A 1WI1A 5D3VA 1XCGA 3UZTA 4HAZB 3SNHA 4F7GA 1QC6A 4ZRKA 1AQCA 3BINA 2COAA 2OQBA 4WSFA 4K17A 4TKNA 5CLLB 5C5BB 4GPTB 3PVLA 1B55A 4HAVB 2FJLA 1SGHA 2YSZA 3D8FA 1X1FA 1XODA 5JLJB 5HE3A 1U5FA 1GC7A 2ROVA 1V5PA 4CHJA 1FHWA 2V76A 5KQ1A 1GG3A 3IVFA 4YL8A 1ZSQA 4HATB 2I5CA 3PZDA 2YRYA 2PZ1A 2KUPA 1FOEA 1GC6A 2E2XA 2RGNB 1FGZA 1ZM0A 1K5GB 1ZC4B 1EVHA 5CLQB 2D9VA
chains in the Genus database with same CATH superfamily
1MKEA 2N0YA 1P5TA 4KHBA 2CY4A 2Z59A 1BTKA 3VOQA 4K81A 1LW3A 2CAYA 4EJNA 3ODOA 1OY2A 3LJUX 1DYNA 2FJUB 4D6WA 1ZVRA 4MY6A 5DH9B 2YT2A 2K8EA 1U2BA 2IYBA 2DX1A 2KR0A 3PEGA 4K2PA 2EJ8A 1PMSA 2GCLA 2YS3A 3PP2A 4GMXB 4WVFB 1U5EA 3P7ZA 1SHCA 1K5DB 3A98B 2GS0A 2KIEA 2DYQA 3G9WA 4K2OA 1MPHA 1DROA 2LG1A 2MKRA 3QBVB 1X05A 3O96A 2OTXA 1FHXA 3FM8C 3QIJA 4GNKB 3PVWA 5HE2A 1FB8A 1WJMA 4WJ7A 2DA0A 5GOWB 4MK0A 1RJ2A 3FVCA 2DKPA 2H7DA 5FI0A 3RCPA 3SUZA 1V5MA 3AU4A 4HAYB 3TFMA 3FEHA 3ODWA 4GMVA 2LOZA 3U8ZA 3T06A 5C6RA 1TXDA 1Y19B 4A6FB 5C5BA 1Q67A 2M38A 2YT1A 5DI9B 5HE1A 2LOXA 3NWFA 1V88A 5LG4B 1UNQA 1EF1A 2R2YA 5DIFB 3MDBC 4GZUA 2K2JA 1FAOA 3P6AA 2DYNA 1KI1B 3KRWA 3HK0A 2GCJA 2ELAA 1P3RA 3A58A 1UNPA 4KVGB 4PQ0A 1U29A 1XR0B 2UVMA 3SYXA 2VRWB 5J3YA 2MDXA 2D11A 4GXBA 4KHAA 1H10A 1XD4A 2ZKMX 2HTHB 3M1IB 2YT0A 2EMSA 2K2UA 3ML4A 1UNRA 1PLSA 2ADZA 4L6EA 2RSGA 2D9WA 4B6HA 3ULBA 4C0AA 3KZ1A 2J0KA 2CY5A 4F7UP 3WA0A 5D3XA 2AL6A 2H7EA 2DHKA 4HDOA 5D3YA 4IFSA 5C79A 2P0FA 4PNKA 4DIXA 2CODA 1DDVA 1NI2A 2YVCA 1X86A 2KIGA 2NBVA 2P0HA 1V89A 2RVBB 4GN1A 1DDMA 3V5WA 4A6HA 2RLOA 3HSAA 2DN6A 2ROZB 4YONA 4BBKA 1MIXA 3ULCA 2Z0PA 3TO1A 1U5GA 4XWXA 5I2MA 5L81A 5KQ4A 1X11A 2Z13A 4EKUA 2Z0QA 4ZRJA 4ZRIA 3CXBB 2COFA 2GJYA 1NU2A 1BTNA 1I7AA 4H8SA 2L1CA 2UZSA 2Q13A 1ZYIA 4DX90 3D8DA 2NZ8B 1BAKA 1LB1A 2RUKB 2X18A 1MI1A 3U12A 4QJ5B 1W1DA 1MK7B 1WG7A 1FGYA 3HW2B 3NW8A 2YS5A 3D8EA 4HSIA 2EC1A 1X1GA 1BWNA 3N7CA 1V5UA 2D9XA 3PVUA 2K00A 2Y8FA 2D10A 2Y8GA 4DXAB 1DBHA 5KCVA 2P0DA 5IRSA 2R0DA 4QJ3B 3NSUA 2RNRB 4CSQA 1N3HA 1UPRA 1OQNA 4HDQA 4IAPA 2D9ZA 2YS1A 5D3WA 4A6FA 3F0WA 3B77A 4HB4B 3A8QA 2I5FA 2LULA 3SO6A 2I1JA 1P6SA 1DDWA 4OSNA 2R09A 2ZPYA 1W1GA 4TYZA 4Y94A 2VSZA 4P7IA 2Z0OA 2W2XD 3AJ4A 4GOUA 3TVVA 1QQGA 2W2WA 2M14A 2HE7A 4OT1A 4MT7A 2MWNB 2EMTA 3DXCA 4HB0B 1U5DA 4HHVA 3CIKA 3U7DA 2BCJA 4F7HA 2XQNM 2LYDA 2VKIA 4NSWA 2JP2A 5DHFB 4CHMA 3X23A 3ZVRA 2IFSA 4DBBA 5C16A 2YF0A 3SV1A 4KAXB 5JHHA 1Y5OA 3QWMA 1MIZB 4Z2NA 2DHJA 1T77A 4A5KA 4HAUB 2KGXB 4HAXB 3TW1A 2D9YA 1W1HA 2LKOA 2P8VA 1XKEA 1UPQA 3GYPA 1J19A 1NTVA 2QKMA 1KZGA 4KHOA 