1XX0A

Structure of the c-terminal ph domain of human pleckstrin
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
117
structure length
117
Chain Sequence
DVILKEEFRGVIIKQGCLLKQGHRRKNWKVRKFILREDPAYLHYYDPAGAEDPLGAIHLRGCVVTSVESNSNGRKSEEENLFEIITADEVHYFLQAATPKERTEWIKAIQMASRTGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Pleckstrin
publication title Structure and phosphatidylinositol-(3,4)-bisphosphate binding of the C-terminal PH domain of human pleckstrin
pubmed doi rcsb
source organism Homo sapiens
molecule tags Lipid binding protein
total genus 25
structure length 117
sequence length 117
ec nomenclature
pdb deposition date 2004-11-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00169 PH PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1xx0A00
3TW1A 3PEGA 2CY5A 1H4RA 3TFMA 4PNKA 1IRSA 4K17A 1U27A 1X1GA 2D9YA 2D4QA 2Y7BA 4ZRKA 1RJ2A 1UEFA 4HAVB 3ZVRA 4HB0B 2CY4A 5DI9B 3SNHA 4CHMA 3N7CA 3PP2A 1X05A 2DYNA 3QWMA 3TCAA 4K81A 2Q13A 5JLJB 2GJYA 2KUPA 1XODA 3U8ZA 2I5FA 2COFA 1SGHA 2LOZA 2CAYA 3KRXA 4WVFB 2EC1A 1MKEA 1WJ1A 3GYOA 5FI1A 1BTNA 4ZRIA 4F7HA 1V61A 4EJNA 2L1CA 3ULCA 5J3TA 2CODA 1I2HA 2AEHA 1X86A 2EMSA 3WYFB 2YS5A 3WA0A 2NZ8B 3PSCA 3UZTA 1GC6A 4GPTB 4GMVA 2QKMA 3QIJA 1KZ7A 1XX0A 5L81A 1AQCA 2M38A 1WI1A 1OQNA 3M1IB 1TJ6A 2MWNB 3P6AA 1W1DA 4CHJA 5LONB 3SUZA 1PMSA 2GCLA 4NSWA 2RUKB 4BBKA 1DDMA 2RSGA 1H10A 5FI0A 2I5CA 1UPRA 4KHOA 2I1JA 2Y8GA 2CRFA 3RCPA 2I1KA 4A6FB 5HE1A 3D8DA 1U5EA 3X23A 2D9XA 1WVHA 4IAPA 2QKLA 3ODXA 1NTVA 1ISNA 2H7DA 1V5MA 3F5RA 2Z0QA 5GOWB 4DXAB 1W1HA 4A6KA 2RNRB 5D3WA 4Y94A 5CLLB 1B55A 4F7GA 5LOPB 2D9WA 1FOEA 1PFJA 3U7DA 1ZVRA 3HQCA 5CLQB 1NI2A 1MK7B 1P6SA 2FJLA 2D10A 2DHJA 2DA0A 3P7ZA 4B6HA 2RGNB 1DYNA 1U29A 2JP2A 2DHIA 5HE2A 2YS1A 2YVCA 4DX90 4HATB 2L2IA 2ELBA 2P8VA 2G35A 3PVUA 2DKQA 2UZRA 5D27A 1QQGA 2D11A 3CIKA 4Z2MB 1ZM0A 1WGQA 1I7AA 3D8FA 2H7EA 2J0KA 2YF0A 5KQ1A 1XKEA 3VIAA 2P0DA 4C0AA 2MDXA 1NTYA 3FEHA 2XQNM 1UNPA 4Z2NA 4HAUB 4TKNA 3ODWA 3ML4A 5KCVA 5EFXA 1ZSQA 1V5PA 5DH9B 1EF1A 1NU2A 1U2BA 3DXDA 2ELAA 4TYZA 1FGYA 1V88A 3T06A 2V76A 3AU5A 2DX1A 4DBBA 5JHHA 3TVVA 4A5KA 5HE0A 4MK0A 4L6EA 4DX8A 4HB4B 3QBVB 4NY0A 5DHFB 2DYQA 1EGXA 2IFSA 2N0YA 1X11A 4EMOA 2Z0OA 2VSZA 1GC7A 2GS0A 2MFQA 3DXCA 3SYXA 2MKRA 1U5DA 4A6HA 2DKPA 2UZSA 2K00A 2K2JA 1K5GB 3NSUA 1BAKA 5D3XA 1UPQA 2DFKA 2COAA 4IOYX 3D8EA 2VKIA 1FB8A 2COCA 3HK0A 4K2OA 3CXBB 2LULA 1J19A 1FAOA 3SO6A 2EJ8A 4H8SA 2W2XC 2BCJA 3O96A 4HDOA 3V5WA 4HHVA 1AWEA 4HDQA 3PVLA 3ZDTA 1XCGA 3ODOA 1UNRA 4GZUA 3MPXA 3IVFA 1MAIA 1DROA 1WJMA 4HAWB 2YT1A 1V89A 5C6RA 2KGXB 1TXDA 1WGUA 4MY6A 4KHAA 4XWXA 3F0WA 1X1FA 3GYPA 4KAXB 1Y5OA 2R09A 4HAYB 1Y19B 1BTKA 2P0HA 4EKUA 5JP4A 4YONA 1LW3A 1OY2A 2OQBA 4IFSA 1SHCA 2AL6A 3KSYA 1K5DB 1MIZB 4D0NB 5C5BA 2E2XA 1MPHA 2GCJA 1GG3A 1U5FA 3FM8C 1FHWA 1E5WA 2OTXA 2M14A 2D9ZA 1FGZA 2LYDA 1FHXA 1DBHA 1M7RA 1ZC3B 3MDBC 2DX5A 3KRWA 4F7UP 5C16A 2LOXA 3A8PA 3A8QA 1DDWA 