2NZ8B

N-terminal dhph cassette of trio in complex with nucleotide-free rac1
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
305
structure length
279
Chain Sequence
b'ARRKEFIMAELIQTEKAYVRDLRECMDTYLWEMTSGVEEIPPGIVNKELIIFGNMQEIYEFHNNIFLKELEKYEQLPEDVGHCFVTWADKFQMYVTYCKNKPDSTQLILEHAGSYFDEIQQRHGLANSISSYLIKPVQRITKYQLLLKELLTCCEEGKGEIKDGLEVMLSVPKRANDAMHLSMLEGFSQGELILQESFQHLFLFEMSLVFSKEVKDSSGRSKYLYKSKLFTSELGVTEHVEGDPCKFATSDNKIVLKASSIENKQDWIKHIREVIQERT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords ras-related C3 botulinum toxin substrate 1 isoform Rac1
publication title The DH and PH Domains of Trio Coordinately Engage Rho GTPases for their Efficient Activation
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein,cell cycle
total genus 91
structure length 279
sequence length 305
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2006-11-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00169 PH PH domain
B PF00621 RhoGEF RhoGEF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.900.10 Mainly Alpha Up-down Bundle Dbl Homology Domain; Chain A Dbl homology (DH) domain 2nz8B01
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2nz8B02
1Q67A 2IFSA 3FSSA 1MKEA 3F5RA 2DX5A 2ADZA 5CLQB 2KR9A 3A8QA 4A6FB 1WJ1A 3G9WA 5D27A 5EFXA 1P3RA 3ZVRA 5KCVA 2LKOA 2DTCA 3MPXA 4Z2MB 4YL8A 5JP4A 3KRXA 2ELBA 4ZRIA 2LG1A 2Y7BA 1I2HA 5C6RA 1EVHA 1WVHA 1J19A 2VRWB 3DXEA 3VIAA 1NTVA 1IRSA 1ISNA 1W1GA 2D11A 3SYXA 1X05A 1WGUA 2DN6A 4ZRJA 3P7ZA 4F7HA 3HQCA 3SO6A 5GOWB 1Y19B 2GS0A 2VKIA 5JLJB 1U5GA 2RNRB 1NI2A 2LOZA 2R0DA 2W2WA 5DI9B 3PG7A 3F0WA 2COFA 1V5MA 3ML4A 1U5EA 2H7DA 4Y94A 4GYVA 1UNRA 4GXBA 2HTHB 4DX90 5J3TA 3TW1A 3QWMA 2K2JA 1BTNA 3T06A 2PZ1A 3N7CA 5C79A 3TO1A 5C5BA 4IOYX 4KVGB 4K17A 2CY4A 4P7IA 3A8PA 1KI1B 3HW2B 5FI0A 1AQCA 2X18A 5DHFB 3D8FA 5D3WA 1B55A 1U2BA 1MPHA 3P6AA 2DA0A 4PNKA 1BWNA 3WA0A 3TCAA 4GN1A 2N0YA 3U8ZA 1H10A 1WJMA 2UZSA 5KQ4A 1M7EA 1MIZB 1MIXA 2FJLA 1BAKA 4IAPA 1UEFA 2EC1A 1TXDA 2YT0A 5D3VA 5FI1A 1FHOA 3VOQA 5DHAB 1V88A 4Z2NA 2VSZA 2J59M 2H7EA 2J0MA 4A6HA 1LW3A 1XX0A 1ZVRA 1OY2A 1RRPB 2D10A 1DDWA 2YSZA 4XWXA 1V5UA 1U5DA 1FHWA 2GCJA 2M38A 3QIJA 1X11A 2CAYA 1XCGA 1X1FA 1XR0B 1KZGA 2YS5A 1FOEA 2CRFA 1X1GA 1ZSQA 1U29A 4DX8A 5J3QA 5HE2A 1MK7B 1J0WA 2AEHA 1WI1A 2NMBA 2DYNA 4IFSA 4MT7A 3SV1A 3D8DA 4H8SA 2DFKA 2N23A 2J0KA 4GPTB 4NY0A 1UPQA 1W1DA 1QQGA 1FAOA 2D9VA 2I1KA 5JHGA 1ZM0A 3ULCA 4HB0B 2GJYA 2D9YA 2IYBA 1XODA 2RGNB 1UPRA 1LB1A 2ZPYA 2G35A 2Y8FA 1ZC4B 2YF0A 3AU5A 2D4QA 3LJUX 3ODWA 5CLLB 3M1IB 2NZ8B 4B6HA 2MDXA 3BINA 1AWEA 3GYPA 4MY6A 2EMSA 2UZRA 3DXCA 2I1JA 1XD4A 2COCA 2YS1A 4CYEA 2W2XD 2DHKA 1X86A 3AJ4A 1EGXA 1V5PA 5LONB 2JP2A 5DIFB 2LOXA 3UZTA 1NTYA 4HATB 1M7RA 1DYNA 4PQ0A 1DDMA 3HK0A 4HAVB 5L81A 1QC6A 1K5DB 2RLOA 3PEGA 4GMXB 5HE3A 3KSYA 2YT1A 2I5CA 1UNQA 2EMTA 2YVCA 1E5WA 5C5BB 1ZC3B 2P0FA 1BTKA 4L6EA 4YONA 1N3HA 1U27A 1H4RA 5DH9B 5JHHA 4ZRKA 5J3YA 1XKEA 2K2UA 1GG3A 2ELAA 5D3XA 1FGYA 3ODOA 1UNPA 1Y5OA 2L2IA 3EO2A 5KQ1A 1FGZA 2I5FA 4A6FA 4GOUA 3ODXA 