1TJ6A

Crystal structure of the xenopus tropicalis spred1 evh-1 domain
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
115
structure length
115
Chain Sequence
b'DSYARVRAVVMTRDDSSGGWLQLGGGGLSSVTVSKTLQPGDSGGTEFLVHGERLRDKTVILECVLRRDLVYNKVTPTFHHWRIGDKKFGLTFQSPADARAFDRGIRRAIEDLSQG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Spred1
publication title 1.65A Crystal structure of the X. tropicalis Spred1 Enabled/Vasodilator-stimulated phosphoprotein homology-1 domain
rcsb
source organism Xenopus tropicalis
molecule tags Signaling protein
total genus 25
structure length 115
sequence length 115
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00568 WH1 WH1 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1tj6A00
4KAXB 2D4QA 3HK0A 3N7CA 2RNRB 4Z2NA 2XQNM 4HAXB 3PVWA 1NU2A 3T06A 2AEHA 1MAIA 1BTKA 5C5BA 2K2JA 1WGUA 5EFXA 1FHWA 2W2XC 1UNPA 3HQCA 1ZC3B 1WJMA 1V89A 2Y7BA 2Q13A 1FGZA 2J0MA 2RGNB 4HAVB 1J0WA 2GS0A 2YF0A 2UVMA 5J3TA 5JHHA 4K2OA 4K2PA 5D3VA 5C79A 3F0WA 1W1GA 4GMVA 1BTNA 3LJUX 1P5TA 2EC1A 3DXCA 1NTYA 3G9WA 1GG3A 1EVHA 2R09A 3FM8C 3WA0A 4HDOA 2AL6A 2ADZA 4TYZA 1U5DA 3UZTA 2EMTA 2LYDA 4ZRIA 4KVGB 3GYOA 5JP4A 3ZDTA 4BBKA 2LKOA 1LW3A 3ODOA 3SNHA 4XWXA 1N3HA 1H4RA 2YRYA 3BINA 1TXDA 2W2XD 2EMSA 5DHAB 2M38A 1IRSA 1KZ7A 1I7AA 4F7HA 5HE1A 1SHCA 3KRWA 2D10A 2N23A 1KZGA 1XX0A 4IAPA 1FAOA 2DKQA 1V5PA 4L6EA 1QQGA 3A98B 3KRXA 1DBHA 2LULA 2IFSA 3O96A 4EMOA 4KHAA 5J3YA 1V88A 3TFMA 2GCLA 1MKEA 2I1KA 3ODWA 2LOXA 2V76A 4A6FB 4C0AA 2Y8FA 2N0YA 2D9VA 4GPTB 3D8EA 3TO1A 2P0DA 3PZDA 4K17A 4B6HA 2G35A 3MDBC 2CRFA 2P8VA 4TKNA 4Y94A 1FHXA 2P0FA 4KHBB 2P0HA 4YONA 2JP2A 3QBVB 2E2XA 3TVVA 5D3WA 5HE2A 3SUZA 1KI1B 3DXDA 2COCA 2COFA 4ZRKA 3X23A 5LONB 3U8ZA 1PFJA 4HDQA 3KY9A 4A5KA 4YL8A 2DYNA 3SO6A 1UEFA 3V5WA 2J0JA 2UZRA 2R0DA 2RLOA 3PG7A 5C16A 1WI1A 3WYFB 1W1HA 1TJ6A 3TW1A 2NMBA 4PNKA 4MY6A 4CHMA 4HB2B 1RRPB 1FHOA 4EKUA 4A6FA 3A8QA 1EF1A 1ZM0A 2DA0A 2X18A 1XD4A 2DKPA 1W1DA 4Z2MB 2Z0QA 5KCVA 1X1GA 2W2WA 1XR0B 3PEGA 5KQ1A 1E5WA 2QKMA 2ELBA 2D11A 5CLQB 2DLWA 5HE0A 1U29A 4F7UP 4WVFB 2CY5A 1K5GB 5DIFB 4HATB 1DDWA 1X11A 3VOQA 1DYNA 1MPHA 3QWMA 1U5EA 3IVFA 1GC6A 1DDVA 2ROZB 4A6HA 4D0NB 2YS1A 2D2QA 1OMWA 3TCAA 2YS5A 1I2HA 4MT7A 2CY4A 4MK0A 1MIXA 2NZ8B 2OQBA 1BAKA 2QKLA 4F7GA 1UPRA 1V5MA 3KZ1A 1NTVA 3BJIA 4IOYX 4DX8A 2DFKA 1B55A 2DHKA 5GOWB 1P6SA 2YT0A 5LOPB 3VIAA 1WGQA 2UZSA 1EAZA 2LG1A 5FI1A 1U27A 3MPXA 2K00A 2BCJA 2KGXB 3SV1A 2DYQA 3FSSA 3DXEA 3ML4A 3AU4A 2RSGA 2YVCA 1XKEA 2YS3A 1X05A 1TQZA 3AU5A 2DHJA 1SGHA 2D9YA 1U2BA 2KCJA 1K5DB 1XCGA 1J19A 3P7ZA 3PP2A 3P6AA 5JLJB 3ULBA 1Q67A 1BWNA 1X86A 2FJLA 2Z0PA 2EJ8A 2ZPYA 5L81A 1DROA 4CHJA 1MK9B 1WJ1A 1UPQA 2I1JA 3HW2B 3KSYA 2Y8GA 1ZSQA 4HB0B 1XODA 5JHGA 5C5BB 2VSZA 5DH9B 3D8FA 1U5GA 1MK7B 4IFSA 3NSUA 1QC6A 4HAUB 1Y5OA 2Z0OA 3OANA 4DBBA 1ZVRA 2YSZA 1MIZB 2HTHB 3PVLA 2CODA 1U5FA 2DHIA 3F5RA 1V61A 2GCJA 4GZUA 1Y19B 2H7DA 3CIKA 1V5UA 5D3XA 