3BJIA 4ZRJA 2K2UA 2ROVA 1XR0B 3TO1A 4GMXB 2ROZB 1V5UA 1PLSA 2NMBA 2W2WA 5HE3A 4HB2B 3PG7A 1LB1A 2DHKA 1EVHA 1BWNA 2R0DA 1ZC4B 5JHGA 1XD4A 2ZPYA 1FHOA 2KCJA 2DTCA 1DDVA 3ULBA 1Z87A 1Q67A 2ADZA 4WSFA 4HAZB 4HB3B 3PVWA 5C79A 5J3YA 3DXEA 2W2XD 5D3VA 1P5TA 3KY9A 2J0MA 3OANA 4P7IA 2DLWA 2PZ1A 3FSSA 2X18A 4KVGB 4PQ0A 2YSZA 3AU4A 1U5GA 2UVMA 2YS3A 4YL8A 1N3HA 1J0WA 1TQZA 2DN6A 2HE7A 3A98B 5DIFB 2N23A 1W1GA 1WG7A 1KZGA 2D9VA 3SV1A 2LG1A 2J59M 1M7EA 1MIXA 2P0FA 3HW2B 1RRPB 4KHBB 2EMTA 1QC6A 3G9WA 4WJ7A 1MK9B 1OMWA 4CYEA 1UNQA 5DHAB 3VOQA 2J0JA 5C5BB 2YRYA 3AJ4A 5J3QA 2RLOA 3KZ1A 3LJUX 1KI1B 4K2PA 4A6FA 4GXBA 3PZDA 2VRWB 2Z0PA 4MT7A 2LKOA 2D2QA 2Y8FA 2RVBB 2YT0A 4GN1A 4HAXB 5KQ4A 1P3RA 5D3YA 1EAZA 2IYBA 2HTHB 3BINA
chains in the Genus database with same CATH superfamily
3TW1A 3PEGA 2CY5A 1H4RA 3TFMA 4PNKA 1IRSA 4K17A 1U27A 1X1GA 2D9YA 2D4QA 4QJ3B 2Y7BA 4QXAB 4ZRKA 1RJ2A 1UEFA 4HAVB 3ZVRA 4HB0B 2CY4A 5DI9B 3HIEA 3SNHA 4CHMA 3N7CA 3PP2A 2Z4DA 1X05A 2DYNA 3FVCA 3QWMA 3TCAA 4K81A 2Q13A 5JLJB 2GJYA 2KUPA 1XODA 3U8ZA 2I5FA 2COFA 1SGHA 2LOZA 2CAYA 3KRXA 4WVFB 2EC1A 1MKEA 1WJ1A 3GYOA 5FI1A 1BTNA 4ZRIA 4F7HA 1V61A 4EJNA 2L1CA 3ULCA 5J3TA 2CODA 1I2HA 2AEHA 1X86A 2EMSA 3WYFB 2YS5A 3WA0A 2NZ8B 3PSCA 3UZTA 1GC6A 5LG4B 4GPTB 4GMVA 2QKMA 3QIJA 1KZ7A 1XX0A 5IRSA 5L81A 1AQCA 2M38A 1WI1A 3NW8A 1OQNA 3M1IB 1TJ6A 2MWNB 3P6AA 5M4YB 4OSNA 1W1DA 4CHJA 5LONB 3SUZA 1PMSA 1MI1A 2GCLA 4NSWA 2RUKB 4BBKA 1DDMA 2RSGA 1H10A 3U12A 5FI0A 2I5CA 1UPRA 4KHOA 2I1JA 2Y8GA 5I2MA 2CRFA 3RCPA 2I1KA 4A6FB 5HE1A 3D8DA 1U5EA 3X23A 2D9XA 1WVHA 4IAPA 2QKLA 3ODXA 1NTVA 1ISNA 3DCXA 2H7DA 1V5MA 3F5RA 2Z0QA 5GOWB 2GUMA 4DXAB 1W1HA 4A6KA 2RNRB 5D3WA 4Y94A 5CLLB 1B55A 4F7GA 5LOPB 2D9WA 1FOEA 1PFJA 3U7DA 2KIGA 1ZVRA 3HQCA 5CLQB 1NI2A 1MK7B 1P6SA 2FJLA 2D10A 2DHJA 2DA0A 3P7ZA 4B6HA 2RGNB 1DYNA 1U29A 2JP2A 2DHIA 5HE2A 2YS1A 2YVCA 4DX90 4HATB 2L2IA 2ELBA 2P8VA 2G35A 3PVUA 2DKQA 2UZRA 5D27A 1QQGA 2D11A 3CIKA 4Z2MB 1ZM0A 1WGQA 1I7AA 3D8FA 2H7EA 3NWFA 2J0KA 2YF0A 5KQ1A 1XKEA 4DIXA 3VIAA 2FJUB 2P0DA 4C0AA 2MDXA 1NTYA 3FEHA 2XQNM 1UNPA 4Z2NA 4HAUB 4TKNA 3ODWA 3ML4A 5KCVA 5EFXA 1ZSQA 1V5PA 5DH9B 1EF1A 1NU2A 1U2BA 3DXDA 2ELAA 4TYZA 1FGYA 1V88A 3T06A 2V76A 3AU5A 2DX1A 3B77A 2RRFA 4DBBA 5JHHA 1ZYIA 3TVVA 2Z13A 4A5KA 5HE0A 4MK0A 4L6EA 2Z14A 4GNKB 4DX8A 4HB4B 3QBVB 4NY0A 5DHFB 3A58A 2DYQA 1EGXA 2IFSA 4L1RA 2N0YA 1X11A 4EMOA 2Z0OA 2VSZA 4QJ5B 2Z59A 1GC7A 2GS0A 2MFQA 3DXCA 3SYXA 2MKRA 1U5DA 4A6HA 2DKPA 2UZSA 2K00A 2K2JA 2NBVA 1K5GB 3NSUA 1BAKA 5D3XA 4OT1A 1UPQA 2DFKA 2R2YA 2COAA 2YT2A 4IOYX 3D8EA 2VKIA 1FB8A 2COCA 3HK0A 4K2OA 3CXBB 2LULA 1J19A 1FAOA 3SO6A 2EJ8A 4H8SA 2W2XC 2BCJA 3O96A 4HDOA 3V5WA 2KUQA 4HHVA 1AWEA 4HDQA 3PVLA 3ZDTA 1XCGA 3ODOA 3HSAA 1UNRA 4GZUA 3MPXA 3IVFA 1MAIA 1DROA 1WJMA 4HAWB 2YT1A 1V89A 5C6RA 2KGXB 1TXDA 1WGUA 4MY6A 4KHAA 4XWXA 3NWDA 4HSIA 3F0WA 1T77A 1X1FA 3GYPA 4KAXB 1Y5OA 2R09A 4HAYB 1Y19B 1BTKA 2P0HA 4EKUA 5JP4A 4YONA 