2D9WA 3TFMA 4HB3B 2KUPA 2ROZB 4F7GA 1MAIA 4EMOA 1MK9B 4CHMA 3IVFA 1BY1A 2CODA 3O96A 2MFQA 1V61A 4D0OA 2LULA 1WG7A 4GMVA 1EF1A 4HDOA 2AL6A 2QKMA 1U5FA 4HDQA 2UVMA 2DKQA 2MKRA 1P6SA 3FM8C 2D2QA 1RJ2A 3GF9A 4F7UP 4KHAA 4HAUB 4HHVA 4HAXB 3GYOA 3WYFB 3X23A 2Y8GA 1V89A 2KGXB 2L1CA 2MWNB 1OMWA 1Z87A 2DHJA 1I7AA 3ULBA 2LYDA 3A98B 1OQNA 3BJIA 2OQBA 3CIKA 3CXBB 2R09A 4HAZB 2ROVA 1PMSA 4HB2B 3KY9A 1SGHA 3TVVA 1DDVA 4EKUA 5C16A 5D3YA 4K81A 2YS3A 1NU2A 4WJ7A 3AU4A 2D9XA 4NSWA 4CHJA 2P0DA 3DXDA 2P0HA 4KHBB 4WSFA 1FB8A 2W2XC 4A6KA 3SUZA 4D0NB 5HE0A 2QKLA 2YRYA 5HE1A 3PVWA 2BCJA 1FHXA 2E2XA 4EJNA 1DBHA 2EJ8A 1TQZA 2OTXA 3U7DA 4KHOA 1WGQA 4HAWB 5LOPB 3PZDA 3PVLA 1F5XA 4BBKA 4K2PA 2GCLA 2CY5A 3KZ1A 1P5TA 4WVFB 1K5GB 4GZUA 3V5WA 1DROA 2J0JA 2K00A 3NSUA 3RCPA 4MK0A 2RVBB 1PFJA 4TKNA 2DYQA 3PP2A 2M14A 3PVUA 2DLWA 2Z0PA 1GC6A 2HE7A 2V76A 1GC7A 2KCJA 4A5KA 3SNHA 4DBBA 3KRWA 4TYZA 1KZ7A 4HB4B 3FEHA 2P8VA 3QBVB 3OANA 3MDBC 1W1HA 1SHCA 1TJ6A 1EAZA 2RSGA 4HAYB 2XQNM 4KAXB 3JV3A 3ZDTA 2Z0OA 2RUKB 4DXAB 3D8EA 2DHIA 4K2OA 2COAA 2Q13A 2DX1A 2D9ZA 2DKPA 4C0AA 3PSCA 2Z0QA 1PLSA
chains in the Genus database with same CATH superfamily
1Q67A 2IFSA 3FSSA 1MKEA 3F5RA 2DX5A 2ADZA 5CLQB 2KR9A 3A8QA 4A6FB 1WJ1A 3G9WA 5D27A 5EFXA 1P3RA 3ZVRA 5KCVA 2LKOA 2DTCA 3MPXA 4Z2MB 4YL8A 5JP4A 3KRXA 2ELBA 4ZRIA 2LG1A 2Y7BA 4D6WA 1I2HA 5C6RA 1EVHA 1WVHA 1J19A 5IRSA 2VRWB 2KR0A 3DXEA 3VIAA 1NTVA 4QJ4B 4QJ3B 1IRSA 1ISNA 1W1GA 2D11A 3SYXA 3U12A 1X05A 1WGUA 2DN6A 4ZRJA 3P7ZA 4F7HA 3HQCA 3SO6A 2Z14A 5GOWB 1Y19B 2GS0A 2VKIA 5JLJB 1U5GA 2RNRB 1NI2A 2LOZA 2R0DA 5I2MA 2W2WA 5DI9B 3PG7A 3F0WA 2COFA 1V5MA 3ML4A 1U5EA 2H7DA 4Y94A 4GYVA 1UNRA 4GXBA 2HTHB 4DX90 5J3TA 3TW1A 3QWMA 3DCXA 2K2JA 1BTNA 3T06A 2PZ1A 3N7CA 5C79A 3TO1A 5C5BA 4IOYX 4KVGB 4K17A 2CY4A 4P7IA 3A8PA 1KI1B 4QXAB 3HW2B 5FI0A 1AQCA 2X18A 5DHFB 3D8FA 5D3WA 1B55A 1U2BA 1MPHA 3P6AA 2DA0A 4PNKA 1BWNA 3WA0A 3TCAA 5M4YB 4GN1A 2N0YA 3U8ZA 1H10A 1WJMA 2UZSA 5KQ4A 1M7EA 1MIZB 1MIXA 2FJLA 1BAKA 3HIEA 2FJUB 4IAPA 1UEFA 2EC1A 1TXDA 2YT0A 5D3VA 5FI1A 1FHOA 3VOQA 5DHAB 1V88A 4Z2NA 4CSQA 2VSZA 2J59M 2H7EA 2J0MA 4A6HA 1LW3A 1XX0A 1ZVRA 1OY2A 1RRPB 2D10A 1DDWA 2YSZA 2R2YA 4XWXA 1V5UA 1U5DA 1FHWA 2Z59A 2GCJA 2M38A 3QIJA 1X11A 2GUMA 2CAYA 1XCGA 1X1FA 1XR0B 5LG4B 1KZGA 2YS5A 1FOEA 2CRFA 1X1GA 1ZSQA 1U29A 4DX8A 5J3QA 5HE2A 1MK7B 1J0WA 2AEHA 1WI1A 2NMBA 2DYNA 4IFSA 4MT7A 3SV1A 3D8DA 4H8SA 2DFKA 2K8EA 2N23A 2J0KA 4GPTB 4NY0A 1UPQA 3NWFA 1W1DA 2Z13A 1QQGA 1FAOA 2D9VA 2I1KA 5JHGA 1ZM0A 3ULCA 4HB0B 2GJYA 2D9YA 2IYBA 1XODA 4KHBA 2RGNB 1UPRA 1LB1A 2ZPYA 2G35A 5I2SA 2RRFA 2Y8FA 1ZC4B 2YF0A 3AU5A 2D4QA 2YT2A 3LJUX 3ODWA 5CLLB 3M1IB 2NZ8B 4B6HA 3B77A 2MDXA 3BINA 3OHMB 1AWEA 3GYPA 4MY6A 2EMSA 2UZRA 3DXCA 2I1JA 1XD4A 2COCA 2YS1A 4CYEA 2KIGA 2W2XD 2DHKA 1X86A 3AJ4A 1EGXA 1V5PA 5LONB 2JP2A 5DIFB 2LOXA 3UZTA 1NTYA 4HATB 1M7RA 1DYNA 3NWDA 4PQ0A 1T77A 1DDMA 3HK0A 4HAVB 5L81A 2KIEA 1QC6A 1K5DB 2RLOA 3PEGA 4GMXB 5HE3A 3KSYA 2YT1A 2I5CA 1UNQA 2EMTA 2YVCA 1E5WA 5C5BB 1ZC3B 2P0FA 1BTKA 4L6EA 4YONA 1N3HA 