1TJ6A

Crystal structure of the xenopus tropicalis spred1 evh-1 domain
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
115
structure length
115
Chain Sequence
DSYARVRAVVMTRDDSSGGWLQLGGGGLSSVTVSKTLQPGDSGGTEFLVHGERLRDKTVILECVLRRDLVYNKVTPTFHHWRIGDKKFGLTFQSPADARAFDRGIRRAIEDLSQG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords Spred1
publication title 1.65A Crystal structure of the X. tropicalis Spred1 Enabled/Vasodilator-stimulated phosphoprotein homology-1 domain
rcsb
source organism Xenopus tropicalis
total genus 25
structure length 115
sequence length 115
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00568 WH1 WH1 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1tj6A00
5EFXA 4MK0A 2QKMA 1XD4A 2LULA 3VIAA 5C5BB 2DYNA 1V5UA 2DX5A 2XQNM 1WVHA 1ZSQA 2X18A 3DXEA 1I2HA 2I5FA 4HATB 3WA0A 3VOQA 1U2BA 1DDWA 3AJ4A 4EJNA 2W2WA 4CHJA 1XCGA 5JHGA 4XWXA 2UZRA 3DXDA 2IYBA 5CLLB 1IRSA 2LOZA 1WG7A 1LB1A 2EMTA 3GYPA 5DH9B 3PZDA 2MFQA 4A6FA 2EC1A 3A8PA 1KZ7A 3D8FA 1V61A 4HAVB 2IFSA 4GMVA 1P6SA 2DHKA 2M14A 3FEHA 4GMXB 3ULCA 1W1HA 4F7UP 4HB4B 3BINA 1X1GA 1N3HA 1MK7B 5FI1A 2L1CA 2R09A 2QKLA 2ELAA 1QC6A 1K5GB 2G35A 1AQCA 1UNPA 5D3YA 2P0FA 1PMSA 4HAXB 4K2OA 4GN1A 4WVFB 4HAZB 2EMSA 2HE7A 1RRPB 3ODXA 1FHWA 1DROA 1EVHA 2OQBA 1UNQA 2YVCA 3SO6A 1ZM0A 1TXDA 2I1KA 2DA0A 1ISNA 2N0YA 4HAUB 1U5GA 2UVMA 1X1FA 4IFSA 1MIXA 2YS5A 4YONA 1H4RA 3QIJA 2EJ8A 2MWNB 5JP4A 1M7EA 1OY2A 1OQNA 4EKUA 1RJ2A 3AU5A 3A8QA 2DTCA 2YT1A 4NY0A 5HE0A 5DHFB 4KHBB 4F7HA 4H8SA 5C79A 1TJ6A 2RNRB 2CY4A 2JP2A 3FSSA 2Z0QA 5L81A 3PEGA 2KGXB 4C0AA 4WSFA 3PG7A 2CODA 2LOXA 1LW3A 3FM8C 1E5WA 3KSYA 2COAA 2RLOA 4NSWA 2DN6A 3QWMA 1EAZA 2K00A 5D3XA 3NSUA 3SNHA 1KZGA 2M38A 4TYZA 4DBBA 5C6RA 4BBKA 3SUZA 4PNKA 1BWNA 2KCJA 1Q67A 1WJ1A 2D2QA 3PVUA 1BAKA 3A98B 2Z0OA 1NI2A 3TVVA 1DBHA 2ROVA 1U27A 4A6FB 3KRWA 1XKEA 1X05A 4TKNA 2D9WA 3ZVRA 2H7EA 4B6HA 1MIZB 5KQ4A 1UPQA 1U29A 2D9XA 5DHAB 5J3TA 3O96A 4HDOA 1P3RA 2GCLA 3P7ZA 5D3VA 3RCPA 2BCJA 1V5MA 5DI9B 2DHJA 3TCAA 3BJIA 4L6EA 2MDXA 4PQ0A 2DYQA 5HE2A 2ROZB 1WJMA 4K17A 3UZTA 4GXBA 2YRYA 2CY5A 2PZ1A 4HAYB 2NMBA 1EF1A 4A6KA 1MKEA 4DXAB 4HB2B 2DKQA 4MT7A 5KQ1A 5D3WA 3HK0A 1X86A 2GCJA 4HDQA 1MPHA 2I5CA 1UNRA 1OMWA 2J0JA 2UZSA 4HB3B 2DX1A 2P8VA 2RVBB 4HAWB 4ZRJA 5J3QA 3T06A 5J3YA 1Y19B 2YF0A 4Y94A 1Z87A 2Y7BA 2GJYA 2DLWA 4GZUA 3V5WA 3CXBB 2DFKA 2R0DA 3D8EA 1WGQA 1KI1B 1ZVRA 1PFJA 3DXCA 4KHAA 1U5FA 2YSZA 2FJLA 1MAIA 1FHOA 1J19A 1FGYA 2YS1A 1DDMA 3PVWA 3SYXA 2P0HA 1V89A 1UEFA 2RSGA 2KUPA 3ML4A 5JHHA 2ADZA 1U5EA 2ZPYA 3TO1A 2V76A 3MDBC 4ZRKA 3HW2B 2RGNB 1NTYA 1P5TA 3GYOA 3F5RA 2HTHB 1TQZA 4A6HA 2VSZA 1U5DA 1W1DA 3U8ZA 3PP2A 2Z0PA 2J59M 2LYDA 4HB0B 2ELBA 4MY6A 3G9WA 4ZRIA 2D4QA 3PVLA 2D10A 4DX8A 1BTNA 1ZC4B 5LONB 3TFMA 1GG3A 5C5BA 5HE3A 4D0NB 3U7DA 1SGHA 5GOWB 3LJUX 2E2XA 2COCA 1J0WA 1XODA 3CIKA 2I1JA 4KHOA 3ULBA 2COFA 1QQGA 1FAOA 2VRWB 1V5PA 4K81A 4Z2MB 2D9VA 2YT0A 2VKIA 