1U27A

Triglycine variant of the arno pleckstrin homology domain in complex with ins(1,3,4,5)p4
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
119
structure length
119
Chain Sequence
PDREGWLLKLGGGRVKTWKRRWFILTDNCLYYFEYTTDKEPRGIIPLENLSIREVDDPRKPNCFELYIPNNKGQLIKACKTEADGRVVEGNHMVYRISAPTQEEKDEWIKSIQAAVSVD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Cytohesin 2
publication title Structural determinants of phosphoinositide selectivity in splice variants of Grp1 family PH domains
pubmed doi rcsb
source organism Mus musculus
molecule tags Lipid binding protein
total genus 22
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2004-07-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00169 PH PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1u27A00
2YF0A 1WGUA 1P3RA 1V5PA 2I1KA 4IOYX 2VSZA 3D8DA 3MPXA 3VIAA 1UPQA 4DX8A 1LB1A 2HTHB 2J0MA 4KAXB 1XKEA 2K2UA 3AU4A 2N0YA 3HW2B 2D9WA 1MKEA 1K5DB 2YT1A 3ZVRA 2MKRA 1DBHA 4BBKA 2CODA 2DLWA 2X18A 1Y19B 1WVHA 1J0WA 1ZC4B 2COCA 1OMWA 3NSUA 1MK9B 3CIKA 2NMBA 5CLQB 1EVHA 2BCJA 1V88A 2E2XA 1U27A 4A6FB 1UPRA 5KCVA 2D9ZA 1Z87A 1P5TA 4NSWA 4K2OA 5DIFB 3MDBC 4GMXB 2YS1A 1WG7A 3QBVB 1XCGA 2LYDA 3SYXA 3P7ZA 2OTXA 4EJNA 2IYBA 2CRFA 2CAYA 2V76A 5HE3A 1TJ6A 4HB3B 3PVLA 2YS5A 1XR0B 3KY9A 2D9YA 1W1GA 2RLOA 4K17A 3ZDTA 3HQCA 1LW3A 1GC7A 2DA0A 4YONA 5C79A 1AWEA 2J59M 2Q13A 2IFSA 2ROZB 1EGXA 2K2JA 4EMOA 2UVMA 3FEHA 2ZPYA 2P0DA 2Y8FA 5FI1A 5C16A 3TCAA 2AEHA 1PLSA 2CY5A 1XX0A 2COAA 1U5GA 1EAZA 2H7DA 1X1FA 2GCLA 1BTNA 5GOWB 5J3YA 1J19A 1DYNA 2DHIA 5FI0A 2M38A 2RGNB 3FM8C 5HE0A 3PVUA 4HATB 4D0NB 5C5BA 4HB2B 4IAPA 1B55A 3CXBB 1BTKA 1I7AA 2I1JA 1U5EA 2QKMA 1W1DA 1XODA 3TO1A 2DN6A 1NTYA 2UZRA 4ZRJA 3ODXA 1EF1A 3KZ1A 1V89A 1MPHA 1IRSA 2LOZA 2MFQA 3FSSA 2DYQA 1ISNA 1WI1A 4NY0A 1P6SA 4HAYB 3D8EA 3PG7A 2P0HA 2D11A 2COFA 4MT7A 3AJ4A 2XQNM 1FAOA 2YT0A 2LG1A 2D9VA 2VRWB 2EJ8A 3SV1A 2YSZA 2DYNA 3IVFA 5EFXA 1V5MA 1NTVA 1UEFA 3U7DA 1UNRA 3KSYA 2NZ8B 2DKPA 2AL6A 5DI9B 1FHOA 4DBBA 1M7RA 1WJ1A 2Z0OA 3KRXA 5D3YA 4XWXA 5HE1A 4CHMA 1V61A 3DXCA 3G9WA 1Q67A 2Y7BA 1RJ2A 3WYFB 5L81A 2R09A 1AQCA 1GC6A 1ZC3B 1PFJA 1FHWA 2KUPA 1N3HA 4A6FA 1PMSA 1X1GA 2J0KA 2Y8GA 2ELAA 3UZTA 3U8ZA 1WJMA 4KHOA 2DTCA 2R0DA 1U5DA 1GG3A 4IFSA 3TVVA 2DX5A 3ULCA 1DROA 1DDMA 4ZRKA 5JP4A 1I2HA 4PNKA 1ZVRA 2Z0PA 3SNHA 4K81A 1QC6A 4A6HA 1ZM0A 1X05A 3DXEA 4K2PA 4HAZB 1K5GB 2FJLA 3RCPA 2DKQA 1BAKA 2I5FA 2L1CA 2RUKB 3F5RA 1FGYA 2GJYA 2KGXB 5J3TA 2QKLA 1U29A 3ODOA 3V5WA 1U5FA 3D8FA 1M7EA 4Y94A 4Z2NA 2GCJA 5C5BB 3SUZA 2EC1A 2KCJA 1BWNA 2YS3A 4F7UP 4H8SA 4P7IA 3M1IB 4F7HA 3F0WA 1FOEA 3TFMA 4CYEA 5JLJB 3PP2A 3PZDA 1TQZA 5J3QA 3T06A 1NI2A 3OANA 4HDQA 1X86A 4HAXB 1V5UA 5HE2A 4WSFA 4F7GA 3KRWA 3ULBA 4KHAA 4GPTB 3BINA 1TXDA 4KHBB 1SHCA 4B6HA 3QIJA 2D10A 4HAUB 5D27A 4WJ7A 2G35A 2PZ1A 3PEGA 4ZRIA 1KZGA 2LKOA 1MIXA 3ODWA 5D3WA 1DDVA 2D2QA 4GZUA 5D3VA 4MK0A 2J0JA 1ZSQA 1FHXA 5JHHA 4KVGB 4A6KA 4HB4B 