1XX0A

Structure of the c-terminal ph domain of human pleckstrin
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
117
structure length
117
Chain Sequence
DVILKEEFRGVIIKQGCLLKQGHRRKNWKVRKFILREDPAYLHYYDPAGAEDPLGAIHLRGCVVTSVESNSNGRKSEEENLFEIITADEVHYFLQAATPKERTEWIKAIQMASRTGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure and phosphatidylinositol-(3,4)-bisphosphate binding of the C-terminal PH domain of human pleckstrin
pubmed doi rcsb
source organism Homo sapiens
molecule tags Lipid binding protein
molecule keywords Pleckstrin
total genus 25
structure length 117
sequence length 117
ec nomenclature
pdb deposition date 2004-11-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00169 PH PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1xx0A00
5HE2A 3SUZA 2K00A 2H7DA 1NTVA 5CLQB 3U7DA 5DI9B 1ZM0A 4K2OA 3QWMA 2YVCA 2LG1A 3M1IB 3A8PA 3KZ1A 2RNRB 2COAA 1U5FA 3TVVA 2OTXA 3A98B 3SV1A 5C5BA 4A6FB 2ZPYA 4MT7A 4GMVA 2J0JA 1UNQA 4Z2MB 1DBHA 5D27A 1GG3A 3MDBC 3ODOA 2V76A 4TYZA 3PP2A 4GZUA 2AEHA 3HK0A 1KI1B 4NSWA 1X11A 2YS5A 2LOXA 1V5PA 4TKNA 2KUPA 4Z2NA 1NI2A 4A6KA 1FGYA 4WJ7A 2COFA 3KRXA 1FGZA 4KHBB 2ELAA 1MIXA 1U5EA 2D10A 3NSUA 1TQZA 4GXBA 3DXDA 2CY4A 2J0MA 3KY9A 1OY2A 1X1GA 2CY5A 1V5UA 1V5MA 3N7CA 5L81A 5KCVA 2K2UA 4C0AA 1RRPB 1KZ7A 1UPRA 4GPTB 2MWNB 2W2XD 2XQNM 2RVBB 3U8ZA 2Y7BA 2RSGA 2DYNA 4EMOA 4DBBA 1MPHA 5DH9B 3PEGA 1WJ1A 5DHFB 3O96A 3TFMA 1NTYA 4PNKA 4WSFA 2DFKA 4GN1A 4CHJA 2YF0A 1XD4A 4EJNA 1V61A 1BAKA 3BINA 3QIJA 4HB0B 1ZC4B 1ZC3B 2AL6A 3QBVB 1Y5OA 3SNHA 4HAUB 1OMWA 2ROVA 2EJ8A 1BTNA 5GOWB 1XX0A 4F7UP 3F0WA 3GYPA 5DHAB 2D2QA 1EAZA 3SYXA 4D0NB 3ULBA 1BTKA 1P3RA 2X18A 4HB3B 2L1CA 4EKUA 5J3TA 1EF1A 2D4QA 2E2XA 2LYDA 1WGQA 1MK9B 1MK7B 2DHIA 2KCJA 3D8DA 1N3HA 3WYFB 2YRYA 3PVLA 2D9WA 1DDVA 3P6AA 3LJUX 3TCAA 1QC6A 1UNPA 4HDQA 2UVMA 3P7ZA 1QQGA 2QKLA 2NMBA 3CXBB 4MY6A 1H4RA 4CHMA 5KQ4A 1ZVRA 4K17A 4HAYB 5HE3A 1X05A 4DX8A 4ZRKA 1MAIA 2GJYA 5J3QA 1EVHA 1U29A 1ISNA 1LB1A 4Y94A 4NY0A 3VOQA 1FAOA 2I5FA 5FI1A 2D9YA 1RJ2A 3AU5A 1W1DA 2Z0PA 4BBKA 3FSSA 4IAPA 3DXEA 1WJMA 4KVGB 3G9WA 2P0DA 3CIKA 