1U27A 1H4RA 5DH9B 5JHHA 4ZRKA 5J3YA 1XKEA 2K2UA 1GG3A 2ELAA 5D3XA 4GNKB 1FGYA 3ODOA 1UNPA 1Y5OA 2L2IA 3EO2A 5KQ1A 1FGZA 2I5FA 4A6FA 4GOUA 1ZYIA 3ODXA 4HSIA 2D9WA 3TFMA 4HB3B 2KUPA 2ROZB 4F7GA 1MAIA 4EMOA 4OT1A 1MK9B 4CHMA 3IVFA 1BY1A 4QJ5B 2CODA 3O96A 2MFQA 1V61A 4D0OA 2LULA 1WG7A 4GMVA 1EF1A 4HDOA 3A58A 2AL6A 2QKMA 1U5FA 4HDQA 2UVMA 3HSAA 2DKQA 2MKRA 3NWAA 1P6SA 3FM8C 2D2QA 1RJ2A 3GF9A 4F7UP 4KHAA 4HAUB 4HHVA 4HAXB 3GYOA 3WYFB 3X23A 2Y8GA 1V89A 2KGXB 2L1CA 2MWNB 1OMWA 1Z87A 2DHJA 1I7AA 3ULBA 2LYDA 3A98B 1OQNA 3BJIA 2OQBA 3CIKA 3CXBB 2R09A 4HAZB 2ROVA 1PMSA 4HB2B 3KY9A 1SGHA 4L1RA 3TVVA 1DDVA 4EKUA 5C16A 5D3YA 4K81A 2YS3A 1NU2A 4WJ7A 3AU4A 2D9XA 4NSWA 4CHJA 2P0DA 3DXDA 2P0HA 4KHBB 4WSFA 1FB8A 2W2XC 4A6KA 3SUZA 4D0NB 5HE0A 2QKLA 2YRYA 5HE1A 3PVWA 2BCJA 1FHXA 2E2XA 4EJNA 1DBHA 2EJ8A 1TQZA 2OTXA 3U7DA 4KHOA 1WGQA 4HAWB 5LOPB 3PZDA 3PVLA 2K49A 3FVCA 1F5XA 4BBKA 4K2PA 2GCLA 2CY5A 3KZ1A 1P5TA 4WVFB 1K5GB 4GZUA 3V5WA 1DROA 2J0JA 2K00A 3NSUA 3RCPA 4MK0A 2RVBB 1PFJA 4TKNA 2DYQA 3PP2A 2M14A 2Z4DA 3PVUA 2DLWA 2Z0PA 1GC6A 2HE7A 2V76A 1GC7A 2KCJA 3NW8A 4DIXA 4A5KA 3SNHA 4DBBA 3KRWA 4TYZA 1KZ7A 4HB4B 4OSNA 3FEHA 2P8VA 3QBVB 3OANA 3MDBC 1W1HA 1SHCA 1TJ6A 1EAZA 2RSGA 4HAYB 2XQNM 4KAXB 2NBVA 3JV3A 3ZDTA 2KUQA 2Z0OA 2RUKB 4DXAB 3D8EA 2DHIA 4K2OA 2COAA 2Q13A 2DX1A 1MI1A 2D9ZA 2DKPA 2ZKMX 4C0AA 3PSCA 2Z0QA 1PLSA
chains in the Genus database with same CATH topology
1Q67A 2IFSA 3FSSA 1MKEA 3F5RA 2DX5A 2ADZA 5CLQB 2KR9A 3A8QA 4A6FB 1WJ1A 3G9WA 5D27A 5EFXA 1P3RA 3ZVRA 5KCVA 2LKOA 2DTCA 3MPXA 4Z2MB 4YL8A 5JP4A 3KRXA 2ELBA 4ZRIA 2LG1A 2Y7BA 1I2HA 5C6RA 1EVHA 1WVHA 1J19A 2VRWB 3DXEA 3VIAA 1NTVA 1IRSA 1ISNA 1W1GA 2D11A 3SYXA 1X05A 1WGUA 2DN6A 4ZRJA 3P7ZA 4F7HA 3HQCA 3SO6A 5GOWB 1Y19B 2GS0A 2VKIA 5JLJB 1U5GA 2RNRB 1NI2A 2LOZA 2R0DA 2W2WA 5DI9B 3PG7A 3F0WA 2COFA 1V5MA 3ML4A 1U5EA 2H7DA 4Y94A 4GYVA 1UNRA 4GXBA 2HTHB 4DX90 5J3TA 3TW1A 3QWMA 2K2JA 1BTNA 3T06A 2PZ1A 3N7CA 5C79A 3TO1A 5C5BA 4IOYX 4KVGB 4K17A 2CY4A 4P7IA 3A8PA 1KI1B 3HW2B 5FI0A 1AQCA 2X18A 5DHFB 3D8FA 5D3WA 1B55A 1U2BA 1MPHA 3P6AA 2DA0A 4PNKA 1BWNA 3WA0A 3TCAA 4GN1A 2N0YA 3U8ZA 1H10A 1WJMA 2UZSA 5KQ4A 1M7EA 1MIZB 1MIXA 2FJLA 1BAKA 4IAPA 1UEFA 2EC1A 1TXDA 2YT0A 5D3VA 5FI1A 1FHOA 3VOQA 5DHAB 1V88A 4Z2NA 2VSZA 2J59M 2H7EA 2J0MA 4A6HA 1LW3A 1XX0A 1ZVRA 1OY2A 1RRPB 2D10A 1DDWA 2YSZA 4XWXA 1V5UA 1U5DA 1FHWA 2GCJA 2M38A 3QIJA 1X11A 2CAYA 1XCGA 1X1FA 1XR0B 1KZGA 2YS5A 1FOEA 2CRFA 1X1GA 1ZSQA 1U29A 4DX8A 5J3QA 5HE2A 1MK7B 1J0WA 2AEHA 1WI1A 2NMBA 2DYNA 4IFSA 4MT7A 3SV1A 3D8DA 4H8SA 2DFKA 2N23A 2J0KA 4GPTB 4NY0A 1UPQA 1W1DA 1QQGA 1FAOA 2D9VA 2I1KA 5JHGA 1ZM0A 3ULCA 4HB0B 2GJYA 2D9YA 2IYBA 1XODA 2RGNB 1UPRA 1LB1A 2ZPYA 2G35A 2Y8FA 1ZC4B 2YF0A 3AU5A 2D4QA 3LJUX 3ODWA 5CLLB 3M1IB 2NZ8B 4B6HA 2MDXA 3BINA 1AWEA 3GYPA 4MY6A 2EMSA 2UZRA 3DXCA 2I1JA 1XD4A 2COCA 2YS1A 4CYEA 2W2XD 2DHKA 1X86A 3AJ4A 1EGXA 1V5PA 5LONB 2JP2A 5DIFB 2LOXA 3UZTA 1NTYA 4HATB 1M7RA 1DYNA 4PQ0A 1DDMA 3HK0A 4HAVB 5L81A 1QC6A 1K5DB 2RLOA 3PEGA 4GMXB 5HE3A 3KSYA 2YT1A 2I5CA 