1FB8A 2I5CA 2MDXA 4HB3B 1M7EA 2ROVA 1RJ2A 1AQCA 3SYXA 2MFQA 1P3RA 2PZ1A 1WVHA 4HAWB 3CXBB 2MKRA 3PVUA 2COAA 5D3YA 5J3QA 4ZRJA 5FI0A 4DX90 2VRWB 2D9XA 2RUKB 1UNRA 5KQ4A 3PSCA 1OQNA 1PMSA 5D27A 2I5FA 3ULCA 4EJNA 4WSFA 4PQ0A 2D9WA 1Z87A 1ZC4B 5DHFB 4KHOA 1X1FA 3FEHA 5CLLB 3ZVRA 3RCPA 4NSWA 2DX5A 2L2IA 1H10A 4GN1A 1PLSA 2YT1A 4P7IA 1FOEA 2M14A 2VKIA 1ISNA 4NY0A 4H8SA 4GMXB 3M1IB 2D9ZA 3D8DA 1LB1A 5C6RA 2H7EA 1AWEA 2J0KA 2MWNB 2KUPA 3U7DA 2DN6A 1EGXA 4DXAB 4A6KA 2CAYA 1WG7A 2OTXA 2HE7A 1M7RA 5DI9B 1DDMA 1GC7A 2J59M 4HB4B 1FGYA 3A8PA 2K2UA 4HAZB 3AJ4A 5HE3A 4CYEA 1UNQA 2ELAA 2L1CA 3QIJA 1NI2A 1OY2A 2RVBB 3GYPA 2DTCA 2LOZA 2DX1A 4HAYB 4GXBA 3ODXA 4WJ7A 2IYBA 4K81A 2GJYA 4HHVA
chains in the Genus database with same CATH superfamily
4KAXB 2D4QA 3HK0A 3N7CA 2RNRB 4Z2NA 2XQNM 4HAXB 3PVWA 1NU2A 3T06A 2AEHA 1MAIA 1BTKA 5C5BA 2K2JA 1WGUA 5EFXA 1FHWA 2W2XC 1UNPA 3HQCA 1ZC3B 1WJMA 1V89A 2Y7BA 2Q13A 1FGZA 2J0MA 2RGNB 4HAVB 4DIXA 1J0WA 2GS0A 2YF0A 2UVMA 5J3TA 5I2SA 5JHHA 4K2OA 4K2PA 5D3VA 5C79A 3F0WA 1W1GA 4GMVA 1BTNA 3LJUX 1P5TA 2EC1A 3DXCA 1NTYA 3G9WA 1GG3A 1EVHA 2R09A 3FM8C 2Z14A 3WA0A 4HDOA 2AL6A 2ADZA 4TYZA 1U5DA 3UZTA 2EMTA 2LYDA 4ZRIA 4KVGB 3GYOA 5JP4A 5I2MA 3ZDTA 4BBKA 2LKOA 1LW3A 3ODOA 3SNHA 4XWXA 3A58A 1N3HA 1H4RA 2YRYA 3BINA 1TXDA 2W2XD 2EMSA 5DHAB 2M38A 1IRSA 1KZ7A 1I7AA 4F7HA 5HE1A 1SHCA 3KRWA 2D10A 2N23A 1KZGA 1XX0A 4IAPA 1FAOA 2DKQA 1V5PA 4L6EA 1QQGA 3A98B 3KRXA 1DBHA 2LULA 2IFSA 3O96A 4EMOA 4KHAA 5J3YA 1V88A 3TFMA 2GCLA 1MKEA 2I1KA 5LG4B 3ODWA 2LOXA 2V76A 4A6FB 4C0AA 2Y8FA 2N0YA 2D9VA 4GPTB 3D8EA 3TO1A 2P0DA 3PZDA 4K17A 4B6HA 2G35A 3MDBC 2CRFA 2P8VA 3OHMB 4TKNA 4Y94A 1FHXA 2P0FA 4KHBB 2P0HA 4YONA 2JP2A 3QBVB 2E2XA 3TVVA 5D3WA 5HE2A 3SUZA 3HIEA 1KI1B 3DXDA 2COCA 2COFA 4ZRKA 3X23A 5LONB 3U8ZA 1PFJA 4HDQA 3KY9A 4A5KA 4YL8A 2DYNA 3SO6A 1UEFA 4QJ5B 3V5WA 2J0JA 2UZRA 2R0DA 2RLOA 3PG7A 5C16A 1WI1A 2ZKMX 3WYFB 5IRSA 1W1HA 1TJ6A 3TW1A 3B77A 4HSIA 2Z59A 2NMBA 4PNKA 4MY6A 4CHMA 4HB2B 1RRPB 1FHOA 4EKUA 4A6FA 3A8QA 1EF1A 1ZM0A 2DA0A 2X18A 1XD4A 2DKPA 1W1DA 4Z2MB 2Z0QA 5KCVA 1X1GA 2W2WA 1ZYIA 2K49A 1XR0B 3PEGA 5KQ1A 4GOUA 1E5WA 2QKMA 2ELBA 2D11A 5CLQB 2DLWA 5HE0A 1U29A 4F7UP 4WVFB 2CY5A 3HSAA 1K5GB 5DIFB 4HATB 3U12A 1DDWA 1X11A 3VOQA 1DYNA 2KIEA 1MPHA 3QWMA 1U5EA 3IVFA 1GC6A 1DDVA 2ROZB 4A6HA 4D0NB 2YS1A 2D2QA 1OMWA 3TCAA 2YS5A 1I2HA 4MT7A 2CY4A 4MK0A 2K8EA 1MIXA 2NZ8B 2OQBA 1BAKA 2QKLA 4F7GA 1UPRA 1V5MA 3KZ1A 4QJ3B 1NTVA 3BJIA 4IOYX 4DX8A 2DFKA 1B55A 2DHKA 5GOWB 1P6SA 1T77A 2YT0A 5LOPB 3NWFA 3VIAA 1WGQA 2UZSA 1EAZA 3FVCA 2LG1A 5FI1A 1U27A 3MPXA 2K00A 2BCJA 2KGXB 2RRFA 3SV1A 2DYQA 3FSSA 3DXEA 3ML4A 2NBVA 3AU4A 2RSGA 2YVCA 1XKEA 2YS3A 1X05A 1TQZA 3AU5A 2DHJA 1SGHA 2D9YA 1U2BA 2KCJA 2KUQA 4GNKB 5M4YB 1K5DB 1XCGA 1J19A 3P7ZA 3PP2A 3P6AA 5JLJB 3ULBA 1Q67A 1BWNA 1X86A 2FJLA 2Z0PA 2EJ8A 4OSNA 2YT2A 2ZPYA 5L81A 1DROA 4L1RA 4KHBA 4CHJA 1MK9B 1WJ1A 1UPQA 2I1JA 3HW2B 3KSYA 2Y8GA 1ZSQA 