2NZ8B

N-terminal dhph cassette of trio in complex with nucleotide-free rac1
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
305
structure length
279
Chain Sequence
ARRKEFIMAELIQTEKAYVRDLRECMDTYLWEMTSGVEEIPPGIVNKELIIFGNMQEIYEFHNNIFLKELEKYEQLPEDVGHCFVTWADKFQMYVTYCKNKPDSTQLILEHAGSYFDEIQQRHGLANSISSYLIKPVQRITKYQLLLKELLTCCEEGKGEIKDGLEVMLSVPKRANDAMHLSMLEGFSQGELILQESFQHLFLFEMSLVFSKEVKDSSGRSKYLYKSKLFTSELGVTEHVEGDPCKFATSDNKIVLKASSIENKQDWIKHIREVIQERT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords ras-related C3 botulinum toxin substrate 1 isoform Rac1
publication title The DH and PH Domains of Trio Coordinately Engage Rho GTPases for their Efficient Activation
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein,cell cycle
total genus 91
structure length 279
sequence length 305
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2006-11-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00169 PH PH domain
B PF00621 RhoGEF RhoGEF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.900.10 Mainly Alpha Up-down Bundle Dbl Homology Domain; Chain A Dbl homology (DH) domain 2nz8B01
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2nz8B02
3M1IB 3O96A 5JHHA 1WVHA 3F0WA 2NZ8B 4HAXB 3DXEA 4HB4B 1RRPB 1BAKA 3PP2A 3PEGA 1X86A 1OY2A 2RNRB 5JLJB 4HB2B 3GYPA 4K2PA 1SHCA 2W2WA 4D0OA 1V5PA 1ZC4B 1AWEA 4Y94A 1XCGA 2EC1A 4A6FB 2YT0A 3SNHA 1M7EA 2X18A 1V89A 4GPTB 1W1HA 2GS0A 3HK0A 4A6KA 5EFXA 1DROA 3SV1A 4HAYB 2DHIA 2R0DA 4KHAA 1V88A 2RGNB 5D3YA 5DIFB 2ZPYA 3TFMA 5HE3A 3F5RA 1XR0B 2D9VA 1WJ1A 1BTKA 1KI1B 1OMWA 2COAA 1I2HA 2AL6A 1XODA 1QC6A 1UPQA 1P3RA 4KAXB 4DXAB 2V76A 5KQ4A 3DXDA 1U29A 3CIKA 1LW3A 4H8SA 1IRSA 2KGXB 1NTVA 2UVMA 2XQNM 1ZM0A 1Y19B 1WGUA 1U5FA 2OQBA 2H7DA 2E2XA 3ODWA 3FM8C 2DKQA 2Y8FA 1X05A 4GMVA 5C5BB 1J0WA 4K81A 4A5KA 5JHGA 1MPHA 5DI9B 1MK9B 1NU2A 1NI2A 2LG1A 5J3TA 3PSCA 4F7UP 2CODA 2D4QA 2ADZA 5C79A 4D0NB 1TQZA 4HAUB 2AEHA 3WA0A 1EGXA 2YVCA 1FB8A 1FGZA 2OTXA 3GF9A 2H7EA 2RVBB 2DFKA 1N3HA 2LULA 2RLOA 3BJIA 4KVGB 3TO1A 3P7ZA 2GCLA 2D9XA 1V61A 1XKEA 2Z0PA 2RSGA 3GYOA 2M38A 2EMSA 2J0JA 2KCJA 1DBHA 3MDBC 3UZTA 4DBBA 1DYNA 2UZRA 1FHWA 2I5CA 3D8EA 3ML4A 4KHBB 4YL8A 1SGHA 2YF0A 4WSFA 2K2UA 2L1CA 3PVWA 1UNPA 1GC6A 3JV3A 4CHMA 1FHXA 5CLQB 4HATB 1W1DA 1P6SA 1MAIA 3V5WA 3ODOA 1H10A 2L2IA 1UEFA 2I1KA 2YT1A 1V5MA 1EVHA 2DKPA 4PQ0A 1UNQA 1AQCA 1WGQA 2D11A 1BY1A 2DN6A 2JP2A 4GYVA 3PVLA 1DDMA 2FJLA 2D2QA 4EKUA 5KCVA 1WI1A 3QWMA 2QKMA 3IVFA 3RCPA 3A8QA 3AU4A 4XWXA 2W2XC 5HE2A 2I5FA 1E5WA 1H4RA 2MWNB 2Y7BA 4GOUA 2CY4A 3D8DA 2IFSA 1RJ2A 1Y5OA 2LOXA 1FAOA 1FHOA 4A6FA 2COCA 2Z0OA 1U2BA 1UPRA 3G9WA 2CRFA 2YRYA 5D3WA 1DDVA 3VOQA 3AJ4A 3KRWA 4DX90 2YS1A 1EAZA 2ELAA 4ZRIA 2J0KA 1XX0A 3ZDTA 4YONA 5FI1A 4MY6A 1UNRA 5DH9B 4GZUA 4HDQA 2N23A 1MKEA 3TW1A 5KQ1A 1Z87A 3PG7A 1GC7A 5C6RA 4TKNA 2D9WA 4WJ7A 3QBVB 2D9ZA 1TJ6A 2COFA 2I1JA 4F7GA 2MDXA 2ROZB 2CY5A 2LOZA 1EF1A 2DTCA 3KSYA 5L81A 2MKRA 2NMBA 2QKLA 2K00A 3QIJA 3ODXA 1BTNA 2G35A 1WJMA 5C5BA 2ELBA 2RUKB 2DX5A 1W1GA 2D10A 3HW2B 