2NZ8B

N-terminal dhph cassette of trio in complex with nucleotide-free rac1
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
305
structure length
279
Chain Sequence
ARRKEFIMAELIQTEKAYVRDLRECMDTYLWEMTSGVEEIPPGIVNKELIIFGNMQEIYEFHNNIFLKELEKYEQLPEDVGHCFVTWADKFQMYVTYCKNKPDSTQLILEHAGSYFDEIQQRHGLANSISSYLIKPVQRITKYQLLLKELLTCCEEGKGEIKDGLEVMLSVPKRANDAMHLSMLEGFSQGELILQESFQHLFLFEMSLVFSKEVKDSSGRSKYLYKSKLFTSELGVTEHVEGDPCKFATSDNKIVLKASSIENKQDWIKHIREVIQERT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Signaling protein,cell cycle
molecule keywords ras-related C3 botulinum toxin substrate 1 isoform Rac1
publication title The DH and PH Domains of Trio Coordinately Engage Rho GTPases for their Efficient Activation
pubmed doi rcsb
source organism Homo sapiens
total genus 91
structure length 279
sequence length 305
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2006-11-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00169 PH PH domain
B PF00621 RhoGEF RhoGEF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.900.10 Mainly Alpha Up-down Bundle Dbl Homology Domain; Chain A Dbl homology (DH) domain 2nz8B01
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2nz8B02
2N23A 2K00A 1SGHA 2GS0A 2AEHA 4GZUA 4K81A 2H7DA 5JP4A 5DH9B 1FGZA 1U5GA 4ZRIA 3HQCA 1AWEA 2J59M 1MIZB 5D3XA 3KRXA 3KRWA 1DDMA 4EJNA 4KHBB 1M7EA 2RSGA 4PQ0A 4F7UP 4DXAB 2VRWB 1FB8A 3DXDA 1WGQA 4GMVA 4HB0B 5KQ4A 1P6SA 5HE1A 4A6FA 4MY6A 2GCLA 2MDXA 3ZDTA 4HATB 1FOEA 3T06A 1W1GA 5C79A 1N3HA 1J0WA 1WGUA 2YS1A 3D8EA 1X1GA 4DBBA 3HW2B 1QQGA 4IOYX 3WYFB 3QIJA 4WSFA 3PZDA 1LB1A 2EMTA 1TXDA 1H10A 3SYXA 2W2WA 2D10A 4F7HA 2V76A 3A8PA 1Y19B 2CAYA 3VIAA 1MIXA 2UVMA 3V5WA 2P0FA 4EKUA 3GF9A 2MFQA 3PEGA 3EO2A 2LOZA 4HDOA 5D27A 3SO6A 3UZTA 2KR9A 1J19A 3TFMA 4HHVA 2GJYA 2YT1A 1KZGA 4K2OA 4DX90 3ODXA 3X23A 5DHFB 1FHWA 2G35A 5DI9B 2ZPYA 3PSCA 3KY9A 5C5BB 2D9XA 2HTHB 1ZC3B 2CY5A 3TW1A 4GMXB 3NSUA 1KI1B 3GYOA 3ML4A 2BCJA 5GOWB 5CLQB 2P0HA 1EAZA 5C16A 3D8FA 2XQNM 3GYPA 1KZ7A 1ZM0A 3A98B 1UEFA 3FEHA 3JV3A 2I5FA 3PVUA 1DROA 3MPXA 2N0YA 2YF0A 1NI2A 2PZ1A 2HE7A 4NY0A 2KUPA 5KCVA 2IFSA 2ELAA 3QBVB 2DX5A 2UZSA 4Z2MB 1NU2A 3DXCA 1V88A 2DN6A 2W2XD 3FM8C 4NSWA 4A6KA 3AU5A 3D8DA 1DDVA 2EJ8A 1ISNA 2DHJA 1BY1A 4CHJA 3F5RA 3HK0A 2GCJA 4HAVB 1BTNA 1I7AA 2D9YA 5HE0A 4A6FB 5JHGA 1Q67A 2I1KA 1WVHA 1OQNA 4CHMA 4D0OA 2Y8GA 1XCGA 2I1JA 1W1DA 2P8VA 3PG7A 1M7RA 1AQCA 1OMWA 2COAA 1X1FA 1QC6A 2EMSA 2QKMA 3F0WA 4WVFB 5LOPB 1UNQA 2Z0OA 2J0MA 2YVCA 4PNKA 4CYEA 4KHOA 1MAIA 2E2XA 2J0KA 5DHAB 4WJ7A 1BAKA 1UPRA 1DDWA 4A5KA 5KQ1A 4D0NB 2YS3A 3VOQA 2UZRA 2L1CA 4A6HA 1MK9B 4Y94A 2DYNA 2I5CA 2R09A 1ZVRA 1P5TA 3WA0A 1WJ1A 1SHCA 2L2IA 3P7ZA 1GC6A 3PVLA 3CIKA 5HE2A 1B55A 4MT7A 2D4QA 2YSZA 2YS5A 3QWMA 4HAUB 2H7EA 1UPQA 4P7IA 1WG7A 4YONA 4GN1A 3ZVRA 5LONB 4KVGB 4HAWB 3O96A 3ODOA 3MDBC 2JP2A 3PP2A 3KSYA 3M1IB 2ELBA 1MK7B 2Y7BA 4Z2NA 4GYVA 1ZC4B 1Z87A 3A8QA 3P6AA 3BJIA 5D3YA 5J3QA 1XR0B 2LKOA 2CRFA 3ULBA 4F7GA 2D9WA 5J3YA 4B6HA 1XKEA 1K5DB 1V5MA 2CODA 2DHKA 4K2PA 