2DLWA 1EAZA 1AWEA 2DX5A 3DCXA 1TJ6A 2I1KA 1Z87A 2DTCA 3KY9A 1M7RA 1WGUA 4Z2MB 5I2SA 2Z4DA 2K49A 4HB3B 3PSCA 3F5RA 1RRPB 2J0JA 2W2XC 1OMWA 1V61A 5EFXA 2L2IA 1WVHA 3DXDA 5LOPB 5LONB 3GYOA 3KRXA 1ISNA 1EGXA 1WGQA 2G35A 4D0NB 3ZDTA 1TQZA 2DKQA 2DHIA 1M7EA 5JHGA 3KSYA 4HB2B 2UZRA 5FI1A 1J0WA 2Y7BA 3MPXA 2N23A 2MFQA 3HQCA 1E5WA 2J59M 1XX0A 1ZC3B 4EMOA 4IOYX 1IRSA 2AEHA 3AU5A 1MK9B 3ODXA 5D27A 3WYFB 2KCJA 2DFKA 2QKLA 4HAWB 4L1RA 2GUMA 5HE0A 2D4QA 2Z14A 4QJ4B 3VIAA 2D2QA 3A8PA 3PG7A 2CRFA 4NY0A 3NWAA 5J3QA 1H4RA 1I2HA 5DHAB 3BJIA 1NTYA 3DXEA 1MAIA 2J0MA 3NWDA 4KHBB 2ELBA 3FSSA 4A6KA 4DX8A 1KZ7A 3HIEA 1PFJA 3OANA 1UEFA 2COCA 2KUQA 5J3TA 1FHOA 5JP4A 3TCAA 4CYEA 2NMBA 1WJ1A 1U27A 1WI1A 5D3VA 1XCGA 3UZTA 4HAZB 3SNHA 4F7GA 1QC6A 4ZRKA 1AQCA 3BINA 2COAA 2OQBA 4WSFA 4K17A 5M4YB 4TKNA 5CLLB 5C5BB 4GPTB 3PVLA 1B55A 4HAVB 2FJLA 1SGHA 2YSZA 3D8FA 1X1FA 1XODA 5JLJB 5HE3A 1U5FA 1GC7A 2ROVA 1V5PA 4CHJA 1FHWA 2V76A 5KQ1A 1GG3A 3IVFA 4YL8A 1ZSQA 4HATB 2I5CA 3PZDA 2YRYA 4QXAB 2PZ1A 3OHMB 2KUPA 1FOEA 1GC6A 2E2XA 2RGNB 1FGZA 1ZM0A 1K5GB 1ZC4B 2RRFA 1EVHA 5CLQB 2D9VA
chains in the Genus database with same CATH topology
1MKEA 2N0YA 1P5TA 2CY4A 1BTKA 3VOQA 4K81A 1LW3A 2CAYA 4EJNA 3ODOA 1OY2A 3LJUX 1DYNA 1ZVRA 4MY6A 5DH9B 1U2BA 2IYBA 2DX1A 3PEGA 4K2PA 2EJ8A 1PMSA 2GCLA 2YS3A 3PP2A 4GMXB 4WVFB 1U5EA 3P7ZA 1SHCA 1K5DB 3A98B 2GS0A 2DYQA 3G9WA 4K2OA 1MPHA 1DROA 2LG1A 2MKRA 3QBVB 1X05A 3O96A 2OTXA 1FHXA 3FM8C 3QIJA 3PVWA 5HE2A 1FB8A 1WJMA 4WJ7A 2DA0A 5GOWB 4MK0A 1RJ2A 2DKPA 2H7DA 5FI0A 3RCPA 3SUZA 1V5MA 3AU4A 4HAYB 3TFMA 3FEHA 3ODWA 4GMVA 2LOZA 3U8ZA 3T06A 5C6RA 1TXDA 1Y19B 4A6FB 5C5BA 1Q67A 2M38A 2YT1A 5DI9B 5HE1A 2LOXA 1V88A 1UNQA 1EF1A 5DIFB 3MDBC 4GZUA 2K2JA 1FAOA 3P6AA 2DYNA 1KI1B 3KRWA 3HK0A 2GCJA 2ELAA 1P3RA 1UNPA 4KVGB 4PQ0A 1U29A 1XR0B 2UVMA 3SYXA 2VRWB 5J3YA 2MDXA 2D11A 4GXBA 4KHAA 1H10A 1XD4A 2HTHB 3M1IB 2YT0A 2EMSA 2K2UA 3ML4A 1UNRA 1PLSA 2ADZA 4L6EA 2RSGA 2D9WA 4B6HA 3ULBA 4C0AA 3KZ1A 2J0KA 2CY5A 4F7UP 3WA0A 5D3XA 2AL6A 2H7EA 2DHKA 4HDOA 5D3YA 4IFSA 5C79A 2P0FA 4PNKA 2CODA 1DDVA 1NI2A 2YVCA 1X86A 2P0HA 1V89A 2RVBB 4GN1A 1DDMA 3V5WA 4A6HA 2RLOA 2DN6A 2ROZB 4YONA 4BBKA 1MIXA 3ULCA 2Z0PA 3TO1A 1U5GA 4XWXA 5L81A 5KQ4A 1X11A 4EKUA 2Z0QA 4ZRJA 4ZRIA 3CXBB 2COFA 2GJYA 1NU2A 1BTNA 1I7AA 4H8SA 2L1CA 2UZSA 2Q13A 4DX90 3D8DA 2NZ8B 1BAKA 1LB1A 2RUKB 2X18A 1W1DA 1MK7B 1WG7A 1FGYA 3HW2B 2YS5A 3D8EA 2EC1A 1X1GA 1BWNA 3N7CA 1V5UA 2D9XA 3PVUA 2K00A 2Y8FA 2D10A 2Y8GA 4DXAB 1DBHA 5KCVA 2P0DA 2R0DA 3NSUA 2RNRB 1N3HA 