4B6HA 2HTHB 4NY0A 1MK7B 4Z2NA 2VSZA 3ZVRA 3OANA 5FI0A 2CAYA 1MIXA 1K5GB 3LJUX 1TXDA 3CXBB 1ZVRA 1I7AA 5D3VA 5J3QA 2J59M 3PVUA 1B55A 1U5DA 4ZRKA 4P7IA 2Z0QA 2LKOA 2VKIA 4Z2MB 2P0FA 2YS5A 1M7RA 2YSZA 4IOYX 3MPXA 3A8PA 3ULCA 2M14A 5J3YA 3PZDA 3U7DA 1ISNA 2KUPA 4L6EA 3P6AA 4HAZB 1PMSA 3SO6A 4GN1A 5D3XA 1J19A 4BBKA 3DXCA 4MK0A 3T06A 1DDWA 3BINA 3D8FA 1BWNA 1KZ7A 1X1GA 3SUZA 2DHJA 3ULBA 2GJYA 4TYZA 4DX8A 4ZRJA 1NTYA 1XD4A 5CLLB 3HQCA 2KR9A 3SYXA 3KRXA 1MIZB 4HDOA 5DHAB 4HB3B 4F7HA 5C16A 3U8ZA 3FSSA 4HAWB 1K5DB 1PFJA 3NSUA 2P0DA 2BCJA 2Q13A 2DYQA 4EMOA 1U27A 4HB0B 2D9YA 1U5GA 1F5XA 1X1FA 2LYDA 4EJNA 1X11A 4GXBA 4K2OA 4WVFB 3A98B 5HE0A 2IYBA 4KHOA 4A6HA 1PLSA 1GG3A 2EJ8A 1U5EA 4CYEA 5JP4A 1V5UA 2N0YA 2W2XD 2ROVA 1QQGA 1Q67A 2VRWB 1ZSQA 2J0MA 5LOPB 4GMXB 3VIAA 2DX1A 2UZSA 5DHFB 3FEHA 4IAPA 2DLWA 2HE7A 2DA0A 2EMTA 2MFQA 1OQNA 3KY9A 4HHVA 3WYFB 4K17A 2YS3A 3EO2A 5D27A 5LONB 2DYNA 4IFSA 1P5TA 2P0HA 4PNKA 1ZC3B 5GOWB 4MT7A 3TVVA 3X23A 3AU5A 5HE1A 1LB1A 2PZ1A 2P8VA 2GCJA 2DHKA 3N7CA 1WG7A 3TCAA 2K2JA 1KZGA 4HAVB 3KZ1A 4C0AA 4CHJA 2R09A 1FGYA 4NSWA 2Y8GA 1FOEA
chains in the Genus database with same CATH superfamily
3M1IB 3O96A 5JHHA 2K8EA 1WVHA 3F0WA 2NZ8B 4HAXB 3DXEA 3NW8A 4HB4B 1RRPB 1BAKA 3PP2A 3PEGA 1X86A 1OY2A 3NWFA 2RNRB 5JLJB 4HB2B 3GYPA 4K2PA 1SHCA 5I2MA 2W2WA 4D0OA 1V5PA 1ZC4B 1AWEA 4Y94A 1XCGA 2EC1A 4A6FB 2YT0A 4OT1A 3SNHA 1M7EA 2X18A 1V89A 4GPTB 1W1HA 2GS0A 3HK0A 4A6KA 5EFXA 1DROA 3SV1A 4HAYB 2DHIA 2R0DA 4KHAA 1V88A 2RGNB 5D3YA 5DIFB 2ZPYA 3TFMA 5HE3A 3F5RA 1XR0B 2D9VA 1WJ1A 1BTKA 1KI1B 1OMWA 2COAA 2K49A 1I2HA 2AL6A 1XODA 1QC6A 1UPQA 1P3RA 4KAXB 2Z59A 4DXAB 2V76A 5KQ4A 3DXDA 1U29A 3CIKA 4L1RA 1LW3A 4H8SA 1IRSA 2KGXB 1NTVA 2UVMA 2XQNM 1ZM0A 1Y19B 1WGUA 1U5FA 2OQBA 2H7DA 2E2XA 3ODWA 3FM8C 2DKQA 2Y8FA 1X05A 4GMVA 5C5BB 1J0WA 5IRSA 4K81A 4A5KA 5JHGA 1MPHA 5DI9B 1MK9B 1NU2A 1NI2A 2LG1A 5J3TA 3PSCA 4F7UP 2CODA 2D4QA 2ADZA 5C79A 4D0NB 1TQZA 4HAUB 2AEHA 3WA0A 1EGXA 2YVCA 1FB8A 1FGZA 2OTXA 4QJ4B 3GF9A 2H7EA 2RVBB 2DFKA 1N3HA 2LULA 2RLOA 3BJIA 4KVGB 3TO1A 3P7ZA 2GCLA 2D9XA 1V61A 1XKEA 2Z0PA 2RSGA 3GYOA 4CSQA 2M38A 2EMSA 2J0JA 2KCJA 1DBHA 3MDBC 3UZTA 4DBBA 1DYNA 2UZRA 1FHWA 2I5CA 3D8EA 3ML4A 4KHBB 4YL8A 1SGHA 2YF0A 4GNKB 4WSFA 2K2UA 2L1CA 3PVWA 1UNPA 1GC6A 3JV3A 4CHMA 1FHXA 5CLQB 4HATB 1W1DA 1P6SA 3NWAA 1MAIA 3V5WA 3ODOA 1H10A 2L2IA 1UEFA 2I1KA 2YT1A 1V5MA 1EVHA 2DKPA 4PQ0A 1UNQA 1AQCA 1WGQA 2D11A 1BY1A 2DN6A 2JP2A 4GYVA 3PVLA 1DDMA 2FJLA 2D2QA 4EKUA 5KCVA 1WI1A 4DIXA 3QWMA 2QKMA 3IVFA 3RCPA 3A8QA 3AU4A 4XWXA 2W2XC 5HE2A 2I5FA 1E5WA 1H4RA 2MWNB 1ZYIA 2Y7BA 4GOUA 2CY4A 3D8DA 2IFSA 1RJ2A 1Y5OA 2LOXA 1FAOA 1FHOA 4A6FA 2COCA 2Z0OA 1U2BA 1UPRA 3G9WA 2CRFA 2KIEA 2YRYA 5D3WA 1DDVA 3VOQA 3AJ4A 3KRWA 4DX90 2YS1A 1EAZA 2ELAA 4ZRIA 2J0KA 3NWDA 1MI1A 2KIGA 3B77A 1XX0A 3ZDTA 4YONA 5FI1A 4MY6A 1UNRA 5DH9B 4GZUA 4HDQA 2Z13A 2N23A 1MKEA 3TW1A 5KQ1A 2YT2A 1Z87A 3PG7A 1GC7A 5C6RA 4TKNA 2D9WA 5M4YB 4WJ7A 3QBVB 2D9ZA 1TJ6A 2COFA 2I1JA 4F7GA 2MDXA 2ROZB 2CY5A 2LOZA 1EF1A 2DTCA 3KSYA 5L81A 2MKRA 