2EC1A 3ZDTA 2YT0A 2CAYA 5JHHA 2LKOA 5JP4A 3UZTA 2DYQA 4HHVA 1TXDA 2I1KA 1I7AA 4CYEA 3T06A 2H7EA 2D9XA 3F5RA 4YL8A 1PFJA 2Y8FA 5C6RA 2W2XC 4K81A 2I5CA 5D3VA 1U5DA 1NU2A 1U5GA 4KHOA 1PLSA 1UEFA 1K5DB 1DDWA 2EMSA 3VIAA 5HE1A 2DX5A 1GC7A 4HAXB 2YS1A 1GC6A 5C16A 1OQNA 4HAZB 4IFSA 5D3XA 2YT1A 4HDOA 1U2BA 2ROZB 4A5KA 3PVWA 3BJIA 2R09A 2MKRA 2DKQA 2P8VA 3OANA 1UNRA 2D11A 1DYNA 1E5WA 2MFQA 5J3YA 1FHXA 2BCJA 2DA0A 2Z0OA 2J59M 1WVHA 2DX1A 1W1HA 2RGNB 4HAWB 5C5BB 2N23A 1J0WA 3PSCA 2N0YA 2VKIA 1Q67A 2Q13A 1X86A 3AJ4A 3TO1A 1ZSQA 3TW1A 2RUKB 2DN6A 4ZRJA 1FOEA 2IFSA 1DROA 3ODXA 3PZDA 4L6EA 1WG7A 1W1GA 3SO6A 1X1FA 2K2JA 1M7EA 2J0KA 1V88A 4IOYX 2P0FA 4MK0A 2G35A 3A8QA 4H8SA 1UPQA 1H10A 2I1JA 2OQBA 2L2IA 2LULA 1K5GB 4DX90 4A6HA 5CLLB 1SGHA 5JHGA 4KHAA 2VRWB 1Y19B 2ELBA 2M38A 4A6FA 2DTCA 3FM8C 3GYOA 3AU4A 1P5TA 2DHJA 2YSZA 4WVFB 1TJ6A 3X23A 3D8EA 5LONB 1WGUA 5D3YA 2CRFA 3D8FA 4HAVB 3HQCA 2GS0A 2UZSA 2M14A 4YONA 5EFXA 4DXAB 3ODWA 3RCPA 1LW3A 3PVUA 1P6SA 3FEHA 2Y8GA 2DHKA 3HW2B 3ML4A 3ULCA 1B55A 3IVFA 1FHOA 4F7HA 4ZRIA 2QKMA 2KGXB 2YS3A 2Z0QA 5LOPB 1AQCA 1EGXA 2DKPA 1V89A 5DIFB 3KSYA 5C79A 4F7GA 1WI1A 2R0DA 1FHWA 2D9VA 4PQ0A 1IRSA 2JP2A 2NZ8B 2IYBA 4GMXB 1Z87A 2GCJA 2GCLA 1DDMA 2FJLA 2LOZA 3PG7A 1MKEA 2PZ1A 1XODA 2COCA 1U27A 2MDXA 1PMSA 5JLJB 5D3WA 2DLWA 4HB4B 2HE7A 3DXCA 1XR0B 3ZVRA 1MIZB 1I2HA 2P0HA 1XKEA 4P7IA 1J19A 3WA0A 2EMTA 4K2PA 1BWNA 1FB8A 3KRWA 2UZRA 2ADZA 5FI0A 3MPXA 5KQ1A 4KAXB 2CODA 2HTHB 1SHCA 2W2WA 4XWXA 1AWEA 2D9ZA 2VSZA 1M7RA 2RLOA 5HE0A 4B6HA 1KZGA 1XCGA 4HB2B 3V5WA 4HATB
chains in the Genus database with same CATH superfamily
5HE2A 3SUZA 2K00A 2H7DA 1NTVA 5CLQB 3U7DA 5DI9B 1ZM0A 4K2OA 1ZYIA 3QWMA 2YVCA 3NW8A 2LG1A 3M1IB 3A8PA 3KZ1A 2Z4DA 2RNRB 2COAA 1U5FA 3TVVA 2OTXA 3A98B 3SV1A 5C5BA 4A6FB 2ZPYA 4MT7A 4GMVA 2J0JA 1UNQA 4Z2MB 2GUMA 4GOUA 1DBHA 5D27A 1GG3A 3MDBC 3ODOA 2V76A 4TYZA 3PP2A 4GZUA 2AEHA 3HK0A 1KI1B 4NSWA 1X11A 2YS5A 2LOXA 1V5PA 4TKNA 2KUPA 4Z2NA 1NI2A 4A6KA 1FGYA 4WJ7A 2COFA 4QJ4B 3KRXA 1FGZA 4KHBB 2ELAA 1MIXA 1U5EA 2D10A 3NSUA 1TQZA 4GXBA 3DXDA 2CY4A 3KY9A 1OY2A 1X1GA 2CY5A 1V5UA 