1TJ6A

Crystal structure of the xenopus tropicalis spred1 evh-1 domain
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
115
structure length
115
Chain Sequence
DSYARVRAVVMTRDDSSGGWLQLGGGGLSSVTVSKTLQPGDSGGTEFLVHGERLRDKTVILECVLRRDLVYNKVTPTFHHWRIGDKKFGLTFQSPADARAFDRGIRRAIEDLSQG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Spred1
publication title 1.65A Crystal structure of the X. tropicalis Spred1 Enabled/Vasodilator-stimulated phosphoprotein homology-1 domain
rcsb
source organism Xenopus tropicalis
molecule tags Signaling protein
total genus 25
structure length 115
sequence length 115
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00568 WH1 WH1 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1tj6A00
1FOEA 1FB8A 1I7AA 1TXDA 5D27A 3QWMA 1OQNA 3ZVRA 2YVCA 2PZ1A 5D3WA 2J0MA 4KAXB 1TJ6A 3F0WA 4DX8A 2ZPYA 4L6EA 2P0DA 3ODXA 4HDQA 5HE3A 2RSGA 1V5PA 2LOXA 3SV1A 1SHCA 4CHMA 2P0FA 2GJYA 4HAYB 2L1CA 2D11A 1BWNA 4NSWA 1NTYA 1U29A 2Y7BA 2YT1A 2H7DA 5FI0A 2DKPA 4HDOA 1ZC4B 3RCPA 3NSUA 2RGNB 4MY6A 4A6FA 1DROA 2DA0A 4WVFB 4HHVA 5J3YA 1Z87A 1ZSQA 2RUKB 1FAOA 2GCLA 1UEFA 2KCJA 2BCJA 3TCAA 2LG1A 2P0HA 1U5EA 2D9YA 2JP2A 4NY0A 2D4QA 3KSYA 4HB2B 2DKQA 1ZC3B 2Z0QA 1V61A 2K2JA 1ZVRA 3PVLA 3M1IB 3PZDA 2COCA 2E2XA 4IFSA 4KHAA 2LYDA 1U5FA 5LONB 4IAPA 4MK0A 1EAZA 2CODA 2J0JA 2N0YA 1V88A 3U8ZA 1PMSA 4GMXB 2D10A 4A6HA 2DX5A 3FM8C 5EFXA 2COAA 3D8DA 2VSZA 2J0KA 1TQZA 4Z2MB 1I2HA 4PQ0A 3HK0A 3A8PA 3PVWA 1EGXA 3LJUX 1V5UA 1UPRA 5HE0A 2D9ZA 4HAUB 2Y8FA 4GPTB 4ZRIA 2DX1A 3DXEA 4A5KA 3T06A 2M14A 1XKEA 2V76A 4CHJA 1MKEA 1FHOA 3ZDTA 2DFKA 2W2XD 2OQBA 2D9XA 2LOZA 2DTCA 4K81A 2AEHA 4EMOA 3BINA 3U7DA 5JHGA 1OY2A 1X1GA 3VOQA 2CY5A 5DHAB 5KQ4A 2ROVA 4HATB 3MPXA 4TKNA 2YF0A 1U5GA 1FGYA 5DH9B 1GC7A 1H10A 2MKRA 4KHBB 5C5BB 4CYEA 3GYPA 2UZRA 1W1HA 1BAKA 2KGXB 2KUPA 5JP4A 1LB1A 5D3VA 2NMBA 1WVHA 1RRPB 2D9WA 3KRXA 1DBHA 4DX90 2R0DA 3ULBA 2Z0OA 2MFQA 3DXCA 1XD4A 5KCVA 1EVHA 1FHXA 1PLSA 3VIAA 4GXBA 5GOWB 2IYBA 4HB3B 4F7GA 1P5TA 1W1GA 2K2UA 1V89A 2I5FA 2VRWB 2W2XC 1H4RA 2D9VA 2HTHB 3TVVA 1J19A 1DDWA 4IOYX 3TW1A 3AU4A 2CAYA 1M7EA 3SUZA 2I5CA 5J3QA 1UNQA 1QC6A 5L81A 2Q13A 3O96A 2EMSA 2N23A 3PG7A 1U5DA 2MWNB 2UVMA 4EKUA 1MK7B 4ZRJA 1FGZA 1AWEA 4Y94A 1J0WA 4ZRKA 1NTVA 2R09A 1U27A 3WA0A 3A98B 3HW2B 2X18A 1SGHA 1DYNA 1DDVA 3TFMA 2P8VA 1Y5OA 2QKMA 4KVGB 3AU5A 2AL6A 3F5RA 3D8EA 4HAVB 1XX0A 2EMTA 3GYOA 1XR0B 2MDXA 2Z0PA 1Q67A 4HAWB 1RJ2A 2DHJA 3CIKA 1P3RA 3OANA 4Z2NA 2DN6A 4KHOA 4A6FB 1QQGA 1UNRA 1X86A 3PP2A 4P7IA 2D2QA 4DBBA 4WJ7A 2HE7A 4K2PA 1WI1A 5C6RA 3ODWA 4WSFA 1WGQA 1MIXA 4HB0B 2UZSA 1UNPA 2CRFA 4GMVA 1WG7A 4K2OA 5JLJB 1MPHA 1MK9B 2I1KA 2ELAA 5D3XA 1FHWA 2YS3A 2DHKA 3CXBB 1NI2A 3P6AA 3KY9A 2I1JA 1U2BA 3G9WA 5KQ1A 1KI1B 4F7HA 1KZ7A 1WJMA 3V5WA 1N3HA 1E5WA 2ADZA 2G35A 3DXDA 1NU2A 1DDMA 1OMWA 4PNKA 1K5GB 5J3TA 3A8QA 2LKOA 4YONA 1UPQA 2GS0A 1B55A 2RNRB 4H8SA 2DYNA 3HQCA 2IFSA 5LOPB 5DHFB 2L2IA 4F7UP 