1LW3A 1OY2A 2OQBA 4IFSA 1SHCA 2AL6A 3KSYA 1K5DB 1MIZB 4D0NB 5C5BA 2E2XA 1MPHA 2GCJA 1GG3A 1U5FA 3FM8C 1FHWA 1E5WA 2OTXA 4D6WA 2M14A 2D9ZA 1FGZA 2LYDA 1FHXA 1DBHA 1M7RA 1ZC3B 3MDBC 2DX5A 3KRWA 4F7UP 5C16A 2LOXA 3A8PA 3A8QA 1DDWA 2KR0A 3BJIA 4ZRJA 2K2UA 2ROVA 4QJ4B 1XR0B 3TO1A 4GMXB 2ROZB 1V5UA 1PLSA 2NMBA 2W2WA 5HE3A 4GOUA 4CSQA 3OHMB 4HB2B 3PG7A 5I2SA 1LB1A 2DHKA 1EVHA 1BWNA 2R0DA 1ZC4B 5JHGA 1XD4A 2ZPYA 1FHOA 2KCJA 2DTCA 1DDVA 3ULBA 1Z87A 1Q67A 2ADZA 4WSFA 4HAZB 4HB3B 3PVWA 5C79A 5J3YA 3DXEA 3NWAA 2W2XD 5D3VA 2K8EA 1P5TA 3KY9A 2J0MA 3OANA 4P7IA 2DLWA 2PZ1A 3FSSA 2X18A 4KVGB 4PQ0A 2YSZA 3AU4A 1U5GA 2UVMA 2YS3A 4YL8A 2ZKMX 1N3HA 1J0WA 1TQZA 2DN6A 2HE7A 2K49A 3A98B 5DIFB 2N23A 1W1GA 1WG7A 1KZGA 2D9VA 3SV1A 2LG1A 2J59M 1M7EA 1MIXA 2P0FA 3HW2B 1RRPB 4KHBB 2EMTA 1QC6A 3G9WA 2KIEA 4WJ7A 1MK9B 1OMWA 4CYEA 1UNQA 5DHAB 3VOQA 2J0JA 5C5BB 2YRYA 3AJ4A 5J3QA 2RLOA 3KZ1A 4KHBA 3LJUX 1KI1B 4K2PA 4A6FA 4GXBA 3PZDA 2VRWB 2Z0PA 4MT7A 2LKOA 2D2QA 2Y8FA 2RVBB 2YT0A 4GN1A 4HAXB 5KQ4A 1P3RA 5D3YA 1EAZA 2IYBA 2HTHB 3BINA
chains in the Genus database with same CATH topology
3TW1A 3PEGA 2CY5A 1H4RA 3TFMA 4PNKA 1IRSA 4K17A 1U27A 1X1GA 2D9YA 2D4QA 2Y7BA 4ZRKA 1RJ2A 1UEFA 4HAVB 3ZVRA 4HB0B 2CY4A 5DI9B 3SNHA 4CHMA 3N7CA 3PP2A 1X05A 2DYNA 3QWMA 3TCAA 4K81A 2Q13A 5JLJB 2GJYA 2KUPA 1XODA 3U8ZA 2I5FA 2COFA 1SGHA 2LOZA 2CAYA 3KRXA 4WVFB 2EC1A 1MKEA 1WJ1A 3GYOA 5FI1A 1BTNA 4ZRIA 4F7HA 1V61A 4EJNA 2L1CA 3ULCA 5J3TA 2CODA 1I2HA 2AEHA 1X86A 2EMSA 3WYFB 2YS5A 3WA0A 2NZ8B 3PSCA 3UZTA 1GC6A 4GPTB 4GMVA 2QKMA 3QIJA 1KZ7A 1XX0A 5L81A 1AQCA 2M38A 1WI1A 1OQNA 3M1IB 1TJ6A 2MWNB 3P6AA 1W1DA 4CHJA 5LONB 3SUZA 1PMSA 2GCLA 4NSWA 2RUKB 4BBKA 1DDMA 2RSGA 1H10A 5FI0A 2I5CA 1UPRA 4KHOA 2I1JA 2Y8GA 2CRFA 3RCPA 2I1KA 4A6FB 5HE1A 3D8DA 1U5EA 3X23A 2D9XA 1WVHA 4IAPA 2QKLA 3ODXA 1NTVA 1ISNA 2H7DA 1V5MA 3F5RA 2Z0QA 5GOWB 4DXAB 1W1HA 4A6KA 2RNRB 5D3WA 4Y94A 5CLLB 1B55A 4F7GA 5LOPB 2D9WA 1FOEA 1PFJA 3U7DA 1ZVRA 3HQCA 5CLQB 1NI2A 1MK7B 1P6SA 2FJLA 2D10A 2DHJA 2DA0A 3P7ZA 4B6HA 2RGNB 1DYNA 1U29A 2JP2A 2DHIA 5HE2A 2YS1A 2YVCA 4DX90 4HATB 2L2IA 2ELBA 2P8VA 2G35A 3PVUA 2DKQA 2UZRA 5D27A 1QQGA 2D11A 3CIKA 4Z2MB 1ZM0A 1WGQA 1I7AA 3D8FA 2H7EA 2J0KA 2YF0A 5KQ1A 1XKEA 3VIAA 2P0DA 4C0AA 2MDXA 1NTYA 3FEHA 2XQNM 1UNPA 4Z2NA 4HAUB 4TKNA 3ODWA 3ML4A 5KCVA 5EFXA 1ZSQA 1V5PA 5DH9B 1EF1A 1NU2A 1U2BA 3DXDA 2ELAA 4TYZA 1FGYA 1V88A 3T06A 2V76A 3AU5A 2DX1A 4DBBA 5JHHA 3TVVA 4A5KA 5HE0A 4MK0A 4L6EA 4DX8A 4HB4B 3QBVB 4NY0A 5DHFB 2DYQA 1EGXA 2IFSA 2N0YA 1X11A 4EMOA 2Z0OA 2VSZA 1GC7A 2GS0A 2MFQA 3DXCA 3SYXA 2MKRA 1U5DA 4A6HA 2DKPA 2UZSA 2K00A 2K2JA 1K5GB 3NSUA 1BAKA 5D3XA 1UPQA 2DFKA 2COAA 4IOYX 3D8EA 2VKIA 1FB8A 2COCA 3HK0A 4K2OA 3CXBB 2LULA 1J19A 1FAOA 3SO6A 2EJ8A 4H8SA 2W2XC 2BCJA 3O96A 4HDOA 3V5WA 4HHVA 1AWEA 4HDQA 3PVLA 3ZDTA 1XCGA 3ODOA 1UNRA 4GZUA 3MPXA 3IVFA 1MAIA 1DROA 1WJMA 4HAWB 2YT1A 1V89A 5C6RA 2KGXB 1TXDA 1WGUA 4MY6A 4KHAA 4XWXA 3F0WA 