1UNQA 2EMTA 2YVCA 1E5WA 5C5BB 1ZC3B 2P0FA 1BTKA 4L6EA 4YONA 1N3HA 1U27A 1H4RA 5DH9B 5JHHA 4ZRKA 5J3YA 1XKEA 2K2UA 1GG3A 2ELAA 5D3XA 1FGYA 3ODOA 1UNPA 1Y5OA 2L2IA 3EO2A 5KQ1A 1FGZA 2I5FA 4A6FA 4GOUA 3ODXA 2D9WA 3TFMA 4HB3B 2KUPA 2ROZB 4F7GA 1MAIA 4EMOA 1MK9B 4CHMA 3IVFA 1BY1A 2CODA 3O96A 2MFQA 1V61A 4D0OA 2LULA 1WG7A 4GMVA 1EF1A 4HDOA 2AL6A 2QKMA 1U5FA 4HDQA 2UVMA 2DKQA 2MKRA 1P6SA 3FM8C 2D2QA 1RJ2A 3GF9A 4F7UP 4KHAA 4HAUB 4HHVA 4HAXB 3GYOA 3WYFB 3X23A 2Y8GA 1V89A 2KGXB 2L1CA 2MWNB 1OMWA 1Z87A 2DHJA 1I7AA 3ULBA 2LYDA 3A98B 1OQNA 3BJIA 2OQBA 3CIKA 3CXBB 2R09A 4HAZB 2ROVA 1PMSA 4HB2B 3KY9A 1SGHA 3TVVA 1DDVA 4EKUA 5C16A 5D3YA 4K81A 2YS3A 1NU2A 4WJ7A 3AU4A 2D9XA 4NSWA 4CHJA 2P0DA 3DXDA 2P0HA 4KHBB 4WSFA 1FB8A 2W2XC 4A6KA 3SUZA 4D0NB 5HE0A 2QKLA 2YRYA 5HE1A 3PVWA 2BCJA 1FHXA 2E2XA 4EJNA 1DBHA 2EJ8A 1TQZA 2OTXA 3U7DA 4KHOA 1WGQA 4HAWB 5LOPB 3PZDA 3PVLA 1F5XA 4BBKA 4K2PA 2GCLA 2CY5A 3KZ1A 1P5TA 4WVFB 1K5GB 4GZUA 3V5WA 1DROA 2J0JA 2K00A 3NSUA 3RCPA 4MK0A 2RVBB 1PFJA 4TKNA 2DYQA 3PP2A 2M14A 3PVUA 2DLWA 2Z0PA 1GC6A 2HE7A 2V76A 1GC7A 2KCJA 4A5KA 3SNHA 4DBBA 3KRWA 4TYZA 1KZ7A 4HB4B 3FEHA 2P8VA 3QBVB 3OANA 3MDBC 1W1HA 1SHCA 1TJ6A 1EAZA 2RSGA 4HAYB 2XQNM 4KAXB 3JV3A 3ZDTA 2Z0OA 2RUKB 4DXAB 3D8EA 2DHIA 4K2OA 2COAA 2Q13A 2DX1A 2D9ZA 2DKPA 4C0AA 3PSCA 2Z0QA 1PLSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Q67 A;  2IFS A;  3FSS A;  1MKE A;  3F5R A;  2DX5 A;  2ADZ A;  5CLQ B;  2KR9 A;  3A8Q A;  4A6F B;  1WJ1 A;  3G9W A;  5D27 A;  5EFX A;  1P3R A;  3ZVR A;  5KCV A;  2LKO A;  2DTC A;  3MPX A;  4Z2M B;  4YL8 A;  5JP4 A;  3KRX A;  2ELB A;  4ZRI A;  2LG1 A;  2Y7B A;  1I2H A;  5C6R A;  1EVH A;  1WVH A;  1J19 A;  2VRW B;  3DXE A;  3VIA A;  1NTV A;  1IRS A;  1ISN A;  1W1G A;  2D11 A;  3SYX A;  1X05 A;  1WGU A;  2DN6 A;  4ZRJ A;  3P7Z A;  4F7H A;  3HQC A;  3SO6 A;  5GOW B;  1Y19 B;  2GS0 A;  2VKI A;  5JLJ B;  1U5G A;  2RNR B;  1NI2 A;  2LOZ A;  2R0D A;  2W2W A;  5DI9 B;  3PG7 A;  3F0W A;  2COF A;  1V5M A;  3ML4 A;  1U5E A;  2H7D A;  4Y94 A;  4GYV A;  1UNR A;  4GXB A;  2HTH B;  4DX9 0;  5J3T A;  3TW1 A;  3QWM A;  2K2J A;  1BTN A;  3T06 A;  2PZ1 A;  3N7C A;  5C79 A;  3TO1 A;  5C5B A;  4IOY X;  4KVG B;  4K17 A;  2CY4 A;  4P7I A;  3A8P A;  1KI1 B;  3HW2 B;  5FI0 A;  1AQC A;  2X18 A;  5DHF B;  3D8F A;  5D3W A;  1B55 A;  1U2B A;  1MPH A;  3P6A A;  2DA0 A;  4PNK A;  1BWN A;  3WA0 A;  3TCA A;  4GN1 A;  2N0Y A;  3U8Z A;  1H10 A;  1WJM A;  2UZS A;  5KQ4 A;  1M7E A;  1MIZ B;  1MIX A;  2FJL A;  1BAK A;  4IAP A;  1UEF A;  2EC1 A;  1TXD A;  2YT0 A;  5D3V A;  5FI1 A;  1FHO A;  3VOQ A;  5DHA B;  1V88 A;  4Z2N A;  2VSZ A;  2J59 M;  2H7E A;  2J0M A;  4A6H A;  1LW3 A;  1XX0 A;  1ZVR A;  1OY2 A;  1RRP B;  2D10 A;  1DDW A;  2YSZ A;  4XWX A;  1V5U A;  1U5D A;  1FHW A;  2GCJ A;  2M38 A;  3QIJ A;  1X11 A;  2CAY A;  1XCG A;  1X1F A;  1XR0 B;  1KZG A;  2YS5 A;  1FOE A;  2CRF A;  1X1G A;  1ZSQ A;  1U29 A;  4DX8 A;  5J3Q A;  5HE2 A;  1MK7 B;  1J0W A;  2AEH A;  1WI1 A;  2NMB A;  2DYN A;  4IFS A;  4MT7 A;  3SV1 