1AQCA 1X1FA 2YSZA 4HAXB 5D3YA 2K00A 4EJNA 3FEHA 4MT7A 1ISNA 2ELBA 2YRYA 3PVUA 3KZ1A 4B6HA 3SO6A 5C5BA 2YT0A 2J59M 1WJ1A 4DXAB 1XODA 3UZTA 2DHIA 3N7CA 1K5DB 1GC6A 2VKIA 3BJIA 1LW3A 5FI1A 2CY4A 5HE2A 3ULCA 2LULA 3MDBC 3QIJA 2DYQA 2W2WA 2NZ8B 4GZUA 1GG3A 5CLLB 5DIFB 2EJ8A 2FJLA 3ML4A 2EC1A 4HB4B 4TYZA 1EF1A 2DLWA 3TO1A 1X11A 1W1DA 1PFJA 4GN1A 2YS1A 4C0AA 1BTKA 1V5MA 3PSCA 5CLQB 3PEGA 3SYXA 1X05A 2COFA 3IVFA 3ODOA 4A6KA 2ROZB 2M38A 4BBKA 3AJ4A 1ZM0A 2XQNM 1XCGA 1BTNA 1WGUA 3KRWA 3WYFB 2RLOA 3SNHA 5JHHA 4K17A 3QBVB 4D0NB 3X23A 3D8FA 1P6SA 1MAIA 4XWXA 5DI9B 5C16A 1IRSA 1KZGA 2QKLA 4YL8A 3FSSA 2OTXA 1M7RA 5HE1A 1Y19B 2Y8GA 2YS5A 3P7ZA 4HAZB 5C79A 2GCJA 2H7EA 1MIZB 2RVBB
chains in the Genus database with same CATH superfamily
1FOEA 1FB8A 2NBVA 1I7AA 1TXDA 5D27A 3A58A 3QWMA 1OQNA 3ZVRA 2YVCA 2YT2A 2PZ1A 3NW8A 5D3WA 2J0MA 5M4YB 2Z59A 4KAXB 1TJ6A 3F0WA 4DX8A 2ZPYA 4L6EA 2KIGA 2P0DA 3ODXA 2KIEA 4HDQA 3B77A 5HE3A 2RSGA 1V5PA 2LOXA 3SV1A 1SHCA 4CHMA 2P0FA 4OSNA 1ZYIA 2GJYA 4HAYB 2L1CA 2D11A 1BWNA 4NSWA 1NTYA 1U29A 2Y7BA 2YT1A 2H7DA 5FI0A 2DKPA 4HSIA 4HDOA 1ZC4B 3RCPA 3NSUA 2RGNB 4MY6A 4A6FA 1DROA 2DA0A 4WVFB 4HHVA 5J3YA 1Z87A 1ZSQA 2RUKB 1FAOA 5I2MA 2GCLA 1UEFA 2KCJA 2BCJA 3TCAA 2LG1A 2P0HA 1U5EA 2D9YA 4GOUA 2JP2A 4NY0A 2D4QA 3KSYA 4HB2B 2DKQA 4DIXA 1ZC3B 2Z0QA 1V61A 2K2JA 1ZVRA 3PVLA 3M1IB 3PZDA 2COCA 2E2XA 4IFSA 4KHAA 2LYDA 1U5FA 5LONB 4IAPA 4MK0A 1EAZA 2CODA 2J0JA 2N0YA 1V88A 3U8ZA 1PMSA 4GMXB 2D10A 4A6HA 4CSQA 2DX5A 2K8EA 3FM8C 5EFXA 2COAA 3D8DA 2VSZA 2J0KA 1TQZA 4Z2MB 1I2HA 4PQ0A 3HK0A 3A8PA 3PVWA 1EGXA 3LJUX 1V5UA 1UPRA 5HE0A 2D9ZA 4HAUB 2Y8FA 4GPTB 4ZRIA 2DX1A 3DXEA 4A5KA 3T06A 2M14A 1XKEA 2V76A 3NWFA 4CHJA 1MKEA 1FHOA 3ZDTA 2DFKA 3FVCA 2W2XD 2OQBA 2D9XA 2LOZA 2DTCA 4K81A 2AEHA 4EMOA 3BINA 3U7DA 5JHGA 1OY2A 1X1GA 3VOQA 2CY5A 5DHAB 5KQ4A 2ROVA 4HATB 3MPXA 4TKNA 2YF0A 1U5GA 1FGYA 5DH9B 1GC7A 1H10A 2MKRA 4KHBB 5C5BB 4CYEA 3GYPA 2GUMA 2UZRA 1W1HA 1BAKA 2KGXB 2KUPA 5JP4A 1LB1A 5D3VA 2NMBA 2KUQA 2Z13A 1WVHA 1RRPB 2D9WA 3KRXA 4QJ3B 1DBHA 4DX90 2R0DA 3ULBA 2Z0OA 2MFQA 3DXCA 3NWDA 1XD4A 5KCVA 1EVHA 1FHXA 1PLSA 3VIAA 4GXBA 5GOWB 2IYBA 4HB3B 4F7GA 1P5TA 1W1GA 2K2UA 1V89A 2I5FA 2VRWB 1MI1A 2W2XC 1H4RA 2D9VA 2FJUB 2HTHB 3TVVA 1J19A 1DDWA 1T77A 2KR0A 4IOYX 3TW1A 4QJ5B 3AU4A 4QJ4B 2CAYA 1M7EA 3DCXA 3SUZA 2I5CA 5J3QA 1UNQA 1QC6A 5L81A 2Q13A 3O96A 2EMSA 2N23A 3PG7A 1U5DA 2MWNB 2UVMA 4KHBA 4EKUA 1MK7B 4ZRJA 1FGZA 1AWEA 4Y94A 1J0WA 4ZRKA 1NTVA 2R09A 1U27A 3WA0A 3A98B 3HW2B 2X18A 1SGHA 1DYNA 1DDVA 3TFMA 2P8VA 1Y5OA 2QKMA 4KVGB 3AU5A 2AL6A 3F5RA 2R2YA 3D8EA 4HAVB 1XX0A 2EMTA 3GYOA 1XR0B 2MDXA 2Z0PA 1Q67A 4HAWB 1RJ2A 4L1RA 2DHJA 3CIKA 1P3RA 3OANA 4Z2NA 2DN6A 4KHOA 5IRSA 4A6FB 4D6WA 1QQGA 1UNRA 1X86A 3PP2A 4P7IA 2D2QA 4DBBA 4WJ7A 2HE7A 4K2PA 1WI1A 5C6RA 3ODWA 4WSFA 1WGQA 1MIXA 4HB0B 2UZSA 1UNPA 2CRFA 4GMVA 1WG7A 4K2OA 5JLJB 1MPHA 1MK9B 2I1KA 4QXAB 2ELAA 5D3XA 1FHWA 2YS3A 2DHKA 3CXBB 