2N23A 1NU2A 5FI0A 1AWEA 1XR0B 1FGZA 3ODWA 2OTXA 1FB8A 2P0DA 4CHMA 1FHXA 1GC6A 1V88A 4KAXB 1ZC3B 1XX0A 2LKOA 4IAPA 2CAYA 5KCVA 1M7RA 2DHIA 2J0MA 4YL8A 4DX90 1Y5OA 2Q13A 1B55A 2DKPA 2K2UA 4F7GA 1SHCA 2NZ8B 1FOEA 2D9YA 2RUKB 3N7CA 3F0WA 1W1GA 5LOPB 4K2PA 2W2XC 1WGUA 3M1IB 2GS0A 4CYEA 4HHVA 3PSCA 2Y8FA 1I7AA 3IVFA 3SV1A 4EMOA 5HE1A 3WYFB 1PLSA 4IOYX 2H7DA 4WJ7A 2K2JA 3D8DA 3QBVB 2AL6A 2Y8GA 1K5DB 4Z2NA 3KZ1A 5CLQB 1GC7A 2D11A 5JLJB 3KY9A 1MK9B 1WI1A 2W2XD 3P6AA 2AEHA 4GPTB 1X11A 4P7IA 1DDVA 2YS3A 4A5KA 3AU4A 4KVGB 3KRXA 3ZDTA 3ODOA 2LG1A 5D27A 1NTVA 1BTKA 5DIFB 2CRFA 2MKRA 1DYNA 3OANA 2J0KA 1H10A 3TW1A 1UPRA 3MPXA 1EGXA 2L2IA 3X23A 5C16A 2D9ZA 3HQCA
chains in the Genus database with same CATH superfamily
3NWAA 5EFXA 4MK0A 3B77A 2QKMA 1XD4A 2LULA 3VIAA 5C5BB 2DYNA 1V5UA 2DX5A 2XQNM 1WVHA 1ZSQA 3NWDA 2X18A 3DXEA 1I2HA 2I5FA 4HATB 3WA0A 3VOQA 1U2BA 1DDWA 3AJ4A 3OHMB 4EJNA 2W2WA 4CHJA 1XCGA 5JHGA 4XWXA 2UZRA 3DXDA 2IYBA 5CLLB 1IRSA 2LOZA 1WG7A 2FJUB 1LB1A 2EMTA 3GYPA 5DH9B 3PZDA 2MFQA 4A6FA 3HSAA 2EC1A 3A8PA 1KZ7A 3D8FA 1V61A 4HAVB 2IFSA 4GMVA 1P6SA 2DHKA 2M14A 3FEHA 4GMXB 3ULCA 1W1HA 4F7UP 4HB4B 3BINA 1X1GA 1N3HA 1MK7B 5FI1A 2L1CA 2R09A 2QKLA 2ELAA 1QC6A 1K5GB 2G35A 1AQCA 1UNPA 5D3YA 2P0FA 3DCXA 1PMSA 4HAXB 4K2OA 4GN1A 4WVFB 4HAZB 2EMSA 2HE7A 1RRPB 3ODXA 1FHWA 1DROA 1EVHA 2OQBA 1UNQA 3U12A 2YVCA 3FVCA 3SO6A 1ZM0A 1TXDA 2I1KA 2DA0A 1ISNA 2N0YA 4HAUB 1U5GA 2UVMA 3A58A 1X1FA 4IFSA 1MIXA 2YS5A 4YONA 1H4RA 3QIJA 3NW8A 2EJ8A 1MI1A 2MWNB 5JP4A 1M7EA 1OY2A 1OQNA 4GNKB 4EKUA 4L1RA 1RJ2A 3AU5A 3A8QA 2DTCA 2YT1A 4NY0A 5HE0A 5DHFB 4KHBB 4F7HA 4H8SA 5C79A 1TJ6A 2RNRB 2CY4A 2JP2A 3FSSA 2Z0QA 5L81A 3PEGA 2KGXB 4C0AA 4WSFA 3PG7A 2Z13A 2CODA 2LOXA 1LW3A 3FM8C 1ZYIA 1E5WA 3KSYA 2COAA 2RLOA 4NSWA 2KIEA 2DN6A 5LG4B 3QWMA 1EAZA 2K00A 4D6WA 5D3XA 3NSUA 3SNHA 1KZGA 2R2YA 2M38A 4TYZA 4DBBA 5C6RA 4BBKA 3SUZA 4PNKA 1BWNA 2ZKMX 2KCJA 1Q67A 1WJ1A 2D2QA 2Z4DA 3PVUA 1BAKA 3A98B 2Z0OA 4QJ4B 1NI2A 3TVVA 1DBHA 2ROVA 1U27A 4A6FB 3KRWA 1XKEA 1X05A 4TKNA 2D9WA 3ZVRA 2H7EA 4B6HA 1MIZB 5KQ4A 1UPQA 1U29A 2D9XA 5DHAB 5J3TA 3O96A 4HDOA 1P3RA 2GCLA 3P7ZA 5D3VA 3RCPA 2BCJA 1V5MA 5DI9B 2DHJA 3TCAA 3BJIA 2Z14A 4L6EA 2MDXA 4HSIA 4PQ0A 2DYQA 5HE2A 2ROZB 1WJMA 4K17A 3UZTA 4GXBA 2Z59A 4OT1A 2YRYA 2CY5A 2PZ1A 4HAYB 2NMBA 1EF1A 4A6KA 1MKEA 4DXAB 4HB2B 2DKQA 4MT7A 5KQ1A 5D3WA 3HK0A 1X86A 2GCJA 4HDQA 1MPHA 2I5CA 1UNRA 1OMWA 2J0JA 2KIGA 2UZSA 4HB3B 2DX1A 2P8VA 2RVBB 4HAWB 4ZRJA 5J3QA 3T06A 2YT2A 5J3YA 1Y19B 2YF0A 2KR0A 4Y94A 1Z87A 4OSNA 2Y7BA 2GJYA 2DLWA 4GZUA 3V5WA 3CXBB 2DFKA 2R0DA 3D8EA 1WGQA 1KI1B 1ZVRA 1PFJA 3DXCA 4KHAA 1U5FA 2YSZA 2FJLA 5IRSA 1MAIA 1FHOA 1J19A 1FGYA 2YS1A 1DDMA 3PVWA 3SYXA 2P0HA 5I2MA 1V89A 1UEFA 2RSGA 2KUPA 3ML4A 5JHHA 2ADZA 1U5EA 2ZPYA 3NWFA 3TO1A 2V76A 3MDBC 4ZRKA 3HW2B 2RGNB 1NTYA 1P5TA 3GYOA 3F5RA 2HTHB 1TQZA 4A6HA 2VSZA 1U5DA 1W1DA 3U8ZA 5M4YB 3PP2A 2Z0PA 2J59M 2LYDA 4HB0B 2ELBA 4MY6A 5I2SA 