4HB0B 1XODA 5JHGA 5C5BB 2VSZA 5DH9B 2FJUB 3D8FA 1U5GA 1MK7B 4IFSA 3NSUA 1QC6A 4HAUB 1Y5OA 2Z0OA 3OANA 4DBBA 1ZVRA 2YSZA 1MIZB 2HTHB 3PVLA 2CODA 1U5FA 2DHIA 3F5RA 1V61A 2GCJA 4GZUA 4CSQA 1Y19B 2KR0A 2Z13A 2H7DA 3CIKA 2KIGA 1V5UA 5D3XA 1FB8A 2I5CA 2MDXA 4HB3B 1M7EA 2ROVA 1RJ2A 1AQCA 3SYXA 2MFQA 3NWDA 1P3RA 3DCXA 1MI1A 2PZ1A 1WVHA 4HAWB 3CXBB 2MKRA 3PVUA 2COAA 5D3YA 5J3QA 4ZRJA 5FI0A 4DX90 2VRWB 2D9XA 2RUKB 1UNRA 5KQ4A 3PSCA 1OQNA 1PMSA 5D27A 2I5FA 3ULCA 4EJNA 4WSFA 4PQ0A 2D9WA 1Z87A 1ZC4B 5DHFB 4KHOA 1X1FA 3FEHA 5CLLB 3ZVRA 3RCPA 4NSWA 2DX5A 2L2IA 1H10A 4GN1A 1PLSA 2YT1A 4P7IA 1FOEA 4OT1A 2M14A 2VKIA 4D6WA 1ISNA 4NY0A 4H8SA 4GMXB 3M1IB 2D9ZA 3D8DA 1LB1A 5C6RA 2H7EA 1AWEA 2J0KA 2MWNB 2KUPA 3U7DA 2DN6A 1EGXA 4DXAB 4A6KA 2CAYA 1WG7A 2OTXA 4QXAB 2HE7A 3NWAA 1M7RA 5DI9B 1DDMA 1GC7A 2R2YA 2GUMA 2J59M 4HB4B 1FGYA 3A8PA 2K2UA 4HAZB 3AJ4A 5HE3A 4CYEA 2Z4DA 1UNQA 2ELAA 4QJ4B 2L1CA 3QIJA 1NI2A 1OY2A 2RVBB 3GYPA 2DTCA 2LOZA 2DX1A 4HAYB 3NW8A 4GXBA 3ODXA 4WJ7A 2IYBA 4K81A 2GJYA 4HHVA
chains in the Genus database with same CATH topology
4KAXB 2D4QA 3HK0A 3N7CA 2RNRB 4Z2NA 2XQNM 4HAXB 3PVWA 1NU2A 3T06A 2AEHA 1MAIA 1BTKA 5C5BA 2K2JA 1WGUA 5EFXA 1FHWA 2W2XC 1UNPA 3HQCA 1ZC3B 1WJMA 1V89A 2Y7BA 2Q13A 1FGZA 2J0MA 2RGNB 4HAVB 1J0WA 2GS0A 2YF0A 2UVMA 5J3TA 5JHHA 4K2OA 4K2PA 5D3VA 5C79A 3F0WA 1W1GA 4GMVA 1BTNA 3LJUX 1P5TA 2EC1A 3DXCA 1NTYA 3G9WA 1GG3A 1EVHA 2R09A 3FM8C 3WA0A 4HDOA 2AL6A 2ADZA 4TYZA 1U5DA 3UZTA 2EMTA 2LYDA 4ZRIA 4KVGB 3GYOA 5JP4A 3ZDTA 4BBKA 2LKOA 1LW3A 3ODOA 3SNHA 4XWXA 1N3HA 1H4RA 2YRYA 3BINA 1TXDA 2W2XD 2EMSA 5DHAB 2M38A 1IRSA 1KZ7A 1I7AA 4F7HA 5HE1A 1SHCA 3KRWA 2D10A 2N23A 1KZGA 1XX0A 4IAPA 1FAOA 2DKQA 1V5PA 4L6EA 1QQGA 3A98B 3KRXA 1DBHA 2LULA 2IFSA 3O96A 4EMOA 4KHAA 5J3YA 1V88A 3TFMA 2GCLA 1MKEA 2I1KA 3ODWA 2LOXA 2V76A 4A6FB 4C0AA 2Y8FA 2N0YA 2D9VA 4GPTB 3D8EA 3TO1A 2P0DA 3PZDA 4K17A 4B6HA 2G35A 3MDBC 2CRFA 2P8VA 4TKNA 4Y94A 1FHXA 2P0FA 4KHBB 2P0HA 4YONA 2JP2A 3QBVB 2E2XA 3TVVA 5D3WA 5HE2A 3SUZA 1KI1B 3DXDA 2COCA 2COFA 4ZRKA 3X23A 5LONB 3U8ZA 1PFJA 4HDQA 3KY9A 4A5KA 4YL8A 2DYNA 3SO6A 1UEFA 3V5WA 2J0JA 2UZRA 2R0DA 2RLOA 3PG7A 5C16A 1WI1A 3WYFB 1W1HA 1TJ6A 3TW1A 2NMBA 4PNKA 4MY6A 4CHMA 4HB2B 1RRPB 1FHOA 4EKUA 4A6FA 3A8QA 1EF1A 1ZM0A 2DA0A 2X18A 1XD4A 2DKPA 1W1DA 4Z2MB 2Z0QA 5KCVA 1X1GA 2W2WA 1XR0B 3PEGA 5KQ1A 1E5WA 2QKMA 2ELBA 2D11A 5CLQB 2DLWA 5HE0A 1U29A 4F7UP 4WVFB 2CY5A 1K5GB 5DIFB 4HATB 1DDWA 1X11A 3VOQA 1DYNA 1MPHA 3QWMA 1U5EA 3IVFA 1GC6A 1DDVA 2ROZB 4A6HA 4D0NB 2YS1A 2D2QA 1OMWA 3TCAA 2YS5A 1I2HA 4MT7A 2CY4A 4MK0A 1MIXA 2NZ8B 2OQBA 1BAKA 2QKLA 4F7GA 1UPRA 1V5MA 3KZ1A 1NTVA 3BJIA 4IOYX 4DX8A 2DFKA 1B55A 2DHKA 5GOWB 1P6SA 2YT0A 5LOPB 3VIAA 1WGQA 2UZSA 1EAZA 2LG1A 5FI1A 1U27A 3MPXA 2K00A 2BCJA 2KGXB 3SV1A 2DYQA 3FSSA 3DXEA 3ML4A 3AU4A 2RSGA 2YVCA 1XKEA 2YS3A 1X05A 1TQZA 3AU5A 2DHJA 1SGHA 2D9YA 1U2BA 2KCJA 1K5DB 1XCGA 1J19A 3P7ZA 3PP2A 3P6AA 5JLJB 3ULBA 1Q67A 