2D4QA 1KZ7A 5CLLB 4GMVA 2LOXA 3A8QA 1Y5OA 1OY2A 2EMTA 5DHFB 1H10A 4TKNA 2D9XA 3PSCA 5KQ1A 3AU5A 1QQGA 1FB8A 3SO6A 1SGHA 3A8PA 2ADZA 1KI1B 2DFKA 2N23A 3N7CA 2HE7A 3DXDA 3GYOA 1MIZB 4DXAB 2GS0A 5LOPB 2K00A 1H4RA 4WVFB 2RNRB 1FGZA 4C0AA 2VKIA 4Z2MB 3A98B 3ML4A 4GXBA 5KQ4A 1DDWA 1NU2A 2YRYA 3P6AA 5C6RA 4PQ0A 2M14A 3GYPA 4MY6A 2JP2A 2I5CA 5LONB 1UNPA 1MK7B 1OQNA 3QWMA 4GN1A 2RSGA 4HB0B 1E5WA 2DHKA 4HDOA 1U2BA 2EMSA 2W2XC 4YL8A 2LULA 3PVWA 2DX1A 2L2IA 3BJIA 2H7EA 4CHJA 5DH9B 5D3XA 2ROVA 4HAVB 3O96A 1X11A 3TW1A 4HAWB 1RRPB 3VOQA 2YVCA 4A5KA 2OQBA 2MWNB 2MDXA 5DHAB 5JHGA 4DX90 2P0FA 4TYZA 4L6EA 1W1HA 2P8VA 4EKUA 2ELBA 2Z0QA 2W2WA 1WGQA 1MAIA 2CY4A 4HHVA 1UNQA 2UZSA 3WA0A 2DHJA 3LJUX 2RVBB 3HK0A 1XD4A 2W2XD 3X23A
chains in the Genus database with same CATH superfamily
2YF0A 1WGUA 1P3RA 1V5PA 2I1KA 4IOYX 2VSZA 3D8DA 3MPXA 3VIAA 1UPQA 4DX8A 1LB1A 2HTHB 5IRSA 5M4YB 2J0MA 4KAXB 1XKEA 2K2UA 3AU4A 2N0YA 3HW2B 2D9WA 3NWFA 1MKEA 2Z4DA 1K5DB 2YT1A 3ZVRA 2MKRA 3NWAA 3U12A 1DBHA 4BBKA 2CODA 2DLWA 2X18A 1Y19B 1WVHA 1J0WA 2GUMA 1ZC4B 2COCA 3OHMB 1OMWA 3NSUA 1MK9B 3CIKA 2K49A 2NMBA 5CLQB 1EVHA 2BCJA 1V88A 2E2XA 1U27A 4A6FB 1UPRA 5KCVA 2D9ZA 1Z87A 1P5TA 4NSWA 4K2OA 5DIFB 3MDBC 4GMXB 2YS1A 1WG7A 3QBVB 1XCGA 2LYDA 3SYXA 3P7ZA 2OTXA 4EJNA 2IYBA 2CRFA 2CAYA 2V76A 5HE3A 1TJ6A 4HB3B 3PVLA 2YS5A 1XR0B 3KY9A 2D9YA 1W1GA 2RLOA 4K17A 3ZDTA 3HQCA 1LW3A 1GC7A 2DA0A 4YONA 5C79A 1AWEA 3NW8A 2J59M 2Q13A 2IFSA 2ROZB 3NWDA 1EGXA 2K2JA 4EMOA 2UVMA 3FEHA 2ZPYA 2P0DA 2Y8FA 5FI1A 5C16A 3TCAA 2AEHA 4GOUA 1PLSA 2CY5A 1XX0A 2COAA 5LG4B 1U5GA 1EAZA 2H7DA 1X1FA 2GCLA 1BTNA 5GOWB 5J3YA 1J19A 1DYNA 2DHIA 5FI0A 2M38A 2RRFA 2RGNB 3FM8C 5HE0A 3PVUA 4HATB 4D0NB 5C5BA 4HB2B 4IAPA 1MI1A 1B55A 4QJ5B 3CXBB 1BTKA 1I7AA 4QJ3B 2I1JA 1U5EA 2QKMA 1W1DA 2NBVA 1XODA 3TO1A 2DN6A 1NTYA 2UZRA 4ZRJA 3ODXA 1EF1A 3KZ1A 1V89A 3FVCA 1MPHA 1IRSA 2LOZA 2MFQA 3FSSA 2DYQA 1ISNA 1WI1A 2KIEA 4KHBA 4NY0A 1P6SA 4HAYB 3D8EA 4CSQA 3PG7A 2P0HA 2D11A 2COFA 4MT7A 3AJ4A 2XQNM 1FAOA 2YT0A 2LG1A 2D9VA 2VRWB 2EJ8A 3SV1A 2YSZA 2DYNA 3IVFA 5EFXA 1V5MA 1NTVA 1UEFA 3U7DA 1UNRA 3KSYA 2NZ8B 2DKPA 2AL6A 5DI9B 1FHOA 4DBBA 1M7RA 1WJ1A 2Z0OA 3KRXA 5D3YA 4XWXA 5HE1A 4CHMA 1V61A 3DXCA 3G9WA 1Q67A 2Y7BA 4OSNA 1RJ2A 3WYFB 5L81A 2R09A 1AQCA 1GC6A 1ZC3B 1PFJA 1FHWA 2KUPA 1N3HA 4A6FA 1PMSA 1X1GA 2J0KA 2Y8GA 2ELAA 3UZTA 3U8ZA 1WJMA 4KHOA 2DTCA 2R0DA 1U5DA 1GG3A 4IFSA 3TVVA 2DX5A 3ULCA 1DROA 1DDMA 4ZRKA 5JP4A 1I2HA 4PNKA 3A58A 1ZVRA 2Z0PA 3SNHA 4K81A 1QC6A 4A6HA 1ZM0A 1X05A 3DXEA 4K2PA 1ZYIA 4HAZB 1K5GB 4QJ4B 2FJLA 3RCPA 2DKQA 1BAKA 2I5FA 2L1CA 4L1RA 2K8EA 2RUKB 3F5RA 1FGYA 2GJYA 2KGXB 5J3TA 2QKLA 1U29A 3ODOA 3V5WA 2Z59A 1U5FA 3D8FA 1M7EA 4QXAB 4Y94A 4Z2NA 2GCJA 4HSIA 5C5BB 3SUZA 2EC1A 2KR0A 2KCJA 1BWNA 2YS3A 4F7UP 4H8SA 4P7IA 3M1IB 4F7HA 3F0WA 1FOEA 3TFMA 3HSAA 4CYEA 5JLJB 3PP2A 3PZDA 1TQZA 5J3QA 3T06A 1NI2A 3OANA 2ZKMX 1X86A 4HAXB 4HDQA 1V5UA 5HE2A 4WSFA 4F7GA 3KRWA 3ULBA 