2NMBA 2QKLA 2K00A 3QIJA 3ODXA 1BTNA 2G35A 1WJMA 5C5BA 4QJ5B 2ELBA 2RUKB 2DX5A 1W1GA 2D10A 3HW2B 4B6HA 2HTHB 4NY0A 1MK7B 4Z2NA 2VSZA 3ZVRA 3OANA 5FI0A 2CAYA 1MIXA 1K5GB 3LJUX 1TXDA 3CXBB 1ZVRA 5I2SA 1I7AA 5D3VA 5J3QA 2J59M 3PVUA 1B55A 1U5DA 4ZRKA 4P7IA 2Z0QA 2LKOA 3HSAA 2VKIA 4Z2MB 2P0FA 2YS5A 3FVCA 1M7RA 2ZKMX 2YSZA 4IOYX 3MPXA 3A8PA 1T77A 3ULCA 2M14A 5J3YA 3PZDA 2RRFA 3U7DA 1ISNA 2KUPA 4L6EA 3P6AA 4HAZB 2FJUB 1PMSA 3SO6A 4GN1A 5D3XA 1J19A 4KHBA 4BBKA 3DXCA 3OHMB 4MK0A 3T06A 1DDWA 3BINA 3D8FA 3U12A 1BWNA 1KZ7A 1X1GA 3SUZA 2DHJA 3ULBA 2GJYA 4TYZA 4DX8A 4ZRJA 1NTYA 1XD4A 5CLLB 3HQCA 2KR9A 3SYXA 3KRXA 1MIZB 2KR0A 4HDOA 5DHAB 4HB3B 4F7HA 5C16A 3U8ZA 3FSSA 4HAWB 1K5DB 1PFJA 3A58A 3NSUA 2P0DA 2BCJA 2Q13A 2DYQA 4EMOA 1U27A 4HB0B 2D9YA 1U5GA 1F5XA 1X1FA 4HSIA 2LYDA 4EJNA 1X11A 2Z14A 4GXBA 4K2OA 4WVFB 3A98B 5HE0A 2IYBA 4QJ3B 4KHOA 4A6HA 1PLSA 1GG3A 2GUMA 2EJ8A 1U5EA 4CYEA 5JP4A 4QXAB 1V5UA 2N0YA 2W2XD 2ROVA 1QQGA 1Q67A 2VRWB 1ZSQA 2J0MA 5LOPB 4GMXB 3VIAA 2DX1A 2UZSA 2NBVA 5DHFB 3FEHA 3DCXA 4IAPA 2DLWA 2HE7A 2R2YA 2DA0A 2EMTA 2MFQA 1OQNA 3KY9A 4HHVA 3WYFB 4K17A 2KUQA 2YS3A 3EO2A 5D27A 5LONB 2DYNA 2Z4DA 1P5TA 2P0HA 4IFSA 1ZC3B 5GOWB 4PNKA 4MT7A 3TVVA 3X23A 3AU5A 5HE1A 4OSNA 5LG4B 1LB1A 2PZ1A 2P8VA 2GCJA 2DHKA 3N7CA 1WG7A 3TCAA 2K2JA 1KZGA 4D6WA 4HAVB 3KZ1A 4C0AA 3HIEA 4CHJA 2R09A 1FGYA 4NSWA 2Y8GA 1FOEA
chains in the Genus database with same CATH topology
3M1IB 3O96A 5JHHA 1WVHA 3F0WA 2NZ8B 4HAXB 3DXEA 4HB4B 1RRPB 1BAKA 3PP2A 3PEGA 1X86A 1OY2A 2RNRB 5JLJB 4HB2B 3GYPA 4K2PA 1SHCA 2W2WA 4D0OA 1V5PA 1ZC4B 1AWEA 4Y94A 1XCGA 2EC1A 4A6FB 2YT0A 3SNHA 1M7EA 2X18A 1V89A 4GPTB 1W1HA 2GS0A 3HK0A 4A6KA 5EFXA 1DROA 3SV1A 4HAYB 2DHIA 2R0DA 4KHAA 1V88A 2RGNB 5D3YA 5DIFB 2ZPYA 3TFMA 5HE3A 3F5RA 1XR0B 2D9VA 1WJ1A 1BTKA 1KI1B 1OMWA 2COAA 1I2HA 2AL6A 1XODA 1QC6A 1UPQA 1P3RA 4KAXB 4DXAB 2V76A 5KQ4A 3DXDA 1U29A 3CIKA 1LW3A 4H8SA 1IRSA 2KGXB 1NTVA 2UVMA 2XQNM 1ZM0A 1Y19B 1WGUA 1U5FA 2OQBA 2H7DA 2E2XA 3ODWA 3FM8C 2DKQA 2Y8FA 1X05A 4GMVA 5C5BB 1J0WA 4K81A 4A5KA 5JHGA 1MPHA 5DI9B 1MK9B 1NU2A 1NI2A 2LG1A 5J3TA 3PSCA 4F7UP 2CODA 2D4QA 2ADZA 5C79A 4D0NB 1TQZA 4HAUB 2AEHA 3WA0A 1EGXA 2YVCA 1FB8A 1FGZA 2OTXA 3GF9A 2H7EA 2RVBB 2DFKA 1N3HA 2LULA 2RLOA 3BJIA 4KVGB 3TO1A 3P7ZA 2GCLA 2D9XA 1V61A 1XKEA 2Z0PA 2RSGA 3GYOA 2M38A 2EMSA 2J0JA 2KCJA 1DBHA 3MDBC 3UZTA 4DBBA 1DYNA 2UZRA 1FHWA 2I5CA 3D8EA 3ML4A 4KHBB 4YL8A 1SGHA 2YF0A 4WSFA 2K2UA 2L1CA 3PVWA 1UNPA 1GC6A 3JV3A 4CHMA 1FHXA 5CLQB 4HATB 1W1DA 1P6SA 1MAIA 3V5WA 3ODOA 1H10A 2L2IA 1UEFA 2I1KA 2YT1A 1V5MA 1EVHA 2DKPA 4PQ0A 1UNQA 1AQCA 1WGQA 2D11A 1BY1A 2DN6A 2JP2A 4GYVA 3PVLA 1DDMA 2FJLA 2D2QA 4EKUA 5KCVA 1WI1A 3QWMA 2QKMA 3IVFA 3RCPA 3A8QA 3AU4A 4XWXA 2W2XC 5HE2A 2I5FA 1E5WA 1H4RA 2MWNB 2Y7BA 4GOUA 2CY4A 3D8DA 2IFSA 1RJ2A 1Y5OA 2LOXA 1FAOA 1FHOA 4A6FA 2COCA 2Z0OA 1U2BA 1UPRA 3G9WA 2CRFA 2YRYA 5D3WA 1DDVA 3VOQA 3AJ4A 3KRWA 4DX90 2YS1A 1EAZA 2ELAA 4ZRIA 2J0KA 1XX0A 3ZDTA 4YONA 5FI1A 4MY6A 1UNRA 5DH9B 4GZUA 4HDQA 2N23A 1MKEA 3TW1A 5KQ1A 1Z87A 3PG7A 1GC7A 