2DA0A 2W2XC 2LYDA 5HE3A 2VKIA 1GG3A 1PFJA 2RVBB 3AJ4A 1UNRA 2NZ8B 4EMOA 1RJ2A 3SNHA 3TVVA 4K17A 3N7CA 2Z0PA 1GC7A 1IRSA 4IFSA 1W1HA 3U8ZA 5JHHA 2DYQA 1RRPB 2DTCA 1NTVA 2DX1A 2FJLA 3TCAA 1P3RA 1U27A 3CXBB 1WJMA 2KGXB 2MWNB 1EF1A 1X86A 1XD4A 1MPHA 5EFXA 2RNRB 5J3TA 1U5FA 5D3VA 1H4RA 2R0DA 2RLOA 5DIFB 2D9ZA 2OTXA 3SV1A 2COCA 3ODWA 2NMBA 4HDQA 4L6EA 2DHIA 3G9WA 4H8SA 4ZRJA 5FI0A 4HB4B 1FHXA 2DKPA 2M14A 1ZSQA 4GPTB 2X18A 1FAOA 2M38A 3KZ1A 1XX0A 4BBKA 2ADZA 1NTYA 3ULCA 2YRYA 2K2UA 4GOUA 1U29A 3BINA 3DXEA 5JLJB 1X11A 1V89A 4TKNA 1TQZA 1F5XA 2D11A 2Z0QA 4HAYB 2LULA 3SUZA 3OANA 1DYNA 4HB3B 1U5EA 2P0DA 1U5DA 5C6RA 2EC1A 5CLLB 2QKLA 1I2HA 1DBHA 2J0JA 1PLSA 2LOXA 3AU4A 1WI1A 1Y5OA 1V61A 3U7DA 3TO1A 4GXBA 2KCJA 3PVWA 2Y8FA 1V5UA 1EGXA 5FI1A 1MKEA 5L81A 1EVHA 4MK0A 2RUKB 4HAZB 1E5WA 1PMSA 2DKQA 1X05A 2YT0A 3LJUX 1V5PA 1U2BA 1BWNA 2ROVA 2DLWA 2MKRA 3FSSA 4XWXA 2ROZB 3IVFA 1K5GB 4IAPA 2OQBA 1OY2A 2RGNB 2K2JA 4YL8A 2COFA 1XODA 1LW3A 2IYBA 2D2QA 4KAXB 2VSZA 4HB2B 1TJ6A 4ZRKA 3RCPA 2AL6A 4KHAA 2CY4A 5D3WA 4TYZA 5C5BA 4C0AA 2DFKA 4HAXB 1FGYA 1BTKA 2LG1A 1FHOA 4DX8A 1UNPA 2D9VA 2Q13A
chains in the Genus database with same CATH superfamily
2N23A 2K00A 1SGHA 2GS0A 2AEHA 4GZUA 2KIGA 4K81A 2H7DA 2NBVA 3FVCA 5JP4A 5DH9B 1FGZA 1U5GA 4ZRIA 3HQCA 4QJ5B 1AWEA 2J59M 1MIZB 5D3XA 3KRXA 2KR0A 3KRWA 1DDMA 4EJNA 2FJUB 4KHBB 1M7EA 2RSGA 4PQ0A 4F7UP 4DXAB 2VRWB 1FB8A 3DXDA 1WGQA 4GMVA 4HB0B 5KQ4A 1P6SA 5M4YB 5HE1A 4A6FA 4MY6A 2GCLA 2MDXA 3ZDTA 4HATB 1FOEA 3T06A 1W1GA 5C79A 1N3HA 1J0WA 1WGUA 2YS1A 3D8EA 1X1GA 4DBBA 3NWAA 3HW2B 2KIEA 1QQGA 4IOYX 3WYFB 3QIJA 4WSFA 3PZDA 1LB1A 2EMTA 1TXDA 1H10A 3SYXA 2W2WA 2D10A 4F7HA 2V76A 3A8PA 1Y19B 2CAYA 3VIAA 1MIXA 2UVMA 3V5WA 2P0FA 4EKUA 3GF9A 2MFQA 3PEGA 3EO2A 2LOZA 4HDOA 5D27A 3SO6A 3UZTA 2KR9A 1J19A 3TFMA 4HHVA 2GJYA 2YT1A 1KZGA 4K2OA 4DX90 3ODXA 3X23A 5DHFB 1FHWA 2G35A 5DI9B 2ZPYA 3PSCA 3KY9A 5IRSA 5C5BB 2D9XA 2HTHB 1ZC3B 2CY5A 3TW1A 4GMXB 3NSUA 1KI1B 3GYOA 3ML4A 2BCJA 5GOWB 5CLQB 2P0HA 1EAZA 5C16A 3D8FA 2XQNM 3GYPA 1KZ7A 1ZM0A 3A98B 5I2SA 1UEFA 3FEHA 3JV3A 2I5FA 3PVUA 1DROA 3MPXA 2N0YA 2YF0A 1NI2A 2PZ1A 2HE7A 4NY0A 2KUPA 5KCVA 2IFSA 2ELAA 3QBVB 2DX5A 2UZSA 4Z2MB 1NU2A 3DXCA 1V88A 2DN6A 2W2XD 3FM8C 4NSWA 4A6KA 3AU5A 3D8DA 1DDVA 2EJ8A 1ISNA 2DHJA 1BY1A 4CHJA 3F5RA 3HK0A 2GCJA 4HAVB 1BTNA 1I7AA 2D9YA 5HE0A 4A6FB 5JHGA 1Q67A 2I1KA 3DCXA 3OHMB 4QJ3B 1WVHA 1OQNA 4CHMA 4D0OA 2Y8GA 1XCGA 2I1JA 1W1DA 2P8VA 3PG7A 1M7RA 1AQCA 1OMWA 2COAA 1X1FA 1QC6A 2EMSA 2QKMA 3F0WA 4WVFB 5LOPB 1UNQA 2Z0OA 2J0MA 3U12A 2YVCA 4PNKA 4CYEA 4KHOA 1MAIA 2E2XA 2J0KA 5DHAB 4WJ7A 1BAKA 2Z13A 1UPRA 1DDWA 4A5KA 3NW8A 5KQ1A 4D0NB 2YS3A 3VOQA 2UZRA 4HSIA 2L1CA 4A6HA 1MK9B 2KUQA 4Y94A 2DYNA 2I5CA 2R09A 1ZVRA 1P5TA 3WA0A 1WJ1A 1SHCA 5LG4B 4OSNA 2L2IA 3P7ZA 1GC6A 3PVLA 3CIKA 5HE2A 1B55A 4MT7A 2D4QA 2YSZA 2YS5A 3QWMA 2YT2A 4HAUB 2H7EA 1UPQA 4P7IA 1WG7A 4YONA 4DIXA 4GN1A 4QXAB 3ZVRA 3HSAA 5LONB 4KVGB 4HAWB 3O96A 3ODOA 3MDBC 2JP2A 3PP2A 3KSYA 3M1IB 2ELBA 4QJ4B 1MK7B 2Y7BA 4Z2NA 4GYVA 1ZC4B 1Z87A 3A8QA 3P6AA 