1V5MA 3N7CA 5L81A 5KCVA 2K2UA 4C0AA 1RRPB 1KZ7A 1UPRA 4GPTB 2MWNB 2W2XD 2XQNM 2RVBB 3U8ZA 2Y7BA 2RSGA 2DYNA 4EMOA 2FJUB 4DBBA 1MPHA 5DH9B 3B77A 3PEGA 1WJ1A 5DHFB 3O96A 3TFMA 2KUQA 1NTYA 4PNKA 4WSFA 2DFKA 4GN1A 3HIEA 4CHJA 2YF0A 1XD4A 4EJNA 1V61A 1BAKA 3BINA 3QIJA 4HB0B 1ZC4B 1ZC3B 2AL6A 3QBVB 1Y5OA 3SNHA 4HAUB 1OMWA 2ROVA 2EJ8A 1BTNA 5I2MA 5GOWB 1XX0A 4F7UP 3F0WA 3GYPA 5DHAB 2D2QA 1EAZA 3SYXA 4D0NB 3ULBA 1BTKA 1P3RA 2X18A 4HB3B 2L1CA 4EKUA 5J3TA 1EF1A 2D4QA 2E2XA 2LYDA 1WGQA 1MK9B 1MK7B 2DHIA 2KCJA 3D8DA 1N3HA 3WYFB 2YRYA 2KIGA 5IRSA 3PVLA 2D9WA 1DDVA 3P6AA 3LJUX 3TCAA 1QC6A 1UNPA 3P7ZA 2UVMA 4HDQA 3NWAA 1QQGA 2QKLA 1MI1A 2NMBA 3CXBB 2K8EA 3DCXA 4MY6A 1H4RA 4CHMA 5KQ4A 4D6WA 1ZVRA 4K17A 4HAYB 5HE3A 1X05A 4DX8A 4ZRKA 1MAIA 2GJYA 5J3QA 1EVHA 1U29A 1ISNA 1LB1A 4Y94A 4NY0A 3VOQA 1FAOA 2YT2A 2I5FA 5FI1A 2D9YA 1RJ2A 3AU5A 1W1DA 2Z0PA 4BBKA 5LG4B 3FSSA 4IAPA 3DXEA 1WJMA 4KVGB 3G9WA 2P0DA 3CIKA 2EC1A 3ZDTA 2YT0A 2CAYA 2KIEA 5JHHA 2LKOA 5JP4A 3UZTA 2DYQA 4HHVA 1TXDA 2KR0A 2I1KA 1I7AA 4CYEA 3T06A 2H7EA 2D9XA 3F5RA 4YL8A 4OT1A 1PFJA 4QJ3B 2Y8FA 5C6RA 2W2XC 4K81A 4KHBA 2I5CA 5D3VA 1U5DA 1NU2A 1U5GA 4KHOA 1PLSA 1UEFA 3A58A 1K5DB 4OSNA 1DDWA 2EMSA 3U12A 3VIAA 5HE1A 2DX5A 1GC7A 4HAXB 2YS1A 1GC6A 4HSIA 5C16A 1OQNA 4HAZB 4IFSA 5D3XA 2YT1A 4HDOA 1U2BA 2ROZB 4A5KA 2K49A 3PVWA 4DIXA 3BJIA 2R09A 2MKRA 2DKQA 2P8VA 3OANA 1UNRA 2D11A 1DYNA 1E5WA 2MFQA 5J3YA 1FHXA 2BCJA 2DA0A 2Z0OA 2J59M 1WVHA 2DX1A 1W1HA 2RGNB 4HAWB 5C5BB 2N23A 3NWFA 1J0WA 3PSCA 2N0YA 2VKIA 1Q67A 2Q13A 1X86A 3AJ4A 3TO1A 2Z59A 1ZSQA 3TW1A 2RUKB 2DN6A 2NBVA 4ZRJA 1FOEA 2IFSA 1DROA 3ODXA 3PZDA 4L6EA 5I2SA 1WG7A 1W1GA 3SO6A 1X1FA 2K2JA 1M7EA 2J0KA 1V88A 4IOYX 2P0FA 4MK0A 2G35A 3A8QA 4H8SA 1UPQA 2Z13A 4HATB 1H10A 2I1JA 2OQBA 2L2IA 2LULA 1K5GB 4DX90 4A6HA 5CLLB 4QXAB 1SGHA 5JHGA 4KHAA 2VRWB 1Y19B 2ELBA 2M38A 4A6FA 2DTCA 3FM8C 3GYOA 3AU4A 1P5TA 2DHJA 2YSZA 4WVFB 1TJ6A 3X23A 3D8EA 5LONB 2R2YA 1WGUA 5D3YA 4GNKB 2CRFA 3D8FA 4HAVB 3HQCA 4L1RA 2GS0A 2UZSA 2M14A 4YONA 5EFXA 4DXAB 3ODWA 3RCPA 1LW3A 3PVUA 1P6SA 3FEHA 2Y8GA 2DHKA 3HW2B 3ML4A 4CSQA 3FVCA 2Z14A 