5C6RA 4TKNA 2D9WA 4WJ7A 3QBVB 2D9ZA 1TJ6A 2COFA 2I1JA 4F7GA 2MDXA 2ROZB 2CY5A 2LOZA 1EF1A 2DTCA 3KSYA 5L81A 2MKRA 2NMBA 2QKLA 2K00A 3QIJA 3ODXA 1BTNA 2G35A 1WJMA 5C5BA 2ELBA 2RUKB 2DX5A 1W1GA 2D10A 3HW2B 4B6HA 2HTHB 4NY0A 1MK7B 4Z2NA 2VSZA 3ZVRA 3OANA 5FI0A 2CAYA 1MIXA 1K5GB 3LJUX 1TXDA 3CXBB 1ZVRA 1I7AA 5D3VA 5J3QA 2J59M 3PVUA 1B55A 1U5DA 4ZRKA 4P7IA 2Z0QA 2LKOA 2VKIA 4Z2MB 2P0FA 2YS5A 1M7RA 2YSZA 4IOYX 3MPXA 3A8PA 3ULCA 2M14A 5J3YA 3PZDA 3U7DA 1ISNA 2KUPA 4L6EA 3P6AA 4HAZB 1PMSA 3SO6A 4GN1A 5D3XA 1J19A 4BBKA 3DXCA 4MK0A 3T06A 1DDWA 3BINA 3D8FA 1BWNA 1KZ7A 1X1GA 3SUZA 2DHJA 3ULBA 2GJYA 4TYZA 4DX8A 4ZRJA 1NTYA 1XD4A 5CLLB 3HQCA 2KR9A 3SYXA 3KRXA 1MIZB 4HDOA 5DHAB 4HB3B 4F7HA 5C16A 3U8ZA 3FSSA 4HAWB 1K5DB 1PFJA 3NSUA 2P0DA 2BCJA 2Q13A 2DYQA 4EMOA 1U27A 4HB0B 2D9YA 1U5GA 1F5XA 1X1FA 2LYDA 4EJNA 1X11A 4GXBA 4K2OA 4WVFB 3A98B 5HE0A 2IYBA 4KHOA 4A6HA 1PLSA 1GG3A 2EJ8A 1U5EA 4CYEA 5JP4A 1V5UA 2N0YA 2W2XD 2ROVA 1QQGA 1Q67A 2VRWB 1ZSQA 2J0MA 5LOPB 4GMXB 3VIAA 2DX1A 2UZSA 5DHFB 3FEHA 4IAPA 2DLWA 2HE7A 2DA0A 2EMTA 2MFQA 1OQNA 3KY9A 4HHVA 3WYFB 4K17A 2YS3A 3EO2A 5D27A 5LONB 2DYNA 4IFSA 1P5TA 2P0HA 4PNKA 1ZC3B 5GOWB 4MT7A 3TVVA 3X23A 3AU5A 5HE1A 1LB1A 2PZ1A 2P8VA 2GCJA 2DHKA 3N7CA 1WG7A 3TCAA 2K2JA 1KZGA 4HAVB 3KZ1A 4C0AA 4CHJA 2R09A 1FGYA 4NSWA 2Y8GA 1FOEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3M1I B;  3O96 A;  5JHH A;  1WVH A;  3F0W A;  2NZ8 B;  4HAX B;  3DXE A;  4HB4 B;  1RRP B;  1BAK A;  3PP2 A;  3PEG A;  1X86 A;  1OY2 A;  2RNR B;  5JLJ B;  4HB2 B;  3GYP A;  4K2P A;  1SHC A;  2W2W A;  4D0O A;  1V5P A;  1ZC4 B;  1AWE A;  4Y94 A;  1XCG A;  2EC1 A;  4A6F B;  2YT0 A;  3SNH A;  1M7E A;  2X18 A;  1V89 A;  4GPT B;  1W1H A;  2GS0 A;  3HK0 A;  4A6K A;  5EFX A;  1DRO A;  3SV1 A;  4HAY B;  2DHI A;  2R0D A;  4KHA A;  1V88 A;  2RGN B;  5D3Y A;  5DIF B;  2ZPY A;  3TFM A;  5HE3 A;  3F5R A;  1XR0 B;  2D9V A;  1WJ1 A;  1BTK A;  1KI1 B;  1OMW A;  2COA A;  1I2H A;  2AL6 A;  1XOD A;  1QC6 A;  1UPQ A;  1P3R A;  4KAX B;  4DXA B;  2V76 A;  5KQ4 A;  3DXD A;  1U29 A;  3CIK A;  1LW3 A;  4H8S A;  1IRS A;  2KGX B;  1NTV A;  2UVM A;  2XQN M;  1ZM0 A;  1Y19 B;  1WGU A;  1U5F A;  2OQB A;  2H7D A;  2E2X A;  3ODW A;  3FM8 C;  2DKQ A;  2Y8F A;  1X05 A;  4GMV A;  5C5B B;  1J0W A;  4K81 A;  4A5K A;  5JHG A;  1MPH A;  5DI9 B;  1MK9 B;  1NU2 A;  1NI2 A;  2LG1 A;  5J3T A;  3PSC A;  4F7U P;  2COD A;  2D4Q A;  2ADZ A;  5C79 A;  4D0N B;  1TQZ A;  4HAU B;  2AEH A;  3WA0 A;  1EGX A;  2YVC A;  1FB8 A;  1FGZ A;  2OTX A;  3GF9 A;  2H7E A;  2RVB B;  2DFK A;  1N3H A;  2LUL A;  2RLO A;  3BJI A;  4KVG B;  3TO1 A;  3P7Z A;  2GCL A;  2D9X A;  1V61 A;  1XKE A;  2Z0P A;  2RSG A;  3GYO A;  2M38 A;  2EMS A;  2J0J A;  2KCJ A;  1DBH A;  3MDB C;  3UZT A;  4DBB A;  1DYN A;  2UZR A;  1FHW A;  2I5C A;  3D8E A;  3ML4 A;  4KHB B;  4YL8 A;  1SGH A;  2YF0 A;  4WSF A;  2K2U A;  2L1C A;  3PVW A;  1UNP A;  1GC6 A;  3JV3 A;  4CHM A;  1FHX A;  5CLQ B;  4HAT B;  1W1D A;  1P6S A;  1MAI A;  3V5W A;  3ODO A;  1H10 A;  2L2I A;  1UEF