3G9WA 4ZRIA 2KUQA 2D4QA 3PVLA 2D10A 4DX8A 1BTNA 1ZC4B 5LONB 3TFMA 1GG3A 4GOUA 5C5BA 5HE3A 4D0NB 3U7DA 1SGHA 5GOWB 3LJUX 2E2XA 2COCA 1J0WA 1XODA 3CIKA 2I1JA 4KHOA 3ULBA 2COFA 1QQGA 1FAOA 2VRWB 1V5PA 4K81A 4Z2MB 2D9VA 2YT0A 2VKIA 4CSQA 2N23A 1NU2A 5FI0A 1AWEA 1XR0B 1FGZA 3ODWA 3HIEA 2OTXA 1FB8A 2GUMA 2P0DA 4CHMA 1FHXA 1GC6A 1V88A 4KAXB 1ZC3B 1XX0A 2LKOA 4IAPA 2CAYA 5KCVA 1M7RA 2DHIA 2J0MA 4YL8A 4DX90 1Y5OA 2Q13A 2RRFA 1B55A 2DKPA 2K2UA 2K8EA 4F7GA 1SHCA 2NZ8B 1FOEA 2D9YA 2RUKB 3N7CA 3F0WA 1T77A 1W1GA 5LOPB 4QJ5B 4K2PA 2W2XC 1WGUA 3M1IB 2GS0A 4CYEA 4HHVA 3PSCA 2Y8FA 1I7AA 3IVFA 3SV1A 4EMOA 5HE1A 2K49A 3WYFB 4QJ3B 1PLSA 4IOYX 2H7DA 4WJ7A 2K2JA 3D8DA 3QBVB 2AL6A 2Y8GA 1K5DB 4Z2NA 3KZ1A 5CLQB 1GC7A 2D11A 5JLJB 3KY9A 1MK9B 1WI1A 2W2XD 3P6AA 2AEHA 4GPTB 1X11A 4P7IA 1DDVA 2YS3A 4A5KA 3AU4A 4KVGB 3KRXA 3ZDTA 3ODOA 2LG1A 4DIXA 5D27A 1NTVA 1BTKA 5DIFB 2CRFA 2MKRA 1DYNA 3OANA 2J0KA 1H10A 2NBVA 4KHBA 3TW1A 1UPRA 3MPXA 4QXAB 1EGXA 2L2IA 3X23A 5C16A 2D9ZA 3HQCA
chains in the Genus database with same CATH topology
5EFXA 4MK0A 2QKMA 1XD4A 2LULA 3VIAA 5C5BB 2DYNA 1V5UA 2DX5A 2XQNM 1WVHA 1ZSQA 2X18A 3DXEA 1I2HA 2I5FA 4HATB 3WA0A 3VOQA 1U2BA 1DDWA 3AJ4A 4EJNA 2W2WA 4CHJA 1XCGA 5JHGA 4XWXA 2UZRA 3DXDA 2IYBA 5CLLB 1IRSA 2LOZA 1WG7A 1LB1A 2EMTA 3GYPA 5DH9B 3PZDA 2MFQA 4A6FA 2EC1A 3A8PA 1KZ7A 3D8FA 1V61A 4HAVB 2IFSA 4GMVA 1P6SA 2DHKA 2M14A 3FEHA 4GMXB 3ULCA 1W1HA 4F7UP 4HB4B 3BINA 1X1GA 1N3HA 1MK7B 5FI1A 2L1CA 2R09A 2QKLA 2ELAA 1QC6A 1K5GB 2G35A 1AQCA 1UNPA 5D3YA 2P0FA 1PMSA 4HAXB 4K2OA 4GN1A 4WVFB 4HAZB 2EMSA 2HE7A 1RRPB 3ODXA 1FHWA 1DROA 1EVHA 2OQBA 1UNQA 2YVCA 3SO6A 1ZM0A 1TXDA 2I1KA 2DA0A 1ISNA 2N0YA 4HAUB 1U5GA 2UVMA 1X1FA 4IFSA 1MIXA 2YS5A 4YONA 1H4RA 3QIJA 2EJ8A 2MWNB 5JP4A 1M7EA 1OY2A 1OQNA 4EKUA 1RJ2A 3AU5A 3A8QA 2DTCA 2YT1A 4NY0A 5HE0A 5DHFB 4KHBB 4F7HA 4H8SA 5C79A 1TJ6A 2RNRB 2CY4A 2JP2A 3FSSA 2Z0QA 5L81A 3PEGA 2KGXB 4C0AA 4WSFA 3PG7A 2CODA 2LOXA 1LW3A 3FM8C 1E5WA 3KSYA 2COAA 2RLOA 4NSWA 2DN6A 3QWMA 1EAZA 2K00A 5D3XA 3NSUA 3SNHA 1KZGA 2M38A 4TYZA 4DBBA 5C6RA 4BBKA 3SUZA 4PNKA 1BWNA 2KCJA 1Q67A 1WJ1A 2D2QA 3PVUA 1BAKA 3A98B 2Z0OA 1NI2A 3TVVA 1DBHA 2ROVA 1U27A 4A6FB 3KRWA 1XKEA 1X05A 4TKNA 2D9WA 3ZVRA 2H7EA 4B6HA 1MIZB 5KQ4A 1UPQA 1U29A 2D9XA 5DHAB 5J3TA 3O96A 4HDOA 1P3RA 2GCLA 3P7ZA 5D3VA 3RCPA 2BCJA 1V5MA 5DI9B 2DHJA 3TCAA 3BJIA 4L6EA 2MDXA 4PQ0A 2DYQA 5HE2A 2ROZB 1WJMA 4K17A 3UZTA 4GXBA 2YRYA 2CY5A 2PZ1A 4HAYB 2NMBA 1EF1A 4A6KA 1MKEA 4DXAB 4HB2B 2DKQA 4MT7A 5KQ1A 5D3WA 3HK0A 1X86A 2GCJA 4HDQA 1MPHA 2I5CA 1UNRA 1OMWA 2J0JA 2UZSA 4HB3B 2DX1A 2P8VA 2RVBB 4HAWB 4ZRJA 5J3QA 3T06A 5J3YA 1Y19B 2YF0A 4Y94A 1Z87A 2Y7BA 2GJYA 2DLWA 4GZUA 3V5WA 3CXBB 2DFKA 2R0DA 3D8EA 1WGQA 1KI1B 1ZVRA 1PFJA 3DXCA 4KHAA 1U5FA 2YSZA 2FJLA 1MAIA 1FHOA 1J19A 1FGYA 2YS1A 1DDMA 3PVWA 3SYXA 2P0HA 1V89A 1UEFA 2RSGA 2KUPA 3ML4A 5JHHA 2ADZA 1U5EA 2ZPYA 3TO1A 2V76A 3MDBC 4ZRKA 3HW2B 2RGNB 1NTYA 1P5TA 