1BWNA 1X86A 2FJLA 2Z0PA 2EJ8A 2ZPYA 5L81A 1DROA 4CHJA 1MK9B 1WJ1A 1UPQA 2I1JA 3HW2B 3KSYA 2Y8GA 1ZSQA 4HB0B 1XODA 5JHGA 5C5BB 2VSZA 5DH9B 3D8FA 1U5GA 1MK7B 4IFSA 3NSUA 1QC6A 4HAUB 1Y5OA 2Z0OA 3OANA 4DBBA 1ZVRA 2YSZA 1MIZB 2HTHB 3PVLA 2CODA 1U5FA 2DHIA 3F5RA 1V61A 2GCJA 4GZUA 1Y19B 2H7DA 3CIKA 1V5UA 5D3XA 1FB8A 2I5CA 2MDXA 4HB3B 1M7EA 2ROVA 1RJ2A 1AQCA 3SYXA 2MFQA 1P3RA 2PZ1A 1WVHA 4HAWB 3CXBB 2MKRA 3PVUA 2COAA 5D3YA 5J3QA 4ZRJA 5FI0A 4DX90 2VRWB 2D9XA 2RUKB 1UNRA 5KQ4A 3PSCA 1OQNA 1PMSA 5D27A 2I5FA 3ULCA 4EJNA 4WSFA 4PQ0A 2D9WA 1Z87A 1ZC4B 5DHFB 4KHOA 1X1FA 3FEHA 5CLLB 3ZVRA 3RCPA 4NSWA 2DX5A 2L2IA 1H10A 4GN1A 1PLSA 2YT1A 4P7IA 1FOEA 2M14A 2VKIA 1ISNA 4NY0A 4H8SA 4GMXB 3M1IB 2D9ZA 3D8DA 1LB1A 5C6RA 2H7EA 1AWEA 2J0KA 2MWNB 2KUPA 3U7DA 2DN6A 1EGXA 4DXAB 4A6KA 2CAYA 1WG7A 2OTXA 2HE7A 1M7RA 5DI9B 1DDMA 1GC7A 2J59M 4HB4B 1FGYA 3A8PA 2K2UA 4HAZB 3AJ4A 5HE3A 4CYEA 1UNQA 2ELAA 2L1CA 3QIJA 1NI2A 1OY2A 2RVBB 3GYPA 2DTCA 2LOZA 2DX1A 4HAYB 4GXBA 3ODXA 4WJ7A 2IYBA 4K81A 2GJYA 4HHVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KAX B;  2D4Q A;  3HK0 A;  3N7C A;  2RNR B;  4Z2N A;  2XQN M;  4HAX B;  3PVW A;  1NU2 A;  3T06 A;  2AEH A;  1MAI A;  1BTK A;  5C5B A;  2K2J A;  1WGU A;  5EFX A;  1FHW A;  2W2X C;  1UNP A;  3HQC A;  1ZC3 B;  1WJM A;  1V89 A;  2Y7B A;  2Q13 A;  1FGZ A;  2J0M A;  2RGN B;  4HAV B;  1J0W A;  2GS0 A;  2YF0 A;  2UVM A;  5J3T A;  5JHH A;  4K2O A;  4K2P A;  5D3V A;  5C79 A;  3F0W A;  1W1G A;  4GMV A;  1BTN A;  3LJU X;  1P5T A;  2EC1 A;  3DXC A;  1NTY A;  3G9W A;  1GG3 A;  1EVH A;  2R09 A;  3FM8 C;  3WA0 A;  4HDO A;  2AL6 A;  2ADZ A;  4TYZ A;  1U5D A;  3UZT A;  2EMT A;  2LYD A;  4ZRI A;  4KVG B;  3GYO A;  5JP4 A;  3ZDT A;  4BBK A;  2LKO A;  1LW3 A;  3ODO A;  3SNH A;  4XWX A;  1N3H A;  1H4R A;  2YRY A;  3BIN A;  1TXD A;  2W2X D;  2EMS A;  5DHA B;  2M38 A;  1IRS A;  1KZ7 A;  1I7A A;  4F7H A;  5HE1 A;  1SHC A;  3KRW A;  2D10 A;  2N23 A;  1KZG A;  1XX0 A;  4IAP A;  1FAO A;  2DKQ A;  1V5P A;  4L6E A;  1QQG A;  3A98 B;  3KRX A;  1DBH A;  2LUL A;  2IFS A;  3O96 A;  4EMO A;  4KHA A;  5J3Y A;  1V88 A;  3TFM A;  2GCL A;  1MKE A;  2I1K A;  3ODW A;  2LOX A;  2V76 A;  4A6F B;  4C0A A;  2Y8F A;  2N0Y A;  2D9V A;  4GPT B;  3D8E A;  3TO1 A;  2P0D A;  3PZD A;  4K17 A;  4B6H A;  2G35 A;  3MDB C;  2CRF A;  2P8V A;  4TKN A;  4Y94 A;  1FHX A;  2P0F A;  4KHB B;  2P0H A;  4YON A;  2JP2 A;  3QBV B;  2E2X A;  3TVV A;  5D3W A;  5HE2 A;  3SUZ A;  1KI1 B;  3DXD A;  2COC A;  2COF A;  4ZRK A;  3X23 A;  5LON B;  3U8Z A;  1PFJ A;  4HDQ A;  3KY9 A;  4A5K A;  4YL8 A;  2DYN A;  3SO6 A;  1UEF A;  3V5W A;  2J0J A;  2UZR A;  2R0D A;  2RLO A;  3PG7 A;  5C16 A;  1WI1 A;  3WYF B;  1W1H A;  1TJ6 A;  3TW1 A;  2NMB A;  4PNK A;  4MY6 A;  4CHM A;  4HB2 B;  1RRP B;  1FHO A;  4EKU A;  4A6F A;  3A8Q A;  1EF1 A;  1ZM0 A;  2DA0 A;  2X18 A;  1XD4 A;  2DKP A;  1W1D A;  4Z2M B;  2Z0Q A;  5KCV A;  1X1G A;  2W2W