3BJIA 5D3YA 5J3QA 1XR0B 2LKOA 2CRFA 3ULBA 4D6WA 4F7GA 2D9WA 5J3YA 4B6HA 1XKEA 1K5DB 1V5MA 2CODA 2DHKA 3NWDA 4K2PA 2DA0A 2W2XC 2LYDA 5HE3A 2VKIA 1GG3A 1PFJA 2RVBB 3AJ4A 1UNRA 2NZ8B 4EMOA 1RJ2A 3SNHA 4OT1A 3TVVA 2R2YA 4K17A 3N7CA 2ZKMX 2Z0PA 1GC7A 1IRSA 2RRFA 4IFSA 1W1HA 3U8ZA 5JHHA 2DYQA 1RRPB 2DTCA 1NTVA 2DX1A 2FJLA 3TCAA 1P3RA 1U27A 3CXBB 1WJMA 2KGXB 3B77A 2MWNB 1EF1A 1X86A 1XD4A 1MPHA 5EFXA 2RNRB 5J3TA 2K49A 1U5FA 5D3VA 1H4RA 2R0DA 1T77A 2RLOA 5DIFB 2D9ZA 2OTXA 3SV1A 2COCA 3ODWA 2NMBA 4HDQA 4L6EA 2DHIA 3G9WA 4H8SA 4ZRJA 5FI0A 2Z4DA 4HB4B 4CSQA 1FHXA 2DKPA 2M14A 2GUMA 1ZSQA 4GPTB 2X18A 1FAOA 1ZYIA 2M38A 3KZ1A 1XX0A 4GNKB 4BBKA 3A58A 2ADZA 2K8EA 1NTYA 3ULCA 2YRYA 2K2UA 4GOUA 1U29A 3NWFA 3BINA 3DXEA 5JLJB 1X11A 1V89A 4TKNA 1TQZA 1F5XA 4KHBA 2D11A 2Z0QA 4HAYB 2LULA 3SUZA 3OANA 1DYNA 4HB3B 1U5EA 2P0DA 1U5DA 5C6RA 2EC1A 5CLLB 2QKLA 1I2HA 1DBHA 2J0JA 1PLSA 2LOXA 2Z14A 3AU4A 1WI1A 1Y5OA 1V61A 3U7DA 3TO1A 4GXBA 2KCJA 3PVWA 2Y8FA 1V5UA 1EGXA 3HIEA 2Z59A 5FI1A 1MKEA 5L81A 1EVHA 4MK0A 2RUKB 4HAZB 1E5WA 5I2MA 1PMSA 2DKQA 1X05A 2YT0A 3LJUX 1V5PA 1U2BA 4L1RA 1MI1A 1BWNA 2ROVA 2DLWA 2MKRA 3FSSA 4XWXA 2ROZB 3IVFA 1K5GB 4IAPA 2OQBA 1OY2A 2RGNB 2K2JA 4YL8A 2COFA 1XODA 1LW3A 2IYBA 2D2QA 4KAXB 2VSZA 4HB2B 1TJ6A 4ZRKA 3RCPA 2AL6A 4KHAA 2CY4A 5D3WA 4TYZA 5C5BA 4C0AA 2DFKA 4HAXB 1FGYA 1BTKA 2LG1A 1FHOA 4DX8A 1UNPA 2D9VA 2Q13A
chains in the Genus database with same CATH topology
2N23A 2K00A 1SGHA 2GS0A 2AEHA 4GZUA 4K81A 2H7DA 5JP4A 5DH9B 1FGZA 1U5GA 4ZRIA 3HQCA 1AWEA 2J59M 1MIZB 5D3XA 3KRXA 3KRWA 1DDMA 4EJNA 4KHBB 1M7EA 2RSGA 4PQ0A 4F7UP 4DXAB 2VRWB 1FB8A 3DXDA 1WGQA 4GMVA 4HB0B 5KQ4A 1P6SA 5HE1A 4A6FA 4MY6A 2GCLA 2MDXA 3ZDTA 4HATB 1FOEA 3T06A 1W1GA 5C79A 1N3HA 1J0WA 1WGUA 2YS1A 3D8EA 1X1GA 4DBBA 3HW2B 1QQGA 4IOYX 3WYFB 3QIJA 4WSFA 3PZDA 1LB1A 2EMTA 1TXDA 1H10A 3SYXA 2W2WA 2D10A 4F7HA 2V76A 3A8PA 1Y19B 2CAYA 3VIAA 1MIXA 2UVMA 3V5WA 2P0FA 4EKUA 3GF9A 2MFQA 3PEGA 3EO2A 2LOZA 4HDOA 5D27A 3SO6A 3UZTA 2KR9A 1J19A 3TFMA 4HHVA 2GJYA 2YT1A 1KZGA 4K2OA 4DX90 3ODXA 3X23A 5DHFB 1FHWA 2G35A 5DI9B 2ZPYA 3PSCA 3KY9A 5C5BB 2D9XA 2HTHB 1ZC3B 2CY5A 3TW1A 4GMXB 3NSUA 1KI1B 3GYOA 3ML4A 2BCJA 5GOWB 5CLQB 2P0HA 1EAZA 5C16A 3D8FA 2XQNM 3GYPA 1KZ7A 1ZM0A 3A98B 1UEFA 3FEHA 3JV3A 2I5FA 3PVUA 1DROA 3MPXA 2N0YA 2YF0A 1NI2A 2PZ1A 2HE7A 4NY0A 2KUPA 5KCVA 2IFSA 2ELAA 3QBVB 2DX5A 2UZSA 4Z2MB 1NU2A 3DXCA 1V88A 2DN6A 2W2XD 3FM8C 4NSWA 4A6KA 3AU5A 3D8DA 1DDVA 2EJ8A 1ISNA 2DHJA 1BY1A 4CHJA 3F5RA 3HK0A 2GCJA 4HAVB 1BTNA 1I7AA 2D9YA 5HE0A 4A6FB 5JHGA 1Q67A 2I1KA 1WVHA 1OQNA 4CHMA 4D0OA 2Y8GA 1XCGA 2I1JA 1W1DA 2P8VA 3PG7A 1M7RA 1AQCA 1OMWA 2COAA 1X1FA 1QC6A 2EMSA 2QKMA 3F0WA 4WVFB 5LOPB 1UNQA 2Z0OA 2J0MA 2YVCA 4PNKA 4CYEA 4KHOA 1MAIA 2E2XA 2J0KA 5DHAB 4WJ7A 1BAKA 1UPRA 1DDWA 4A5KA 5KQ1A 4D0NB 2YS3A 3VOQA 2UZRA 2L1CA 4A6HA 1MK9B 4Y94A 2DYNA 2I5CA 2R09A 1ZVRA 1P5TA 3WA0A 1WJ1A 1SHCA 2L2IA 3P7ZA 1GC6A 3PVLA 3CIKA 5HE2A 1B55A 4MT7A 2D4QA 2YSZA 2YS5A 3QWMA 4HAUB 2H7EA 1UPQA 4P7IA 1WG7A 4YONA 4GN1A 3ZVRA 5LONB 4KVGB 4HAWB 3O96A 