3GYOA 3F5RA 2HTHB 1TQZA 4A6HA 2VSZA 1U5DA 1W1DA 3U8ZA 3PP2A 2Z0PA 2J59M 2LYDA 4HB0B 2ELBA 4MY6A 3G9WA 4ZRIA 2D4QA 3PVLA 2D10A 4DX8A 1BTNA 1ZC4B 5LONB 3TFMA 1GG3A 5C5BA 5HE3A 4D0NB 3U7DA 1SGHA 5GOWB 3LJUX 2E2XA 2COCA 1J0WA 1XODA 3CIKA 2I1JA 4KHOA 3ULBA 2COFA 1QQGA 1FAOA 2VRWB 1V5PA 4K81A 4Z2MB 2D9VA 2YT0A 2VKIA 2N23A 1NU2A 5FI0A 1AWEA 1XR0B 1FGZA 3ODWA 2OTXA 1FB8A 2P0DA 4CHMA 1FHXA 1GC6A 1V88A 4KAXB 1ZC3B 1XX0A 2LKOA 4IAPA 2CAYA 5KCVA 1M7RA 2DHIA 2J0MA 4YL8A 4DX90 1Y5OA 2Q13A 1B55A 2DKPA 2K2UA 4F7GA 1SHCA 2NZ8B 1FOEA 2D9YA 2RUKB 3N7CA 3F0WA 1W1GA 5LOPB 4K2PA 2W2XC 1WGUA 3M1IB 2GS0A 4CYEA 4HHVA 3PSCA 2Y8FA 1I7AA 3IVFA 3SV1A 4EMOA 5HE1A 3WYFB 1PLSA 4IOYX 2H7DA 4WJ7A 2K2JA 3D8DA 3QBVB 2AL6A 2Y8GA 1K5DB 4Z2NA 3KZ1A 5CLQB 1GC7A 2D11A 5JLJB 3KY9A 1MK9B 1WI1A 2W2XD 3P6AA 2AEHA 4GPTB 1X11A 4P7IA 1DDVA 2YS3A 4A5KA 3AU4A 4KVGB 3KRXA 3ZDTA 3ODOA 2LG1A 5D27A 1NTVA 1BTKA 5DIFB 2CRFA 2MKRA 1DYNA 3OANA 2J0KA 1H10A 3TW1A 1UPRA 3MPXA 1EGXA 2L2IA 3X23A 5C16A 2D9ZA 3HQCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5EFX A;  4MK0 A;  2QKM A;  1XD4 A;  2LUL A;  3VIA A;  5C5B B;  2DYN A;  1V5U A;  2DX5 A;  2XQN M;  1WVH A;  1ZSQ A;  2X18 A;  3DXE A;  1I2H A;  2I5F A;  4HAT B;  3WA0 A;  3VOQ A;  1U2B A;  1DDW A;  3AJ4 A;  4EJN A;  2W2W A;  4CHJ A;  1XCG A;  5JHG A;  4XWX A;  2UZR A;  3DXD A;  2IYB A;  5CLL B;  1IRS A;  2LOZ A;  1WG7 A;  1LB1 A;  2EMT A;  3GYP A;  5DH9 B;  3PZD A;  2MFQ A;  4A6F A;  2EC1 A;  3A8P A;  1KZ7 A;  3D8F A;  1V61 A;  4HAV B;  2IFS A;  4GMV A;  1P6S A;  2DHK A;  2M14 A;  3FEH A;  4GMX B;  3ULC A;  1W1H A;  4F7U P;  4HB4 B;  3BIN A;  1X1G A;  1N3H A;  1MK7 B;  5FI1 A;  2L1C A;  2R09 A;  2QKL A;  2ELA A;  1QC6 A;  1K5G B;  2G35 A;  1AQC A;  1UNP A;  5D3Y A;  2P0F A;  1PMS A;  4HAX B;  4K2O A;  4GN1 A;  4WVF B;  4HAZ B;  2EMS A;  2HE7 A;  1RRP B;  3ODX A;  1FHW A;  1DRO A;  1EVH A;  2OQB A;  1UNQ A;  2YVC A;  3SO6 A;  1ZM0 A;  1TXD A;  2I1K A;  2DA0 A;  1ISN A;  2N0Y A;  4HAU B;  1U5G A;  2UVM A;  1X1F A;  4IFS A;  1MIX A;  2YS5 A;  4YON A;  1H4R A;  3QIJ A;  2EJ8 A;  2MWN B;  5JP4 A;  1M7E A;  1OY2 A;  1OQN A;  4EKU A;  1RJ2 A;  3AU5 A;  3A8Q A;  2DTC A;  2YT1 A;  4NY0 A;  5HE0 A;  5DHF B;  4KHB B;  4F7H A;  4H8S A;  5C79 A;  1TJ6 A;  2RNR B;  2CY4 A;  2JP2 A;  3FSS A;  2Z0Q A;  5L81 A;  3PEG A;  2KGX B;  4C0A A;  4WSF A;  3PG7 A;  2COD A;  2LOX A;  1LW3 A;  3FM8 C;  1E5W A;  3KSY A;  2COA A;  2RLO A;  4NSW A;  2DN6 A;  3QWM A;  1EAZ A;  2K00 A;  5D3X A;  3NSU A;  3SNH A;  1KZG A;  2M38 A;  4TYZ A;  4DBB A;  5C6R A;  4BBK A;  3SUZ A;  4PNK A;  1BWN A;  2KCJ A;  1Q67 A;  1WJ1 A;  2D2Q A;  3PVU A;  1BAK A;  3A98 B;  2Z0O A;  1NI2 A;  3TVV A;  1DBH A;  2ROV A;  1U27 A;  4A6F B;  3KRW A;  1XKE A;  1X05 A;  4TKN A;  2D9W A;  3ZVR A;  2H7E A;  4B6H A;  1MIZ B;  5KQ4 A;  1UPQ A;  1U29 A;  2D9X A;  5DHA B;  5J3T A;  3O96 A;  4HDO A;  1P3R A;  2GCL A;  3P7Z A;  