A;  1XR0 B;  3PEG A;  5KQ1 A;  1E5W A;  2QKM A;  2ELB A;  2D11 A;  5CLQ B;  2DLW A;  5HE0 A;  1U29 A;  4F7U P;  4WVF B;  2CY5 A;  1K5G B;  5DIF B;  4HAT B;  1DDW A;  1X11 A;  3VOQ A;  1DYN A;  1MPH A;  3QWM A;  1U5E A;  3IVF A;  1GC6 A;  1DDV A;  2ROZ B;  4A6H A;  4D0N B;  2YS1 A;  2D2Q A;  1OMW A;  3TCA A;  2YS5 A;  1I2H A;  4MT7 A;  2CY4 A;  4MK0 A;  1MIX A;  2NZ8 B;  2OQB A;  1BAK A;  2QKL A;  4F7G A;  1UPR A;  1V5M A;  3KZ1 A;  1NTV A;  3BJI A;  4IOY X;  4DX8 A;  2DFK A;  1B55 A;  2DHK A;  5GOW B;  1P6S A;  2YT0 A;  5LOP B;  3VIA A;  1WGQ A;  2UZS A;  1EAZ A;  2LG1 A;  5FI1 A;  1U27 A;  3MPX A;  2K00 A;  2BCJ A;  2KGX B;  3SV1 A;  2DYQ A;  3FSS A;  3DXE A;  3ML4 A;  3AU4 A;  2RSG A;  2YVC A;  1XKE A;  2YS3 A;  1X05 A;  1TQZ A;  3AU5 A;  2DHJ A;  1SGH A;  2D9Y A;  1U2B A;  2KCJ A;  1K5D B;  1XCG A;  1J19 A;  3P7Z A;  3PP2 A;  3P6A A;  5JLJ B;  3ULB A;  1Q67 A;  1BWN A;  1X86 A;  2FJL A;  2Z0P A;  2EJ8 A;  2ZPY A;  5L81 A;  1DRO A;  4CHJ A;  1MK9 B;  1WJ1 A;  1UPQ A;  2I1J A;  3HW2 B;  3KSY A;  2Y8G A;  1ZSQ A;  4HB0 B;  1XOD A;  5JHG A;  5C5B B;  2VSZ A;  5DH9 B;  3D8F A;  1U5G A;  1MK7 B;  4IFS A;  3NSU A;  1QC6 A;  4HAU B;  1Y5O A;  2Z0O A;  3OAN A;  4DBB A;  1ZVR A;  2YSZ A;  1MIZ B;  2HTH B;  3PVL A;  2COD A;  1U5F A;  2DHI A;  3F5R A;  1V61 A;  2GCJ A;  4GZU A;  1Y19 B;  2H7D A;  3CIK A;  1V5U A;  5D3X A;  1FB8 A;  2I5C A;  2MDX A;  4HB3 B;  1M7E A;  2ROV A;  1RJ2 A;  1AQC A;  3SYX A;  2MFQ A;  1P3R A;  2PZ1 A;  1WVH A;  4HAW B;  3CXB B;  2MKR A;  3PVU A;  2COA A;  5D3Y A;  5J3Q A;  4ZRJ A;  5FI0 A;  4DX9 0;  2VRW B;  2D9X A;  2RUK B;  1UNR A;  5KQ4 A;  3PSC A;  1OQN A;  1PMS A;  5D27 A;  2I5F A;  3ULC A;  4EJN A;  4WSF A;  4PQ0 A;  2D9W A;  1Z87 A;  1ZC4 B;  5DHF B;  4KHO A;  1X1F A;  3FEH A;  5CLL B;  3ZVR A;  3RCP A;  4NSW A;  2DX5 A;  2L2I A;  1H10 A;  4GN1 A;  1PLS A;  2YT1 A;  4P7I A;  1FOE A;  2M14 A;  2VKI A;  1ISN A;  4NY0 A;  4H8S A;  4GMX B;  3M1I B;  2D9Z A;  3D8D A;  1LB1 A;  5C6R A;  2H7E A;  1AWE A;  2J0K A;  2MWN B;  2KUP A;  3U7D A;  2DN6 A;  1EGX A;  4DXA B;  4A6K A;  2CAY A;  1WG7 A;  2OTX A;  2HE7 A;  1M7R A;  5DI9 B;  1DDM A;  1GC7 A;  2J59 M;  4HB4 B;  1FGY A;  3A8P A;  2K2U A;  4HAZ B;  3AJ4 A;  5HE3 A;  4CYE A;  1UNQ A;  2ELA A;  2L1C A;  3QIJ A;  1NI2 A;  1OY2 A;  2RVB B;  3GYP A;  2DTC A;  2LOZ A;  2DX1 A;  4HAY B;  4GXB A;  3ODX A;  4WJ7 A;  2IYB A;  4K81 A;  2GJY A;  4HHV A; 
#chains in the Genus database with same CATH topology