1UPRA 1OQNA 4HDQA 4IAPA 2D9ZA 2YS1A 5D3WA 4A6FA 3F0WA 4HB4B 3A8QA 2I5FA 2LULA 3SO6A 2I1JA 1P6SA 1DDWA 2R09A 2ZPYA 1W1GA 4TYZA 4Y94A 2VSZA 4P7IA 2Z0OA 2W2XD 3AJ4A 3TVVA 1QQGA 2W2WA 2M14A 2HE7A 4MT7A 2MWNB 2EMTA 3DXCA 4HB0B 1U5DA 4HHVA 3CIKA 3U7DA 2BCJA 4F7HA 2XQNM 2LYDA 2VKIA 4NSWA 2JP2A 5DHFB 4CHMA 3X23A 3ZVRA 2IFSA 4DBBA 5C16A 2YF0A 3SV1A 4KAXB 5JHHA 1Y5OA 3QWMA 1MIZB 4Z2NA 2DHJA 4A5KA 4HAUB 2KGXB 4HAXB 3TW1A 2D9YA 1W1HA 2LKOA 2P8VA 1XKEA 1UPQA 3GYPA 1J19A 1NTVA 2QKMA 1KZGA 4KHOA 2DLWA 1EAZA 1AWEA 2DX5A 1TJ6A 2I1KA 1Z87A 2DTCA 3KY9A 1M7RA 1WGUA 4Z2MB 4HB3B 3PSCA 3F5RA 1RRPB 2J0JA 2W2XC 1OMWA 1V61A 5EFXA 2L2IA 1WVHA 3DXDA 5LOPB 5LONB 3GYOA 3KRXA 1ISNA 1EGXA 1WGQA 2G35A 4D0NB 3ZDTA 1TQZA 2DKQA 2DHIA 1M7EA 5JHGA 3KSYA 4HB2B 2UZRA 5FI1A 1J0WA 2Y7BA 3MPXA 2N23A 2MFQA 3HQCA 1E5WA 2J59M 1XX0A 1ZC3B 4EMOA 4IOYX 1IRSA 2AEHA 3AU5A 1MK9B 3ODXA 5D27A 3WYFB 2KCJA 2DFKA 2QKLA 4HAWB 5HE0A 2D4QA 3VIAA 2D2QA 3A8PA 3PG7A 2CRFA 4NY0A 5J3QA 1H4RA 1I2HA 5DHAB 3BJIA 1NTYA 3DXEA 1MAIA 2J0MA 4KHBB 2ELBA 3FSSA 4A6KA 4DX8A 1KZ7A 1PFJA 3OANA 1UEFA 2COCA 5J3TA 1FHOA 5JP4A 3TCAA 4CYEA 2NMBA 1WJ1A 1U27A 1WI1A 5D3VA 1XCGA 3UZTA 4HAZB 3SNHA 4F7GA 1QC6A 4ZRKA 1AQCA 3BINA 2COAA 2OQBA 4WSFA 4K17A 4TKNA 5CLLB 5C5BB 4GPTB 3PVLA 1B55A 4HAVB 2FJLA 1SGHA 2YSZA 3D8FA 1X1FA 1XODA 5JLJB 5HE3A 1U5FA 1GC7A 2ROVA 1V5PA 4CHJA 1FHWA 2V76A 5KQ1A 1GG3A 3IVFA 4YL8A 1ZSQA 4HATB 2I5CA 3PZDA 2YRYA 2PZ1A 2KUPA 1FOEA 1GC6A 2E2XA 2RGNB 1FGZA 1ZM0A 1K5GB 1ZC4B 1EVHA 5CLQB 2D9VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MKE A;  2N0Y A;  1P5T A;  2CY4 A;  1BTK A;  3VOQ A;  4K81 A;  1LW3 A;  2CAY A;  4EJN A;  3ODO A;  1OY2 A;  3LJU X;  1DYN A;  1ZVR A;  4MY6 A;  5DH9 B;  1U2B A;  2IYB A;  2DX1 A;  3PEG A;  4K2P A;  2EJ8 A;  1PMS A;  2GCL A;  2YS3 A;  3PP2 A;  4GMX B;  4WVF B;  1U5E A;  3P7Z A;  1SHC A;  1K5D B;  3A98 B;  2GS0 A;  2DYQ A;  3G9W A;  4K2O A;  1MPH A;  1DRO A;  2LG1 A;  2MKR A;  3QBV B;  1X05 A;  3O96 A;  2OTX A;  1FHX A;  3FM8 C;  3QIJ A;  3PVW A;  5HE2 A;  1FB8 A;  1WJM A;  4WJ7 A;  2DA0 A;  5GOW B;  4MK0 A;  1RJ2 A;  2DKP A;  2H7D A;  5FI0 A;  3RCP A;  3SUZ A;  1V5M A;  3AU4 A;  4HAY B;  3TFM A;  3FEH A;  3ODW A;  4GMV A;  2LOZ A;  3U8Z A;  3T06 A;  5C6R A;  1TXD A;  1Y19 B;  4A6F B;  5C5B A;  1Q67 A;  2M38 A;  2YT1 A;  5DI9 B;  5HE1 A;  2LOX A;  1V88 A;  1UNQ A;  1EF1 A;  5DIF B;  3MDB C;  4GZU A;  2K2J A;  1FAO A;  3P6A A;  2DYN A;  1KI1 B;  3KRW A;  3HK0 A;  2GCJ A;  2ELA A;  1P3R A;  1UNP A;  4KVG B;  4PQ0 