A;  2I1K A;  2YT1 A;  1V5M A;  1EVH A;  2DKP A;  4PQ0 A;  1UNQ A;  1AQC A;  1WGQ A;  2D11 A;  1BY1 A;  2DN6 A;  2JP2 A;  4GYV A;  3PVL A;  1DDM A;  2FJL A;  2D2Q A;  4EKU A;  5KCV A;  1WI1 A;  3QWM A;  2QKM A;  3IVF A;  3RCP A;  3A8Q A;  3AU4 A;  4XWX A;  2W2X C;  5HE2 A;  2I5F A;  1E5W A;  1H4R A;  2MWN B;  2Y7B A;  4GOU A;  2CY4 A;  3D8D A;  2IFS A;  1RJ2 A;  1Y5O A;  2LOX A;  1FAO A;  1FHO A;  4A6F A;  2COC A;  2Z0O A;  1U2B A;  1UPR A;  3G9W A;  2CRF A;  2YRY A;  5D3W A;  1DDV A;  3VOQ A;  3AJ4 A;  3KRW A;  4DX9 0;  2YS1 A;  1EAZ A;  2ELA A;  4ZRI A;  2J0K A;  1XX0 A;  3ZDT A;  4YON A;  5FI1 A;  4MY6 A;  1UNR A;  5DH9 B;  4GZU A;  4HDQ A;  2N23 A;  1MKE A;  3TW1 A;  5KQ1 A;  1Z87 A;  3PG7 A;  1GC7 A;  5C6R A;  4TKN A;  2D9W A;  4WJ7 A;  3QBV B;  2D9Z A;  1TJ6 A;  2COF A;  2I1J A;  4F7G A;  2MDX A;  2ROZ B;  2CY5 A;  2LOZ A;  1EF1 A;  2DTC A;  3KSY A;  5L81 A;  2MKR A;  2NMB A;  2QKL A;  2K00 A;  3QIJ A;  3ODX A;  1BTN A;  2G35 A;  1WJM A;  5C5B A;  2ELB A;  2RUK B;  2DX5 A;  1W1G A;  2D10 A;  3HW2 B;  4B6H A;  2HTH B;  4NY0 A;  1MK7 B;  4Z2N A;  2VSZ A;  3ZVR A;  3OAN A;  5FI0 A;  2CAY A;  1MIX A;  1K5G B;  3LJU X;  1TXD A;  3CXB B;  1ZVR A;  1I7A A;  5D3V A;  5J3Q A;  2J59 M;  3PVU A;  1B55 A;  1U5D A;  4ZRK A;  4P7I A;  2Z0Q A;  2LKO A;  2VKI A;  4Z2M B;  2P0F A;  2YS5 A;  1M7R A;  2YSZ A;  4IOY X;  3MPX A;  3A8P A;  3ULC A;  2M14 A;  5J3Y A;  3PZD A;  3U7D A;  1ISN A;  2KUP A;  4L6E A;  3P6A A;  4HAZ B;  1PMS A;  3SO6 A;  4GN1 A;  5D3X A;  1J19 A;  4BBK A;  3DXC A;  4MK0 A;  3T06 A;  1DDW A;  3BIN A;  3D8F A;  1BWN A;  1KZ7 A;  1X1G A;  3SUZ A;  2DHJ A;  3ULB A;  2GJY A;  4TYZ A;  4DX8 A;  4ZRJ A;  1NTY A;  1XD4 A;  5CLL B;  3HQC A;  2KR9 A;  3SYX A;  3KRX A;  1MIZ B;  4HDO A;  5DHA B;  4HB3 B;  4F7H A;  5C16 A;  3U8Z A;  3FSS A;  4HAW B;  1K5D B;  1PFJ A;  3NSU A;  2P0D A;  2BCJ A;  2Q13 A;  2DYQ A;  4EMO A;  1U27 A;  4HB0 B;  2D9Y A;  1U5G A;  1F5X A;  1X1F A;  2LYD A;  4EJN A;  1X11 A;  4GXB A;  4K2O A;  4WVF B;  3A98 B;  5HE0 A;  2IYB A;  4KHO A;  4A6H A;  1PLS A;  1GG3 A;  2EJ8 A;  1U5E A;  4CYE A;  5JP4 A;  1V5U A;  2N0Y A;  2W2X D;  2ROV A;  1QQG A;  1Q67 A;  2VRW B;  1ZSQ A;  2J0M A;  5LOP B;  4GMX B;  3VIA A;  2DX1 A;  2UZS A;  5DHF B;  3FEH A;  4IAP A;  2DLW A;  2HE7 A;  2DA0 A;  2EMT A;  2MFQ A;  1OQN A;  3KY9 A;  4HHV A;  3WYF B;  4K17 A;  2YS3 A;  3EO2 A;  5D27 A;  5LON B;  2DYN A;  4IFS A;  1P5T A;  2P0H A;  4PNK A;  1ZC3 B;  5GOW B;  4MT7 A;  3TVV A;  3X23 A;  3AU5 A;  5HE1 A;  1LB1 A;  2PZ1 A;  2P8V A;  2GCJ A;  2DHK A;  3N7C A;  1WG7 A;  3TCA A;  2K2J A;  1KZG A;  4HAV B;  3KZ1 A;  4C0A A;  4CHJ A;  2R09 A;  1FGY A;  4NSW A;  2Y8G A;  1FOE A; 
#chains in the Genus database with same CATH topology