A;  3D8D A;  4H8S A;  2DFK A;  2N23 A;  2J0K A;  4GPT B;  4NY0 A;  1UPQ A;  1W1D A;  1QQG A;  1FAO A;  2D9V A;  2I1K A;  5JHG A;  1ZM0 A;  3ULC A;  4HB0 B;  2GJY A;  2D9Y A;  2IYB A;  1XOD A;  2RGN B;  1UPR A;  1LB1 A;  2ZPY A;  2G35 A;  2Y8F A;  1ZC4 B;  2YF0 A;  3AU5 A;  2D4Q A;  3LJU X;  3ODW A;  5CLL B;  3M1I B;  2NZ8 B;  4B6H A;  2MDX A;  3BIN A;  1AWE A;  3GYP A;  4MY6 A;  2EMS A;  2UZR A;  3DXC A;  2I1J A;  1XD4 A;  2COC A;  2YS1 A;  4CYE A;  2W2X D;  2DHK A;  1X86 A;  3AJ4 A;  1EGX A;  1V5P A;  5LON B;  2JP2 A;  5DIF B;  2LOX A;  3UZT A;  1NTY A;  4HAT B;  1M7R A;  1DYN A;  4PQ0 A;  1DDM A;  3HK0 A;  4HAV B;  5L81 A;  1QC6 A;  1K5D B;  2RLO A;  3PEG A;  4GMX B;  5HE3 A;  3KSY A;  2YT1 A;  2I5C A;  1UNQ A;  2EMT A;  2YVC A;  1E5W A;  5C5B B;  1ZC3 B;  2P0F A;  1BTK A;  4L6E A;  4YON A;  1N3H A;  1U27 A;  1H4R A;  5DH9 B;  5JHH A;  4ZRK A;  5J3Y A;  1XKE A;  2K2U A;  1GG3 A;  2ELA A;  5D3X A;  1FGY A;  3ODO A;  1UNP A;  1Y5O A;  2L2I A;  3EO2 A;  5KQ1 A;  1FGZ A;  2I5F A;  4A6F A;  4GOU A;  3ODX A;  2D9W A;  3TFM A;  4HB3 B;  2KUP A;  2ROZ B;  4F7G A;  1MAI A;  4EMO A;  1MK9 B;  4CHM A;  3IVF A;  1BY1 A;  2COD A;  3O96 A;  2MFQ A;  1V61 A;  4D0O A;  2LUL A;  1WG7 A;  4GMV A;  1EF1 A;  4HDO A;  2AL6 A;  2QKM A;  1U5F A;  4HDQ A;  2UVM A;  2DKQ A;  2MKR A;  1P6S A;  3FM8 C;  2D2Q A;  1RJ2 A;  3GF9 A;  4F7U P;  4KHA A;  4HAU B;  4HHV A;  4HAX B;  3GYO A;  3WYF B;  3X23 A;  2Y8G A;  1V89 A;  2KGX B;  2L1C A;  2MWN B;  1OMW A;  1Z87 A;  2DHJ A;  1I7A A;  3ULB A;  2LYD A;  3A98 B;  1OQN A;  3BJI A;  2OQB A;  3CIK A;  3CXB B;  2R09 A;  4HAZ B;  2ROV A;  1PMS A;  4HB2 B;  3KY9 A;  1SGH A;  3TVV A;  1DDV A;  4EKU A;  5C16 A;  5D3Y A;  4K81 A;  2YS3 A;  1NU2 A;  4WJ7 A;  3AU4 A;  2D9X A;  4NSW A;  4CHJ A;  2P0D A;  3DXD A;  2P0H A;  4KHB B;  4WSF A;  1FB8 A;  2W2X C;  4A6K A;  3SUZ A;  4D0N B;  5HE0 A;  2QKL A;  2YRY A;  5HE1 A;  3PVW A;  2BCJ A;  1FHX A;  2E2X A;  4EJN A;  1DBH A;  2EJ8 A;  1TQZ A;  2OTX A;  3U7D A;  4KHO A;  1WGQ A;  4HAW B;  5LOP B;  3PZD A;  3PVL A;  1F5X A;  4BBK A;  4K2P A;  2GCL A;  2CY5 A;  3KZ1 A;  1P5T A;  4WVF B;  1K5G B;  4GZU A;  3V5W A;  1DRO A;  2J0J A;  2K00 A;  3NSU A;  3RCP A;  4MK0 A;  2RVB B;  1PFJ A;  4TKN A;  2DYQ A;  3PP2 A;  2M14 A;  3PVU A;  2DLW A;  2Z0P A;  1GC6 A;  2HE7 A;  2V76 A;  1GC7 A;  2KCJ A;  4A5K A;  3SNH A;  4DBB A;  3KRW A;  4TYZ A;  1KZ7 A;  4HB4 B;  3FEH A;  2P8V A;  3QBV B;  3OAN A;  3MDB C;  1W1H A;  1SHC A;  1TJ6 A;  1EAZ A;  2RSG A;  4HAY B;  2XQN M;  4KAX B;  3JV3 A;  3ZDT A;  2Z0O A;  2RUK B;  4DXA B;  3D8E A;  2DHI A;  4K2O A;  2COA A;  2Q13 A;  2DX1 A;  2D9Z A;  2DKP A;  4C0A A;  3PSC A;  2Z0Q A;  1PLS A; 
#chains in the Genus database with same CATH topology