3ODOA 3MDBC 2JP2A 3PP2A 3KSYA 3M1IB 2ELBA 1MK7B 2Y7BA 4Z2NA 4GYVA 1ZC4B 1Z87A 3A8QA 3P6AA 3BJIA 5D3YA 5J3QA 1XR0B 2LKOA 2CRFA 3ULBA 4F7GA 2D9WA 5J3YA 4B6HA 1XKEA 1K5DB 1V5MA 2CODA 2DHKA 4K2PA 2DA0A 2W2XC 2LYDA 5HE3A 2VKIA 1GG3A 1PFJA 2RVBB 3AJ4A 1UNRA 2NZ8B 4EMOA 1RJ2A 3SNHA 3TVVA 4K17A 3N7CA 2Z0PA 1GC7A 1IRSA 4IFSA 1W1HA 3U8ZA 5JHHA 2DYQA 1RRPB 2DTCA 1NTVA 2DX1A 2FJLA 3TCAA 1P3RA 1U27A 3CXBB 1WJMA 2KGXB 2MWNB 1EF1A 1X86A 1XD4A 1MPHA 5EFXA 2RNRB 5J3TA 1U5FA 5D3VA 1H4RA 2R0DA 2RLOA 5DIFB 2D9ZA 2OTXA 3SV1A 2COCA 3ODWA 2NMBA 4HDQA 4L6EA 2DHIA 3G9WA 4H8SA 4ZRJA 5FI0A 4HB4B 1FHXA 2DKPA 2M14A 1ZSQA 4GPTB 2X18A 1FAOA 2M38A 3KZ1A 1XX0A 4BBKA 2ADZA 1NTYA 3ULCA 2YRYA 2K2UA 4GOUA 1U29A 3BINA 3DXEA 5JLJB 1X11A 1V89A 4TKNA 1TQZA 1F5XA 2D11A 2Z0QA 4HAYB 2LULA 3SUZA 3OANA 1DYNA 4HB3B 1U5EA 2P0DA 1U5DA 5C6RA 2EC1A 5CLLB 2QKLA 1I2HA 1DBHA 2J0JA 1PLSA 2LOXA 3AU4A 1WI1A 1Y5OA 1V61A 3U7DA 3TO1A 4GXBA 2KCJA 3PVWA 2Y8FA 1V5UA 1EGXA 5FI1A 1MKEA 5L81A 1EVHA 4MK0A 2RUKB 4HAZB 1E5WA 1PMSA 2DKQA 1X05A 2YT0A 3LJUX 1V5PA 1U2BA 1BWNA 2ROVA 2DLWA 2MKRA 3FSSA 4XWXA 2ROZB 3IVFA 1K5GB 4IAPA 2OQBA 1OY2A 2RGNB 2K2JA 4YL8A 2COFA 1XODA 1LW3A 2IYBA 2D2QA 4KAXB 2VSZA 4HB2B 1TJ6A 4ZRKA 3RCPA 2AL6A 4KHAA 2CY4A 5D3WA 4TYZA 5C5BA 4C0AA 2DFKA 4HAXB 1FGYA 1BTKA 2LG1A 1FHOA 4DX8A 1UNPA 2D9VA 2Q13A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2N23 A;  2K00 A;  1SGH A;  2GS0 A;  2AEH A;  4GZU A;  4K81 A;  2H7D A;  5JP4 A;  5DH9 B;  1FGZ A;  1U5G A;  4ZRI A;  3HQC A;  1AWE A;  2J59 M;  1MIZ B;  5D3X A;  3KRX A;  3KRW A;  1DDM A;  4EJN A;  4KHB B;  1M7E A;  2RSG A;  4PQ0 A;  4F7U P;  4DXA B;  2VRW B;  1FB8 A;  3DXD A;  1WGQ A;  4GMV A;  4HB0 B;  5KQ4 A;  1P6S A;  5HE1 A;  4A6F A;  4MY6 A;  2GCL A;  2MDX A;  3ZDT A;  4HAT B;  1FOE A;  3T06 A;  1W1G A;  5C79 A;  1N3H A;  1J0W A;  1WGU A;  2YS1 A;  3D8E A;  1X1G A;  4DBB A;  3HW2 B;  1QQG A;  4IOY X;  3WYF B;  3QIJ A;  4WSF A;  3PZD A;  1LB1 A;  2EMT A;  1TXD A;  1H10 A;  3SYX A;  2W2W A;  2D10 A;  4F7H A;  2V76 A;  3A8P A;  1Y19 B;  2CAY A;  3VIA A;  1MIX A;  2UVM A;  3V5W A;  2P0F A;  4EKU A;  3GF9 A;  2MFQ A;  3PEG A;  3EO2 A;  2LOZ A;  4HDO A;  5D27 A;  3SO6 A;  3UZT A;  2KR9 A;  1J19 A;  3TFM A;  4HHV A;  2GJY A;  2YT1 A;  1KZG A;  4K2O A;  4DX9 0;  3ODX A;  3X23 A;  5DHF B;  1FHW A;  2G35 A;  5DI9 B;  2ZPY A;  3PSC A;  3KY9 A;  5C5B B;  2D9X A;  2HTH B;  1ZC3 B;  2CY5 A;  3TW1 A;  4GMX B;  3NSU A;  1KI1 B;  3GYO A;  3ML4 A;  2BCJ A;  5GOW B;  5CLQ B;  2P0H A;  1EAZ A;  5C16 A;  3D8F A;  2XQN M;  3GYP A;  1KZ7 A;  1ZM0 A;  3A98 B;  1UEF A;  3FEH A;  3JV3 A;  2I5F A;  3PVU A;  1DRO A;  3MPX A;  2N0Y A;  2YF0 A;  1NI2 A;  2PZ1 A;  2HE7 A;  4NY0 A;  2KUP A;  5KCV A;  2IFS A;  2ELA A;  3QBV B;  2DX5 A;  2UZS A;  4Z2M B;  1NU2 A;  3DXC A;  1V88 A;  2DN6 A;  2W2X D;  3FM8 C;  4NSW A;  4A6K A;  3AU5 A;  3D8D A;  1DDV A;  2EJ8 A;  1ISN A;  2DHJ A;  1BY1 A;  4CHJ A;  3F5R A;  3HK0 A;  2GCJ A;  4HAV B;  1BTN A;  1I7A A;  2D9Y A;  5HE0 A;  4A6F B;  5JHG A;  1Q67 