A;  1U29 A;  1XR0 B;  2UVM A;  3SYX A;  2VRW B;  5J3Y A;  2MDX A;  2D11 A;  4GXB A;  4KHA A;  1H10 A;  1XD4 A;  2HTH B;  3M1I B;  2YT0 A;  2EMS A;  2K2U A;  3ML4 A;  1UNR A;  1PLS A;  2ADZ A;  4L6E A;  2RSG A;  2D9W A;  4B6H A;  3ULB A;  4C0A A;  3KZ1 A;  2J0K A;  2CY5 A;  4F7U P;  3WA0 A;  5D3X A;  2AL6 A;  2H7E A;  2DHK A;  4HDO A;  5D3Y A;  4IFS A;  5C79 A;  2P0F A;  4PNK A;  2COD A;  1DDV A;  1NI2 A;  2YVC A;  1X86 A;  2P0H A;  1V89 A;  2RVB B;  4GN1 A;  1DDM A;  3V5W A;  4A6H A;  2RLO A;  2DN6 A;  2ROZ B;  4YON A;  4BBK A;  1MIX A;  3ULC A;  2Z0P A;  3TO1 A;  1U5G A;  4XWX A;  5L81 A;  5KQ4 A;  1X11 A;  4EKU A;  2Z0Q A;  4ZRJ A;  4ZRI A;  3CXB B;  2COF A;  2GJY A;  1NU2 A;  1BTN A;  1I7A A;  4H8S A;  2L1C A;  2UZS A;  2Q13 A;  4DX9 0;  3D8D A;  2NZ8 B;  1BAK A;  1LB1 A;  2RUK B;  2X18 A;  1W1D A;  1MK7 B;  1WG7 A;  1FGY A;  3HW2 B;  2YS5 A;  3D8E A;  2EC1 A;  1X1G A;  1BWN A;  3N7C A;  1V5U A;  2D9X A;  3PVU A;  2K00 A;  2Y8F A;  2D10 A;  2Y8G A;  4DXA B;  1DBH A;  5KCV A;  2P0D A;  2R0D A;  3NSU A;  2RNR B;  1N3H A;  1UPR A;  1OQN A;  4HDQ A;  4IAP A;  2D9Z A;  2YS1 A;  5D3W A;  4A6F A;  3F0W A;  4HB4 B;  3A8Q A;  2I5F A;  2LUL A;  3SO6 A;  2I1J A;  1P6S A;  1DDW A;  2R09 A;  2ZPY A;  1W1G A;  4TYZ A;  4Y94 A;  2VSZ A;  4P7I A;  2Z0O A;  2W2X D;  3AJ4 A;  3TVV A;  1QQG A;  2W2W A;  2M14 A;  2HE7 A;  4MT7 A;  2MWN B;  2EMT A;  3DXC A;  4HB0 B;  1U5D A;  4HHV A;  3CIK A;  3U7D A;  2BCJ A;  4F7H A;  2XQN M;  2LYD A;  2VKI A;  4NSW A;  2JP2 A;  5DHF B;  4CHM A;  3X23 A;  3ZVR A;  2IFS A;  4DBB A;  5C16 A;  2YF0 A;  3SV1 A;  4KAX B;  5JHH A;  1Y5O A;  3QWM A;  1MIZ B;  4Z2N A;  2DHJ A;  4A5K A;  4HAU B;  2KGX B;  4HAX B;  3TW1 A;  2D9Y A;  1W1H A;  2LKO A;  2P8V A;  1XKE A;  1UPQ A;  3GYP A;  1J19 A;  1NTV A;  2QKM A;  1KZG A;  4KHO A;  2DLW A;  1EAZ A;  1AWE A;  2DX5 A;  1TJ6 A;  2I1K A;  1Z87 A;  2DTC A;  3KY9 A;  1M7R A;  1WGU A;  4Z2M B;  4HB3 B;  3PSC A;  3F5R A;  1RRP B;  2J0J A;  2W2X C;  1OMW A;  1V61 A;  5EFX A;  2L2I A;  1WVH A;  3DXD A;  5LOP B;  5LON B;  3GYO A;  3KRX A;  1ISN A;  1EGX A;  1WGQ A;  2G35 A;  4D0N B;  3ZDT A;  1TQZ A;  2DKQ A;  2DHI A;  1M7E A;  5JHG A;  3KSY A;  4HB2 B;  2UZR A;  5FI1 A;  1J0W A;  2Y7B A;  3MPX A;  2N23 A;  2MFQ A;  3HQC A;  1E5W A;  2J59 M;  1XX0 A;  1ZC3 B;  4EMO A;  4IOY X;  1IRS A;  2AEH A;  3AU5 A;  1MK9 B;  3ODX A;  5D27 A;  3WYF B;  2KCJ A;  2DFK A;  2QKL A;  4HAW B;  5HE0 A;  2D4Q A;  3VIA A;  2D2Q A;  3A8P A;  3PG7 A;  2CRF