 1Q67 A;  2IFS A;  3FSS A;  1MKE A;  3F5R A;  2DX5 A;  2ADZ A;  5CLQ B;  2KR9 A;  3A8Q A;  4A6F B;  1WJ1 A;  3G9W A;  5D27 A;  5EFX A;  1P3R A;  3ZVR A;  5KCV A;  2LKO A;  2DTC A;  3MPX A;  4Z2M B;  4YL8 A;  5JP4 A;  3KRX A;  2ELB A;  4ZRI A;  2LG1 A;  2Y7B A;  4D6W A;  1I2H A;  5C6R A;  1EVH A;  1WVH A;  1J19 A;  5IRS A;  2VRW B;  2KR0 A;  3DXE A;  3VIA A;  1NTV A;  4QJ4 B;  4QJ3 B;  1IRS A;  1ISN A;  1W1G A;  2D11 A;  3SYX A;  3U12 A;  1X05 A;  1WGU A;  2DN6 A;  4ZRJ A;  3P7Z A;  4F7H A;  3HQC A;  3SO6 A;  2Z14 A;  5GOW B;  1Y19 B;  2GS0 A;  2VKI A;  5JLJ B;  1U5G A;  2RNR B;  1NI2 A;  2LOZ A;  2R0D A;  5I2M A;  2W2W A;  5DI9 B;  3PG7 A;  3F0W A;  2COF A;  1V5M A;  3ML4 A;  1U5E A;  2H7D A;  4Y94 A;  4GYV A;  1UNR A;  4GXB A;  2HTH B;  4DX9 0;  5J3T A;  3TW1 A;  3QWM A;  3DCX A;  2K2J A;  1BTN A;  3T06 A;  2PZ1 A;  3N7C A;  5C79 A;  3TO1 A;  5C5B A;  4IOY X;  4KVG B;  4K17 A;  2CY4 A;  4P7I A;  3A8P A;  1KI1 B;  4QXA B;  3HW2 B;  5FI0 A;  1AQC A;  2X18 A;  5DHF B;  3D8F A;  5D3W A;  1B55 A;  1U2B A;  1MPH A;  3P6A A;  2DA0 A;  4PNK A;  1BWN A;  3WA0 A;  3TCA A;  5M4Y B;  4GN1 A;  2N0Y A;  3U8Z A;  1H10 A;  1WJM A;  2UZS A;  5KQ4 A;  1M7E A;  1MIZ B;  1MIX A;  2FJL A;  1BAK A;  3HIE A;  2FJU B;  4IAP A;  1UEF A;  2EC1 A;  1TXD A;  2YT0 A;  5D3V A;  5FI1 A;  1FHO A;  3VOQ A;  5DHA B;  1V88 A;  4Z2N A;  4CSQ A;  2VSZ A;  2J59 M;  2H7E A;  2J0M A;  4A6H A;  1LW3 A;  1XX0 A;  1ZVR A;  1OY2 A;  1RRP B;  2D10 A;  1DDW A;  2YSZ A;  2R2Y A;  4XWX A;  1V5U A;  1U5D A;  1FHW A;  2Z59 A;  2GCJ A;  2M38 A;  3QIJ A;  1X11 A;  2GUM A;  2CAY A;  1XCG A;  1X1F A;  1XR0 B;  5LG4 B;  1KZG A;  2YS5 A;  1FOE A;  2CRF A;  1X1G A;  1ZSQ A;  1U29 A;  4DX8 A;  5J3Q A;  5HE2 A;  1MK7 B;  1J0W A;  2AEH A;  1WI1 A;  2NMB A;  2DYN A;  4IFS A;  4MT7 A;  3SV1 A;  3D8D A;  4H8S A;  2DFK A;  2K8E A;  2N23 A;  2J0K A;  4GPT B;  4NY0 A;  1UPQ A;  3NWF A;  1W1D A;  2Z13 A;  1QQG A;  1FAO A;  2D9V A;  2I1K A;  5JHG A;  1ZM0 A;  3ULC A;  4HB0 B;  2GJY A;  2D9Y A;  2IYB A;  1XOD A;  4KHB A;  2RGN B;  1UPR A;  1LB1 A;  2ZPY A;  2G35 A;  5I2S A;  2RRF A;  2Y8F A;  1ZC4 B;  2YF0 A;  3AU5 A;  2D4Q A;  2YT2 A;  3LJU X;  3ODW A;  5CLL B;  3M1I B;  2NZ8 B;  4B6H A;  3B77 A;  2MDX A;  3BIN A;  3OHM B;  1AWE A;  3GYP A;  4MY6 A;  2EMS A;  2UZR A;  3DXC A;  2I1J A;  1XD4 A;  2COC A;  2YS1 A;  4CYE A;  2KIG A;  2W2X D;  2DHK A;  1X86 A;  3AJ4 A;  1EGX A;  1V5P A;  5LON B;  2JP2 A;  5DIF B;  2LOX A;  3UZT A;  1NTY A;  4HAT B;  1M7R A;  1DYN A;  3NWD A;  4PQ0 A;  1T77 A;  1DDM A;  3HK0 A;  4HAV B;  5L81 A;  2KIE A;  1QC6 A;  1K5D B;  2RLO A;  3PEG A;  4GMX B;  5HE3 A;  3KSY A;  2YT1 A;  2I5C A;  1UNQ A;  2EMT A;  2YVC A;  1E5W A;  5C5B B;  1ZC3 B;  2P0F A;  1BTK A;  4L6E A;  4YON A;  1N3H A;  1U27 A;  1H4R A;  5DH9 B;  5JHH A;  4ZRK A;  5J3Y A;  1XKE A;  2K2U A;  1GG3 A;  2ELA A;  5D3X A;  4GNK B;  1FGY A;  3ODO A;  1UNP A;  1Y5O A;  2L2I A;  3EO2 A;  5KQ1 A;  1FGZ A;  2I5F A;  4A6F A;  4GOU A;  1ZYI A;  3ODX A;  4HSI A;  2D9W A;  3TFM A;  4HB3 B;  2KUP A;  2ROZ B;  4F7G A;  1MAI A;  4EMO A;  4OT1 A;  1MK9 B;  4CHM A;  3IVF A;  1BY1 A;  4QJ5 B;  2COD A;  3O96 A;  2MFQ A;  1V61 A;  4D0O A;  2LUL A;  1WG7 A;  4GMV A;  1EF1 A;  4HDO A;  3A58 A;  2AL6 