 4KAX B;  2D4Q A;  3HK0 A;  3N7C A;  2RNR B;  4Z2N A;  2XQN M;  4HAX B;  3PVW A;  1NU2 A;  3T06 A;  2AEH A;  1MAI A;  1BTK A;  5C5B A;  2K2J A;  1WGU A;  5EFX A;  1FHW A;  2W2X C;  1UNP A;  3HQC A;  1ZC3 B;  1WJM A;  1V89 A;  2Y7B A;  2Q13 A;  1FGZ A;  2J0M A;  2RGN B;  4HAV B;  4DIX A;  1J0W A;  2GS0 A;  2YF0 A;  2UVM A;  5J3T A;  5I2S A;  5JHH A;  4K2O A;  4K2P A;  5D3V A;  5C79 A;  3F0W A;  1W1G A;  4GMV A;  1BTN A;  3LJU X;  1P5T A;  2EC1 A;  3DXC A;  1NTY A;  3G9W A;  1GG3 A;  1EVH A;  2R09 A;  3FM8 C;  2Z14 A;  3WA0 A;  4HDO A;  2AL6 A;  2ADZ A;  4TYZ A;  1U5D A;  3UZT A;  2EMT A;  2LYD A;  4ZRI A;  4KVG B;  3GYO A;  5JP4 A;  5I2M A;  3ZDT A;  4BBK A;  2LKO A;  1LW3 A;  3ODO A;  3SNH A;  4XWX A;  3A58 A;  1N3H A;  1H4R A;  2YRY A;  3BIN A;  1TXD A;  2W2X D;  2EMS A;  5DHA B;  2M38 A;  1IRS A;  1KZ7 A;  1I7A A;  4F7H A;  5HE1 A;  1SHC A;  3KRW A;  2D10 A;  2N23 A;  1KZG A;  1XX0 A;  4IAP A;  1FAO A;  2DKQ A;  1V5P A;  4L6E A;  1QQG A;  3A98 B;  3KRX A;  1DBH A;  2LUL A;  2IFS A;  3O96 A;  4EMO A;  4KHA A;  5J3Y A;  1V88 A;  3TFM A;  2GCL A;  1MKE A;  2I1K A;  5LG4 B;  3ODW A;  2LOX A;  2V76 A;  4A6F B;  4C0A A;  2Y8F A;  2N0Y A;  2D9V A;  4GPT B;  3D8E A;  3TO1 A;  2P0D A;  3PZD A;  4K17 A;  4B6H A;  2G35 A;  3MDB C;  2CRF A;  2P8V A;  3OHM B;  4TKN A;  4Y94 A;  1FHX A;  2P0F A;  4KHB B;  2P0H A;  4YON A;  2JP2 A;  3QBV B;  2E2X A;  3TVV A;  5D3W A;  5HE2 A;  3SUZ A;  3HIE A;  1KI1 B;  3DXD A;  2COC A;  2COF A;  4ZRK A;  3X23 A;  5LON B;  3U8Z A;  1PFJ A;  4HDQ A;  3KY9 A;  4A5K A;  4YL8 A;  2DYN A;  3SO6 A;  1UEF A;  4QJ5 B;  3V5W A;  2J0J A;  2UZR A;  2R0D A;  2RLO A;  3PG7 A;  5C16 A;  1WI1 A;  2ZKM X;  3WYF B;  5IRS A;  1W1H A;  1TJ6 A;  3TW1 A;  3B77 A;  4HSI A;  2Z59 A;  2NMB A;  4PNK A;  4MY6 A;  4CHM A;  4HB2 B;  1RRP B;  1FHO A;  4EKU A;  4A6F A;  3A8Q A;  1EF1 A;  1ZM0 A;  2DA0 A;  2X18 A;  1XD4 A;  2DKP A;  1W1D A;  4Z2M B;  2Z0Q A;  5KCV A;  1X1G A;  2W2W A;  1ZYI A;  2K49 A;  1XR0 B;  3PEG A;  5KQ1 A;  4GOU A;  1E5W A;  2QKM A;  2ELB A;  2D11 A;  5CLQ B;  2DLW A;  5HE0 A;  1U29 A;  4F7U P;  4WVF B;  2CY5 A;  3HSA A;  1K5G B;  5DIF B;  4HAT B;  3U12 A;  1DDW A;  1X11 A;  3VOQ A;  1DYN A;  2KIE A;  1MPH A;  3QWM A;  1U5E A;  3IVF A;  1GC6 A;  1DDV A;  2ROZ B;  4A6H A;  4D0N B;  2YS1 A;  2D2Q A;  1OMW A;  3TCA A;  2YS5 A;  1I2H A;  4MT7 A;  2CY4 A;  4MK0 A;  2K8E A;  1MIX A;  2NZ8 B;  2OQB A;  1BAK A;  2QKL A;  4F7G A;  1UPR A;  1V5M A;  3KZ1 A;  4QJ3 B;  1NTV A;  3BJI A;  4IOY X;  4DX8 A;  2DFK A;  1B55 A;  2DHK A;  5GOW B;  1P6S A;  1T77 A;  2YT0 A;  5LOP B;  3NWF A;  3VIA A;  1WGQ A;  2UZS A;  1EAZ A;  3FVC A;  2LG1 A;  5FI1 A;  1U27 A;  3MPX A;  2K00 A;  2BCJ A;  2KGX B;  2RRF A;  3SV1 A;  2DYQ A;  3FSS A;  3DXE A;  3ML4 A;  2NBV A;  3AU4 A;  2RSG A;  2YVC A;  1XKE A;  2YS3 A;  1X05 A;  1TQZ A;  3AU5 A;  2DHJ A;  1SGH A;  2D9Y A;  1U2B A;  2KCJ A;  2KUQ A;  4GNK B;  5M4Y B;  1K5D B;  1XCG A;  1J19 A;  3P7Z A;  3PP2 A;  3P6A A;  5JLJ B;  3ULB A;  1Q67 A;  1BWN A;  1X86 A;  2FJL A;  2Z0P A;  2EJ8 A;  4OSN A;  2YT2 A;  2ZPY A;  5L81 A;  1DRO A;  4L1R A;  4KHB A;  4CHJ A;  1MK9 B;  1WJ1 A;  1UPQ A;  2I1J A;  3HW2 B;  3KSY A;  2Y8G A;  1ZSQ A;  4HB0 B;  1XOD A;  5JHG A;  5C5B B;  2VSZ A;  5DH9 B;  2FJU B;  3D8F A;  1U5G A;  1MK7 B;  4IFS