1NI2A 3P6AA 3KY9A 2I1JA 1U2BA 3G9WA 2RRFA 5KQ1A 1KI1B 4F7HA 1KZ7A 1WJMA 3V5WA 1N3HA 1E5WA 2ADZA 2G35A 3DXDA 3HIEA 1NU2A 1DDMA 1OMWA 4PNKA 1K5GB 3U12A 5J3TA 3A8QA 2LKOA 4YONA 1UPQA 2GS0A 1B55A 2RNRB 4H8SA 2DYNA 3HQCA 2IFSA 5LOPB 5DHFB 2L2IA 4F7UP 1AQCA 1X1FA 2YSZA 4HAXB 5D3YA 2K00A 4EJNA 2K49A 3FEHA 4MT7A 1ISNA 2ELBA 2YRYA 3PVUA 4OT1A 3HSAA 3KZ1A 3NWAA 4B6HA 3SO6A 5C5BA 2YT0A 2J59M 1WJ1A 4DXAB 1XODA 3UZTA 4GNKB 2DHIA 3N7CA 1K5DB 1GC6A 2VKIA 3BJIA 1LW3A 5FI1A 2CY4A 5HE2A 3ULCA 2LULA 3MDBC 3QIJA 2DYQA 2W2WA 2NZ8B 4GZUA 1GG3A 5CLLB 5DIFB 2EJ8A 2FJLA 3ML4A 2EC1A 4HB4B 4TYZA 1EF1A 2DLWA 3TO1A 1X11A 1W1DA 1PFJA 3OHMB 4GN1A 2YS1A 4C0AA 5I2SA 1BTKA 1V5MA 3PSCA 5CLQB 3PEGA 3SYXA 1X05A 2COFA 3IVFA 2ZKMX 3ODOA 4A6KA 2ROZB 2M38A 4BBKA 3AJ4A 1ZM0A 2XQNM 1XCGA 1BTNA 1WGUA 3KRWA 3WYFB 2RLOA 3SNHA 5JHHA 4K17A 3QBVB 4D0NB 3X23A 3D8FA 1P6SA 1MAIA 4XWXA 5DI9B 5C16A 5LG4B 1IRSA 1KZGA 2QKLA 4YL8A 3FSSA 2OTXA 1M7RA 2Z4DA 5HE1A 1Y19B 2Y8GA 2YS5A 2Z14A 3P7ZA 4HAZB 5C79A 2GCJA 2H7EA 1MIZB 2RVBB
chains in the Genus database with same CATH topology
1FOEA 1FB8A 1I7AA 1TXDA 5D27A 3QWMA 1OQNA 3ZVRA 2YVCA 2PZ1A 5D3WA 2J0MA 4KAXB 1TJ6A 3F0WA 4DX8A 2ZPYA 4L6EA 2P0DA 3ODXA 4HDQA 5HE3A 2RSGA 1V5PA 2LOXA 3SV1A 1SHCA 4CHMA 2P0FA 2GJYA 4HAYB 2L1CA 2D11A 1BWNA 4NSWA 1NTYA 1U29A 2Y7BA 2YT1A 2H7DA 5FI0A 2DKPA 4HDOA 1ZC4B 3RCPA 3NSUA 2RGNB 4MY6A 4A6FA 1DROA 2DA0A 4WVFB 4HHVA 5J3YA 1Z87A 1ZSQA 2RUKB 1FAOA 2GCLA 1UEFA 2KCJA 2BCJA 3TCAA 2LG1A 2P0HA 1U5EA 2D9YA 2JP2A 4NY0A 2D4QA 3KSYA 4HB2B 2DKQA 1ZC3B 2Z0QA 1V61A 2K2JA 1ZVRA 3PVLA 3M1IB 3PZDA 2COCA 2E2XA 4IFSA 4KHAA 2LYDA 1U5FA 5LONB 4IAPA 4MK0A 1EAZA 2CODA 2J0JA 2N0YA 1V88A 3U8ZA 1PMSA 4GMXB 2D10A 4A6HA 2DX5A 3FM8C 5EFXA 2COAA 3D8DA 2VSZA 2J0KA 1TQZA 4Z2MB 1I2HA 4PQ0A 3HK0A 3A8PA 3PVWA 1EGXA 3LJUX 1V5UA 1UPRA 5HE0A 2D9ZA 4HAUB 2Y8FA 4GPTB 4ZRIA 2DX1A 3DXEA 4A5KA 3T06A 2M14A 1XKEA 2V76A 4CHJA 1MKEA 1FHOA 3ZDTA 2DFKA 2W2XD 2OQBA 2D9XA 2LOZA 2DTCA 4K81A 2AEHA 4EMOA 3BINA 3U7DA 5JHGA 1OY2A 1X1GA 3VOQA 2CY5A 5DHAB 5KQ4A 2ROVA 4HATB 3MPXA 4TKNA 2YF0A 1U5GA 1FGYA 5DH9B 1GC7A 1H10A 2MKRA 4KHBB 5C5BB 4CYEA 3GYPA 2UZRA 1W1HA 1BAKA 2KGXB 2KUPA 5JP4A 1LB1A 5D3VA 2NMBA 1WVHA 1RRPB 2D9WA 3KRXA 1DBHA 4DX90 2R0DA 3ULBA 2Z0OA 2MFQA 3DXCA 1XD4A 5KCVA 1EVHA 1FHXA 1PLSA 3VIAA 4GXBA 5GOWB 2IYBA 4HB3B 4F7GA 1P5TA 1W1GA 2K2UA 1V89A 2I5FA 2VRWB 2W2XC 1H4RA 2D9VA 2HTHB 3TVVA 1J19A 1DDWA 4IOYX 3TW1A 3AU4A 2CAYA 1M7EA 3SUZA 2I5CA 5J3QA 1UNQA 1QC6A 5L81A 2Q13A 3O96A 2EMSA 2N23A 3PG7A 1U5DA 2MWNB 2UVMA 4EKUA 1MK7B 4ZRJA 1FGZA 1AWEA 4Y94A 1J0WA 4ZRKA 1NTVA 2R09A 1U27A 3WA0A 3A98B 3HW2B 2X18A 1SGHA 1DYNA 1DDVA 3TFMA 2P8VA 1Y5OA 2QKMA 4KVGB 3AU5A 2AL6A 3F5RA 3D8EA 4HAVB 1XX0A 2EMTA 3GYOA 1XR0B 2MDXA 2Z0PA 1Q67A 4HAWB 1RJ2A 2DHJA 3CIKA 1P3RA 3OANA 4Z2NA 2DN6A 4KHOA 4A6FB 1QQGA 1UNRA 1X86A 3PP2A 4P7IA 2D2QA 4DBBA 4WJ7A 2HE7A 4K2PA 1WI1A 5C6RA 3ODWA 4WSFA 1WGQA 1MIXA 4HB0B 2UZSA 1UNPA 2CRFA 