A;  2QKM A;  1U5F A;  4HDQ A;  2UVM A;  3HSA A;  2DKQ A;  2MKR A;  3NWA A;  1P6S A;  3FM8 C;  2D2Q A;  1RJ2 A;  3GF9 A;  4F7U P;  4KHA A;  4HAU B;  4HHV A;  4HAX B;  3GYO A;  3WYF B;  3X23 A;  2Y8G A;  1V89 A;  2KGX B;  2L1C A;  2MWN B;  1OMW A;  1Z87 A;  2DHJ A;  1I7A A;  3ULB A;  2LYD A;  3A98 B;  1OQN A;  3BJI A;  2OQB A;  3CIK A;  3CXB B;  2R09 A;  4HAZ B;  2ROV A;  1PMS A;  4HB2 B;  3KY9 A;  1SGH A;  4L1R A;  3TVV A;  1DDV A;  4EKU A;  5C16 A;  5D3Y A;  4K81 A;  2YS3 A;  1NU2 A;  4WJ7 A;  3AU4 A;  2D9X A;  4NSW A;  4CHJ A;  2P0D A;  3DXD A;  2P0H A;  4KHB B;  4WSF A;  1FB8 A;  2W2X C;  4A6K A;  3SUZ A;  4D0N B;  5HE0 A;  2QKL A;  2YRY A;  5HE1 A;  3PVW A;  2BCJ A;  1FHX A;  2E2X A;  4EJN A;  1DBH A;  2EJ8 A;  1TQZ A;  2OTX A;  3U7D A;  4KHO A;  1WGQ A;  4HAW B;  5LOP B;  3PZD A;  3PVL A;  2K49 A;  3FVC A;  1F5X A;  4BBK A;  4K2P A;  2GCL A;  2CY5 A;  3KZ1 A;  1P5T A;  4WVF B;  1K5G B;  4GZU A;  3V5W A;  1DRO A;  2J0J A;  2K00 A;  3NSU A;  3RCP A;  4MK0 A;  2RVB B;  1PFJ A;  4TKN A;  2DYQ A;  3PP2 A;  2M14 A;  2Z4D A;  3PVU A;  2DLW A;  2Z0P A;  1GC6 A;  2HE7 A;  2V76 A;  1GC7 A;  2KCJ A;  3NW8 A;  4DIX A;  4A5K A;  3SNH A;  4DBB A;  3KRW A;  4TYZ A;  1KZ7 A;  4HB4 B;  4OSN A;  3FEH A;  2P8V A;  3QBV B;  3OAN A;  3MDB C;  1W1H A;  1SHC A;  1TJ6 A;  1EAZ A;  2RSG A;  4HAY B;  2XQN M;  4KAX B;  2NBV A;  3JV3 A;  3ZDT A;  2KUQ A;  2Z0O A;  2RUK B;  4DXA B;  3D8E A;  2DHI A;  4K2O A;  2COA A;  2Q13 A;  2DX1 A;  1MI1 A;  2D9Z A;  2DKP A;  2ZKM X;  4C0A A;  3PSC A;  2Z0Q A;  1PLS A; 
#chains in the Genus database with same CATH homology
 1Q67 A;  2IFS A;  3FSS A;  1MKE A;  3F5R A;  2DX5 A;  2ADZ A;  5CLQ B;  2KR9 A;  3A8Q A;  4A6F B;  1WJ1 A;  3G9W A;  5D27 A;  5EFX A;  1P3R A;  3ZVR A;  5KCV A;  2LKO A;  2DTC A;  3MPX A;  4Z2M B;  4YL8 A;  5JP4 A;  3KRX A;  2ELB A;  4ZRI A;  2LG1 A;  2Y7B A;  1I2H A;  5C6R A;  1EVH A;  1WVH A;  1J19 A;  2VRW B;  3DXE A;  3VIA A;  1NTV A;  1IRS A;  1ISN A;  1W1G A;  2D11 A;  3SYX A;  1X05 A;  1WGU A;  2DN6 A;  4ZRJ A;  3P7Z A;  4F7H A;  3HQC A;  3SO6 A;  5GOW B;  1Y19 B;  2GS0 A;  2VKI A;  5JLJ B;  1U5G A;  2RNR B;  1NI2 A;  2LOZ A;  2R0D A;  2W2W A;  5DI9 B;  3PG7 A;  3F0W A;  2COF A;  1V5M A;  3ML4 A;  1U5E A;  2H7D A;  4Y94 A;  4GYV A;  1UNR A;  4GXB A;  2HTH B;  4DX9 0;  5J3T A;  3TW1 A;  3QWM A;  2K2J A;  1BTN A;  3T06 A;  2PZ1 A;  3N7C A;  5C79 A;  3TO1 A;  5C5B A;  4IOY X;  4KVG B;  4K17 A;  2CY4 A;  4P7I A;  3A8P A;  1KI1 B;  3HW2 B;  5FI0 A;  1AQC A;  2X18 A;  5DHF B;  3D8F A;  5D3W A;  1B55 A;  1U2B A;  1MPH A;  3P6A A;  2DA0 A;  4PNK A;  1BWN A;  3WA0 A;  3TCA A;  4GN1 A;  2N0Y A;  3U8Z A;  1H10 A;  1WJM A;  2UZS A;  5KQ4 A;  1M7E A;  1MIZ B;  1MIX A;  2FJL A;  1BAK A;  4IAP A;  1UEF A;  2EC1 A;  1TXD A;  2YT0 A;  5D3V A;  5FI1 A;  1FHO A;  3VOQ A;  5DHA B;  1V88 A;  4Z2N A;  2VSZ A;  2J59 M;  2H7E A;  2J0M A;  4A6H A;  1LW3 A;  1XX0 A;  1ZVR A;  1OY2 A;  1RRP B;  2D10 A;  1DDW A;  2YSZ A;  4XWX A;  1V5U A;  1U5D A;  