A;  3NSU A;  1QC6 A;  4HAU B;  1Y5O A;  2Z0O A;  3OAN A;  4DBB A;  1ZVR A;  2YSZ A;  1MIZ B;  2HTH B;  3PVL A;  2COD A;  1U5F A;  2DHI A;  3F5R A;  1V61 A;  2GCJ A;  4GZU A;  4CSQ A;  1Y19 B;  2KR0 A;  2Z13 A;  2H7D A;  3CIK A;  2KIG A;  1V5U A;  5D3X A;  1FB8 A;  2I5C A;  2MDX A;  4HB3 B;  1M7E A;  2ROV A;  1RJ2 A;  1AQC A;  3SYX A;  2MFQ A;  3NWD A;  1P3R A;  3DCX A;  1MI1 A;  2PZ1 A;  1WVH A;  4HAW B;  3CXB B;  2MKR A;  3PVU A;  2COA A;  5D3Y A;  5J3Q A;  4ZRJ A;  5FI0 A;  4DX9 0;  2VRW B;  2D9X A;  2RUK B;  1UNR A;  5KQ4 A;  3PSC A;  1OQN A;  1PMS A;  5D27 A;  2I5F A;  3ULC A;  4EJN A;  4WSF A;  4PQ0 A;  2D9W A;  1Z87 A;  1ZC4 B;  5DHF B;  4KHO A;  1X1F A;  3FEH A;  5CLL B;  3ZVR A;  3RCP A;  4NSW A;  2DX5 A;  2L2I A;  1H10 A;  4GN1 A;  1PLS A;  2YT1 A;  4P7I A;  1FOE A;  4OT1 A;  2M14 A;  2VKI A;  4D6W A;  1ISN A;  4NY0 A;  4H8S A;  4GMX B;  3M1I B;  2D9Z A;  3D8D A;  1LB1 A;  5C6R A;  2H7E A;  1AWE A;  2J0K A;  2MWN B;  2KUP A;  3U7D A;  2DN6 A;  1EGX A;  4DXA B;  4A6K A;  2CAY A;  1WG7 A;  2OTX A;  4QXA B;  2HE7 A;  3NWA A;  1M7R A;  5DI9 B;  1DDM A;  1GC7 A;  2R2Y A;  2GUM A;  2J59 M;  4HB4 B;  1FGY A;  3A8P A;  2K2U A;  4HAZ B;  3AJ4 A;  5HE3 A;  4CYE A;  2Z4D A;  1UNQ A;  2ELA A;  4QJ4 B;  2L1C A;  3QIJ A;  1NI2 A;  1OY2 A;  2RVB B;  3GYP A;  2DTC A;  2LOZ A;  2DX1 A;  4HAY B;  3NW8 A;  4GXB A;  3ODX A;  4WJ7 A;  2IYB A;  4K81 A;  2GJY A;  4HHV A; 
#chains in the Genus database with same CATH homology
 4KAX B;  2D4Q A;  3HK0 A;  3N7C A;  2RNR B;  4Z2N A;  2XQN M;  4HAX B;  3PVW A;  1NU2 A;  3T06 A;  2AEH A;  1MAI A;  1BTK A;  5C5B A;  2K2J A;  1WGU A;  5EFX A;  1FHW A;  2W2X C;  1UNP A;  3HQC A;  1ZC3 B;  1WJM A;  1V89 A;  2Y7B A;  2Q13 A;  1FGZ A;  2J0M A;  2RGN B;  4HAV B;  1J0W A;  2GS0 A;  2YF0 A;  2UVM A;  5J3T A;  5JHH A;  4K2O A;  4K2P A;  5D3V A;  5C79 A;  3F0W A;  1W1G A;  4GMV A;  1BTN A;  3LJU X;  1P5T A;  2EC1 A;  3DXC A;  1NTY A;  3G9W A;  1GG3 A;  1EVH A;  2R09 A;  3FM8 C;  3WA0 A;  4HDO A;  2AL6 A;  2ADZ A;  4TYZ A;  1U5D A;  3UZT A;  2EMT A;  2LYD A;  4ZRI A;  4KVG B;  3GYO A;  5JP4 A;  3ZDT A;  4BBK A;  2LKO A;  1LW3 A;  3ODO A;  3SNH A;  4XWX A;  1N3H A;  1H4R A;  2YRY A;  3BIN A;  1TXD A;  2W2X D;  2EMS A;  5DHA B;  2M38 A;  1IRS A;  1KZ7 A;  1I7A A;  4F7H A;  5HE1 A;  1SHC A;  3KRW A;  2D10 A;  2N23 A;  1KZG A;  1XX0 A;  4IAP A;  1FAO A;  2DKQ A;  1V5P A;  4L6E A;  1QQG A;  3A98 B;  3KRX A;  1DBH A;  2LUL A;  2IFS A;  3O96 A;  4EMO A;  4KHA A;  5J3Y A;  1V88 A;  3TFM A;  2GCL A;  1MKE A;  2I1K A;  3ODW A;  2LOX A;  2V76 A;  4A6F B;  4C0A A;  2Y8F A;  2N0Y A;  2D9V A;  4GPT B;  3D8E A;  3TO1 A;  2P0D A;  3PZD A;  4K17 A;  4B6H A;  2G35 A;  3MDB C;  2CRF A;  2P8V A;  4TKN A;  4Y94 A;  1FHX A;  2P0F A;  4KHB B;  2P0H A;  4YON A;  2JP2 A;  3QBV B;  2E2X A;  3TVV A;  5D3W A;  5HE2 A;  3SUZ A;  1KI1 B;  3DXD A;  2COC A;  2COF A;  4ZRK