1X1FA 3GYPA 4KAXB 1Y5OA 2R09A 4HAYB 1Y19B 1BTKA 2P0HA 4EKUA 5JP4A 4YONA 1LW3A 1OY2A 2OQBA 4IFSA 1SHCA 2AL6A 3KSYA 1K5DB 1MIZB 4D0NB 5C5BA 2E2XA 1MPHA 2GCJA 1GG3A 1U5FA 3FM8C 1FHWA 1E5WA 2OTXA 2M14A 2D9ZA 1FGZA 2LYDA 1FHXA 1DBHA 1M7RA 1ZC3B 3MDBC 2DX5A 3KRWA 4F7UP 5C16A 2LOXA 3A8PA 3A8QA 1DDWA 3BJIA 4ZRJA 2K2UA 2ROVA 1XR0B 3TO1A 4GMXB 2ROZB 1V5UA 1PLSA 2NMBA 2W2WA 5HE3A 4HB2B 3PG7A 1LB1A 2DHKA 1EVHA 1BWNA 2R0DA 1ZC4B 5JHGA 1XD4A 2ZPYA 1FHOA 2KCJA 2DTCA 1DDVA 3ULBA 1Z87A 1Q67A 2ADZA 4WSFA 4HAZB 4HB3B 3PVWA 5C79A 5J3YA 3DXEA 2W2XD 5D3VA 1P5TA 3KY9A 2J0MA 3OANA 4P7IA 2DLWA 2PZ1A 3FSSA 2X18A 4KVGB 4PQ0A 2YSZA 3AU4A 1U5GA 2UVMA 2YS3A 4YL8A 1N3HA 1J0WA 1TQZA 2DN6A 2HE7A 3A98B 5DIFB 2N23A 1W1GA 1WG7A 1KZGA 2D9VA 3SV1A 2LG1A 2J59M 1M7EA 1MIXA 2P0FA 3HW2B 1RRPB 4KHBB 2EMTA 1QC6A 3G9WA 4WJ7A 1MK9B 1OMWA 4CYEA 1UNQA 5DHAB 3VOQA 2J0JA 5C5BB 2YRYA 3AJ4A 5J3QA 2RLOA 3KZ1A 3LJUX 1KI1B 4K2PA 4A6FA 4GXBA 3PZDA 2VRWB 2Z0PA 4MT7A 2LKOA 2D2QA 2Y8FA 2RVBB 2YT0A 4GN1A 4HAXB 5KQ4A 1P3RA 5D3YA 1EAZA 2IYBA 2HTHB 3BINA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TW1 A;  3PEG A;  2CY5 A;  1H4R A;  3TFM A;  4PNK A;  1IRS A;  4K17 A;  1U27 A;  1X1G A;  2D9Y A;  2D4Q A;  2Y7B A;  4ZRK A;  1RJ2 A;  1UEF A;  4HAV B;  3ZVR A;  4HB0 B;  2CY4 A;  5DI9 B;  3SNH A;  4CHM A;  3N7C A;  3PP2 A;  1X05 A;  2DYN A;  3QWM A;  3TCA A;  4K81 A;  2Q13 A;  5JLJ B;  2GJY A;  2KUP A;  1XOD A;  3U8Z A;  2I5F A;  2COF A;  1SGH A;  2LOZ A;  2CAY A;  3KRX A;  4WVF B;  2EC1 A;  1MKE A;  1WJ1 A;  3GYO A;  5FI1 A;  1BTN A;  4ZRI A;  4F7H A;  1V61 A;  4EJN A;  2L1C A;  3ULC A;  5J3T A;  2COD A;  1I2H A;  2AEH A;  1X86 A;  2EMS A;  3WYF B;  2YS5 A;  3WA0 A;  2NZ8 B;  3PSC A;  3UZT A;  1GC6 A;  4GPT B;  4GMV A;  2QKM A;  3QIJ A;  1KZ7 A;  1XX0 A;  5L81 A;  1AQC A;  2M38 A;  1WI1 A;  1OQN A;  3M1I B;  1TJ6 A;  2MWN B;  3P6A A;  1W1D A;  4CHJ A;  5LON B;  3SUZ A;  1PMS A;  2GCL A;  4NSW A;  2RUK B;  4BBK A;  1DDM A;  2RSG A;  1H10 A;  5FI0 A;  2I5C A;  1UPR A;  4KHO A;  2I1J A;  2Y8G A;  2CRF A;  3RCP A;  2I1K A;  4A6F B;  5HE1 A;  3D8D A;  1U5E A;  3X23 A;  2D9X A;  1WVH A;  4IAP A;  2QKL A;  3ODX A;  1NTV A;  1ISN A;  2H7D A;  1V5M A;  3F5R A;  2Z0Q A;  5GOW B;  4DXA B;  1W1H A;  4A6K A;  2RNR B;  5D3W A;  4Y94 A;  5CLL B;  1B55 A;  4F7G A;  5LOP B;  2D9W A;  1FOE A;  1PFJ A;  3U7D A;  1ZVR A;  3HQC A;  5CLQ B;  1NI2 A;  1MK7 B;  1P6S A;  2FJL A;  2D10 A;  2DHJ A;  2DA0 A;  3P7Z A;  4B6H A;  2RGN B;  1DYN A;  1U29 A;  2JP2 A;  2DHI A;  5HE2 A;  2YS1 A;  2YVC A;  4DX9 0;  4HAT B;  2L2I A;  2ELB A;  2P8V A;  2G35 A;  3PVU A;  2DKQ A;  2UZR A;  5D27 A;  1QQG A;  2D11 A;  3CIK A;  4Z2M B;  1ZM0 A;  1WGQ A;  1I7A A;  3D8F A;  2H7E A;  2J0K A;  2YF0 A;  5KQ1 A;  1XKE A;  3VIA A;  2P0D A;  4C0A A;  2MDX A;  1NTY A;  3FEH A;  2XQN M;  1UNP A;  4Z2N A;  4HAU B;  4TKN A;  3ODW A;  3ML4 A;  5KCV A;  5EFX A;  1ZSQ A;  1V5P A;  