A;  4NY0 A;  5J3Q A;  1H4R A;  1I2H A;  5DHA B;  3BJI A;  1NTY A;  3DXE A;  1MAI A;  2J0M A;  4KHB B;  2ELB A;  3FSS A;  4A6K A;  4DX8 A;  1KZ7 A;  1PFJ A;  3OAN A;  1UEF A;  2COC A;  5J3T A;  1FHO A;  5JP4 A;  3TCA A;  4CYE A;  2NMB A;  1WJ1 A;  1U27 A;  1WI1 A;  5D3V A;  1XCG A;  3UZT A;  4HAZ B;  3SNH A;  4F7G A;  1QC6 A;  4ZRK A;  1AQC A;  3BIN A;  2COA A;  2OQB A;  4WSF A;  4K17 A;  4TKN A;  5CLL B;  5C5B B;  4GPT B;  3PVL A;  1B55 A;  4HAV B;  2FJL A;  1SGH A;  2YSZ A;  3D8F A;  1X1F A;  1XOD A;  5JLJ B;  5HE3 A;  1U5F A;  1GC7 A;  2ROV A;  1V5P A;  4CHJ A;  1FHW A;  2V76 A;  5KQ1 A;  1GG3 A;  3IVF A;  4YL8 A;  1ZSQ A;  4HAT B;  2I5C A;  3PZD A;  2YRY A;  2PZ1 A;  2KUP A;  1FOE A;  1GC6 A;  2E2X A;  2RGN B;  1FGZ A;  1ZM0 A;  1K5G B;  1ZC4 B;  1EVH A;  5CLQ B;  2D9V A; 
#chains in the Genus database with same CATH topology
 1MKE A;  2N0Y A;  1P5T A;  4KHB A;  2CY4 A;  2Z59 A;  1BTK A;  3VOQ A;  4K81 A;  1LW3 A;  2CAY A;  4EJN A;  3ODO A;  1OY2 A;  3LJU X;  1DYN A;  2FJU B;  4D6W A;  1ZVR A;  4MY6 A;  5DH9 B;  2YT2 A;  2K8E A;  1U2B A;  2IYB A;  2DX1 A;  2KR0 A;  3PEG A;  4K2P A;  2EJ8 A;  1PMS A;  2GCL A;  2YS3 A;  3PP2 A;  4GMX B;  4WVF B;  1U5E A;  3P7Z A;  1SHC A;  1K5D B;  3A98 B;  2GS0 A;  2KIE A;  2DYQ A;  3G9W A;  4K2O A;  1MPH A;  1DRO A;  2LG1 A;  2MKR A;  3QBV B;  1X05 A;  3O96 A;  2OTX A;  1FHX A;  3FM8 C;  3QIJ A;  4GNK B;  3PVW A;  5HE2 A;  1FB8 A;  1WJM A;  4WJ7 A;  2DA0 A;  5GOW B;  4MK0 A;  1RJ2 A;  3FVC A;  2DKP A;  2H7D A;  5FI0 A;  3RCP A;  3SUZ A;  1V5M A;  3AU4 A;  4HAY B;  3TFM A;  3FEH A;  3ODW A;  4GMV A;  2LOZ A;  3U8Z A;  3T06 A;  5C6R A;  1TXD A;  1Y19 B;  4A6F B;  5C5B A;  1Q67 A;  2M38 A;  2YT1 A;  5DI9 B;  5HE1 A;  2LOX A;  3NWF A;  1V88 A;  5LG4 B;  1UNQ A;  1EF1 A;  2R2Y A;  5DIF B;  3MDB C;  4GZU A;  2K2J A;  1FAO A;  3P6A A;  2DYN A;  1KI1 B;  3KRW A;  3HK0 A;  2GCJ A;  2ELA A;  1P3R A;  3A58 A;  1UNP A;  4KVG B;  4PQ0 A;  1U29 A;  1XR0 B;  2UVM A;  3SYX A;  2VRW B;  5J3Y A;  2MDX A;  2D11 A;  4GXB A;  4KHA A;  1H10 A;  1XD4 A;  2ZKM X;  2HTH B;  3M1I B;  2YT0 A;  2EMS A;  2K2U A;  3ML4 A;  1UNR A;  1PLS A;  2ADZ A;  4L6E A;  2RSG A;  2D9W A;  4B6H A;  3ULB A;  4C0A A;  3KZ1 A;  2J0K A;  2CY5 A;  4F7U P;  3WA0 A;  5D3X A;  2AL6 A;  2H7E A;  2DHK A;  4HDO A;  5D3Y A;  4IFS A;  5C79 A;  2P0F A;  4PNK A;  4DIX A;  2COD A;  1DDV A;  1NI2 A;  2YVC A;  1X86 A;  2KIG A;  2NBV A;  2P0H A;  1V89 A;  2RVB B;  4GN1 A;  1DDM A;  3V5W A;  4A6H A;  