1FHW A;  2GCJ A;  2M38 A;  3QIJ A;  1X11 A;  2CAY A;  1XCG A;  1X1F A;  1XR0 B;  1KZG A;  2YS5 A;  1FOE A;  2CRF A;  1X1G A;  1ZSQ A;  1U29 A;  4DX8 A;  5J3Q A;  5HE2 A;  1MK7 B;  1J0W A;  2AEH A;  1WI1 A;  2NMB A;  2DYN A;  4IFS A;  4MT7 A;  3SV1 A;  3D8D A;  4H8S A;  2DFK A;  2N23 A;  2J0K A;  4GPT B;  4NY0 A;  1UPQ A;  1W1D A;  1QQG A;  1FAO A;  2D9V A;  2I1K A;  5JHG A;  1ZM0 A;  3ULC A;  4HB0 B;  2GJY A;  2D9Y A;  2IYB A;  1XOD A;  2RGN B;  1UPR A;  1LB1 A;  2ZPY A;  2G35 A;  2Y8F A;  1ZC4 B;  2YF0 A;  3AU5 A;  2D4Q A;  3LJU X;  3ODW A;  5CLL B;  3M1I B;  2NZ8 B;  4B6H A;  2MDX A;  3BIN A;  1AWE A;  3GYP A;  4MY6 A;  2EMS A;  2UZR A;  3DXC A;  2I1J A;  1XD4 A;  2COC A;  2YS1 A;  4CYE A;  2W2X D;  2DHK A;  1X86 A;  3AJ4 A;  1EGX A;  1V5P A;  5LON B;  2JP2 A;  5DIF B;  2LOX A;  3UZT A;  1NTY A;  4HAT B;  1M7R A;  1DYN A;  4PQ0 A;  1DDM A;  3HK0 A;  4HAV B;  5L81 A;  1QC6 A;  1K5D B;  2RLO A;  3PEG A;  4GMX B;  5HE3 A;  3KSY A;  2YT1 A;  2I5C A;  1UNQ A;  2EMT A;  2YVC A;  1E5W A;  5C5B B;  1ZC3 B;  2P0F A;  1BTK A;  4L6E A;  4YON A;  1N3H A;  1U27 A;  1H4R A;  5DH9 B;  5JHH A;  4ZRK A;  5J3Y A;  1XKE A;  2K2U A;  1GG3 A;  2ELA A;  5D3X A;  1FGY A;  3ODO A;  1UNP A;  1Y5O A;  2L2I A;  3EO2 A;  5KQ1 A;  1FGZ A;  2I5F A;  4A6F A;  4GOU A;  3ODX A;  2D9W A;  3TFM A;  4HB3 B;  2KUP A;  2ROZ B;  4F7G A;  1MAI A;  4EMO A;  1MK9 B;  4CHM A;  3IVF A;  1BY1 A;  2COD A;  3O96 A;  2MFQ A;  1V61 A;  4D0O A;  2LUL A;  1WG7 A;  4GMV A;  1EF1 A;  4HDO A;  2AL6 A;  2QKM A;  1U5F A;  4HDQ A;  2UVM A;  2DKQ A;  2MKR A;  1P6S A;  3FM8 C;  2D2Q A;  1RJ2 A;  3GF9 A;  4F7U P;  4KHA A;  4HAU B;  4HHV A;  4HAX B;  3GYO A;  3WYF B;  3X23 A;  2Y8G A;  1V89 A;  2KGX B;  2L1C A;  2MWN B;  1OMW A;  1Z87 A;  2DHJ A;  1I7A A;  3ULB A;  2LYD A;  3A98 B;  1OQN A;  3BJI A;  2OQB A;  3CIK A;  3CXB B;  2R09 A;  4HAZ B;  2ROV A;  1PMS A;  4HB2 B;  3KY9 A;  1SGH A;  3TVV A;  1DDV A;  4EKU A;  5C16 A;  5D3Y A;  4K81 A;  2YS3 A;  1NU2 A;  4WJ7 A;  3AU4 A;  2D9X A;  4NSW A;  4CHJ A;  2P0D A;  3DXD A;  2P0H A;  4KHB B;  4WSF A;  1FB8 A;  2W2X C;  4A6K A;  3SUZ A;  4D0N B;  5HE0 A;  2QKL A;  2YRY A;  5HE1 A;  3PVW A;  2BCJ A;  1FHX A;  2E2X A;  4EJN A;  1DBH A;  2EJ8 A;  1TQZ A;  2OTX A;  3U7D A;  4KHO A;  1WGQ A;  4HAW B;  5LOP B;  3PZD A;  3PVL A;  1F5X A;  4BBK A;  4K2P A;  2GCL A;  2CY5 A;  3KZ1 A;  1P5T A;  4WVF B;  1K5G B;  4GZU A;  3V5W A;  1DRO A;  2J0J A;  2K00 A;  3NSU A;  3RCP A;  4MK0 A;  2RVB B;  1PFJ A;  4TKN A;  2DYQ A;  3PP2 A;  2M14 A;  3PVU A;  2DLW A;  2Z0P A;  1GC6 A;  2HE7 A;  2V76 A;  1GC7 A;  2KCJ A;  4A5K A;  3SNH A;  4DBB A;  3KRW A;  4TYZ A;  1KZ7 A;  4HB4 B;  3FEH A;  2P8V A;  3QBV B;  3OAN A;  3MDB C;  1W1H A;  1SHC A;  1TJ6 A;  1EAZ A;  2RSG A;  4HAY B;  2XQN M;  4KAX B;  3JV3 A;  3ZDT A;  2Z0O A;  2RUK B;  4DXA B;  3D8E A;  2DHI A;  4K2O A;  2COA A;  2Q13 A;  2DX1 A;  2D9Z A;  2DKP A;  4C0A A;  3PSC A;  2Z0Q A;  1PLS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...