A;  2I1K A;  1WVH A;  1OQN A;  4CHM A;  4D0O A;  2Y8G A;  1XCG A;  2I1J A;  1W1D A;  2P8V A;  3PG7 A;  1M7R A;  1AQC A;  1OMW A;  2COA A;  1X1F A;  1QC6 A;  2EMS A;  2QKM A;  3F0W A;  4WVF B;  5LOP B;  1UNQ A;  2Z0O A;  2J0M A;  2YVC A;  4PNK A;  4CYE A;  4KHO A;  1MAI A;  2E2X A;  2J0K A;  5DHA B;  4WJ7 A;  1BAK A;  1UPR A;  1DDW A;  4A5K A;  5KQ1 A;  4D0N B;  2YS3 A;  3VOQ A;  2UZR A;  2L1C A;  4A6H A;  1MK9 B;  4Y94 A;  2DYN A;  2I5C A;  2R09 A;  1ZVR A;  1P5T A;  3WA0 A;  1WJ1 A;  1SHC A;  2L2I A;  3P7Z A;  1GC6 A;  3PVL A;  3CIK A;  5HE2 A;  1B55 A;  4MT7 A;  2D4Q A;  2YSZ A;  2YS5 A;  3QWM A;  4HAU B;  2H7E A;  1UPQ A;  4P7I A;  1WG7 A;  4YON A;  4GN1 A;  3ZVR A;  5LON B;  4KVG B;  4HAW B;  3O96 A;  3ODO A;  3MDB C;  2JP2 A;  3PP2 A;  3KSY A;  3M1I B;  2ELB A;  1MK7 B;  2Y7B A;  4Z2N A;  4GYV A;  1ZC4 B;  1Z87 A;  3A8Q A;  3P6A A;  3BJI A;  5D3Y A;  5J3Q A;  1XR0 B;  2LKO A;  2CRF A;  3ULB A;  4F7G A;  2D9W A;  5J3Y A;  4B6H A;  1XKE A;  1K5D B;  1V5M A;  2COD A;  2DHK A;  4K2P A;  2DA0 A;  2W2X C;  2LYD A;  5HE3 A;  2VKI A;  1GG3 A;  1PFJ A;  2RVB B;  3AJ4 A;  1UNR A;  2NZ8 B;  4EMO A;  1RJ2 A;  3SNH A;  3TVV A;  4K17 A;  3N7C A;  2Z0P A;  1GC7 A;  1IRS A;  4IFS A;  1W1H A;  3U8Z A;  5JHH A;  2DYQ A;  1RRP B;  2DTC A;  1NTV A;  2DX1 A;  2FJL A;  3TCA A;  1P3R A;  1U27 A;  3CXB B;  1WJM A;  2KGX B;  2MWN B;  1EF1 A;  1X86 A;  1XD4 A;  1MPH A;  5EFX A;  2RNR B;  5J3T A;  1U5F A;  5D3V A;  1H4R A;  2R0D A;  2RLO A;  5DIF B;  2D9Z A;  2OTX A;  3SV1 A;  2COC A;  3ODW A;  2NMB A;  4HDQ A;  4L6E A;  2DHI A;  3G9W A;  4H8S A;  4ZRJ A;  5FI0 A;  4HB4 B;  1FHX A;  2DKP A;  2M14 A;  1ZSQ A;  4GPT B;  2X18 A;  1FAO A;  2M38 A;  3KZ1 A;  1XX0 A;  4BBK A;  2ADZ A;  1NTY A;  3ULC A;  2YRY A;  2K2U A;  4GOU A;  1U29 A;  3BIN A;  3DXE A;  5JLJ B;  1X11 A;  1V89 A;  4TKN A;  1TQZ A;  1F5X A;  2D11 A;  2Z0Q A;  4HAY B;  2LUL A;  3SUZ A;  3OAN A;  1DYN A;  4HB3 B;  1U5E A;  2P0D A;  1U5D A;  5C6R A;  2EC1 A;  5CLL B;  2QKL A;  1I2H A;  1DBH A;  2J0J A;  1PLS A;  2LOX A;  3AU4 A;  1WI1 A;  1Y5O A;  1V61 A;  3U7D A;  3TO1 A;  4GXB A;  2KCJ A;  3PVW A;  2Y8F A;  1V5U A;  1EGX A;  5FI1 A;  1MKE A;  5L81 A;  1EVH A;  4MK0 A;  2RUK B;  4HAZ B;  1E5W A;  1PMS A;  2DKQ A;  1X05 A;  2YT0 A;  3LJU X;  1V5P A;  1U2B A;  1BWN A;  2ROV A;  2DLW A;  2MKR A;  3FSS A;  4XWX A;  2ROZ B;  3IVF A;  1K5G B;  4IAP A;  2OQB A;  1OY2 A;  2RGN B;  2K2J A;  4YL8 A;  2COF A;  1XOD A;  1LW3 A;  2IYB A;  2D2Q A;  4KAX B;  2VSZ A;  4HB2 B;  1TJ6 A;  4ZRK A;  3RCP A;  2AL6 A;  4KHA A;  2CY4 A;  5D3W A;  4TYZ A;  5C5B A;  4C0A A;  2DFK A;  4HAX B;  1FGY A;  1BTK A;  2LG1 A;  1FHO A;  4DX8 A;  1UNP A;  2D9V A;  2Q13 A; 
#chains in the Genus database with same CATH topology