5DH9 B;  1EF1 A;  1NU2 A;  1U2B A;  3DXD A;  2ELA A;  4TYZ A;  1FGY A;  1V88 A;  3T06 A;  2V76 A;  3AU5 A;  2DX1 A;  4DBB A;  5JHH A;  3TVV A;  4A5K A;  5HE0 A;  4MK0 A;  4L6E A;  4DX8 A;  4HB4 B;  3QBV B;  4NY0 A;  5DHF B;  2DYQ A;  1EGX A;  2IFS A;  2N0Y A;  1X11 A;  4EMO A;  2Z0O A;  2VSZ A;  1GC7 A;  2GS0 A;  2MFQ A;  3DXC A;  3SYX A;  2MKR A;  1U5D A;  4A6H A;  2DKP A;  2UZS A;  2K00 A;  2K2J A;  1K5G B;  3NSU A;  1BAK A;  5D3X A;  1UPQ A;  2DFK A;  2COA A;  4IOY X;  3D8E A;  2VKI A;  1FB8 A;  2COC A;  3HK0 A;  4K2O A;  3CXB B;  2LUL A;  1J19 A;  1FAO A;  3SO6 A;  2EJ8 A;  4H8S A;  2W2X C;  2BCJ A;  3O96 A;  4HDO A;  3V5W A;  4HHV A;  1AWE A;  4HDQ A;  3PVL A;  3ZDT A;  1XCG A;  3ODO A;  1UNR A;  4GZU A;  3MPX A;  3IVF A;  1MAI A;  1DRO A;  1WJM A;  4HAW B;  2YT1 A;  1V89 A;  5C6R A;  2KGX B;  1TXD A;  1WGU A;  4MY6 A;  4KHA A;  4XWX A;  3F0W A;  1X1F A;  3GYP A;  4KAX B;  1Y5O A;  2R09 A;  4HAY B;  1Y19 B;  1BTK A;  2P0H A;  4EKU A;  5JP4 A;  4YON A;  1LW3 A;  1OY2 A;  2OQB A;  4IFS A;  1SHC A;  2AL6 A;  3KSY A;  1K5D B;  1MIZ B;  4D0N B;  5C5B A;  2E2X A;  1MPH A;  2GCJ A;  1GG3 A;  1U5F A;  3FM8 C;  1FHW A;  1E5W A;  2OTX A;  2M14 A;  2D9Z A;  1FGZ A;  2LYD A;  1FHX A;  1DBH A;  1M7R A;  1ZC3 B;  3MDB C;  2DX5 A;  3KRW A;  4F7U P;  5C16 A;  2LOX A;  3A8P A;  3A8Q A;  1DDW A;  3BJI A;  4ZRJ A;  2K2U A;  2ROV A;  1XR0 B;  3TO1 A;  4GMX B;  2ROZ B;  1V5U A;  1PLS A;  2NMB A;  2W2W A;  5HE3 A;  4HB2 B;  3PG7 A;  1LB1 A;  2DHK A;  1EVH A;  1BWN A;  2R0D A;  1ZC4 B;  5JHG A;  1XD4 A;  2ZPY A;  1FHO A;  2KCJ A;  2DTC A;  1DDV A;  3ULB A;  1Z87 A;  1Q67 A;  2ADZ A;  4WSF A;  4HAZ B;  4HB3 B;  3PVW A;  5C79 A;  5J3Y A;  3DXE A;  2W2X D;  5D3V A;  1P5T A;  3KY9 A;  2J0M A;  3OAN A;  4P7I A;  2DLW A;  2PZ1 A;  3FSS A;  2X18 A;  4KVG B;  4PQ0 A;  2YSZ A;  3AU4 A;  1U5G A;  2UVM A;  2YS3 A;  4YL8 A;  1N3H A;  1J0W A;  1TQZ A;  2DN6 A;  2HE7 A;  3A98 B;  5DIF B;  2N23 A;  1W1G A;  1WG7 A;  1KZG A;  2D9V A;  3SV1 A;  2LG1 A;  2J59 M;  1M7E A;  1MIX A;  2P0F A;  3HW2 B;  1RRP B;  4KHB B;  2EMT A;  1QC6 A;  3G9W A;  4WJ7 A;  1MK9 B;  1OMW A;  4CYE A;  1UNQ A;  5DHA B;  3VOQ A;  2J0J A;  5C5B B;  2YRY A;  3AJ4 A;  5J3Q A;  2RLO A;  3KZ1 A;  3LJU X;  1KI1 B;  4K2P A;  4A6F A;  4GXB A;  3PZD A;  2VRW B;  2Z0P A;  4MT7 A;  2LKO A;  2D2Q A;  2Y8F A;  2RVB B;  2YT0 A;  4GN1 A;  4HAX B;  5KQ4 A;  1P3R A;  5D3Y A;  1EAZ A;  2IYB A;  2HTH B;  3BIN A; 
#chains in the Genus database with same CATH topology