4KHAA 4GPTB 3BINA 3HIEA 1TXDA 2FJUB 4KHBB 1SHCA 4B6HA 3QIJA 2D10A 4HAUB 5D27A 4WJ7A 5I2MA 2G35A 2PZ1A 3PEGA 4ZRIA 1KZGA 2LKOA 1MIXA 3ODWA 5D3WA 1DDVA 2D2QA 4GZUA 5D3VA 4MK0A 2J0JA 1ZSQA 1FHXA 5JHHA 4KVGB 4A6KA 4HB4B 2D4QA 1KZ7A 4GNKB 5CLLB 4GMVA 2LOXA 3A8QA 1Y5OA 1OY2A 2EMTA 5DHFB 1H10A 4TKNA 2D9XA 3PSCA 5KQ1A 3AU5A 1T77A 1QQGA 1FB8A 4OT1A 3SO6A 1SGHA 3A8PA 2ADZA 1KI1B 2DFKA 2N23A 3N7CA 2HE7A 3DXDA 3GYOA 4DIXA 1MIZB 2KUQA 4DXAB 2GS0A 5LOPB 2K00A 2R2YA 1H4RA 2KIGA 4WVFB 2RNRB 1FGZA 4C0AA 2VKIA 2Z13A 4Z2MB 3A98B 3B77A 3ML4A 4GXBA 5KQ4A 1DDWA 1NU2A 2YRYA 3DCXA 3P6AA 5C6RA 4PQ0A 2M14A 3GYPA 4MY6A 2JP2A 2I5CA 5LONB 1UNPA 1MK7B 1OQNA 3QWMA 4GN1A 2RSGA 4HB0B 1E5WA 2DHKA 4HDOA 1U2BA 2EMSA 2W2XC 4YL8A 2LULA 3PVWA 2DX1A 2L2IA 4D6WA 3BJIA 2H7EA 4CHJA 5DH9B 5D3XA 2ROVA 4HAVB 3O96A 1X11A 2Z14A 3TW1A 4HAWB 1RRPB 3VOQA 2YVCA 4A5KA 2OQBA 2MWNB 2MDXA 2YT2A 5DHAB 5JHGA 4DX90 2P0FA 4TYZA 4L6EA 1W1HA 2P8VA 4EKUA 2ELBA 2Z0QA 2W2WA 1WGQA 1MAIA 2CY4A 4HHVA 1UNQA 2UZSA 3WA0A 2DHJA 3LJUX 5I2SA 2RVBB 3HK0A 1XD4A 2W2XD 3X23A
chains in the Genus database with same CATH topology
2YF0A 1WGUA 1P3RA 1V5PA 2I1KA 4IOYX 2VSZA 3D8DA 3MPXA 3VIAA 1UPQA 4DX8A 1LB1A 2HTHB 2J0MA 4KAXB 1XKEA 2K2UA 3AU4A 2N0YA 3HW2B 2D9WA 1MKEA 1K5DB 2YT1A 3ZVRA 2MKRA 1DBHA 4BBKA 2CODA 2DLWA 2X18A 1Y19B 1WVHA 1J0WA 1ZC4B 2COCA 1OMWA 3NSUA 1MK9B 3CIKA 2NMBA 5CLQB 1EVHA 2BCJA 1V88A 2E2XA 1U27A 4A6FB 1UPRA 5KCVA 2D9ZA 1Z87A 1P5TA 4NSWA 4K2OA 5DIFB 3MDBC 4GMXB 2YS1A 1WG7A 3QBVB 1XCGA 2LYDA 3SYXA 3P7ZA 2OTXA 4EJNA 2IYBA 2CRFA 2CAYA 2V76A 5HE3A 1TJ6A 4HB3B 3PVLA 2YS5A 1XR0B 3KY9A 2D9YA 1W1GA 2RLOA 4K17A 3ZDTA 3HQCA 1LW3A 1GC7A 2DA0A 4YONA 5C79A 1AWEA 2J59M 2Q13A 2IFSA 2ROZB 1EGXA 2K2JA 4EMOA 2UVMA 3FEHA 2ZPYA 2P0DA 2Y8FA 5FI1A 5C16A 3TCAA 2AEHA 1PLSA 2CY5A 1XX0A 2COAA 1U5GA 1EAZA 2H7DA 1X1FA 2GCLA 1BTNA 5GOWB 5J3YA 1J19A 1DYNA 2DHIA 5FI0A 2M38A 2RGNB 3FM8C 5HE0A 3PVUA 4HATB 4D0NB 5C5BA 4HB2B 4IAPA 1B55A 3CXBB 1BTKA 1I7AA 2I1JA 1U5EA 2QKMA 1W1DA 1XODA 3TO1A 2DN6A 1NTYA 2UZRA 4ZRJA 3ODXA 1EF1A 3KZ1A 1V89A 1MPHA 1IRSA 2LOZA 2MFQA 3FSSA 2DYQA 1ISNA 1WI1A 4NY0A 1P6SA 4HAYB 3D8EA 3PG7A 2P0HA 2D11A 2COFA 4MT7A 3AJ4A 2XQNM 1FAOA 2YT0A 2LG1A 2D9VA 2VRWB 2EJ8A 3SV1A 2YSZA 2DYNA 3IVFA 5EFXA 1V5MA 1NTVA 1UEFA 3U7DA 1UNRA 3KSYA 2NZ8B 2DKPA 2AL6A 5DI9B 1FHOA 4DBBA 1M7RA 1WJ1A 2Z0OA 3KRXA 5D3YA 4XWXA 5HE1A 4CHMA 1V61A 3DXCA 3G9WA 1Q67A 2Y7BA 1RJ2A 3WYFB 5L81A 2R09A 1AQCA 1GC6A 1ZC3B 1PFJA 1FHWA 2KUPA 1N3HA 4A6FA 1PMSA 1X1GA 2J0KA 2Y8GA 2ELAA 3UZTA 3U8ZA 1WJMA 4KHOA 2DTCA 2R0DA 1U5DA 1GG3A 4IFSA 3TVVA 2DX5A 3ULCA 1DROA 1DDMA 4ZRKA 5JP4A 1I2HA 4PNKA 1ZVRA 2Z0PA 3SNHA 4K81A 1QC6A 4A6HA 1ZM0A 1X05A 3DXEA 4K2PA 4HAZB 1K5GB 2FJLA 3RCPA 2DKQA 1BAKA 2I5FA 2L1CA 2RUKB 3F5RA 1FGYA 2GJYA 2KGXB 5J3TA 2QKLA 1U29A 3ODOA 3V5WA 1U5FA 3D8FA 1M7EA 4Y94A 4Z2NA 2GCJA 5C5BB 3SUZA 2EC1A 2KCJA 1BWNA 2YS3A 4F7UP 4H8SA 4P7IA 3M1IB 4F7HA 3F0WA 1FOEA 3TFMA 4CYEA 5JLJB 