 3M1I B;  3O96 A;  5JHH A;  2K8E A;  1WVH A;  3F0W A;  2NZ8 B;  4HAX B;  3DXE A;  3NW8 A;  4HB4 B;  1RRP B;  1BAK A;  3PP2 A;  3PEG A;  1X86 A;  1OY2 A;  3NWF A;  2RNR B;  5JLJ B;  4HB2 B;  3GYP A;  4K2P A;  1SHC A;  5I2M A;  2W2W A;  4D0O A;  1V5P A;  1ZC4 B;  1AWE A;  4Y94 A;  1XCG A;  2EC1 A;  4A6F B;  2YT0 A;  4OT1 A;  3SNH A;  1M7E A;  2X18 A;  1V89 A;  4GPT B;  1W1H A;  2GS0 A;  3HK0 A;  4A6K A;  5EFX A;  1DRO A;  3SV1 A;  4HAY B;  2DHI A;  2R0D A;  4KHA A;  1V88 A;  2RGN B;  5D3Y A;  5DIF B;  2ZPY A;  3TFM A;  5HE3 A;  3F5R A;  1XR0 B;  2D9V A;  1WJ1 A;  1BTK A;  1KI1 B;  1OMW A;  2COA A;  2K49 A;  1I2H A;  2AL6 A;  1XOD A;  1QC6 A;  1UPQ A;  1P3R A;  4KAX B;  2Z59 A;  4DXA B;  2V76 A;  5KQ4 A;  3DXD A;  1U29 A;  3CIK A;  4L1R A;  1LW3 A;  4H8S A;  1IRS A;  2KGX B;  1NTV A;  2UVM A;  2XQN M;  1ZM0 A;  1Y19 B;  1WGU A;  1U5F A;  2OQB A;  2H7D A;  2E2X A;  3ODW A;  3FM8 C;  2DKQ A;  2Y8F A;  1X05 A;  4GMV A;  5C5B B;  1J0W A;  5IRS A;  4K81 A;  4A5K A;  5JHG A;  1MPH A;  5DI9 B;  1MK9 B;  1NU2 A;  1NI2 A;  2LG1 A;  5J3T A;  3PSC A;  4F7U P;  2COD A;  2D4Q A;  2ADZ A;  5C79 A;  4D0N B;  1TQZ A;  4HAU B;  2AEH A;  3WA0 A;  1EGX A;  2YVC A;  1FB8 A;  1FGZ A;  2OTX A;  4QJ4 B;  3GF9 A;  2H7E A;  2RVB B;  2DFK A;  1N3H A;  2LUL A;  2RLO A;  3BJI A;  4KVG B;  3TO1 A;  3P7Z A;  2GCL A;  2D9X A;  1V61 A;  1XKE A;  2Z0P A;  2RSG A;  3GYO A;  4CSQ A;  2M38 A;  2EMS A;  2J0J A;  2KCJ A;  1DBH A;  3MDB C;  3UZT A;  4DBB A;  1DYN A;  2UZR A;  1FHW A;  2I5C A;  3D8E A;  3ML4 A;  4KHB B;  4YL8 A;  1SGH A;  2YF0 A;  4GNK B;  4WSF A;  2K2U A;  2L1C A;  3PVW A;  1UNP A;  1GC6 A;  3JV3 A;  4CHM A;  1FHX A;  5CLQ B;  4HAT B;  1W1D A;  1P6S A;  3NWA A;  1MAI A;  3V5W A;  3ODO A;  1H10 A;  2L2I A;  1UEF A;  2I1K A;  2YT1 A;  1V5M A;  1EVH A;  2DKP A;  4PQ0 A;  1UNQ A;  1AQC A;  1WGQ A;  2D11 A;  1BY1 A;  2DN6 A;  2JP2 A;  4GYV A;  3PVL A;  1DDM A;  2FJL A;  2D2Q A;  4EKU A;  5KCV A;  1WI1 A;  4DIX A;  3QWM A;  2QKM A;  3IVF A;  3RCP A;  3A8Q A;  3AU4 A;  4XWX A;  2W2X C;  5HE2 A;  2I5F A;  1E5W A;  1H4R A;  2MWN B;  1ZYI A;  2Y7B A;  4GOU A;  2CY4 A;  3D8D A;  2IFS A;  1RJ2 A;  1Y5O A;  2LOX A;  1FAO A;  1FHO A;  4A6F A;  2COC A;  2Z0O A;  1U2B A;  1UPR A;  3G9W A;  2CRF A;  2KIE A;  2YRY A;  5D3W A;  1DDV A;  3VOQ A;  3AJ4 A;  3KRW A;  4DX9 0;  2YS1 A;  1EAZ A;  2ELA A;  4ZRI A;  2J0K A;  3NWD A;  1MI1 A;  2KIG A;  3B77 A;  1XX0 A;  3ZDT A;  4YON A;  5FI1 A;  4MY6 A;  1UNR A;  5DH9 B;  4GZU A;  4HDQ A;  2Z13 A;  2N23 A;  1MKE A;  3TW1 A;  5KQ1 A;  2YT2 A;  1Z87 A;  3PG7 A;  1GC7 A;  5C6R A;  4TKN A;  2D9W A;  5M4Y B;  4WJ7 A;  3QBV B;  2D9Z A;  1TJ6 A;  2COF A;  2I1J A;  4F7G A;  2MDX A;  2ROZ B;  2CY5 A;  2LOZ A;  1EF1 A;  2DTC A;  3KSY A;  5L81 A;  2MKR A;  2NMB A;  2QKL A;  2K00 A;  3QIJ A;  3ODX A;  1BTN A;  2G35 A;  1WJM A;  5C5B A;  4QJ5 B;  2ELB A;  2RUK B;  2DX5 A;  1W1G A;  2D10 A;  3HW2 B;  4B6H A;  2HTH B;  4NY0 A;  1MK7 B;  4Z2N A;  2VSZ A;  3ZVR A;  3OAN A;  5FI0 A;  2CAY A;  1MIX A;  1K5G B;  3LJU X;  1TXD A;  3CXB B;  1ZVR A;  5I2S A;  1I7A A;  5D3V A;  5J3Q A;  2J59 M;  3PVU A;  1B55 A;  1U5D A;  4ZRK A;  4P7I A;  2Z0Q A;  2LKO A;  3HSA A;  2VKI A;  4Z2M B;  2P0F A;  2YS5 A;  3FVC A;  1M7R A;  2ZKM