4GMVA 1WG7A 4K2OA 5JLJB 1MPHA 1MK9B 2I1KA 2ELAA 5D3XA 1FHWA 2YS3A 2DHKA 3CXBB 1NI2A 3P6AA 3KY9A 2I1JA 1U2BA 3G9WA 5KQ1A 1KI1B 4F7HA 1KZ7A 1WJMA 3V5WA 1N3HA 1E5WA 2ADZA 2G35A 3DXDA 1NU2A 1DDMA 1OMWA 4PNKA 1K5GB 5J3TA 3A8QA 2LKOA 4YONA 1UPQA 2GS0A 1B55A 2RNRB 4H8SA 2DYNA 3HQCA 2IFSA 5LOPB 5DHFB 2L2IA 4F7UP 1AQCA 1X1FA 2YSZA 4HAXB 5D3YA 2K00A 4EJNA 3FEHA 4MT7A 1ISNA 2ELBA 2YRYA 3PVUA 3KZ1A 4B6HA 3SO6A 5C5BA 2YT0A 2J59M 1WJ1A 4DXAB 1XODA 3UZTA 2DHIA 3N7CA 1K5DB 1GC6A 2VKIA 3BJIA 1LW3A 5FI1A 2CY4A 5HE2A 3ULCA 2LULA 3MDBC 3QIJA 2DYQA 2W2WA 2NZ8B 4GZUA 1GG3A 5CLLB 5DIFB 2EJ8A 2FJLA 3ML4A 2EC1A 4HB4B 4TYZA 1EF1A 2DLWA 3TO1A 1X11A 1W1DA 1PFJA 4GN1A 2YS1A 4C0AA 1BTKA 1V5MA 3PSCA 5CLQB 3PEGA 3SYXA 1X05A 2COFA 3IVFA 3ODOA 4A6KA 2ROZB 2M38A 4BBKA 3AJ4A 1ZM0A 2XQNM 1XCGA 1BTNA 1WGUA 3KRWA 3WYFB 2RLOA 3SNHA 5JHHA 4K17A 3QBVB 4D0NB 3X23A 3D8FA 1P6SA 1MAIA 4XWXA 5DI9B 5C16A 1IRSA 1KZGA 2QKLA 4YL8A 3FSSA 2OTXA 1M7RA 5HE1A 1Y19B 2Y8GA 2YS5A 3P7ZA 4HAZB 5C79A 2GCJA 2H7EA 1MIZB 2RVBB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FOE A;  1FB8 A;  1I7A A;  1TXD A;  5D27 A;  3QWM A;  1OQN A;  3ZVR A;  2YVC A;  2PZ1 A;  5D3W A;  2J0M A;  4KAX B;  1TJ6 A;  3F0W A;  4DX8 A;  2ZPY A;  4L6E A;  2P0D A;  3ODX A;  4HDQ A;  5HE3 A;  2RSG A;  1V5P A;  2LOX A;  3SV1 A;  1SHC A;  4CHM A;  2P0F A;  2GJY A;  4HAY B;  2L1C A;  2D11 A;  1BWN A;  4NSW A;  1NTY A;  1U29 A;  2Y7B A;  2YT1 A;  2H7D A;  5FI0 A;  2DKP A;  4HDO A;  1ZC4 B;  3RCP A;  3NSU A;  2RGN B;  4MY6 A;  4A6F A;  1DRO A;  2DA0 A;  4WVF B;  4HHV A;  5J3Y A;  1Z87 A;  1ZSQ A;  2RUK B;  1FAO A;  2GCL A;  1UEF A;  2KCJ A;  2BCJ A;  3TCA A;  2LG1 A;  2P0H A;  1U5E A;  2D9Y A;  2JP2 A;  4NY0 A;  2D4Q A;  3KSY A;  4HB2 B;  2DKQ A;  1ZC3 B;  2Z0Q A;  1V61 A;  2K2J A;  1ZVR A;  3PVL A;  3M1I B;  3PZD A;  2COC A;  2E2X A;  4IFS A;  4KHA A;  2LYD A;  1U5F A;  5LON B;  4IAP A;  4MK0 A;  1EAZ A;  2COD A;  2J0J A;  2N0Y A;  1V88 A;  3U8Z A;  1PMS A;  4GMX B;  2D10 A;  4A6H A;  2DX5 A;  3FM8 C;  5EFX A;  2COA A;  3D8D A;  2VSZ A;  2J0K A;  1TQZ A;  4Z2M B;  1I2H A;  4PQ0 A;  3HK0 A;  3A8P A;  3PVW A;  1EGX A;  3LJU X;  1V5U A;  1UPR A;  5HE0 A;  2D9Z A;  4HAU B;  2Y8F A;  4GPT B;  4ZRI A;  2DX1 A;  3DXE A;  4A5K A;  3T06 A;  2M14 A;  1XKE A;  2V76 A;  4CHJ A;  1MKE A;  1FHO A;  3ZDT A;  2DFK A;  2W2X D;  2OQB A;  2D9X A;  2LOZ A;  2DTC A;  4K81 A;  2AEH A;  4EMO A;  3BIN A;  3U7D A;  5JHG A;  1OY2 A;  1X1G A;  3VOQ A;  2CY5 A;  5DHA B;  5KQ4 A;  2ROV A;  4HAT B;  3MPX A;  4TKN A;  2YF0 A;  1U5G A;  1FGY A;  5DH9 B;  1GC7 A;  1H10 A;  2MKR A;  4KHB B;  5C5B B;  4CYE A;  3GYP A;  2UZR A;  1W1H A;  1BAK A;  2KGX B;  2KUP A;  5JP4 A;  1LB1 A;  5D3V A;  2NMB A;  1WVH A;  1RRP B;  2D9W A;  3KRX A;  1DBH A;  4DX9 0;  2R0D A;  3ULB A;  2Z0O A;  2MFQ A;  3DXC A;  1XD4 A;  5KCV A;  1EVH A;  1FHX A;  1PLS A;  3VIA A;  4GXB A;  5GOW B;  2IYB A;  4HB3 