3PP2A 3PZDA 1TQZA 5J3QA 3T06A 1NI2A 3OANA 4HDQA 1X86A 4HAXB 1V5UA 5HE2A 4WSFA 4F7GA 3KRWA 3ULBA 4KHAA 4GPTB 3BINA 1TXDA 4KHBB 1SHCA 4B6HA 3QIJA 2D10A 4HAUB 5D27A 4WJ7A 2G35A 2PZ1A 3PEGA 4ZRIA 1KZGA 2LKOA 1MIXA 3ODWA 5D3WA 1DDVA 2D2QA 4GZUA 5D3VA 4MK0A 2J0JA 1ZSQA 1FHXA 5JHHA 4KVGB 4A6KA 4HB4B 2D4QA 1KZ7A 5CLLB 4GMVA 2LOXA 3A8QA 1Y5OA 1OY2A 2EMTA 5DHFB 1H10A 4TKNA 2D9XA 3PSCA 5KQ1A 3AU5A 1QQGA 1FB8A 3SO6A 1SGHA 3A8PA 2ADZA 1KI1B 2DFKA 2N23A 3N7CA 2HE7A 3DXDA 3GYOA 1MIZB 4DXAB 2GS0A 5LOPB 2K00A 1H4RA 4WVFB 2RNRB 1FGZA 4C0AA 2VKIA 4Z2MB 3A98B 3ML4A 4GXBA 5KQ4A 1DDWA 1NU2A 2YRYA 3P6AA 5C6RA 4PQ0A 2M14A 3GYPA 4MY6A 2JP2A 2I5CA 5LONB 1UNPA 1MK7B 1OQNA 3QWMA 4GN1A 2RSGA 4HB0B 1E5WA 2DHKA 4HDOA 1U2BA 2EMSA 2W2XC 4YL8A 2LULA 3PVWA 2DX1A 2L2IA 3BJIA 2H7EA 4CHJA 5DH9B 5D3XA 2ROVA 4HAVB 3O96A 1X11A 3TW1A 4HAWB 1RRPB 3VOQA 2YVCA 4A5KA 2OQBA 2MWNB 2MDXA 5DHAB 5JHGA 4DX90 2P0FA 4TYZA 4L6EA 1W1HA 2P8VA 4EKUA 2ELBA 2Z0QA 2W2WA 1WGQA 1MAIA 2CY4A 4HHVA 1UNQA 2UZSA 3WA0A 2DHJA 3LJUX 2RVBB 3HK0A 1XD4A 2W2XD 3X23A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YF0 A;  1WGU A;  1P3R A;  1V5P A;  2I1K A;  4IOY X;  2VSZ A;  3D8D A;  3MPX A;  3VIA A;  1UPQ A;  4DX8 A;  1LB1 A;  2HTH B;  2J0M A;  4KAX B;  1XKE A;  2K2U A;  3AU4 A;  2N0Y A;  3HW2 B;  2D9W A;  1MKE A;  1K5D B;  2YT1 A;  3ZVR A;  2MKR A;  1DBH A;  4BBK A;  2COD A;  2DLW A;  2X18 A;  1Y19 B;  1WVH A;  1J0W A;  1ZC4 B;  2COC A;  1OMW A;  3NSU A;  1MK9 B;  3CIK A;  2NMB A;  5CLQ B;  1EVH A;  2BCJ A;  1V88 A;  2E2X A;  1U27 A;  4A6F B;  1UPR A;  5KCV A;  2D9Z A;  1Z87 A;  1P5T A;  4NSW A;  4K2O A;  5DIF B;  3MDB C;  4GMX B;  2YS1 A;  1WG7 A;  3QBV B;  1XCG A;  2LYD A;  3SYX A;  3P7Z A;  2OTX A;  4EJN A;  2IYB A;  2CRF A;  2CAY A;  2V76 A;  5HE3 A;  1TJ6 A;  4HB3 B;  3PVL A;  2YS5 A;  1XR0 B;  3KY9 A;  2D9Y A;  1W1G A;  2RLO A;  4K17 A;  3ZDT A;  3HQC A;  1LW3 A;  1GC7 A;  2DA0 A;  4YON A;  5C79 A;  1AWE A;  2J59 M;  2Q13 A;  2IFS A;  2ROZ B;  1EGX A;  2K2J A;  4EMO A;  2UVM A;  3FEH A;  2ZPY A;  2P0D A;  2Y8F A;  5FI1 A;  5C16 A;  3TCA A;  2AEH A;  1PLS A;  2CY5 A;  1XX0 A;  2COA A;  1U5G A;  1EAZ A;  2H7D A;  1X1F A;  2GCL A;  1BTN A;  5GOW B;  5J3Y A;  1J19 A;  1DYN A;  2DHI A;  5FI0 A;  2M38 A;  2RGN B;  3FM8 C;  5HE0 A;  3PVU A;  4HAT B;  4D0N B;  5C5B A;  4HB2 B;  4IAP A;  1B55 A;  3CXB B;  1BTK A;  1I7A A;  2I1J A;  1U5E A;  2QKM A;  1W1D A;  1XOD A;  3TO1 A;  2DN6 A;  1NTY A;  2UZR A;  4ZRJ A;  3ODX A;  1EF1 A;  3KZ1 A;  1V89 A;  1MPH A;  1IRS A;  2LOZ A;  2MFQ A;  3FSS A;  2DYQ A;  1ISN A;  1WI1 A;  4NY0 A;  1P6S A;  4HAY B;  3D8E A;  3PG7 A;  2P0H A;  2D11 A;  2COF A;  4MT7 A;  3AJ4 A;  2XQN M;  1FAO A;  2YT0 A;  2LG1 A;  2D9V A;  2VRW B;  2EJ8 A;  3SV1 A;  2YSZ A;  2DYN A;  3IVF A;  5EFX A;  1V5M A;  1NTV A;  1UEF A;  3U7D A;  1UNR A;  3KSY A;  2NZ8 B;  2DKP A;  2AL6 A;  5DI9 B;  1FHO A;  4DBB A;  1M7R A;  1WJ1 A;  