 3TW1 A;  3PEG A;  2CY5 A;  1H4R A;  3TFM A;  4PNK A;  1IRS A;  4K17 A;  1U27 A;  1X1G A;  2D9Y A;  2D4Q A;  4QJ3 B;  2Y7B A;  4QXA B;  4ZRK A;  1RJ2 A;  1UEF A;  4HAV B;  3ZVR A;  4HB0 B;  2CY4 A;  5DI9 B;  3HIE A;  3SNH A;  4CHM A;  3N7C A;  3PP2 A;  2Z4D A;  1X05 A;  2DYN A;  3FVC A;  3QWM A;  3TCA A;  4K81 A;  2Q13 A;  5JLJ B;  2GJY A;  2KUP A;  1XOD A;  3U8Z A;  2I5F A;  2COF A;  1SGH A;  2LOZ A;  2CAY A;  3KRX A;  4WVF B;  2EC1 A;  1MKE A;  1WJ1 A;  3GYO A;  5FI1 A;  1BTN A;  4ZRI A;  4F7H A;  1V61 A;  4EJN A;  2L1C A;  3ULC A;  5J3T A;  2COD A;  1I2H A;  2AEH A;  1X86 A;  2EMS A;  3WYF B;  2YS5 A;  3WA0 A;  2NZ8 B;  3PSC A;  3UZT A;  1GC6 A;  5LG4 B;  4GPT B;  4GMV A;  2QKM A;  3QIJ A;  1KZ7 A;  1XX0 A;  5IRS A;  5L81 A;  1AQC A;  2M38 A;  1WI1 A;  3NW8 A;  1OQN A;  3M1I B;  1TJ6 A;  2MWN B;  3P6A A;  5M4Y B;  4OSN A;  1W1D A;  4CHJ A;  5LON B;  3SUZ A;  1PMS A;  1MI1 A;  2GCL A;  4NSW A;  2RUK B;  4BBK A;  1DDM A;  2RSG A;  1H10 A;  3U12 A;  5FI0 A;  2I5C A;  1UPR A;  4KHO A;  2I1J A;  2Y8G A;  5I2M A;  2CRF A;  3RCP A;  2I1K A;  4A6F B;  5HE1 A;  3D8D A;  1U5E A;  3X23 A;  2D9X A;  1WVH A;  4IAP A;  2QKL A;  3ODX A;  1NTV A;  1ISN A;  3DCX A;  2H7D A;  1V5M A;  3F5R A;  2Z0Q A;  5GOW B;  2GUM A;  4DXA B;  1W1H A;  4A6K A;  2RNR B;  5D3W A;  4Y94 A;  5CLL B;  1B55 A;  4F7G A;  5LOP B;  2D9W A;  1FOE A;  1PFJ A;  3U7D A;  2KIG A;  1ZVR A;  3HQC A;  5CLQ B;  1NI2 A;  1MK7 B;  1P6S A;  2FJL A;  2D10 A;  2DHJ A;  2DA0 A;  3P7Z A;  4B6H A;  2RGN B;  1DYN A;  1U29 A;  2JP2 A;  2DHI A;  5HE2 A;  2YS1 A;  2YVC A;  4DX9 0;  4HAT B;  2L2I A;  2ELB A;  2P8V A;  2G35 A;  3PVU A;  2DKQ A;  2UZR A;  5D27 A;  1QQG A;  2D11 A;  3CIK A;  4Z2M B;  1ZM0 A;  1WGQ A;  1I7A A;  3D8F A;  2H7E A;  3NWF A;  2J0K A;  2YF0 A;  5KQ1 A;  1XKE A;  4DIX A;  3VIA A;  2FJU B;  2P0D A;  4C0A A;  2MDX A;  1NTY A;  3FEH A;  2XQN M;  1UNP A;  4Z2N A;  4HAU B;  4TKN A;  3ODW A;  3ML4 A;  5KCV A;  5EFX A;  1ZSQ A;  1V5P A;  5DH9 B;  1EF1 A;  1NU2 A;  1U2B A;  3DXD A;  2ELA A;  4TYZ A;  1FGY A;  1V88 A;  3T06 A;  2V76 A;  3AU5 A;  2DX1 A;  3B77 A;  2RRF A;  4DBB A;  5JHH A;  1ZYI A;  3TVV A;  2Z13 A;  4A5K A;  5HE0 A;  4MK0 A;  4L6E A;  2Z14 A;  4GNK B;  4DX8 A;  4HB4 B;  3QBV B;  4NY0 A;  5DHF B;  3A58 A;  2DYQ A;  1EGX A;  2IFS A;  4L1R A;  2N0Y A;  1X11 A;  4EMO A;  2Z0O A;  2VSZ A;  4QJ5 B;  2Z59 A;  1GC7 A;  2GS0 A;  2MFQ A;  3DXC A;  3SYX A;  2MKR A;  1U5D A;  4A6H A;  2DKP A;  2UZS A;  2K00 A;  2K2J A;  2NBV A;  1K5G B;  3NSU A;  1BAK A;  5D3X A;  4OT1 A;  1UPQ A;  2DFK A;  2R2Y A;  2COA A;  2YT2 A;  4IOY X;  3D8E A;  2VKI A;  1FB8 A;  2COC A;  3HK0 A;  4K2O A;  3CXB B;  2LUL A;  1J19 A;  1FAO A;  3SO6 A;  2EJ8 A;  4H8S A;  2W2X C;  2BCJ A;  3O96 A;  4HDO A;  3V5W A;  2KUQ A;  4HHV A;  1AWE A;  4HDQ A;  3PVL A;  3ZDT A;  1XCG A;  3ODO A;  3HSA A;  1UNR A;  4GZU A;  3MPX A;  3IVF A;  1MAI A;  1DRO A;  1WJM A;  4HAW B;  2YT1 A;  1V89 A;  5C6R A;  2KGX B;  1TXD A;  1WGU A;  4MY6 A;  4KHA A;  4XWX A;  3NWD A;  4HSI A;  3F0W A;  1T77 A;  1X1F A;  3GYP A;  4KAX B;  1Y5O A;  2R09 A;  4HAY B;  1Y19 B;  1BTK A;  2P0H A;  4EKU A;  5JP4 A;  4YON A;  1LW3 A;  1OY2 A;  2OQB A;  4IFS A;  1SHC A;  2AL6 A;  3KSY A;  1K5D B;  1MIZ B;  4D0N B;  5C5B A;  2E2X A;  1MPH A;  2GCJ A;  1GG3 