 2N23 A;  2K00 A;  1SGH A;  2GS0 A;  2AEH A;  4GZU A;  2KIG A;  4K81 A;  2H7D A;  2NBV A;  3FVC A;  5JP4 A;  5DH9 B;  1FGZ A;  1U5G A;  4ZRI A;  3HQC A;  4QJ5 B;  1AWE A;  2J59 M;  1MIZ B;  5D3X A;  3KRX A;  2KR0 A;  3KRW A;  1DDM A;  4EJN A;  2FJU B;  4KHB B;  1M7E A;  2RSG A;  4PQ0 A;  4F7U P;  4DXA B;  2VRW B;  1FB8 A;  3DXD A;  1WGQ A;  4GMV A;  4HB0 B;  5KQ4 A;  1P6S A;  5M4Y B;  5HE1 A;  4A6F A;  4MY6 A;  2GCL A;  2MDX A;  3ZDT A;  4HAT B;  1FOE A;  3T06 A;  1W1G A;  5C79 A;  1N3H A;  1J0W A;  1WGU A;  2YS1 A;  3D8E A;  1X1G A;  4DBB A;  3NWA A;  3HW2 B;  2KIE A;  1QQG A;  4IOY X;  3WYF B;  3QIJ A;  4WSF A;  3PZD A;  1LB1 A;  2EMT A;  1TXD A;  1H10 A;  3SYX A;  2W2W A;  2D10 A;  4F7H A;  2V76 A;  3A8P A;  1Y19 B;  2CAY A;  3VIA A;  1MIX A;  2UVM A;  3V5W A;  2P0F A;  4EKU A;  3GF9 A;  2MFQ A;  3PEG A;  3EO2 A;  2LOZ A;  4HDO A;  5D27 A;  3SO6 A;  3UZT A;  2KR9 A;  1J19 A;  3TFM A;  4HHV A;  2GJY A;  2YT1 A;  1KZG A;  4K2O A;  4DX9 0;  3ODX A;  3X23 A;  5DHF B;  1FHW A;  2G35 A;  5DI9 B;  2ZPY A;  3PSC A;  3KY9 A;  5IRS A;  5C5B B;  2D9X A;  2HTH B;  1ZC3 B;  2CY5 A;  3TW1 A;  4GMX B;  3NSU A;  1KI1 B;  3GYO A;  3ML4 A;  2BCJ A;  5GOW B;  5CLQ B;  2P0H A;  1EAZ A;  5C16 A;  3D8F A;  2XQN M;  3GYP A;  1KZ7 A;  1ZM0 A;  3A98 B;  5I2S A;  1UEF A;  3FEH A;  3JV3 A;  2I5F A;  3PVU A;  1DRO A;  3MPX A;  2N0Y A;  2YF0 A;  1NI2 A;  2PZ1 A;  2HE7 A;  4NY0 A;  2KUP A;  5KCV A;  2IFS A;  2ELA A;  3QBV B;  2DX5 A;  2UZS A;  4Z2M B;  1NU2 A;  3DXC A;  1V88 A;  2DN6 A;  2W2X D;  3FM8 C;  4NSW A;  4A6K A;  3AU5 A;  3D8D A;  1DDV A;  2EJ8 A;  1ISN A;  2DHJ A;  1BY1 A;  4CHJ A;  3F5R A;  3HK0 A;  2GCJ A;  4HAV B;  1BTN A;  1I7A A;  2D9Y A;  5HE0 A;  4A6F B;  5JHG A;  1Q67 A;  2I1K A;  3DCX A;  3OHM B;  4QJ3 B;  1WVH A;  1OQN A;  4CHM A;  4D0O A;  2Y8G A;  1XCG A;  2I1J A;  1W1D A;  2P8V A;  3PG7 A;  1M7R A;  1AQC A;  1OMW A;  2COA A;  1X1F A;  1QC6 A;  2EMS A;  2QKM A;  3F0W A;  4WVF B;  5LOP B;  1UNQ A;  2Z0O A;  2J0M A;  3U12 A;  2YVC A;  4PNK A;  4CYE A;  4KHO A;  1MAI A;  2E2X A;  2J0K A;  5DHA B;  4WJ7 A;  1BAK A;  2Z13 A;  1UPR A;  1DDW A;  4A5K A;  3NW8 A;  5KQ1 A;  4D0N B;  2YS3 A;  3VOQ A;  2UZR A;  4HSI A;  2L1C A;  4A6H A;  1MK9 B;  2KUQ A;  4Y94 A;  2DYN A;  2I5C A;  2R09 A;  1ZVR A;  1P5T A;  3WA0 A;  1WJ1 A;  1SHC A;  5LG4 B;  4OSN A;  2L2I A;  3P7Z A;  1GC6 A;  3PVL A;  3CIK A;  5HE2 A;  1B55 A;  4MT7 A;  2D4Q A;  2YSZ A;  2YS5 A;  3QWM A;  2YT2 A;  4HAU B;  2H7E A;  1UPQ A;  4P7I A;  1WG7 A;  4YON A;  4DIX A;  4GN1 A;  4QXA B;  3ZVR A;  3HSA A;  5LON B;  4KVG B;  4HAW B;  3O96 A;  3ODO A;  3MDB C;  2JP2 A;  3PP2 A;  3KSY A;  3M1I B;  2ELB A;  4QJ4 B;  1MK7 B;  2Y7B A;  4Z2N A;  4GYV A;  1ZC4 B;  1Z87 A;  3A8Q A;  3P6A A;  3BJI A;  5D3Y A;  5J3Q A;  1XR0 B;  2LKO A;  2CRF A;  3ULB A;  4D6W A;  4F7G A;  2D9W A;  5J3Y A;  4B6H A;  1XKE A;  1K5D B;  1V5M A;  2COD A;  2DHK A;  3NWD A;  4K2P A;  2DA0 A;  2W2X C;  2LYD A;  5HE3 A;  2VKI A;  1GG3 A;  1PFJ A;  2RVB B;  3AJ4 A;  1UNR A;  2NZ8 B;  4EMO A;  1RJ2 A;  3SNH A;  4OT1 A;  3TVV A;  2R2Y A;  4K17 A;  3N7C A;  2ZKM X;  2Z0P A;  1GC7 A;  1IRS A;  2RRF A;  4IFS A;  1W1H A;  3U8Z A;  5JHH A;  2DYQ A;  1RRP B;  2DTC A;  1NTV A;  2DX1 A;  2FJL A;  