2Z0O A;  3KRX A;  5D3Y A;  4XWX A;  5HE1 A;  4CHM A;  1V61 A;  3DXC A;  3G9W A;  1Q67 A;  2Y7B A;  1RJ2 A;  3WYF B;  5L81 A;  2R09 A;  1AQC A;  1GC6 A;  1ZC3 B;  1PFJ A;  1FHW A;  2KUP A;  1N3H A;  4A6F A;  1PMS A;  1X1G A;  2J0K A;  2Y8G A;  2ELA A;  3UZT A;  3U8Z A;  1WJM A;  4KHO A;  2DTC A;  2R0D A;  1U5D A;  1GG3 A;  4IFS A;  3TVV A;  2DX5 A;  3ULC A;  1DRO A;  1DDM A;  4ZRK A;  5JP4 A;  1I2H A;  4PNK A;  1ZVR A;  2Z0P A;  3SNH A;  4K81 A;  1QC6 A;  4A6H A;  1ZM0 A;  1X05 A;  3DXE A;  4K2P A;  4HAZ B;  1K5G B;  2FJL A;  3RCP A;  2DKQ A;  1BAK A;  2I5F A;  2L1C A;  2RUK B;  3F5R A;  1FGY A;  2GJY A;  2KGX B;  5J3T A;  2QKL A;  1U29 A;  3ODO A;  3V5W A;  1U5F A;  3D8F A;  1M7E A;  4Y94 A;  4Z2N A;  2GCJ A;  5C5B B;  3SUZ A;  2EC1 A;  2KCJ A;  1BWN A;  2YS3 A;  4F7U P;  4H8S A;  4P7I A;  3M1I B;  4F7H A;  3F0W A;  1FOE A;  3TFM A;  4CYE A;  5JLJ B;  3PP2 A;  3PZD A;  1TQZ A;  5J3Q A;  3T06 A;  1NI2 A;  3OAN A;  4HDQ A;  1X86 A;  4HAX B;  1V5U A;  5HE2 A;  4WSF A;  4F7G A;  3KRW A;  3ULB A;  4KHA A;  4GPT B;  3BIN A;  1TXD A;  4KHB B;  1SHC A;  4B6H A;  3QIJ A;  2D10 A;  4HAU B;  5D27 A;  4WJ7 A;  2G35 A;  2PZ1 A;  3PEG A;  4ZRI A;  1KZG A;  2LKO A;  1MIX A;  3ODW A;  5D3W A;  1DDV A;  2D2Q A;  4GZU A;  5D3V A;  4MK0 A;  2J0J A;  1ZSQ A;  1FHX A;  5JHH A;  4KVG B;  4A6K A;  4HB4 B;  2D4Q A;  1KZ7 A;  5CLL B;  4GMV A;  2LOX A;  3A8Q A;  1Y5O A;  1OY2 A;  2EMT A;  5DHF B;  1H10 A;  4TKN A;  2D9X A;  3PSC A;  5KQ1 A;  3AU5 A;  1QQG A;  1FB8 A;  3SO6 A;  1SGH A;  3A8P A;  2ADZ A;  1KI1 B;  2DFK A;  2N23 A;  3N7C A;  2HE7 A;  3DXD A;  3GYO A;  1MIZ B;  4DXA B;  2GS0 A;  5LOP B;  2K00 A;  1H4R A;  4WVF B;  2RNR B;  1FGZ A;  4C0A A;  2VKI A;  4Z2M B;  3A98 B;  3ML4 A;  4GXB A;  5KQ4 A;  1DDW A;  1NU2 A;  2YRY A;  3P6A A;  5C6R A;  4PQ0 A;  2M14 A;  3GYP A;  4MY6 A;  2JP2 A;  2I5C A;  5LON B;  1UNP A;  1MK7 B;  1OQN A;  3QWM A;  4GN1 A;  2RSG A;  4HB0 B;  1E5W A;  2DHK A;  4HDO A;  1U2B A;  2EMS A;  2W2X C;  4YL8 A;  2LUL A;  3PVW A;  2DX1 A;  2L2I A;  3BJI A;  2H7E A;  4CHJ A;  5DH9 B;  5D3X A;  2ROV A;  4HAV B;  3O96 A;  1X11 A;  3TW1 A;  4HAW B;  1RRP B;  3VOQ A;  2YVC A;  4A5K A;  2OQB A;  2MWN B;  2MDX A;  5DHA B;  5JHG A;  4DX9 0;  2P0F A;  4TYZ A;  4L6E A;  1W1H A;  2P8V A;  4EKU A;  2ELB A;  2Z0Q A;  2W2W A;  1WGQ A;  1MAI A;  2CY4 A;  4HHV A;  1UNQ A;  2UZS A;  3WA0 A;  2DHJ A;  3LJU X;  2RVB B;  3HK0 A;  1XD4 A;  2W2X D;  3X23 A; 
#chains in the Genus database with same CATH topology