2RLO A;  3HSA A;  2DN6 A;  2ROZ B;  4YON A;  4BBK A;  1MIX A;  3ULC A;  2Z0P A;  3TO1 A;  1U5G A;  4XWX A;  5I2M A;  5L81 A;  5KQ4 A;  1X11 A;  2Z13 A;  4EKU A;  2Z0Q A;  4ZRJ A;  4ZRI A;  3CXB B;  2COF A;  2GJY A;  1NU2 A;  1BTN A;  1I7A A;  4H8S A;  2L1C A;  2UZS A;  2Q13 A;  1ZYI A;  4DX9 0;  3D8D A;  2NZ8 B;  1BAK A;  1LB1 A;  2RUK B;  2X18 A;  1MI1 A;  3U12 A;  4QJ5 B;  1W1D A;  1MK7 B;  1WG7 A;  1FGY A;  3HW2 B;  3NW8 A;  2YS5 A;  3D8E A;  4HSI A;  2EC1 A;  1X1G A;  1BWN A;  3N7C A;  1V5U A;  2D9X A;  3PVU A;  2K00 A;  2Y8F A;  2D10 A;  2Y8G A;  4DXA B;  1DBH A;  5KCV A;  2P0D A;  5IRS A;  2R0D A;  4QJ3 B;  3NSU A;  2RNR B;  4CSQ A;  1N3H A;  1UPR A;  1OQN A;  4HDQ A;  4IAP A;  2D9Z A;  2YS1 A;  5D3W A;  4A6F A;  3F0W A;  3B77 A;  4HB4 B;  3A8Q A;  2I5F A;  2LUL A;  3SO6 A;  2I1J A;  1P6S A;  1DDW A;  4OSN A;  2R09 A;  2ZPY A;  1W1G A;  4TYZ A;  4Y94 A;  2VSZ A;  4P7I A;  2Z0O A;  2W2X D;  3AJ4 A;  4GOU A;  3TVV A;  1QQG A;  2W2W A;  2M14 A;  2HE7 A;  4OT1 A;  4MT7 A;  2MWN B;  2EMT A;  3DXC A;  4HB0 B;  1U5D A;  4HHV A;  3CIK A;  3U7D A;  2BCJ A;  4F7H A;  2XQN M;  2LYD A;  2VKI A;  4NSW A;  2JP2 A;  5DHF B;  4CHM A;  3X23 A;  3ZVR A;  2IFS A;  4DBB A;  5C16 A;  2YF0 A;  3SV1 A;  4KAX B;  5JHH A;  1Y5O A;  3QWM A;  1MIZ B;  4Z2N A;  2DHJ A;  1T77 A;  4A5K A;  4HAU B;  2KGX B;  4HAX B;  3TW1 A;  2D9Y A;  1W1H A;  2LKO A;  2P8V A;  1XKE A;  1UPQ A;  3GYP A;  1J19 A;  1NTV A;  2QKM A;  1KZG A;  4KHO A;  2DLW A;  1EAZ A;  1AWE A;  2DX5 A;  3DCX A;  1TJ6 A;  2I1K A;  1Z87 A;  2DTC A;  3KY9 A;  1M7R A;  1WGU A;  4Z2M B;  5I2S A;  2Z4D A;  2K49 A;  4HB3 B;  3PSC A;  3F5R A;  1RRP B;  2J0J A;  2W2X C;  1OMW A;  1V61 A;  5EFX A;  2L2I A;  1WVH A;  3DXD A;  5LOP B;  5LON B;  3GYO A;  3KRX A;  1ISN A;  1EGX A;  1WGQ A;  2G35 A;  4D0N B;  3ZDT A;  1TQZ A;  2DKQ A;  2DHI A;  1M7E A;  5JHG A;  3KSY A;  4HB2 B;  2UZR A;  5FI1 A;  1J0W A;  2Y7B A;  3MPX A;  2N23 A;  2MFQ A;  3HQC A;  1E5W A;  2J59 M;  1XX0 A;  1ZC3 B;  4EMO A;  4IOY X;  1IRS A;  2AEH A;  3AU5 A;  1MK9 B;  3ODX A;  5D27 A;  3WYF B;  2KCJ A;  2DFK A;  2QKL A;  4HAW B;  4L1R A;  2GUM A;  5HE0 A;  2D4Q A;  2Z14 A;  4QJ4 B;  3VIA A;  2D2Q A;  3A8P A;  3PG7 A;  2CRF A;  4NY0 A;  3NWA A;  5J3Q A;  1H4R A;  1I2H A;  5DHA B;  3BJI A;  1NTY A;  3DXE A;  1MAI A;  2J0M A;  3NWD A;  4KHB B;  2ELB A;  3FSS A;  4A6K A;  4DX8 A;  1KZ7 A;  3HIE A;  1PFJ A;  3OAN A;  1UEF A;  2COC A;  2KUQ A;  5J3T A;  1FHO A;  5JP4 A;  3TCA A;  4CYE