3TCA A;  1P3R A;  1U27 A;  3CXB B;  1WJM A;  2KGX B;  3B77 A;  2MWN B;  1EF1 A;  1X86 A;  1XD4 A;  1MPH A;  5EFX A;  2RNR B;  5J3T A;  2K49 A;  1U5F A;  5D3V A;  1H4R A;  2R0D A;  1T77 A;  2RLO A;  5DIF B;  2D9Z A;  2OTX A;  3SV1 A;  2COC A;  3ODW A;  2NMB A;  4HDQ A;  4L6E A;  2DHI A;  3G9W A;  4H8S A;  4ZRJ A;  5FI0 A;  2Z4D A;  4HB4 B;  4CSQ A;  1FHX A;  2DKP A;  2M14 A;  2GUM A;  1ZSQ A;  4GPT B;  2X18 A;  1FAO A;  1ZYI A;  2M38 A;  3KZ1 A;  1XX0 A;  4GNK B;  4BBK A;  3A58 A;  2ADZ A;  2K8E A;  1NTY A;  3ULC A;  2YRY A;  2K2U A;  4GOU A;  1U29 A;  3NWF A;  3BIN A;  3DXE A;  5JLJ B;  1X11 A;  1V89 A;  4TKN A;  1TQZ A;  1F5X A;  4KHB A;  2D11 A;  2Z0Q A;  4HAY B;  2LUL A;  3SUZ A;  3OAN A;  1DYN A;  4HB3 B;  1U5E A;  2P0D A;  1U5D A;  5C6R A;  2EC1 A;  5CLL B;  2QKL A;  1I2H A;  1DBH A;  2J0J A;  1PLS A;  2LOX A;  2Z14 A;  3AU4 A;  1WI1 A;  1Y5O A;  1V61 A;  3U7D A;  3TO1 A;  4GXB A;  2KCJ A;  3PVW A;  2Y8F A;  1V5U A;  1EGX A;  3HIE A;  2Z59 A;  5FI1 A;  1MKE A;  5L81 A;  1EVH A;  4MK0 A;  2RUK B;  4HAZ B;  1E5W A;  5I2M A;  1PMS A;  2DKQ A;  1X05 A;  2YT0 A;  3LJU X;  1V5P A;  1U2B A;  4L1R A;  1MI1 A;  1BWN A;  2ROV A;  2DLW A;  2MKR A;  3FSS A;  4XWX A;  2ROZ B;  3IVF A;  1K5G B;  4IAP A;  2OQB A;  1OY2 A;  2RGN B;  2K2J A;  4YL8 A;  2COF A;  1XOD A;  1LW3 A;  2IYB A;  2D2Q A;  4KAX B;  2VSZ A;  4HB2 B;  1TJ6 A;  4ZRK A;  3RCP A;  2AL6 A;  4KHA A;  2CY4 A;  5D3W A;  4TYZ A;  5C5B A;  4C0A A;  2DFK A;  4HAX B;  1FGY A;  1BTK A;  2LG1 A;  1FHO A;  4DX8 A;  1UNP A;  2D9V A;  2Q13 A; 
#chains in the Genus database with same CATH homology
 2N23 A;  2K00 A;  1SGH A;  2GS0 A;  2AEH A;  4GZU A;  4K81 A;  2H7D A;  5JP4 A;  5DH9 B;  1FGZ A;  1U5G A;  4ZRI A;  3HQC A;  1AWE A;  2J59 M;  1MIZ B;  5D3X A;  3KRX A;  3KRW A;  1DDM A;  4EJN A;  4KHB B;  1M7E A;  2RSG A;  4PQ0 A;  4F7U P;  4DXA B;  2VRW B;  1FB8 A;  3DXD A;  1WGQ A;  4GMV A;  4HB0 B;  5KQ4 A;  1P6S A;  5HE1 A;  4A6F A;  4MY6 A;  2GCL A;  2MDX A;  3ZDT A;  4HAT B;  1FOE A;  3T06 A;  1W1G A;  5C79 A;  1N3H A;  1J0W A;  1WGU A;  2YS1 A;  3D8E A;  1X1G A;  4DBB A;  3HW2 B;  1QQG A;  4IOY X;  3WYF B;  3QIJ A;  4WSF A;  3PZD A;  1LB1 A;  2EMT A;  1TXD A;  1H10 A;  3SYX A;  2W2W A;  2D10 A;  4F7H A;  2V76 A;  3A8P A;  1Y19 B;  2CAY A;  3VIA A;  1MIX A;  2UVM A;  3V5W A;  2P0F A;  4EKU A;  3GF9 A;  2MFQ A;  3PEG A;  3EO2 A;  2LOZ A;  4HDO A;  5D27 A;  3SO6 A;  3UZT A;  2KR9 A;  1J19 A;  3TFM A;  4HHV A;  2GJY A;  2YT1 A;  1KZG A;  4K2O A;  4DX9 0;  3ODX A;  3X23 A;  5DHF B;  1FHW A;  2G35 A;  5DI9 B;  2ZPY A;  3PSC A;  3KY9 A;  5C5B B;  2D9X A;  2HTH B;  1ZC3 B;  2CY5 A;  3TW1 A;  4GMX B;  3NSU A;  1KI1 B;  3GYO A;  3ML4 A;  2BCJ A;  5GOW B;  5CLQ B;  2P0H A;  1EAZ A;  5C16 A;  3D8F A;  2XQN M;  3GYP A;  1KZ7 A;  1ZM0 A;  3A98 B;  1UEF A;  3FEH A;  3JV3 A;  2I5F A;  3PVU A;  1DRO A;  3MPX A;  2N0Y A;  2YF0 A;  1NI2 A;  2PZ1 A;  2HE7 A;  4NY0 A;  2KUP A;  5KCV A;  2IFS A;  2ELA A;  3QBV B;  2DX5 A;  2UZS A;  4Z2M B;  