A;  1U5F A;  3FM8 C;  1FHW A;  1E5W A;  2OTX A;  4D6W A;  2M14 A;  2D9Z A;  1FGZ A;  2LYD A;  1FHX A;  1DBH A;  1M7R A;  1ZC3 B;  3MDB C;  2DX5 A;  3KRW A;  4F7U P;  5C16 A;  2LOX A;  3A8P A;  3A8Q A;  1DDW A;  2KR0 A;  3BJI A;  4ZRJ A;  2K2U A;  2ROV A;  4QJ4 B;  1XR0 B;  3TO1 A;  4GMX B;  2ROZ B;  1V5U A;  1PLS A;  2NMB A;  2W2W A;  5HE3 A;  4GOU A;  4CSQ A;  3OHM B;  4HB2 B;  3PG7 A;  5I2S A;  1LB1 A;  2DHK A;  1EVH A;  1BWN A;  2R0D A;  1ZC4 B;  5JHG A;  1XD4 A;  2ZPY A;  1FHO A;  2KCJ A;  2DTC A;  1DDV A;  3ULB A;  1Z87 A;  1Q67 A;  2ADZ A;  4WSF A;  4HAZ B;  4HB3 B;  3PVW A;  5C79 A;  5J3Y A;  3DXE A;  3NWA A;  2W2X D;  5D3V A;  2K8E A;  1P5T A;  3KY9 A;  2J0M A;  3OAN A;  4P7I A;  2DLW A;  2PZ1 A;  3FSS A;  2X18 A;  4KVG B;  4PQ0 A;  2YSZ A;  3AU4 A;  1U5G A;  2UVM A;  2YS3 A;  4YL8 A;  2ZKM X;  1N3H A;  1J0W A;  1TQZ A;  2DN6 A;  2HE7 A;  2K49 A;  3A98 B;  5DIF B;  2N23 A;  1W1G A;  1WG7 A;  1KZG A;  2D9V A;  3SV1 A;  2LG1 A;  2J59 M;  1M7E A;  1MIX A;  2P0F A;  3HW2 B;  1RRP B;  4KHB B;  2EMT A;  1QC6 A;  3G9W A;  2KIE A;  4WJ7 A;  1MK9 B;  1OMW A;  4CYE A;  1UNQ A;  5DHA B;  3VOQ A;  2J0J A;  5C5B B;  2YRY A;  3AJ4 A;  5J3Q A;  2RLO A;  3KZ1 A;  4KHB A;  3LJU X;  1KI1 B;  4K2P A;  4A6F A;  4GXB A;  3PZD A;  2VRW B;  2Z0P A;  4MT7 A;  2LKO A;  2D2Q A;  2Y8F A;  2RVB B;  2YT0 A;  4GN1 A;  4HAX B;  5KQ4 A;  1P3R A;  5D3Y A;  1EAZ A;  2IYB A;  2HTH B;  3BIN A; 
#chains in the Genus database with same CATH homology
 3TW1 A;  3PEG A;  2CY5 A;  1H4R A;  3TFM A;  4PNK A;  1IRS A;  4K17 A;  1U27 A;  1X1G A;  2D9Y A;  2D4Q A;  2Y7B A;  4ZRK A;  1RJ2 A;  1UEF A;  4HAV B;  3ZVR A;  4HB0 B;  2CY4 A;  5DI9 B;  3SNH A;  4CHM A;  3N7C A;  3PP2 A;  1X05 A;  2DYN A;  3QWM A;  3TCA A;  4K81 A;  2Q13 A;  5JLJ B;  2GJY A;  2KUP A;  1XOD A;  3U8Z A;  2I5F A;  2COF A;  1SGH A;  2LOZ A;  2CAY A;  3KRX A;  4WVF B;  2EC1 A;  1MKE A;  1WJ1 A;  3GYO A;  5FI1 A;  1BTN A;  4ZRI A;  4F7H A;  1V61 A;  4EJN A;  2L1C A;  3ULC A;  5J3T A;  2COD A;  1I2H A;  2AEH A;  1X86 A;  2EMS A;  3WYF B;  2YS5 A;  3WA0 A;  2NZ8 B;  3PSC A;  3UZT A;  1GC6 A;  4GPT B;  4GMV A;  2QKM A;  3QIJ A;  1KZ7 A;  1XX0 A;  5L81 A;  1AQC A;  2M38 A;  1WI1 A;  1OQN A;  3M1I B;  1TJ6 A;  2MWN B;  3P6A A;  1W1D A;  4CHJ A;  5LON B;  3SUZ A;  1PMS A;  2GCL A;  4NSW A;  2RUK B;  4BBK A;  1DDM A;  2RSG A;  1H10 A;  5FI0 A;  2I5C A;  1UPR A;  4KHO A;  2I1J A;  2Y8G A;  2CRF A;  3RCP A;  2I1K A;  4A6F B;  5HE1 A;  3D8D A;  1U5E A;  3X23 A;  2D9X A;  1WVH A;  4IAP A;  2QKL A;  3ODX A;  1NTV A;  1ISN A;  2H7D A;  1V5M A;  3F5R A;  2Z0Q A;  5GOW B;  4DXA B;  1W1H A;  4A6K A;  2RNR B;  5D3W A;  4Y94 A;  5CLL B;  1B55 A;  4F7G A;  5LOP B;  2D9W A;  1FOE A;  1PFJ A;  3U7D A;  1ZVR A;  3HQC A;  5CLQ B;  1NI2 A;  1MK7 B;  1P6S A;  2FJL A;  2D10 A;  2DHJ A;  2DA0 A;  3P7Z A;  4B6H A;  2RGN B;  1DYN A;  1U29 A;  2JP2 A;  2DHI A;  