X;  2YSZ A;  4IOY X;  3MPX A;  3A8P A;  1T77 A;  3ULC A;  2M14 A;  5J3Y A;  3PZD A;  2RRF A;  3U7D A;  1ISN A;  2KUP A;  4L6E A;  3P6A A;  4HAZ B;  2FJU B;  1PMS A;  3SO6 A;  4GN1 A;  5D3X A;  1J19 A;  4KHB A;  4BBK A;  3DXC A;  3OHM B;  4MK0 A;  3T06 A;  1DDW A;  3BIN A;  3D8F A;  3U12 A;  1BWN A;  1KZ7 A;  1X1G A;  3SUZ A;  2DHJ A;  3ULB A;  2GJY A;  4TYZ A;  4DX8 A;  4ZRJ A;  1NTY A;  1XD4 A;  5CLL B;  3HQC A;  2KR9 A;  3SYX A;  3KRX A;  1MIZ B;  2KR0 A;  4HDO A;  5DHA B;  4HB3 B;  4F7H A;  5C16 A;  3U8Z A;  3FSS A;  4HAW B;  1K5D B;  1PFJ A;  3A58 A;  3NSU A;  2P0D A;  2BCJ A;  2Q13 A;  2DYQ A;  4EMO A;  1U27 A;  4HB0 B;  2D9Y A;  1U5G A;  1F5X A;  1X1F A;  4HSI A;  2LYD A;  4EJN A;  1X11 A;  2Z14 A;  4GXB A;  4K2O A;  4WVF B;  3A98 B;  5HE0 A;  2IYB A;  4QJ3 B;  4KHO A;  4A6H A;  1PLS A;  1GG3 A;  2GUM A;  2EJ8 A;  1U5E A;  4CYE A;  5JP4 A;  4QXA B;  1V5U A;  2N0Y A;  2W2X D;  2ROV A;  1QQG A;  1Q67 A;  2VRW B;  1ZSQ A;  2J0M A;  5LOP B;  4GMX B;  3VIA A;  2DX1 A;  2UZS A;  2NBV A;  5DHF B;  3FEH A;  3DCX A;  4IAP A;  2DLW A;  2HE7 A;  2R2Y A;  2DA0 A;  2EMT A;  2MFQ A;  1OQN A;  3KY9 A;  4HHV A;  3WYF B;  4K17 A;  2KUQ A;  2YS3 A;  3EO2 A;  5D27 A;  5LON B;  2DYN A;  2Z4D A;  1P5T A;  2P0H A;  4IFS A;  1ZC3 B;  5GOW B;  4PNK A;  4MT7 A;  3TVV A;  3X23 A;  3AU5 A;  5HE1 A;  4OSN A;  5LG4 B;  1LB1 A;  2PZ1 A;  2P8V A;  2GCJ A;  2DHK A;  3N7C A;  1WG7 A;  3TCA A;  2K2J A;  1KZG A;  4D6W A;  4HAV B;  3KZ1 A;  4C0A A;  3HIE A;  4CHJ A;  2R09 A;  1FGY A;  4NSW A;  2Y8G A;  1FOE A; 
#chains in the Genus database with same CATH homology
 3M1I B;  3O96 A;  5JHH A;  1WVH A;  3F0W A;  2NZ8 B;  4HAX B;  3DXE A;  4HB4 B;  1RRP B;  1BAK A;  3PP2 A;  3PEG A;  1X86 A;  1OY2 A;  2RNR B;  5JLJ B;  4HB2 B;  3GYP A;  4K2P A;  1SHC A;  2W2W A;  4D0O A;  1V5P A;  1ZC4 B;  1AWE A;  4Y94 A;  1XCG A;  2EC1 A;  4A6F B;  2YT0 A;  3SNH A;  1M7E A;  2X18 A;  1V89 A;  4GPT B;  1W1H A;  2GS0 A;  3HK0 A;  4A6K A;  5EFX A;  1DRO A;  3SV1 A;  4HAY B;  2DHI A;  2R0D A;  4KHA A;  1V88 A;  2RGN B;  5D3Y A;  5DIF B;  2ZPY A;  3TFM A;  5HE3 A;  3F5R A;  1XR0 B;  2D9V A;  1WJ1 A;  1BTK A;  1KI1 B;  1OMW A;  2COA A;  1I2H A;  2AL6 A;  1XOD A;  1QC6 A;  1UPQ A;  1P3R A;  4KAX B;  4DXA B;  2V76 A;  5KQ4 A;  3DXD A;  1U29 A;  3CIK A;  1LW3 A;  4H8S A;  1IRS A;  2KGX B;  1NTV A;  2UVM A;  2XQN M;  1ZM0 A;  1Y19 B;  1WGU A;  1U5F A;  2OQB A;  2H7D A;  2E2X A;  3ODW A;  3FM8 C;  2DKQ A;  2Y8F A;  1X05 A;  4GMV A;  5C5B B;  1J0W A;  4K81 A;  4A5K A;  5JHG A;  1MPH A;  5DI9 B;  1MK9 B;  1NU2 A;  1NI2 A;  2LG1 A;  5J3T A;  3PSC A;  4F7U P;  2COD A;  2D4Q A;  2ADZ A;  5C79 A;  4D0N B;  1TQZ A;  4HAU B;  2AEH A;  3WA0 A;  1EGX A;  2YVC A;  1FB8 A;  1FGZ A;  2OTX A;  3GF9 A;  2H7E A;  2RVB B;  2DFK A;  1N3H A;  2LUL A;  2RLO A;  3BJI A;  4KVG B;  3TO1 A;  3P7Z A;  2GCL A;  2D9X A;  1V61 A;  1XKE A;  2Z0P A;  2RSG A;  3GYO A;  2M38 A;  2EMS A;  2J0J A;  2KCJ A;  1DBH A;  3MDB C;  3UZT A;  4DBB A;  1DYN A;  