1NU2 A;  3DXC A;  1V88 A;  2DN6 A;  2W2X D;  3FM8 C;  4NSW A;  4A6K A;  3AU5 A;  3D8D A;  1DDV A;  2EJ8 A;  1ISN A;  2DHJ A;  1BY1 A;  4CHJ A;  3F5R A;  3HK0 A;  2GCJ A;  4HAV B;  1BTN A;  1I7A A;  2D9Y A;  5HE0 A;  4A6F B;  5JHG A;  1Q67 A;  2I1K A;  1WVH A;  1OQN A;  4CHM A;  4D0O A;  2Y8G A;  1XCG A;  2I1J A;  1W1D A;  2P8V A;  3PG7 A;  1M7R A;  1AQC A;  1OMW A;  2COA A;  1X1F A;  1QC6 A;  2EMS A;  2QKM A;  3F0W A;  4WVF B;  5LOP B;  1UNQ A;  2Z0O A;  2J0M A;  2YVC A;  4PNK A;  4CYE A;  4KHO A;  1MAI A;  2E2X A;  2J0K A;  5DHA B;  4WJ7 A;  1BAK A;  1UPR A;  1DDW A;  4A5K A;  5KQ1 A;  4D0N B;  2YS3 A;  3VOQ A;  2UZR A;  2L1C A;  4A6H A;  1MK9 B;  4Y94 A;  2DYN A;  2I5C A;  2R09 A;  1ZVR A;  1P5T A;  3WA0 A;  1WJ1 A;  1SHC A;  2L2I A;  3P7Z A;  1GC6 A;  3PVL A;  3CIK A;  5HE2 A;  1B55 A;  4MT7 A;  2D4Q A;  2YSZ A;  2YS5 A;  3QWM A;  4HAU B;  2H7E A;  1UPQ A;  4P7I A;  1WG7 A;  4YON A;  4GN1 A;  3ZVR A;  5LON B;  4KVG B;  4HAW B;  3O96 A;  3ODO A;  3MDB C;  2JP2 A;  3PP2 A;  3KSY A;  3M1I B;  2ELB A;  1MK7 B;  2Y7B A;  4Z2N A;  4GYV A;  1ZC4 B;  1Z87 A;  3A8Q A;  3P6A A;  3BJI A;  5D3Y A;  5J3Q A;  1XR0 B;  2LKO A;  2CRF A;  3ULB A;  4F7G A;  2D9W A;  5J3Y A;  4B6H A;  1XKE A;  1K5D B;  1V5M A;  2COD A;  2DHK A;  4K2P A;  2DA0 A;  2W2X C;  2LYD A;  5HE3 A;  2VKI A;  1GG3 A;  1PFJ A;  2RVB B;  3AJ4 A;  1UNR A;  2NZ8 B;  4EMO A;  1RJ2 A;  3SNH A;  3TVV A;  4K17 A;  3N7C A;  2Z0P A;  1GC7 A;  1IRS A;  4IFS A;  1W1H A;  3U8Z A;  5JHH A;  2DYQ A;  1RRP B;  2DTC A;  1NTV A;  2DX1 A;  2FJL A;  3TCA A;  1P3R A;  1U27 A;  3CXB B;  1WJM A;  2KGX B;  2MWN B;  1EF1 A;  1X86 A;  1XD4 A;  1MPH A;  5EFX A;  2RNR B;  5J3T A;  1U5F A;  5D3V A;  1H4R A;  2R0D A;  2RLO A;  5DIF B;  2D9Z A;  2OTX A;  3SV1 A;  2COC A;  3ODW A;  2NMB A;  4HDQ A;  4L6E A;  2DHI A;  3G9W A;  4H8S A;  4ZRJ A;  5FI0 A;  4HB4 B;  1FHX A;  2DKP A;  2M14 A;  1ZSQ A;  4GPT B;  2X18 A;  1FAO A;  2M38 A;  3KZ1 A;  1XX0 A;  4BBK A;  2ADZ A;  1NTY A;  3ULC A;  2YRY A;  2K2U A;  4GOU A;  1U29 A;  3BIN A;  3DXE A;  5JLJ B;  1X11 A;  1V89 A;  4TKN A;  1TQZ A;  1F5X A;  2D11 A;  2Z0Q A;  4HAY B;  2LUL A;  3SUZ A;  3OAN A;  1DYN A;  4HB3 B;  1U5E A;  2P0D A;  1U5D A;  5C6R A;  2EC1 A;  5CLL B;  2QKL A;  1I2H A;  1DBH A;  2J0J A;  1PLS A;  2LOX A;  3AU4 A;  1WI1 A;  1Y5O A;  1V61 A;  3U7D A;  3TO1 A;  4GXB A;  2KCJ A;  3PVW A;  2Y8F A;  1V5U A;  1EGX A;  5FI1 A;  1MKE A;  5L81 A;  1EVH A;  4MK0 A;  2RUK B;  4HAZ B;  1E5W A;  1PMS A;  2DKQ A;  1X05 A;  2YT0 A;  3LJU X;  1V5P A;  1U2B A;  1BWN A;  2ROV A;  2DLW A;  2MKR A;  3FSS A;  4XWX A;  2ROZ B;  3IVF A;  1K5G B;  4IAP A;  2OQB A;  1OY2 A;  2RGN B;  2K2J A;  4YL8 A;  2COF A;  1XOD A;  1LW3 A;  2IYB A;  2D2Q A;  4KAX B;  2VSZ A;  4HB2 B;  1TJ6 A;  4ZRK A;  3RCP A;  2AL6 A;  4KHA A;  2CY4 A;  5D3W A;  4TYZ A;  5C5B A;  4C0A A;  2DFK A;  4HAX B;  1FGY A;  1BTK A;  2LG1 A;  1FHO A;  4DX8 A;  1UNP A;  2D9V A;  2Q13 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...