B;  4F7G A;  1P5T A;  1W1G A;  2K2U A;  1V89 A;  2I5F A;  2VRW B;  2W2X C;  1H4R A;  2D9V A;  2HTH B;  3TVV A;  1J19 A;  1DDW A;  4IOY X;  3TW1 A;  3AU4 A;  2CAY A;  1M7E A;  3SUZ A;  2I5C A;  5J3Q A;  1UNQ A;  1QC6 A;  5L81 A;  2Q13 A;  3O96 A;  2EMS A;  2N23 A;  3PG7 A;  1U5D A;  2MWN B;  2UVM A;  4EKU A;  1MK7 B;  4ZRJ A;  1FGZ A;  1AWE A;  4Y94 A;  1J0W A;  4ZRK A;  1NTV A;  2R09 A;  1U27 A;  3WA0 A;  3A98 B;  3HW2 B;  2X18 A;  1SGH A;  1DYN A;  1DDV A;  3TFM A;  2P8V A;  1Y5O A;  2QKM A;  4KVG B;  3AU5 A;  2AL6 A;  3F5R A;  3D8E A;  4HAV B;  1XX0 A;  2EMT A;  3GYO A;  1XR0 B;  2MDX A;  2Z0P A;  1Q67 A;  4HAW B;  1RJ2 A;  2DHJ A;  3CIK A;  1P3R A;  3OAN A;  4Z2N A;  2DN6 A;  4KHO A;  4A6F B;  1QQG A;  1UNR A;  1X86 A;  3PP2 A;  4P7I A;  2D2Q A;  4DBB A;  4WJ7 A;  2HE7 A;  4K2P A;  1WI1 A;  5C6R A;  3ODW A;  4WSF A;  1WGQ A;  1MIX A;  4HB0 B;  2UZS A;  1UNP A;  2CRF A;  4GMV A;  1WG7 A;  4K2O A;  5JLJ B;  1MPH A;  1MK9 B;  2I1K A;  2ELA A;  5D3X A;  1FHW A;  2YS3 A;  2DHK A;  3CXB B;  1NI2 A;  3P6A A;  3KY9 A;  2I1J A;  1U2B A;  3G9W A;  5KQ1 A;  1KI1 B;  4F7H A;  1KZ7 A;  1WJM A;  3V5W A;  1N3H A;  1E5W A;  2ADZ A;  2G35 A;  3DXD A;  1NU2 A;  1DDM A;  1OMW A;  4PNK A;  1K5G B;  5J3T A;  3A8Q A;  2LKO A;  4YON A;  1UPQ A;  2GS0 A;  1B55 A;  2RNR B;  4H8S A;  2DYN A;  3HQC A;  2IFS A;  5LOP B;  5DHF B;  2L2I A;  4F7U P;  1AQC A;  1X1F A;  2YSZ A;  4HAX B;  5D3Y A;  2K00 A;  4EJN A;  3FEH A;  4MT7 A;  1ISN A;  2ELB A;  2YRY A;  3PVU A;  3KZ1 A;  4B6H A;  3SO6 A;  5C5B A;  2YT0 A;  2J59 M;  1WJ1 A;  4DXA B;  1XOD A;  3UZT A;  2DHI A;  3N7C A;  1K5D B;  1GC6 A;  2VKI A;  3BJI A;  1LW3 A;  5FI1 A;  2CY4 A;  5HE2 A;  3ULC A;  2LUL A;  3MDB C;  3QIJ A;  2DYQ A;  2W2W A;  2NZ8 B;  4GZU A;  1GG3 A;  5CLL B;  5DIF B;  2EJ8 A;  2FJL A;  3ML4 A;  2EC1 A;  4HB4 B;  4TYZ A;  1EF1 A;  2DLW A;  3TO1 A;  1X11 A;  1W1D A;  1PFJ A;  4GN1 A;  2YS1 A;  4C0A A;  1BTK A;  1V5M A;  3PSC A;  5CLQ B;  3PEG A;  3SYX A;  1X05 A;  2COF A;  3IVF A;  3ODO A;  4A6K A;  2ROZ B;  2M38 A;  4BBK A;  3AJ4 A;  1ZM0 A;  2XQN M;  1XCG A;  1BTN A;  1WGU A;  3KRW A;  3WYF B;  2RLO A;  3SNH A;  5JHH A;  4K17 A;  3QBV B;  4D0N B;  3X23 A;  3D8F A;  1P6S A;  1MAI A;  4XWX A;  5DI9 B;  5C16 A;  1IRS A;  1KZG A;  2QKL A;  4YL8 A;  3FSS A;  2OTX A;  1M7R A;  5HE1 A;  1Y19 B;  2Y8G A;  2YS5 A;  3P7Z A;  4HAZ B;  5C79 A;  2GCJ A;  2H7E A;  1MIZ B;  2RVB B; 
#chains in the Genus database with same CATH topology