2UZR A;  1FHW A;  2I5C A;  3D8E A;  3ML4 A;  4KHB B;  4YL8 A;  1SGH A;  2YF0 A;  4WSF A;  2K2U A;  2L1C A;  3PVW A;  1UNP A;  1GC6 A;  3JV3 A;  4CHM A;  1FHX A;  5CLQ B;  4HAT B;  1W1D A;  1P6S A;  1MAI A;  3V5W A;  3ODO A;  1H10 A;  2L2I A;  1UEF A;  2I1K A;  2YT1 A;  1V5M A;  1EVH A;  2DKP A;  4PQ0 A;  1UNQ A;  1AQC A;  1WGQ A;  2D11 A;  1BY1 A;  2DN6 A;  2JP2 A;  4GYV A;  3PVL A;  1DDM A;  2FJL A;  2D2Q A;  4EKU A;  5KCV A;  1WI1 A;  3QWM A;  2QKM A;  3IVF A;  3RCP A;  3A8Q A;  3AU4 A;  4XWX A;  2W2X C;  5HE2 A;  2I5F A;  1E5W A;  1H4R A;  2MWN B;  2Y7B A;  4GOU A;  2CY4 A;  3D8D A;  2IFS A;  1RJ2 A;  1Y5O A;  2LOX A;  1FAO A;  1FHO A;  4A6F A;  2COC A;  2Z0O A;  1U2B A;  1UPR A;  3G9W A;  2CRF A;  2YRY A;  5D3W A;  1DDV A;  3VOQ A;  3AJ4 A;  3KRW A;  4DX9 0;  2YS1 A;  1EAZ A;  2ELA A;  4ZRI A;  2J0K A;  1XX0 A;  3ZDT A;  4YON A;  5FI1 A;  4MY6 A;  1UNR A;  5DH9 B;  4GZU A;  4HDQ A;  2N23 A;  1MKE A;  3TW1 A;  5KQ1 A;  1Z87 A;  3PG7 A;  1GC7 A;  5C6R A;  4TKN A;  2D9W A;  4WJ7 A;  3QBV B;  2D9Z A;  1TJ6 A;  2COF A;  2I1J A;  4F7G A;  2MDX A;  2ROZ B;  2CY5 A;  2LOZ A;  1EF1 A;  2DTC A;  3KSY A;  5L81 A;  2MKR A;  2NMB A;  2QKL A;  2K00 A;  3QIJ A;  3ODX A;  1BTN A;  2G35 A;  1WJM A;  5C5B A;  2ELB A;  2RUK B;  2DX5 A;  1W1G A;  2D10 A;  3HW2 B;  4B6H A;  2HTH B;  4NY0 A;  1MK7 B;  4Z2N A;  2VSZ A;  3ZVR A;  3OAN A;  5FI0 A;  2CAY A;  1MIX A;  1K5G B;  3LJU X;  1TXD A;  3CXB B;  1ZVR A;  1I7A A;  5D3V A;  5J3Q A;  2J59 M;  3PVU A;  1B55 A;  1U5D A;  4ZRK A;  4P7I A;  2Z0Q A;  2LKO A;  2VKI A;  4Z2M B;  2P0F A;  2YS5 A;  1M7R A;  2YSZ A;  4IOY X;  3MPX A;  3A8P A;  3ULC A;  2M14 A;  5J3Y A;  3PZD A;  3U7D A;  1ISN A;  2KUP A;  4L6E A;  3P6A A;  4HAZ B;  1PMS A;  3SO6 A;  4GN1 A;  5D3X A;  1J19 A;  4BBK A;  3DXC A;  4MK0 A;  3T06 A;  1DDW A;  3BIN A;  3D8F A;  1BWN A;  1KZ7 A;  1X1G A;  3SUZ A;  2DHJ A;  3ULB A;  2GJY A;  4TYZ A;  4DX8 A;  4ZRJ A;  1NTY A;  1XD4 A;  5CLL B;  3HQC A;  2KR9 A;  3SYX A;  3KRX A;  1MIZ B;  4HDO A;  5DHA B;  4HB3 B;  4F7H A;  5C16 A;  3U8Z A;  3FSS A;  4HAW B;  1K5D B;  1PFJ A;  3NSU A;  2P0D A;  2BCJ A;  2Q13 A;  2DYQ A;  4EMO A;  1U27 A;  4HB0 B;  2D9Y A;  1U5G A;  1F5X A;  1X1F A;  2LYD A;  4EJN A;  1X11 A;  4GXB A;  4K2O A;  4WVF B;  3A98 B;  5HE0 A;  2IYB A;  4KHO A;  4A6H A;  1PLS A;  1GG3 A;  2EJ8 A;  1U5E A;  4CYE A;  5JP4 A;  1V5U A;  2N0Y A;  2W2X D;  2ROV A;  1QQG A;  1Q67 A;  2VRW B;  1ZSQ A;  2J0M A;  5LOP B;  4GMX B;  3VIA A;  2DX1 A;  2UZS A;  5DHF B;  3FEH A;  4IAP A;  2DLW A;  2HE7 A;  2DA0 A;  2EMT A;  2MFQ A;  1OQN A;  3KY9 A;  4HHV A;  3WYF B;  4K17 A;  2YS3 A;  3EO2 A;  5D27 A;  5LON B;  2DYN A;  4IFS A;  1P5T A;  2P0H A;  4PNK A;  1ZC3 B;  5GOW B;  4MT7 A;  3TVV A;  3X23 A;  3AU5 A;  5HE1 A;  1LB1 A;  2PZ1 A;  2P8V A;  2GCJ A;  2DHK A;  3N7C A;  1WG7 A;  3TCA A;  2K2J A;  1KZG A;  4HAV B;  3KZ1 A;  4C0A A;  4CHJ A;  2R09 A;  1FGY A;  4NSW A;  2Y8G A;  1FOE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...