 2YF0 A;  1WGU A;  1P3R A;  1V5P A;  2I1K A;  4IOY X;  2VSZ A;  3D8D A;  3MPX A;  3VIA A;  1UPQ A;  4DX8 A;  1LB1 A;  2HTH B;  5IRS A;  5M4Y B;  2J0M A;  4KAX B;  1XKE A;  2K2U A;  3AU4 A;  2N0Y A;  3HW2 B;  2D9W A;  3NWF A;  1MKE A;  2Z4D A;  1K5D B;  2YT1 A;  3ZVR A;  2MKR A;  3NWA A;  3U12 A;  1DBH A;  4BBK A;  2COD A;  2DLW A;  2X18 A;  1Y19 B;  1WVH A;  1J0W A;  2GUM A;  1ZC4 B;  2COC A;  3OHM B;  1OMW A;  3NSU A;  1MK9 B;  3CIK A;  2K49 A;  2NMB A;  5CLQ B;  1EVH A;  2BCJ A;  1V88 A;  2E2X A;  1U27 A;  4A6F B;  1UPR A;  5KCV A;  2D9Z A;  1Z87 A;  1P5T A;  4NSW A;  4K2O A;  5DIF B;  3MDB C;  4GMX B;  2YS1 A;  1WG7 A;  3QBV B;  1XCG A;  2LYD A;  3SYX A;  3P7Z A;  2OTX A;  4EJN A;  2IYB A;  2CRF A;  2CAY A;  2V76 A;  5HE3 A;  1TJ6 A;  4HB3 B;  3PVL A;  2YS5 A;  1XR0 B;  3KY9 A;  2D9Y A;  1W1G A;  2RLO A;  4K17 A;  3ZDT A;  3HQC A;  1LW3 A;  1GC7 A;  2DA0 A;  4YON A;  5C79 A;  1AWE A;  3NW8 A;  2J59 M;  2Q13 A;  2IFS A;  2ROZ B;  3NWD A;  1EGX A;  2K2J A;  4EMO A;  2UVM A;  3FEH A;  2ZPY A;  2P0D A;  2Y8F A;  5FI1 A;  5C16 A;  3TCA A;  2AEH A;  4GOU A;  1PLS A;  2CY5 A;  1XX0 A;  2COA A;  5LG4 B;  1U5G A;  1EAZ A;  2H7D A;  1X1F A;  2GCL A;  1BTN A;  5GOW B;  5J3Y A;  1J19 A;  1DYN A;  2DHI A;  5FI0 A;  2M38 A;  2RRF A;  2RGN B;  3FM8 C;  5HE0 A;  3PVU A;  4HAT B;  4D0N B;  5C5B A;  4HB2 B;  4IAP A;  1MI1 A;  1B55 A;  4QJ5 B;  3CXB B;  1BTK A;  1I7A A;  4QJ3 B;  2I1J A;  1U5E A;  2QKM A;  1W1D A;  2NBV A;  1XOD A;  3TO1 A;  2DN6 A;  1NTY A;  2UZR A;  4ZRJ A;  3ODX A;  1EF1 A;  3KZ1 A;  1V89 A;  3FVC A;  1MPH A;  1IRS A;  2LOZ A;  2MFQ A;  3FSS A;  2DYQ A;  1ISN A;  1WI1 A;  2KIE A;  4KHB A;  4NY0 A;  1P6S A;  4HAY B;  3D8E A;  4CSQ A;  3PG7 A;  2P0H A;  2D11 A;  2COF A;  4MT7 A;  3AJ4 A;  2XQN M;  1FAO A;  2YT0 A;  2LG1 A;  2D9V A;  2VRW B;  2EJ8 A;  3SV1 A;  2YSZ A;  2DYN A;  3IVF A;  5EFX A;  1V5M A;  1NTV A;  1UEF A;  3U7D A;  1UNR A;  3KSY A;  2NZ8 B;  2DKP A;  2AL6 A;  5DI9 B;  1FHO A;  4DBB A;  1M7R A;  1WJ1 A;  2Z0O A;  3KRX A;  5D3Y A;  4XWX A;  5HE1 A;  4CHM A;  1V61 A;  3DXC A;  3G9W A;  1Q67 A;  2Y7B A;  4OSN A;  1RJ2 A;  3WYF B;  5L81 A;  2R09 A;  1AQC A;  1GC6 A;  1ZC3 B;  1PFJ A;  1FHW A;  2KUP A;  1N3H A;  4A6F A;  1PMS A;  1X1G A;  2J0K A;  2Y8G A;  2ELA A;  3UZT A;  3U8Z A;  1WJM A;  4KHO A;  2DTC A;  2R0D A;  1U5D A;  1GG3 A;  4IFS A;  3TVV A;  2DX5 A;  3ULC A;  1DRO A;  1DDM A;  4ZRK A;  5JP4 A;  1I2H A;  4PNK A;  3A58 A;  1ZVR A;  2Z0P A;  3SNH A;  4K81 A;  1QC6 A;  4A6H A;  1ZM0 A;  1X05 A;  3DXE A;  4K2P A;  1ZYI A;  4HAZ B;  1K5G B;  4QJ4 B;  2FJL A;  3RCP A;  2DKQ A;  1BAK A;  2I5F A;  2L1C A;  4L1R A;  2K8E A;  2RUK B;  3F5R A;  1FGY A;  2GJY A;  2KGX B;  5J3T A;  2QKL A;  1U29 A;  3ODO A;  3V5W A;  2Z59 A;  1U5F A;  3D8F A;  1M7E A;  4QXA B;  4Y94 A;  4Z2N A;  2GCJ A;  4HSI A;  5C5B B;  3SUZ A;  2EC1 A;  2KR0 A;  2KCJ A;  1BWN A;  2YS3 A;  4F7U P;  4H8S A;  4P7I A;  3M1I B;  4F7H A;  3F0W A;  1FOE A;  3TFM A;  3HSA A;  4CYE A;  5JLJ B;  3PP2 A;  3PZD A;  1TQZ A;  5J3Q A;  3T06 A;  1NI2 A;  3OAN A;  2ZKM X;  1X86 A;  4HAX B;  4HDQ A;  1V5U A;  5HE2 A;  4WSF A;  4F7G A;  3KRW A;  3ULB A;  4KHA A;  4GPT B;  3BIN A;  3HIE A;  1TXD A;  2FJU B;  4KHB B;  1SHC A;  4B6H A;  3QIJ A;  2D10 A;  4HAU B;  5D27 A;  4WJ7 A;  5I2M