5D3V A;  3RCP A;  2BCJ A;  1V5M A;  5DI9 B;  2DHJ A;  3TCA A;  3BJI A;  4L6E A;  2MDX A;  4PQ0 A;  2DYQ A;  5HE2 A;  2ROZ B;  1WJM A;  4K17 A;  3UZT A;  4GXB A;  2YRY A;  2CY5 A;  2PZ1 A;  4HAY B;  2NMB A;  1EF1 A;  4A6K A;  1MKE A;  4DXA B;  4HB2 B;  2DKQ A;  4MT7 A;  5KQ1 A;  5D3W A;  3HK0 A;  1X86 A;  2GCJ A;  4HDQ A;  1MPH A;  2I5C A;  1UNR A;  1OMW A;  2J0J A;  2UZS A;  4HB3 B;  2DX1 A;  2P8V A;  2RVB B;  4HAW B;  4ZRJ A;  5J3Q A;  3T06 A;  5J3Y A;  1Y19 B;  2YF0 A;  4Y94 A;  1Z87 A;  2Y7B A;  2GJY A;  2DLW A;  4GZU A;  3V5W A;  3CXB B;  2DFK A;  2R0D A;  3D8E A;  1WGQ A;  1KI1 B;  1ZVR A;  1PFJ A;  3DXC A;  4KHA A;  1U5F A;  2YSZ A;  2FJL A;  1MAI A;  1FHO A;  1J19 A;  1FGY A;  2YS1 A;  1DDM A;  3PVW A;  3SYX A;  2P0H A;  1V89 A;  1UEF A;  2RSG A;  2KUP A;  3ML4 A;  5JHH A;  2ADZ A;  1U5E A;  2ZPY A;  3TO1 A;  2V76 A;  3MDB C;  4ZRK A;  3HW2 B;  2RGN B;  1NTY A;  1P5T A;  3GYO A;  3F5R A;  2HTH B;  1TQZ A;  4A6H A;  2VSZ A;  1U5D A;  1W1D A;  3U8Z A;  3PP2 A;  2Z0P A;  2J59 M;  2LYD A;  4HB0 B;  2ELB A;  4MY6 A;  3G9W A;  4ZRI A;  2D4Q A;  3PVL A;  2D10 A;  4DX8 A;  1BTN A;  1ZC4 B;  5LON B;  3TFM A;  1GG3 A;  5C5B A;  5HE3 A;  4D0N B;  3U7D A;  1SGH A;  5GOW B;  3LJU X;  2E2X A;  2COC A;  1J0W A;  1XOD A;  3CIK A;  2I1J A;  4KHO A;  3ULB A;  2COF A;  1QQG A;  1FAO A;  2VRW B;  1V5P A;  4K81 A;  4Z2M B;  2D9V A;  2YT0 A;  2VKI A;  2N23 A;  1NU2 A;  5FI0 A;  1AWE A;  1XR0 B;  1FGZ A;  3ODW A;  2OTX A;  1FB8 A;  2P0D A;  4CHM A;  1FHX A;  1GC6 A;  1V88 A;  4KAX B;  1ZC3 B;  1XX0 A;  2LKO A;  4IAP A;  2CAY A;  5KCV A;  1M7R A;  2DHI A;  2J0M A;  4YL8 A;  4DX9 0;  1Y5O A;  2Q13 A;  1B55 A;  2DKP A;  2K2U A;  4F7G A;  1SHC A;  2NZ8 B;  1FOE A;  2D9Y A;  2RUK B;  3N7C A;  3F0W A;  1W1G A;  5LOP B;  4K2P A;  2W2X C;  1WGU A;  3M1I B;  2GS0 A;  4CYE A;  4HHV A;  3PSC A;  2Y8F A;  1I7A A;  3IVF A;  3SV1 A;  4EMO A;  5HE1 A;  3WYF B;  1PLS A;  4IOY X;  2H7D A;  4WJ7 A;  2K2J A;  3D8D A;  3QBV B;  2AL6 A;  2Y8G A;  1K5D B;  4Z2N A;  3KZ1 A;  5CLQ B;  1GC7 A;  2D11 A;  5JLJ B;  3KY9 A;  1MK9 B;  1WI1 A;  2W2X D;  3P6A A;  2AEH A;  4GPT B;  1X11 A;  4P7I A;  1DDV A;  2YS3 A;  4A5K A;  3AU4 A;  4KVG B;  3KRX A;  3ZDT A;  3ODO A;  2LG1 A;  5D27 A;  1NTV A;  1BTK A;  5DIF B;  2CRF A;  2MKR A;  1DYN A;  3OAN A;  2J0K A;  1H10 A;  3TW1 A;  1UPR A;  3MPX A;  1EGX A;  2L2I A;  3X23 A;  5C16 A;  2D9Z A;  3HQC A; 
#chains in the Genus database with same CATH topology