A;  3X23 A;  5LON B;  3U8Z A;  1PFJ A;  4HDQ A;  3KY9 A;  4A5K A;  4YL8 A;  2DYN A;  3SO6 A;  1UEF A;  3V5W A;  2J0J A;  2UZR A;  2R0D A;  2RLO A;  3PG7 A;  5C16 A;  1WI1 A;  3WYF B;  1W1H A;  1TJ6 A;  3TW1 A;  2NMB A;  4PNK A;  4MY6 A;  4CHM A;  4HB2 B;  1RRP B;  1FHO A;  4EKU A;  4A6F A;  3A8Q A;  1EF1 A;  1ZM0 A;  2DA0 A;  2X18 A;  1XD4 A;  2DKP A;  1W1D A;  4Z2M B;  2Z0Q A;  5KCV A;  1X1G A;  2W2W A;  1XR0 B;  3PEG A;  5KQ1 A;  1E5W A;  2QKM A;  2ELB A;  2D11 A;  5CLQ B;  2DLW A;  5HE0 A;  1U29 A;  4F7U P;  4WVF B;  2CY5 A;  1K5G B;  5DIF B;  4HAT B;  1DDW A;  1X11 A;  3VOQ A;  1DYN A;  1MPH A;  3QWM A;  1U5E A;  3IVF A;  1GC6 A;  1DDV A;  2ROZ B;  4A6H A;  4D0N B;  2YS1 A;  2D2Q A;  1OMW A;  3TCA A;  2YS5 A;  1I2H A;  4MT7 A;  2CY4 A;  4MK0 A;  1MIX A;  2NZ8 B;  2OQB A;  1BAK A;  2QKL A;  4F7G A;  1UPR A;  1V5M A;  3KZ1 A;  1NTV A;  3BJI A;  4IOY X;  4DX8 A;  2DFK A;  1B55 A;  2DHK A;  5GOW B;  1P6S A;  2YT0 A;  5LOP B;  3VIA A;  1WGQ A;  2UZS A;  1EAZ A;  2LG1 A;  5FI1 A;  1U27 A;  3MPX A;  2K00 A;  2BCJ A;  2KGX B;  3SV1 A;  2DYQ A;  3FSS A;  3DXE A;  3ML4 A;  3AU4 A;  2RSG A;  2YVC A;  1XKE A;  2YS3 A;  1X05 A;  1TQZ A;  3AU5 A;  2DHJ A;  1SGH A;  2D9Y A;  1U2B A;  2KCJ A;  1K5D B;  1XCG A;  1J19 A;  3P7Z A;  3PP2 A;  3P6A A;  5JLJ B;  3ULB A;  1Q67 A;  1BWN A;  1X86 A;  2FJL A;  2Z0P A;  2EJ8 A;  2ZPY A;  5L81 A;  1DRO A;  4CHJ A;  1MK9 B;  1WJ1 A;  1UPQ A;  2I1J A;  3HW2 B;  3KSY A;  2Y8G A;  1ZSQ A;  4HB0 B;  1XOD A;  5JHG A;  5C5B B;  2VSZ A;  5DH9 B;  3D8F A;  1U5G A;  1MK7 B;  4IFS A;  3NSU A;  1QC6 A;  4HAU B;  1Y5O A;  2Z0O A;  3OAN A;  4DBB A;  1ZVR A;  2YSZ A;  1MIZ B;  2HTH B;  3PVL A;  2COD A;  1U5F A;  2DHI A;  3F5R A;  1V61 A;  2GCJ A;  4GZU A;  1Y19 B;  2H7D A;  3CIK A;  1V5U A;  5D3X A;  1FB8 A;  2I5C A;  2MDX A;  4HB3 B;  1M7E A;  2ROV A;  1RJ2 A;  1AQC A;  3SYX A;  2MFQ A;  1P3R A;  2PZ1 A;  1WVH A;  4HAW B;  3CXB B;  2MKR A;  3PVU A;  2COA A;  5D3Y A;  5J3Q A;  4ZRJ A;  5FI0 A;  4DX9 0;  2VRW B;  2D9X A;  2RUK B;  1UNR A;  5KQ4 A;  3PSC A;  1OQN A;  1PMS A;  5D27 A;  2I5F A;  3ULC A;  4EJN A;  4WSF A;  4PQ0 A;  2D9W A;  1Z87 A;  1ZC4 B;  5DHF B;  4KHO A;  1X1F A;  3FEH A;  5CLL B;  3ZVR A;  3RCP A;  4NSW A;  2DX5 A;  2L2I A;  1H10 A;  4GN1 A;  1PLS A;  2YT1 A;  4P7I A;  1FOE A;  2M14 A;  2VKI A;  1ISN A;  4NY0 A;  4H8S A;  4GMX B;  3M1I B;  2D9Z A;  3D8D A;  1LB1 A;  5C6R A;  2H7E A;  1AWE A;  2J0K A;  2MWN B;  2KUP A;  3U7D A;  2DN6 A;  1EGX A;  4DXA B;  4A6K A;  2CAY A;  1WG7 A;  2OTX A;  2HE7 A;  1M7R A;  5DI9 B;  1DDM A;  1GC7 A;  2J59 M;  4HB4 B;  1FGY A;  3A8P A;  2K2U A;  4HAZ B;  3AJ4 A;  5HE3 A;  4CYE A;  1UNQ A;  2ELA A;  2L1C A;  3QIJ A;  1NI2 A;  1OY2 A;  2RVB B;  3GYP A;  2DTC A;  2LOZ A;  2DX1 A;  4HAY B;  4GXB A;  3ODX A;  4WJ7 A;  2IYB A;  4K81 A;  2GJY A;  4HHV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...