A;  2NMB A;  1WJ1 A;  1U27 A;  1WI1 A;  5D3V A;  1XCG A;  3UZT A;  4HAZ B;  3SNH A;  4F7G A;  1QC6 A;  4ZRK A;  1AQC A;  3BIN A;  2COA A;  2OQB A;  4WSF A;  4K17 A;  5M4Y B;  4TKN A;  5CLL B;  5C5B B;  4GPT B;  3PVL A;  1B55 A;  4HAV B;  2FJL A;  1SGH A;  2YSZ A;  3D8F A;  1X1F A;  1XOD A;  5JLJ B;  5HE3 A;  1U5F A;  1GC7 A;  2ROV A;  1V5P A;  4CHJ A;  1FHW A;  2V76 A;  5KQ1 A;  1GG3 A;  3IVF A;  4YL8 A;  1ZSQ A;  4HAT B;  2I5C A;  3PZD A;  2YRY A;  4QXA B;  2PZ1 A;  3OHM B;  2KUP A;  1FOE A;  1GC6 A;  2E2X A;  2RGN B;  1FGZ A;  1ZM0 A;  1K5G B;  1ZC4 B;  2RRF A;  1EVH A;  5CLQ B;  2D9V A; 
#chains in the Genus database with same CATH homology
 1MKE A;  2N0Y A;  1P5T A;  2CY4 A;  1BTK A;  3VOQ A;  4K81 A;  1LW3 A;  2CAY A;  4EJN A;  3ODO A;  1OY2 A;  3LJU X;  1DYN A;  1ZVR A;  4MY6 A;  5DH9 B;  1U2B A;  2IYB A;  2DX1 A;  3PEG A;  4K2P A;  2EJ8 A;  1PMS A;  2GCL A;  2YS3 A;  3PP2 A;  4GMX B;  4WVF B;  1U5E A;  3P7Z A;  1SHC A;  1K5D B;  3A98 B;  2GS0 A;  2DYQ A;  3G9W A;  4K2O A;  1MPH A;  1DRO A;  2LG1 A;  2MKR A;  3QBV B;  1X05 A;  3O96 A;  2OTX A;  1FHX A;  3FM8 C;  3QIJ A;  3PVW A;  5HE2 A;  1FB8 A;  1WJM A;  4WJ7 A;  2DA0 A;  5GOW B;  4MK0 A;  1RJ2 A;  2DKP A;  2H7D A;  5FI0 A;  3RCP A;  3SUZ A;  1V5M A;  3AU4 A;  4HAY B;  3TFM A;  3FEH A;  3ODW A;  4GMV A;  2LOZ A;  3U8Z A;  3T06 A;  5C6R A;  1TXD A;  1Y19 B;  4A6F B;  5C5B A;  1Q67 A;  2M38 A;  2YT1 A;  5DI9 B;  5HE1 A;  2LOX A;  1V88 A;  1UNQ A;  1EF1 A;  5DIF B;  3MDB C;  4GZU A;  2K2J A;  1FAO A;  3P6A A;  2DYN A;  1KI1 B;  3KRW A;  3HK0 A;  2GCJ A;  2ELA A;  1P3R A;  1UNP A;  4KVG B;  4PQ0 A;  1U29 A;  1XR0 B;  2UVM A;  3SYX A;  2VRW B;  5J3Y A;  2MDX A;  2D11 A;  4GXB A;  4KHA A;  1H10 A;  1XD4 A;  2HTH B;  3M1I B;  2YT0 A;  2EMS A;  2K2U A;  3ML4 A;  1UNR A;  1PLS A;  2ADZ A;  4L6E A;  2RSG A;  2D9W A;  4B6H A;  3ULB A;  4C0A A;  3KZ1 A;  2J0K A;  2CY5 A;  4F7U P;  3WA0 A;  5D3X A;  2AL6 A;  2H7E A;  2DHK A;  4HDO A;  5D3Y A;  4IFS A;  5C79 A;  2P0F A;  4PNK A;  2COD A;  1DDV A;  1NI2 A;  2YVC A;  1X86 A;  2P0H A;  1V89 A;  2RVB B;  4GN1 A;  1DDM A;  3V5W A;  4A6H A;  2RLO A;  2DN6 A;  2ROZ B;  4YON A;  4BBK A;  1MIX A;  3ULC A;  2Z0P A;  3TO1 A;  1U5G A;  4XWX A;  5L81 A;  5KQ4 A;  1X11 A;  4EKU A;  2Z0Q A;  4ZRJ A;  4ZRI A;  3CXB B;  2COF A;  2GJY A;  1NU2 A;  1BTN A;  1I7A A;  4H8S A;  2L1C A;  2UZS A;  2Q13 A;  4DX9 0;  3D8D A;  2NZ8 B;  1BAK A;  1LB1 A;  2RUK B;  2X18 A;  1W1D A;  1MK7 B;  1WG7 A;  1FGY A;  