5HE2 A;  2YS1 A;  2YVC A;  4DX9 0;  4HAT B;  2L2I A;  2ELB A;  2P8V A;  2G35 A;  3PVU A;  2DKQ A;  2UZR A;  5D27 A;  1QQG A;  2D11 A;  3CIK A;  4Z2M B;  1ZM0 A;  1WGQ A;  1I7A A;  3D8F A;  2H7E A;  2J0K A;  2YF0 A;  5KQ1 A;  1XKE A;  3VIA A;  2P0D A;  4C0A A;  2MDX A;  1NTY A;  3FEH A;  2XQN M;  1UNP A;  4Z2N A;  4HAU B;  4TKN A;  3ODW A;  3ML4 A;  5KCV A;  5EFX A;  1ZSQ A;  1V5P A;  5DH9 B;  1EF1 A;  1NU2 A;  1U2B A;  3DXD A;  2ELA A;  4TYZ A;  1FGY A;  1V88 A;  3T06 A;  2V76 A;  3AU5 A;  2DX1 A;  4DBB A;  5JHH A;  3TVV A;  4A5K A;  5HE0 A;  4MK0 A;  4L6E A;  4DX8 A;  4HB4 B;  3QBV B;  4NY0 A;  5DHF B;  2DYQ A;  1EGX A;  2IFS A;  2N0Y A;  1X11 A;  4EMO A;  2Z0O A;  2VSZ A;  1GC7 A;  2GS0 A;  2MFQ A;  3DXC A;  3SYX A;  2MKR A;  1U5D A;  4A6H A;  2DKP A;  2UZS A;  2K00 A;  2K2J A;  1K5G B;  3NSU A;  1BAK A;  5D3X A;  1UPQ A;  2DFK A;  2COA A;  4IOY X;  3D8E A;  2VKI A;  1FB8 A;  2COC A;  3HK0 A;  4K2O A;  3CXB B;  2LUL A;  1J19 A;  1FAO A;  3SO6 A;  2EJ8 A;  4H8S A;  2W2X C;  2BCJ A;  3O96 A;  4HDO A;  3V5W A;  4HHV A;  1AWE A;  4HDQ A;  3PVL A;  3ZDT A;  1XCG A;  3ODO A;  1UNR A;  4GZU A;  3MPX A;  3IVF A;  1MAI A;  1DRO A;  1WJM A;  4HAW B;  2YT1 A;  1V89 A;  5C6R A;  2KGX B;  1TXD A;  1WGU A;  4MY6 A;  4KHA A;  4XWX A;  3F0W A;  1X1F A;  3GYP A;  4KAX B;  1Y5O A;  2R09 A;  4HAY B;  1Y19 B;  1BTK A;  2P0H A;  4EKU A;  5JP4 A;  4YON A;  1LW3 A;  1OY2 A;  2OQB A;  4IFS A;  1SHC A;  2AL6 A;  3KSY A;  1K5D B;  1MIZ B;  4D0N B;  5C5B A;  2E2X A;  1MPH A;  2GCJ A;  1GG3 A;  1U5F A;  3FM8 C;  1FHW A;  1E5W A;  2OTX A;  2M14 A;  2D9Z A;  1FGZ A;  2LYD A;  1FHX A;  1DBH A;  1M7R A;  1ZC3 B;  3MDB C;  2DX5 A;  3KRW A;  4F7U P;  5C16 A;  2LOX A;  3A8P A;  3A8Q A;  1DDW A;  3BJI A;  4ZRJ A;  2K2U A;  2ROV A;  1XR0 B;  3TO1 A;  4GMX B;  2ROZ B;  1V5U A;  1PLS A;  2NMB A;  2W2W A;  5HE3 A;  4HB2 B;  3PG7 A;  1LB1 A;  2DHK A;  1EVH A;  1BWN A;  2R0D A;  1ZC4 B;  5JHG A;  1XD4 A;  2ZPY A;  1FHO A;  2KCJ A;  2DTC A;  1DDV A;  3ULB A;  1Z87 A;  1Q67 A;  2ADZ A;  4WSF A;  4HAZ B;  4HB3 B;  3PVW A;  5C79 A;  5J3Y A;  3DXE A;  2W2X D;  5D3V A;  1P5T A;  3KY9 A;  2J0M A;  3OAN A;  4P7I A;  2DLW A;  2PZ1 A;  3FSS A;  2X18 A;  4KVG B;  4PQ0 A;  2YSZ A;  3AU4 A;  1U5G A;  2UVM A;  2YS3 A;  4YL8 A;  1N3H A;  1J0W A;  1TQZ A;  2DN6 A;  2HE7 A;  3A98 B;  5DIF B;  2N23 A;  1W1G A;  1WG7 A;  1KZG A;  2D9V A;  3SV1 A;  2LG1 A;  2J59 M;  1M7E A;  1MIX A;  2P0F A;  3HW2 B;  1RRP B;  4KHB B;  2EMT A;  1QC6 A;  3G9W A;  4WJ7 A;  1MK9 B;  1OMW A;  4CYE A;  1UNQ A;  5DHA B;  3VOQ A;  2J0J A;  5C5B B;  2YRY A;  3AJ4 A;  5J3Q A;  2RLO A;  3KZ1 A;  3LJU X;  1KI1 B;  4K2P A;  4A6F A;  4GXB A;  3PZD A;  2VRW B;  2Z0P A;  4MT7 A;  2LKO A;  2D2Q A;  2Y8F A;  2RVB B;  2YT0 A;  4GN1 A;  4HAX B;  5KQ4 A;  1P3R A;  5D3Y A;  1EAZ A;  2IYB A;  2HTH B;  3BIN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...