 3NWA A;  5EFX A;  4MK0 A;  3B77 A;  2QKM A;  1XD4 A;  2LUL A;  3VIA A;  5C5B B;  2DYN A;  1V5U A;  2DX5 A;  2XQN M;  1WVH A;  1ZSQ A;  3NWD A;  2X18 A;  3DXE A;  1I2H A;  2I5F A;  4HAT B;  3WA0 A;  3VOQ A;  1U2B A;  1DDW A;  3AJ4 A;  3OHM B;  4EJN A;  2W2W A;  4CHJ A;  1XCG A;  5JHG A;  4XWX A;  2UZR A;  3DXD A;  2IYB A;  5CLL B;  1IRS A;  2LOZ A;  1WG7 A;  2FJU B;  1LB1 A;  2EMT A;  3GYP A;  5DH9 B;  3PZD A;  2MFQ A;  4A6F A;  3HSA A;  2EC1 A;  3A8P A;  1KZ7 A;  3D8F A;  1V61 A;  4HAV B;  2IFS A;  4GMV A;  1P6S A;  2DHK A;  2M14 A;  3FEH A;  4GMX B;  3ULC A;  1W1H A;  4F7U P;  4HB4 B;  3BIN A;  1X1G A;  1N3H A;  1MK7 B;  5FI1 A;  2L1C A;  2R09 A;  2QKL A;  2ELA A;  1QC6 A;  1K5G B;  2G35 A;  1AQC A;  1UNP A;  5D3Y A;  2P0F A;  3DCX A;  1PMS A;  4HAX B;  4K2O A;  4GN1 A;  4WVF B;  4HAZ B;  2EMS A;  2HE7 A;  1RRP B;  3ODX A;  1FHW A;  1DRO A;  1EVH A;  2OQB A;  1UNQ A;  3U12 A;  2YVC A;  3FVC A;  3SO6 A;  1ZM0 A;  1TXD A;  2I1K A;  2DA0 A;  1ISN A;  2N0Y A;  4HAU B;  1U5G A;  2UVM A;  3A58 A;  1X1F A;  4IFS A;  1MIX A;  2YS5 A;  4YON A;  1H4R A;  3QIJ A;  3NW8 A;  2EJ8 A;  1MI1 A;  2MWN B;  5JP4 A;  1M7E A;  1OY2 A;  1OQN A;  4GNK B;  4EKU A;  4L1R A;  1RJ2 A;  3AU5 A;  3A8Q A;  2DTC A;  2YT1 A;  4NY0 A;  5HE0 A;  5DHF B;  4KHB B;  4F7H A;  4H8S A;  5C79 A;  1TJ6 A;  2RNR B;  2CY4 A;  2JP2 A;  3FSS A;  2Z0Q A;  5L81 A;  3PEG A;  2KGX B;  4C0A A;  4WSF A;  3PG7 A;  2Z13 A;  2COD A;  2LOX A;  1LW3 A;  3FM8 C;  1ZYI A;  1E5W A;  3KSY A;  2COA A;  2RLO A;  4NSW A;  2KIE A;  2DN6 A;  5LG4 B;  3QWM A;  1EAZ A;  2K00 A;  4D6W A;  5D3X A;  3NSU A;  3SNH A;  1KZG A;  2R2Y A;  2M38 A;  4TYZ A;  4DBB A;  5C6R A;  4BBK A;  3SUZ A;  4PNK A;  1BWN A;  2ZKM X;  2KCJ A;  1Q67 A;  1WJ1 A;  2D2Q A;  2Z4D A;  3PVU A;  1BAK A;  3A98 B;  2Z0O A;  4QJ4 B;  1NI2 A;  3TVV A;  1DBH A;  2ROV A;  1U27 A;  4A6F B;  3KRW A;  1XKE A;  1X05 A;  4TKN A;  2D9W A;  3ZVR A;  2H7E A;  4B6H A;  1MIZ B;  5KQ4 A;  1UPQ A;  1U29 A;  2D9X A;  5DHA B;  5J3T A;  3O96 A;  4HDO A;  1P3R A;  2GCL A;  3P7Z A;  5D3V A;  3RCP A;  2BCJ A;  1V5M A;  5DI9 B;  2DHJ A;  3TCA A;  3BJI A;  2Z14 A;  4L6E A;  2MDX A;  4HSI A;  4PQ0 A;  2DYQ A;  5HE2 A;  2ROZ B;  1WJM A;  4K17 A;  3UZT A;  4GXB A;  2Z59 A;  4OT1 A;  2YRY A;  2CY5 A;  2PZ1 A;  4HAY B;  2NMB A;  1EF1 A;  4A6K A;  1MKE A;  4DXA B;  4HB2 B;  2DKQ A;  4MT7 A;  5KQ1 A;  5D3W A;  3HK0 A;  1X86 A;  2GCJ A;  4HDQ A;  1MPH A;  2I5C A;  1UNR A;  1OMW A;  2J0J A;  2KIG A;  2UZS A;  4HB3 B;  2DX1 A;  2P8V A;  2RVB B;  4HAW B;  4ZRJ A;  5J3Q A;  3T06 A;  2YT2 A;  5J3Y A;  1Y19 B;  2YF0 A;  2KR0 A;  4Y94 A;  1Z87 A;  4OSN A;  2Y7B A;  2GJY A;  2DLW A;  4GZU A;  3V5W A;  3CXB B;  2DFK A;  2R0D A;  3D8E A;  1WGQ A;  1KI1 B;  1ZVR A;  1PFJ A;  3DXC A;  4KHA A;  1U5F A;  2YSZ A;  2FJL A;  5IRS A;  1MAI A;  1FHO A;  1J19 A;  1FGY A;  2YS1 A;  1DDM A;  3PVW A;  3SYX A;  2P0H A;  5I2M A;  1V89 A;  1UEF A;  2RSG A;  2KUP A;  3ML4 A;  5JHH A;  2ADZ A;  1U5E A;  2ZPY A;  3NWF A;  3TO1 A;  2V76 A;  3MDB C;  4ZRK A;  3HW2 B;  2RGN B;  1NTY A;  1P5T A;  3GYO A;  3F5R A;  2HTH B;  1TQZ A;  4A6H A;  2VSZ A;  1U5D A;  1W1D A;  3U8Z A;  5M4Y B;  3PP2 A;  2Z0P A;  2J59 M;  2LYD A;  4HB0 B;  2ELB A;  4MY6 A;  5I2S A;  3G9W A;  4ZRI A;  2KUQ A;  2D4Q A;  3PVL A;  2D10 A;  4DX8 A;  1BTN