 1FOE A;  1FB8 A;  2NBV A;  1I7A A;  1TXD A;  5D27 A;  3A58 A;  3QWM A;  1OQN A;  3ZVR A;  2YVC A;  2YT2 A;  2PZ1 A;  3NW8 A;  5D3W A;  2J0M A;  5M4Y B;  2Z59 A;  4KAX B;  1TJ6 A;  3F0W A;  4DX8 A;  2ZPY A;  4L6E A;  2KIG A;  2P0D A;  3ODX A;  2KIE A;  4HDQ A;  3B77 A;  5HE3 A;  2RSG A;  1V5P A;  2LOX A;  3SV1 A;  1SHC A;  4CHM A;  2P0F A;  4OSN A;  1ZYI A;  2GJY A;  4HAY B;  2L1C A;  2D11 A;  1BWN A;  4NSW A;  1NTY A;  1U29 A;  2Y7B A;  2YT1 A;  2H7D A;  5FI0 A;  2DKP A;  4HSI A;  4HDO A;  1ZC4 B;  3RCP A;  3NSU A;  2RGN B;  4MY6 A;  4A6F A;  1DRO A;  2DA0 A;  4WVF B;  4HHV A;  5J3Y A;  1Z87 A;  1ZSQ A;  2RUK B;  1FAO A;  5I2M A;  2GCL A;  1UEF A;  2KCJ A;  2BCJ A;  3TCA A;  2LG1 A;  2P0H A;  1U5E A;  2D9Y A;  4GOU A;  2JP2 A;  4NY0 A;  2D4Q A;  3KSY A;  4HB2 B;  2DKQ A;  4DIX A;  1ZC3 B;  2Z0Q A;  1V61 A;  2K2J A;  1ZVR A;  3PVL A;  3M1I B;  3PZD A;  2COC A;  2E2X A;  4IFS A;  4KHA A;  2LYD A;  1U5F A;  5LON B;  4IAP A;  4MK0 A;  1EAZ A;  2COD A;  2J0J A;  2N0Y A;  1V88 A;  3U8Z A;  1PMS A;  4GMX B;  2D10 A;  4A6H A;  4CSQ A;  2DX5 A;  2K8E A;  3FM8 C;  5EFX A;  2COA A;  3D8D A;  2VSZ A;  2J0K A;  1TQZ A;  4Z2M B;  1I2H A;  4PQ0 A;  3HK0 A;  3A8P A;  3PVW A;  1EGX A;  3LJU X;  1V5U A;  1UPR A;  5HE0 A;  2D9Z A;  4HAU B;  2Y8F A;  4GPT B;  4ZRI A;  2DX1 A;  3DXE A;  4A5K A;  3T06 A;  2M14 A;  1XKE A;  2V76 A;  3NWF A;  4CHJ A;  1MKE A;  1FHO A;  3ZDT A;  2DFK A;  3FVC A;  2W2X D;  2OQB A;  2D9X A;  2LOZ A;  2DTC A;  4K81 A;  2AEH A;  4EMO A;  3BIN A;  3U7D A;  5JHG A;  1OY2 A;  1X1G A;  3VOQ A;  2CY5 A;  5DHA B;  5KQ4 A;  2ROV A;  4HAT B;  3MPX A;  4TKN A;  2YF0 A;  1U5G A;  1FGY A;  5DH9 B;  1GC7 A;  1H10 A;  2MKR A;  4KHB B;  5C5B B;  4CYE A;  3GYP A;  2GUM A;  2UZR A;  1W1H A;  1BAK A;  2KGX B;  2KUP A;  5JP4 A;  1LB1 A;  5D3V A;  2NMB A;  2KUQ A;  2Z13 A;  1WVH A;  1RRP B;  2D9W A;  3KRX A;  4QJ3 B;  1DBH A;  4DX9 0;  2R0D A;  3ULB A;  2Z0O A;  2MFQ A;  3DXC A;  3NWD A;  1XD4 A;  5KCV A;  1EVH A;  1FHX A;  1PLS A;  3VIA A;  4GXB A;  5GOW B;  2IYB A;  4HB3 B;  4F7G A;  1P5T A;  1W1G A;  2K2U A;  1V89 A;  2I5F A;  2VRW B;  1MI1 A;  2W2X C;  1H4R A;  2D9V A;  2FJU B;  2HTH B;  3TVV A;  1J19 A;  1DDW A;  1T77 A;  2KR0 A;  4IOY X;  3TW1 A;  4QJ5 B;  3AU4 A;  4QJ4 B;  2CAY A;  1M7E A;  3DCX A;  3SUZ A;  2I5C A;  5J3Q A;  1UNQ A;  1QC6 A;  5L81 A;  2Q13 A;  3O96 A;  2EMS A;  2N23 A;  3PG7 A;  1U5D A;  2MWN B;  2UVM A;  4KHB A;  4EKU A;  1MK7 B;  4ZRJ A;  1FGZ A;  1AWE A;  4Y94 A;  1J0W A;  4ZRK A;  1NTV A;  2R09 A;  1U27 A;  3WA0 A;  3A98 B;  3HW2 B;  2X18 A;  1SGH A;  1DYN A;  1DDV A;  3TFM A;  2P8V A;  1Y5O A;  2QKM A;  4KVG B;  3AU5 A;  2AL6 A;  3F5R A;  2R2Y A;  3D8E A;  4HAV B;  1XX0 A;  2EMT A;  3GYO A;  1XR0 B;  2MDX A;  2Z0P A;  1Q67 A;  4HAW B;  1RJ2 A;  4L1R A;  2DHJ A;  3CIK A;  1P3R A;  3OAN A;  4Z2N A;  2DN6 A;  4KHO A;  5IRS A;  4A6F B;  4D6W A;  1QQG A;  1UNR A;  1X86 A;  3PP2 A;  4P7I A;  2D2Q A;  4DBB A;  4WJ7 A;  2HE7 A;  4K2P A;  1WI1 A;  5C6R A;  3ODW A;  4WSF A;  1WGQ A;  1MIX A;  4HB0 B;  2UZS A;  1UNP A;  2CRF A;  4GMV A;  1WG7 A;  4K2O A;  5JLJ B;  1MPH A;  1MK9 B;  2I1K A;  4QXA B;  2ELA A;  5D3X A;  1FHW A;  2YS3 A;  2DHK A;  3CXB B;  1NI2 A;  3P6A A;  3KY9 A;  2I1J A;  1U2B A;  3G9W A;  2RRF A;  5KQ1 A;  1KI1 B;  4F7H A;  1KZ7 