A;  2G35 A;  2PZ1 A;  3PEG A;  4ZRI A;  1KZG A;  2LKO A;  1MIX A;  3ODW A;  5D3W A;  1DDV A;  2D2Q A;  4GZU A;  5D3V A;  4MK0 A;  2J0J A;  1ZSQ A;  1FHX A;  5JHH A;  4KVG B;  4A6K A;  4HB4 B;  2D4Q A;  1KZ7 A;  4GNK B;  5CLL B;  4GMV A;  2LOX A;  3A8Q A;  1Y5O A;  1OY2 A;  2EMT A;  5DHF B;  1H10 A;  4TKN A;  2D9X A;  3PSC A;  5KQ1 A;  3AU5 A;  1T77 A;  1QQG A;  1FB8 A;  4OT1 A;  3SO6 A;  1SGH A;  3A8P A;  2ADZ A;  1KI1 B;  2DFK A;  2N23 A;  3N7C A;  2HE7 A;  3DXD A;  3GYO A;  4DIX A;  1MIZ B;  2KUQ A;  4DXA B;  2GS0 A;  5LOP B;  2K00 A;  2R2Y A;  1H4R A;  2KIG A;  4WVF B;  2RNR B;  1FGZ A;  4C0A A;  2VKI A;  2Z13 A;  4Z2M B;  3A98 B;  3B77 A;  3ML4 A;  4GXB A;  5KQ4 A;  1DDW A;  1NU2 A;  2YRY A;  3DCX A;  3P6A A;  5C6R A;  4PQ0 A;  2M14 A;  3GYP A;  4MY6 A;  2JP2 A;  2I5C A;  5LON B;  1UNP A;  1MK7 B;  1OQN A;  3QWM A;  4GN1 A;  2RSG A;  4HB0 B;  1E5W A;  2DHK A;  4HDO A;  1U2B A;  2EMS A;  2W2X C;  4YL8 A;  2LUL A;  3PVW A;  2DX1 A;  2L2I A;  4D6W A;  3BJI A;  2H7E A;  4CHJ A;  5DH9 B;  5D3X A;  2ROV A;  4HAV B;  3O96 A;  1X11 A;  2Z14 A;  3TW1 A;  4HAW B;  1RRP B;  3VOQ A;  2YVC A;  4A5K A;  2OQB A;  2MWN B;  2MDX A;  2YT2 A;  5DHA B;  5JHG A;  4DX9 0;  2P0F A;  4TYZ A;  4L6E A;  1W1H A;  2P8V A;  4EKU A;  2ELB A;  2Z0Q A;  2W2W A;  1WGQ A;  1MAI A;  2CY4 A;  4HHV A;  1UNQ A;  2UZS A;  3WA0 A;  2DHJ A;  3LJU X;  5I2S A;  2RVB B;  3HK0 A;  1XD4 A;  2W2X D;  3X23 A; 
#chains in the Genus database with same CATH homology
 2YF0 A;  1WGU A;  1P3R A;  1V5P A;  2I1K A;  4IOY X;  2VSZ A;  3D8D A;  3MPX A;  3VIA A;  1UPQ A;  4DX8 A;  1LB1 A;  2HTH B;  2J0M A;  4KAX B;  1XKE A;  2K2U A;  3AU4 A;  2N0Y A;  3HW2 B;  2D9W A;  1MKE A;  1K5D B;  2YT1 A;  3ZVR A;  2MKR A;  1DBH A;  4BBK A;  2COD A;  2DLW A;  2X18 A;  1Y19 B;  1WVH A;  1J0W A;  1ZC4 B;  2COC A;  1OMW A;  3NSU A;  1MK9 B;  3CIK A;  2NMB A;  5CLQ B;  1EVH A;  2BCJ A;  1V88 A;  2E2X A;  1U27 A;  4A6F B;  1UPR A;  5KCV A;  2D9Z A;  1Z87 A;  1P5T A;  4NSW A;  4K2O A;  5DIF B;  3MDB C;  4GMX B;  2YS1 A;  1WG7 A;  3QBV B;  1XCG A;  2LYD A;  3SYX A;  3P7Z A;  2OTX A;  4EJN A;  2IYB A;  2CRF A;  2CAY A;  2V76 A;  5HE3 A;  1TJ6 A;  4HB3 B;  3PVL A;  2YS5 A;  1XR0 B;  3KY9 A;  2D9Y A;  1W1G A;  2RLO A;  4K17 A;  3ZDT A;  3HQC A;  1LW3 A;  1GC7 A;  2DA0 A;  4YON A;  5C79 A;  1AWE A;  2J59 M;  2Q13 A;  2IFS A;  2ROZ B;  1EGX A;  2K2J A;  4EMO A;  2UVM A;  3FEH A;  2ZPY A;  2P0D A;  2Y8F A;  5FI1 A;  5C16 A;  3TCA A;  2AEH A;  1PLS A;  2CY5 A;  1XX0 A;  2COA A;  1U5G A;  1EAZ A;  2H7D A;  1X1F A;  2GCL A;  1BTN A;  5GOW B;  5J3Y A;  1J19 A;  1DYN A;  2DHI A;  5FI0 A;  2M38 A;  2RGN B;  3FM8 C;  5HE0 A;  3PVU A;  4HAT B;  4D0N B;  5C5B A;  4HB2 B;  4IAP A;  1B55 A;  3CXB B;  1BTK A;  1I7A A;  2I1J A;  1U5E A;  2QKM A;  1W1D A;  1XOD A;  3TO1 A;  2DN6 A;  1NTY A;  2UZR A;  4ZRJ A;  3ODX A;  1EF1 A;  3KZ1 A;  1V89 A;  1MPH A;  