A;  1ZC4 B;  5LON B;  3TFM A;  1GG3 A;  4GOU A;  5C5B A;  5HE3 A;  4D0N B;  3U7D A;  1SGH A;  5GOW B;  3LJU X;  2E2X A;  2COC A;  1J0W A;  1XOD A;  3CIK A;  2I1J A;  4KHO A;  3ULB A;  2COF A;  1QQG A;  1FAO A;  2VRW B;  1V5P A;  4K81 A;  4Z2M B;  2D9V A;  2YT0 A;  2VKI A;  4CSQ A;  2N23 A;  1NU2 A;  5FI0 A;  1AWE A;  1XR0 B;  1FGZ A;  3ODW A;  3HIE A;  2OTX A;  1FB8 A;  2GUM A;  2P0D A;  4CHM A;  1FHX A;  1GC6 A;  1V88 A;  4KAX B;  1ZC3 B;  1XX0 A;  2LKO A;  4IAP A;  2CAY A;  5KCV A;  1M7R A;  2DHI A;  2J0M A;  4YL8 A;  4DX9 0;  1Y5O A;  2Q13 A;  2RRF A;  1B55 A;  2DKP A;  2K2U A;  2K8E A;  4F7G A;  1SHC A;  2NZ8 B;  1FOE A;  2D9Y A;  2RUK B;  3N7C A;  3F0W A;  1T77 A;  1W1G A;  5LOP B;  4QJ5 B;  4K2P A;  2W2X C;  1WGU A;  3M1I B;  2GS0 A;  4CYE A;  4HHV A;  3PSC A;  2Y8F A;  1I7A A;  3IVF A;  3SV1 A;  4EMO A;  5HE1 A;  2K49 A;  3WYF B;  4QJ3 B;  1PLS A;  4IOY X;  2H7D A;  4WJ7 A;  2K2J A;  3D8D A;  3QBV B;  2AL6 A;  2Y8G A;  1K5D B;  4Z2N A;  3KZ1 A;  5CLQ B;  1GC7 A;  2D11 A;  5JLJ B;  3KY9 A;  1MK9 B;  1WI1 A;  2W2X D;  3P6A A;  2AEH A;  4GPT B;  1X11 A;  4P7I A;  1DDV A;  2YS3 A;  4A5K A;  3AU4 A;  4KVG B;  3KRX A;  3ZDT A;  3ODO A;  2LG1 A;  4DIX A;  5D27 A;  1NTV A;  1BTK A;  5DIF B;  2CRF A;  2MKR A;  1DYN A;  3OAN A;  2J0K A;  1H10 A;  2NBV A;  4KHB A;  3TW1 A;  1UPR A;  3MPX A;  4QXA B;  1EGX A;  2L2I A;  3X23 A;  5C16 A;  2D9Z A;  3HQC A; 
#chains in the Genus database with same CATH homology
 5EFX A;  4MK0 A;  2QKM A;  1XD4 A;  2LUL A;  3VIA A;  5C5B B;  2DYN A;  1V5U A;  2DX5 A;  2XQN M;  1WVH A;  1ZSQ A;  2X18 A;  3DXE A;  1I2H A;  2I5F A;  4HAT B;  3WA0 A;  3VOQ A;  1U2B A;  1DDW A;  3AJ4 A;  4EJN A;  2W2W A;  4CHJ A;  1XCG A;  5JHG A;  4XWX A;  2UZR A;  3DXD A;  2IYB A;  5CLL B;  1IRS A;  2LOZ A;  1WG7 A;  1LB1 A;  2EMT A;  3GYP A;  5DH9 B;  3PZD A;  2MFQ A;  4A6F A;  2EC1 A;  3A8P A;  1KZ7 A;  3D8F A;  1V61 A;  4HAV B;  2IFS A;  4GMV A;  1P6S A;  2DHK A;  2M14 A;  3FEH A;  4GMX B;  3ULC A;  1W1H A;  4F7U P;  4HB4 B;  3BIN A;  1X1G A;  1N3H A;  1MK7 B;  5FI1 A;  2L1C A;  2R09 A;  2QKL A;  2ELA A;  1QC6 A;  1K5G B;  2G35 A;  1AQC A;  1UNP A;  5D3Y A;  2P0F A;  1PMS A;  4HAX B;  4K2O A;  4GN1 A;  4WVF B;  4HAZ B;  2EMS A;  2HE7 A;  1RRP B;  3ODX A;  1FHW A;  1DRO A;  1EVH A;  2OQB A;  1UNQ A;  2YVC A;  3SO6 A;  1ZM0 A;  1TXD A;  2I1K A;  2DA0 A;  1ISN A;  2N0Y A;  4HAU B;  1U5G A;  2UVM A;  1X1F A;  4IFS A;  1MIX A;  2YS5 A;  4YON A;  1H4R A;  3QIJ A;  2EJ8 A;  2MWN B;  5JP4 A;  1M7E A;  1OY2 A;  1OQN A;  4EKU A;  1RJ2 A;  3AU5 A;  3A8Q A;  2DTC A;  2YT1 A;  4NY0 A;  5HE0 A;  5DHF B;  4KHB B;  4F7H A;  4H8S A;  5C79 A;  1TJ6 A;  2RNR B;  2CY4 A;  2JP2 A;  3FSS A;  2Z0Q A;  5L81 A;  3PEG A;  2KGX B;  4C0A A;  4WSF A;  3PG7 A;  2COD A;  2LOX A;  1LW3 A;  3FM8 C;  1E5W A;  3KSY A;  2COA A;  2RLO A;  4NSW A;  2DN6 A;  3QWM A;  1EAZ A;  2K00 A;  