A;  1WJM A;  3V5W A;  1N3H A;  1E5W A;  2ADZ A;  2G35 A;  3DXD A;  3HIE A;  1NU2 A;  1DDM A;  1OMW A;  4PNK A;  1K5G B;  3U12 A;  5J3T A;  3A8Q A;  2LKO A;  4YON A;  1UPQ A;  2GS0 A;  1B55 A;  2RNR B;  4H8S A;  2DYN A;  3HQC A;  2IFS A;  5LOP B;  5DHF B;  2L2I A;  4F7U P;  1AQC A;  1X1F A;  2YSZ A;  4HAX B;  5D3Y A;  2K00 A;  4EJN A;  2K49 A;  3FEH A;  4MT7 A;  1ISN A;  2ELB A;  2YRY A;  3PVU A;  4OT1 A;  3HSA A;  3KZ1 A;  3NWA A;  4B6H A;  3SO6 A;  5C5B A;  2YT0 A;  2J59 M;  1WJ1 A;  4DXA B;  1XOD A;  3UZT A;  4GNK B;  2DHI A;  3N7C A;  1K5D B;  1GC6 A;  2VKI A;  3BJI A;  1LW3 A;  5FI1 A;  2CY4 A;  5HE2 A;  3ULC A;  2LUL A;  3MDB C;  3QIJ A;  2DYQ A;  2W2W A;  2NZ8 B;  4GZU A;  1GG3 A;  5CLL B;  5DIF B;  2EJ8 A;  2FJL A;  3ML4 A;  2EC1 A;  4HB4 B;  4TYZ A;  1EF1 A;  2DLW A;  3TO1 A;  1X11 A;  1W1D A;  1PFJ A;  3OHM B;  4GN1 A;  2YS1 A;  4C0A A;  5I2S A;  1BTK A;  1V5M A;  3PSC A;  5CLQ B;  3PEG A;  3SYX A;  1X05 A;  2COF A;  3IVF A;  2ZKM X;  3ODO A;  4A6K A;  2ROZ B;  2M38 A;  4BBK A;  3AJ4 A;  1ZM0 A;  2XQN M;  1XCG A;  1BTN A;  1WGU A;  3KRW A;  3WYF B;  2RLO A;  3SNH A;  5JHH A;  4K17 A;  3QBV B;  4D0N B;  3X23 A;  3D8F A;  1P6S A;  1MAI A;  4XWX A;  5DI9 B;  5C16 A;  5LG4 B;  1IRS A;  1KZG A;  2QKL A;  4YL8 A;  3FSS A;  2OTX A;  1M7R A;  2Z4D A;  5HE1 A;  1Y19 B;  2Y8G A;  2YS5 A;  2Z14 A;  3P7Z A;  4HAZ B;  5C79 A;  2GCJ A;  2H7E A;  1MIZ B;  2RVB B; 
#chains in the Genus database with same CATH homology
 1FOE A;  1FB8 A;  1I7A A;  1TXD A;  5D27 A;  3QWM A;  1OQN A;  3ZVR A;  2YVC A;  2PZ1 A;  5D3W A;  2J0M A;  4KAX B;  1TJ6 A;  3F0W A;  4DX8 A;  2ZPY A;  4L6E A;  2P0D A;  3ODX A;  4HDQ A;  5HE3 A;  2RSG A;  1V5P A;  2LOX A;  3SV1 A;  1SHC A;  4CHM A;  2P0F A;  2GJY A;  4HAY B;  2L1C A;  2D11 A;  1BWN A;  4NSW A;  1NTY A;  1U29 A;  2Y7B A;  2YT1 A;  2H7D A;  5FI0 A;  2DKP A;  4HDO A;  1ZC4 B;  3RCP A;  3NSU A;  2RGN B;  4MY6 A;  4A6F A;  1DRO A;  2DA0 A;  4WVF B;  4HHV A;  5J3Y A;  1Z87 A;  1ZSQ A;  2RUK B;  1FAO A;  2GCL A;  1UEF A;  2KCJ A;  2BCJ A;  3TCA A;  2LG1 A;  2P0H A;  1U5E A;  2D9Y A;  2JP2 A;  4NY0 A;  2D4Q A;  3KSY A;  4HB2 B;  2DKQ A;  1ZC3 B;  2Z0Q A;  1V61 A;  2K2J A;  1ZVR A;  3PVL A;  3M1I B;  3PZD A;  2COC A;  2E2X A;  4IFS A;  4KHA A;  2LYD A;  1U5F A;  5LON B;  4IAP A;  4MK0 A;  1EAZ A;  2COD A;  2J0J A;  2N0Y A;  1V88 A;  3U8Z A;  1PMS A;  4GMX B;  2D10 A;  4A6H A;  2DX5 A;  3FM8 C;  5EFX A;  2COA A;  3D8D A;  2VSZ A;  2J0K A;  1TQZ A;  4Z2M B;  1I2H A;  4PQ0 A;  3HK0 A;  3A8P A;  3PVW A;  1EGX A;  3LJU X;  1V5U A;  1UPR A;  5HE0 A;  2D9Z A;  4HAU B;  2Y8F A;  4GPT B;  4ZRI A;  2DX1 A;  3DXE A;  4A5K A;  3T06 A;  2M14 A;  1XKE A;  2V76 A;  4CHJ A;  1MKE A;  1FHO A;  3ZDT A;  2DFK A;  2W2X D;  2OQB A;  2D9X A;  2LOZ A;  2DTC A;  4K81 A;  2AEH A;  4EMO A;  3BIN A;  3U7D A;  5JHG A;  1OY2 A;  1X1G A;  3VOQ A;  2CY5 A;  5DHA B;  5KQ4 