1IRS A;  2LOZ A;  2MFQ A;  3FSS A;  2DYQ A;  1ISN A;  1WI1 A;  4NY0 A;  1P6S A;  4HAY B;  3D8E A;  3PG7 A;  2P0H A;  2D11 A;  2COF A;  4MT7 A;  3AJ4 A;  2XQN M;  1FAO A;  2YT0 A;  2LG1 A;  2D9V A;  2VRW B;  2EJ8 A;  3SV1 A;  2YSZ A;  2DYN A;  3IVF A;  5EFX A;  1V5M A;  1NTV A;  1UEF A;  3U7D A;  1UNR A;  3KSY A;  2NZ8 B;  2DKP A;  2AL6 A;  5DI9 B;  1FHO A;  4DBB A;  1M7R A;  1WJ1 A;  2Z0O A;  3KRX A;  5D3Y A;  4XWX A;  5HE1 A;  4CHM A;  1V61 A;  3DXC A;  3G9W A;  1Q67 A;  2Y7B A;  1RJ2 A;  3WYF B;  5L81 A;  2R09 A;  1AQC A;  1GC6 A;  1ZC3 B;  1PFJ A;  1FHW A;  2KUP A;  1N3H A;  4A6F A;  1PMS A;  1X1G A;  2J0K A;  2Y8G A;  2ELA A;  3UZT A;  3U8Z A;  1WJM A;  4KHO A;  2DTC A;  2R0D A;  1U5D A;  1GG3 A;  4IFS A;  3TVV A;  2DX5 A;  3ULC A;  1DRO A;  1DDM A;  4ZRK A;  5JP4 A;  1I2H A;  4PNK A;  1ZVR A;  2Z0P A;  3SNH A;  4K81 A;  1QC6 A;  4A6H A;  1ZM0 A;  1X05 A;  3DXE A;  4K2P A;  4HAZ B;  1K5G B;  2FJL A;  3RCP A;  2DKQ A;  1BAK A;  2I5F A;  2L1C A;  2RUK B;  3F5R A;  1FGY A;  2GJY A;  2KGX B;  5J3T A;  2QKL A;  1U29 A;  3ODO A;  3V5W A;  1U5F A;  3D8F A;  1M7E A;  4Y94 A;  4Z2N A;  2GCJ A;  5C5B B;  3SUZ A;  2EC1 A;  2KCJ A;  1BWN A;  2YS3 A;  4F7U P;  4H8S A;  4P7I A;  3M1I B;  4F7H A;  3F0W A;  1FOE A;  3TFM A;  4CYE A;  5JLJ B;  3PP2 A;  3PZD A;  1TQZ A;  5J3Q A;  3T06 A;  1NI2 A;  3OAN A;  4HDQ A;  1X86 A;  4HAX B;  1V5U A;  5HE2 A;  4WSF A;  4F7G A;  3KRW A;  3ULB A;  4KHA A;  4GPT B;  3BIN A;  1TXD A;  4KHB B;  1SHC A;  4B6H A;  3QIJ A;  2D10 A;  4HAU B;  5D27 A;  4WJ7 A;  2G35 A;  2PZ1 A;  3PEG A;  4ZRI A;  1KZG A;  2LKO A;  1MIX A;  3ODW A;  5D3W A;  1DDV A;  2D2Q A;  4GZU A;  5D3V A;  4MK0 A;  2J0J A;  1ZSQ A;  1FHX A;  5JHH A;  4KVG B;  4A6K A;  4HB4 B;  2D4Q A;  1KZ7 A;  5CLL B;  4GMV A;  2LOX A;  3A8Q A;  1Y5O A;  1OY2 A;  2EMT A;  5DHF B;  1H10 A;  4TKN A;  2D9X A;  3PSC A;  5KQ1 A;  3AU5 A;  1QQG A;  1FB8 A;  3SO6 A;  1SGH A;  3A8P A;  2ADZ A;  1KI1 B;  2DFK A;  2N23 A;  3N7C A;  2HE7 A;  3DXD A;  3GYO A;  1MIZ B;  4DXA B;  2GS0 A;  5LOP B;  2K00 A;  1H4R A;  4WVF B;  2RNR B;  1FGZ A;  4C0A A;  2VKI A;  4Z2M B;  3A98 B;  3ML4 A;  4GXB A;  5KQ4 A;  1DDW A;  1NU2 A;  2YRY A;  3P6A A;  5C6R A;  4PQ0 A;  2M14 A;  3GYP A;  4MY6 A;  2JP2 A;  2I5C A;  5LON B;  1UNP A;  1MK7 B;  1OQN A;  3QWM A;  4GN1 A;  2RSG A;  4HB0 B;  1E5W A;  2DHK A;  4HDO A;  1U2B A;  2EMS A;  2W2X C;  4YL8 A;  2LUL A;  3PVW A;  2DX1 A;  2L2I A;  3BJI A;  2H7E A;  4CHJ A;  5DH9 B;  5D3X A;  2ROV A;  4HAV B;  3O96 A;  1X11 A;  3TW1 A;  4HAW B;  1RRP B;  3VOQ A;  2YVC A;  4A5K A;  2OQB A;  2MWN B;  2MDX A;  5DHA B;  5JHG A;  4DX9 0;  2P0F A;  4TYZ A;  4L6E A;  1W1H A;  2P8V A;  4EKU A;  2ELB A;  2Z0Q A;  2W2W A;  1WGQ A;  1MAI A;  2CY4 A;  4HHV A;  1UNQ A;  2UZS A;  3WA0 A;  2DHJ A;  3LJU X;  2RVB B;  3HK0 A;  1XD4 A;  2W2X D;  3X23 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...