5D3X A;  3NSU A;  3SNH A;  1KZG A;  2M38 A;  4TYZ A;  4DBB A;  5C6R A;  4BBK A;  3SUZ A;  4PNK A;  1BWN A;  2KCJ A;  1Q67 A;  1WJ1 A;  2D2Q A;  3PVU A;  1BAK A;  3A98 B;  2Z0O A;  1NI2 A;  3TVV A;  1DBH A;  2ROV A;  1U27 A;  4A6F B;  3KRW A;  1XKE A;  1X05 A;  4TKN A;  2D9W A;  3ZVR A;  2H7E A;  4B6H A;  1MIZ B;  5KQ4 A;  1UPQ A;  1U29 A;  2D9X A;  5DHA B;  5J3T A;  3O96 A;  4HDO A;  1P3R A;  2GCL A;  3P7Z A;  5D3V A;  3RCP A;  2BCJ A;  1V5M A;  5DI9 B;  2DHJ A;  3TCA A;  3BJI A;  4L6E A;  2MDX A;  4PQ0 A;  2DYQ A;  5HE2 A;  2ROZ B;  1WJM A;  4K17 A;  3UZT A;  4GXB A;  2YRY A;  2CY5 A;  2PZ1 A;  4HAY B;  2NMB A;  1EF1 A;  4A6K A;  1MKE A;  4DXA B;  4HB2 B;  2DKQ A;  4MT7 A;  5KQ1 A;  5D3W A;  3HK0 A;  1X86 A;  2GCJ A;  4HDQ A;  1MPH A;  2I5C A;  1UNR A;  1OMW A;  2J0J A;  2UZS A;  4HB3 B;  2DX1 A;  2P8V A;  2RVB B;  4HAW B;  4ZRJ A;  5J3Q A;  3T06 A;  5J3Y A;  1Y19 B;  2YF0 A;  4Y94 A;  1Z87 A;  2Y7B A;  2GJY A;  2DLW A;  4GZU A;  3V5W A;  3CXB B;  2DFK A;  2R0D A;  3D8E A;  1WGQ A;  1KI1 B;  1ZVR A;  1PFJ A;  3DXC A;  4KHA A;  1U5F A;  2YSZ A;  2FJL A;  1MAI A;  1FHO A;  1J19 A;  1FGY A;  2YS1 A;  1DDM A;  3PVW A;  3SYX A;  2P0H A;  1V89 A;  1UEF A;  2RSG A;  2KUP A;  3ML4 A;  5JHH A;  2ADZ A;  1U5E A;  2ZPY A;  3TO1 A;  2V76 A;  3MDB C;  4ZRK A;  3HW2 B;  2RGN B;  1NTY A;  1P5T A;  3GYO A;  3F5R A;  2HTH B;  1TQZ A;  4A6H A;  2VSZ A;  1U5D A;  1W1D A;  3U8Z A;  3PP2 A;  2Z0P A;  2J59 M;  2LYD A;  4HB0 B;  2ELB A;  4MY6 A;  3G9W A;  4ZRI A;  2D4Q A;  3PVL A;  2D10 A;  4DX8 A;  1BTN A;  1ZC4 B;  5LON B;  3TFM A;  1GG3 A;  5C5B A;  5HE3 A;  4D0N B;  3U7D A;  1SGH A;  5GOW B;  3LJU X;  2E2X A;  2COC A;  1J0W A;  1XOD A;  3CIK A;  2I1J A;  4KHO A;  3ULB A;  2COF A;  1QQG A;  1FAO A;  2VRW B;  1V5P A;  4K81 A;  4Z2M B;  2D9V A;  2YT0 A;  2VKI A;  2N23 A;  1NU2 A;  5FI0 A;  1AWE A;  1XR0 B;  1FGZ A;  3ODW A;  2OTX A;  1FB8 A;  2P0D A;  4CHM A;  1FHX A;  1GC6 A;  1V88 A;  4KAX B;  1ZC3 B;  1XX0 A;  2LKO A;  4IAP A;  2CAY A;  5KCV A;  1M7R A;  2DHI A;  2J0M A;  4YL8 A;  4DX9 0;  1Y5O A;  2Q13 A;  1B55 A;  2DKP A;  2K2U A;  4F7G A;  1SHC A;  2NZ8 B;  1FOE A;  2D9Y A;  2RUK B;  3N7C A;  3F0W A;  1W1G A;  5LOP B;  4K2P A;  2W2X C;  1WGU A;  3M1I B;  2GS0 A;  4CYE A;  4HHV A;  3PSC A;  2Y8F A;  1I7A A;  3IVF A;  3SV1 A;  4EMO A;  5HE1 A;  3WYF B;  1PLS A;  4IOY X;  2H7D A;  4WJ7 A;  2K2J A;  3D8D A;  3QBV B;  2AL6 A;  2Y8G A;  1K5D B;  4Z2N A;  3KZ1 A;  5CLQ B;  1GC7 A;  2D11 A;  5JLJ B;  3KY9 A;  1MK9 B;  1WI1 A;  2W2X D;  3P6A A;  2AEH A;  4GPT B;  1X11 A;  4P7I A;  1DDV A;  2YS3 A;  4A5K A;  3AU4 A;  4KVG B;  3KRX A;  3ZDT A;  3ODO A;  2LG1 A;  5D27 A;  1NTV A;  1BTK A;  5DIF B;  2CRF A;  2MKR A;  1DYN A;  3OAN A;  2J0K A;  1H10 A;  3TW1 A;  1UPR A;  3MPX A;  1EGX A;  2L2I A;  3X23 A;  5C16 A;  2D9Z A;  3HQC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...