A;  2ROV A;  4HAT B;  3MPX A;  4TKN A;  2YF0 A;  1U5G A;  1FGY A;  5DH9 B;  1GC7 A;  1H10 A;  2MKR A;  4KHB B;  5C5B B;  4CYE A;  3GYP A;  2UZR A;  1W1H A;  1BAK A;  2KGX B;  2KUP A;  5JP4 A;  1LB1 A;  5D3V A;  2NMB A;  1WVH A;  1RRP B;  2D9W A;  3KRX A;  1DBH A;  4DX9 0;  2R0D A;  3ULB A;  2Z0O A;  2MFQ A;  3DXC A;  1XD4 A;  5KCV A;  1EVH A;  1FHX A;  1PLS A;  3VIA A;  4GXB A;  5GOW B;  2IYB A;  4HB3 B;  4F7G A;  1P5T A;  1W1G A;  2K2U A;  1V89 A;  2I5F A;  2VRW B;  2W2X C;  1H4R A;  2D9V A;  2HTH B;  3TVV A;  1J19 A;  1DDW A;  4IOY X;  3TW1 A;  3AU4 A;  2CAY A;  1M7E A;  3SUZ A;  2I5C A;  5J3Q A;  1UNQ A;  1QC6 A;  5L81 A;  2Q13 A;  3O96 A;  2EMS A;  2N23 A;  3PG7 A;  1U5D A;  2MWN B;  2UVM A;  4EKU A;  1MK7 B;  4ZRJ A;  1FGZ A;  1AWE A;  4Y94 A;  1J0W A;  4ZRK A;  1NTV A;  2R09 A;  1U27 A;  3WA0 A;  3A98 B;  3HW2 B;  2X18 A;  1SGH A;  1DYN A;  1DDV A;  3TFM A;  2P8V A;  1Y5O A;  2QKM A;  4KVG B;  3AU5 A;  2AL6 A;  3F5R A;  3D8E A;  4HAV B;  1XX0 A;  2EMT A;  3GYO A;  1XR0 B;  2MDX A;  2Z0P A;  1Q67 A;  4HAW B;  1RJ2 A;  2DHJ A;  3CIK A;  1P3R A;  3OAN A;  4Z2N A;  2DN6 A;  4KHO A;  4A6F B;  1QQG A;  1UNR A;  1X86 A;  3PP2 A;  4P7I A;  2D2Q A;  4DBB A;  4WJ7 A;  2HE7 A;  4K2P A;  1WI1 A;  5C6R A;  3ODW A;  4WSF A;  1WGQ A;  1MIX A;  4HB0 B;  2UZS A;  1UNP A;  2CRF A;  4GMV A;  1WG7 A;  4K2O A;  5JLJ B;  1MPH A;  1MK9 B;  2I1K A;  2ELA A;  5D3X A;  1FHW A;  2YS3 A;  2DHK A;  3CXB B;  1NI2 A;  3P6A A;  3KY9 A;  2I1J A;  1U2B A;  3G9W A;  5KQ1 A;  1KI1 B;  4F7H A;  1KZ7 A;  1WJM A;  3V5W A;  1N3H A;  1E5W A;  2ADZ A;  2G35 A;  3DXD A;  1NU2 A;  1DDM A;  1OMW A;  4PNK A;  1K5G B;  5J3T A;  3A8Q A;  2LKO A;  4YON A;  1UPQ A;  2GS0 A;  1B55 A;  2RNR B;  4H8S A;  2DYN A;  3HQC A;  2IFS A;  5LOP B;  5DHF B;  2L2I A;  4F7U P;  1AQC A;  1X1F A;  2YSZ A;  4HAX B;  5D3Y A;  2K00 A;  4EJN A;  3FEH A;  4MT7 A;  1ISN A;  2ELB A;  2YRY A;  3PVU A;  3KZ1 A;  4B6H A;  3SO6 A;  5C5B A;  2YT0 A;  2J59 M;  1WJ1 A;  4DXA B;  1XOD A;  3UZT A;  2DHI A;  3N7C A;  1K5D B;  1GC6 A;  2VKI A;  3BJI A;  1LW3 A;  5FI1 A;  2CY4 A;  5HE2 A;  3ULC A;  2LUL A;  3MDB C;  3QIJ A;  2DYQ A;  2W2W A;  2NZ8 B;  4GZU A;  1GG3 A;  5CLL B;  5DIF B;  2EJ8 A;  2FJL A;  3ML4 A;  2EC1 A;  4HB4 B;  4TYZ A;  1EF1 A;  2DLW A;  3TO1 A;  1X11 A;  1W1D A;  1PFJ A;  4GN1 A;  2YS1 A;  4C0A A;  1BTK A;  1V5M A;  3PSC A;  5CLQ B;  3PEG A;  3SYX A;  1X05 A;  2COF A;  3IVF A;  3ODO A;  4A6K A;  2ROZ B;  2M38 A;  4BBK A;  3AJ4 A;  1ZM0 A;  2XQN M;  1XCG A;  1BTN A;  1WGU A;  3KRW A;  3WYF B;  2RLO A;  3SNH A;  5JHH A;  4K17 A;  3QBV B;  4D0N B;  3X23 A;  3D8F A;  1P6S A;  1MAI A;  4XWX A;  5DI9 B;  5C16 A;  1IRS A;  1KZG A;  2QKL A;  4YL8 A;  3FSS A;  2OTX A;  1M7R A;  5HE1 A;  1Y19 B;  2Y8G A;  2YS5 A;  3P7Z A;  4HAZ B;  5C79 A;  2GCJ A;  2H7E A;  1MIZ B;  2RVB B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...