3HW2 B;  2YS5 A;  3D8E A;  2EC1 A;  1X1G A;  1BWN A;  3N7C A;  1V5U A;  2D9X A;  3PVU A;  2K00 A;  2Y8F A;  2D10 A;  2Y8G A;  4DXA B;  1DBH A;  5KCV A;  2P0D A;  2R0D A;  3NSU A;  2RNR B;  1N3H A;  1UPR A;  1OQN A;  4HDQ A;  4IAP A;  2D9Z A;  2YS1 A;  5D3W A;  4A6F A;  3F0W A;  4HB4 B;  3A8Q A;  2I5F A;  2LUL A;  3SO6 A;  2I1J A;  1P6S A;  1DDW A;  2R09 A;  2ZPY A;  1W1G A;  4TYZ A;  4Y94 A;  2VSZ A;  4P7I A;  2Z0O A;  2W2X D;  3AJ4 A;  3TVV A;  1QQG A;  2W2W A;  2M14 A;  2HE7 A;  4MT7 A;  2MWN B;  2EMT A;  3DXC A;  4HB0 B;  1U5D A;  4HHV A;  3CIK A;  3U7D A;  2BCJ A;  4F7H A;  2XQN M;  2LYD A;  2VKI A;  4NSW A;  2JP2 A;  5DHF B;  4CHM A;  3X23 A;  3ZVR A;  2IFS A;  4DBB A;  5C16 A;  2YF0 A;  3SV1 A;  4KAX B;  5JHH A;  1Y5O A;  3QWM A;  1MIZ B;  4Z2N A;  2DHJ A;  4A5K A;  4HAU B;  2KGX B;  4HAX B;  3TW1 A;  2D9Y A;  1W1H A;  2LKO A;  2P8V A;  1XKE A;  1UPQ A;  3GYP A;  1J19 A;  1NTV A;  2QKM A;  1KZG A;  4KHO A;  2DLW A;  1EAZ A;  1AWE A;  2DX5 A;  1TJ6 A;  2I1K A;  1Z87 A;  2DTC A;  3KY9 A;  1M7R A;  1WGU A;  4Z2M B;  4HB3 B;  3PSC A;  3F5R A;  1RRP B;  2J0J A;  2W2X C;  1OMW A;  1V61 A;  5EFX A;  2L2I A;  1WVH A;  3DXD A;  5LOP B;  5LON B;  3GYO A;  3KRX A;  1ISN A;  1EGX A;  1WGQ A;  2G35 A;  4D0N B;  3ZDT A;  1TQZ A;  2DKQ A;  2DHI A;  1M7E A;  5JHG A;  3KSY A;  4HB2 B;  2UZR A;  5FI1 A;  1J0W A;  2Y7B A;  3MPX A;  2N23 A;  2MFQ A;  3HQC A;  1E5W A;  2J59 M;  1XX0 A;  1ZC3 B;  4EMO A;  4IOY X;  1IRS A;  2AEH A;  3AU5 A;  1MK9 B;  3ODX A;  5D27 A;  3WYF B;  2KCJ A;  2DFK A;  2QKL A;  4HAW B;  5HE0 A;  2D4Q A;  3VIA A;  2D2Q A;  3A8P A;  3PG7 A;  2CRF A;  4NY0 A;  5J3Q A;  1H4R A;  1I2H A;  5DHA B;  3BJI A;  1NTY A;  3DXE A;  1MAI A;  2J0M A;  4KHB B;  2ELB A;  3FSS A;  4A6K A;  4DX8 A;  1KZ7 A;  1PFJ A;  3OAN A;  1UEF A;  2COC A;  5J3T A;  1FHO A;  5JP4 A;  3TCA A;  4CYE A;  2NMB A;  1WJ1 A;  1U27 A;  1WI1 A;  5D3V A;  1XCG A;  3UZT A;  4HAZ B;  3SNH A;  4F7G A;  1QC6 A;  4ZRK A;  1AQC A;  3BIN A;  2COA A;  2OQB A;  4WSF A;  4K17 A;  4TKN A;  5CLL B;  5C5B B;  4GPT B;  3PVL A;  1B55 A;  4HAV B;  2FJL A;  1SGH A;  2YSZ A;  3D8F A;  1X1F A;  1XOD A;  5JLJ B;  5HE3 A;  1U5F A;  1GC7 A;  2ROV A;  1V5P A;  4CHJ A;  1FHW A;  2V76 A;  5KQ1 A;  1GG3 A;  3IVF A;  4YL8 A;  1ZSQ A;  4HAT B;  2I5C A;  3PZD A;  2YRY A;  2PZ1 A;  2KUP A;  1FOE A;  1GC6 A;  2E2X A;  2RGN B;  1FGZ A;  1ZM0 A;  1K5G B;  1ZC4 B;  1EVH A;  5CLQ B;  2D9V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...