3ULCA 1B55A 3IVFA 1FHOA 4F7HA 4ZRIA 2QKMA 3OHMB 2KGXB 2YS3A 2Z0QA 5LOPB 1AQCA 1EGXA 2DKPA 1V89A 5DIFB 3KSYA 5C79A 4F7GA 1WI1A 2R0DA 1FHWA 2D9VA 4PQ0A 1IRSA 2JP2A 2NZ8B 2IYBA 4GMXB 1Z87A 2GCJA 2GCLA 1DDMA 2FJLA 2LOZA 3PG7A 2ZKMX 1MKEA 4QJ5B 2PZ1A 1XODA 2COCA 1U27A 2MDXA 1PMSA 5JLJB 3HSAA 5D3WA 2DLWA 4HB4B 2HE7A 3DXCA 1XR0B 3ZVRA 1MIZB 1I2HA 2P0HA 1XKEA 4P7IA 1J19A 3WA0A 1T77A 2EMTA 4K2PA 1BWNA 1FB8A 3NWDA 3KRWA 2UZRA 2ADZA 5FI0A 3MPXA 5KQ1A 4KAXB 2CODA 2HTHB 1SHCA 2W2WA 4XWXA 2RRFA 1AWEA 2D9ZA 2VSZA 1M7RA 2RLOA 5HE0A 4B6HA 5M4YB 1KZGA 1XCGA 4HB2B 3V5WA 2J0MA
chains in the Genus database with same CATH topology
5HE2A 3SUZA 2K00A 2H7DA 1NTVA 5CLQB 3U7DA 5DI9B 1ZM0A 4K2OA 3QWMA 2YVCA 2LG1A 3M1IB 3A8PA 3KZ1A 2RNRB 2COAA 1U5FA 3TVVA 2OTXA 3A98B 3SV1A 5C5BA 4A6FB 2ZPYA 4MT7A 4GMVA 2J0JA 1UNQA 4Z2MB 1DBHA 5D27A 1GG3A 3MDBC 3ODOA 2V76A 4TYZA 3PP2A 4GZUA 2AEHA 3HK0A 1KI1B 4NSWA 1X11A 2YS5A 2LOXA 1V5PA 4TKNA 2KUPA 4Z2NA 1NI2A 4A6KA 1FGYA 4WJ7A 2COFA 3KRXA 1FGZA 4KHBB 2ELAA 1MIXA 1U5EA 2D10A 3NSUA 1TQZA 4GXBA 3DXDA 2CY4A 2J0MA 3KY9A 1OY2A 1X1GA 2CY5A 1V5UA 1V5MA 3N7CA 5L81A 5KCVA 2K2UA 4C0AA 1RRPB 1KZ7A 1UPRA 4GPTB 2MWNB 2W2XD 2XQNM 2RVBB 3U8ZA 2Y7BA 2RSGA 2DYNA 4EMOA 4DBBA 1MPHA 5DH9B 3PEGA 1WJ1A 5DHFB 3O96A 3TFMA 1NTYA 4PNKA 4WSFA 2DFKA 4GN1A 4CHJA 2YF0A 1XD4A 4EJNA 1V61A 1BAKA 3BINA 3QIJA 4HB0B 1ZC4B 1ZC3B 2AL6A 3QBVB 1Y5OA 3SNHA 4HAUB 1OMWA 2ROVA 2EJ8A 1BTNA 5GOWB 1XX0A 4F7UP 3F0WA 3GYPA 5DHAB 2D2QA 1EAZA 3SYXA 4D0NB 3ULBA 1BTKA 1P3RA 2X18A 4HB3B 2L1CA 4EKUA 5J3TA 1EF1A 2D4QA 2E2XA 2LYDA 1WGQA 1MK9B 1MK7B 2DHIA 2KCJA 3D8DA 1N3HA 3WYFB 2YRYA 3PVLA 2D9WA 1DDVA 3P6AA 3LJUX 3TCAA 1QC6A 1UNPA 4HDQA 2UVMA 3P7ZA 1QQGA 2QKLA 2NMBA 3CXBB 4MY6A 1H4RA 4CHMA 5KQ4A 1ZVRA 4K17A 4HAYB 5HE3A 1X05A 4DX8A 4ZRKA 1MAIA 2GJYA 5J3QA 1EVHA 1U29A 1ISNA 1LB1A 4Y94A 4NY0A 3VOQA 1FAOA 2I5FA 5FI1A 2D9YA 1RJ2A 3AU5A 1W1DA 2Z0PA 4BBKA 3FSSA 4IAPA 3DXEA 1WJMA 4KVGB 3G9WA 2P0DA 3CIKA 2EC1A 3ZDTA 2YT0A 2CAYA 5JHHA 2LKOA 5JP4A 3UZTA 2DYQA 4HHVA 1TXDA 2I1KA 1I7AA 4CYEA 3T06A 2H7EA 2D9XA 3F5RA 4YL8A 1PFJA 2Y8FA 5C6RA 2W2XC 4K81A 2I5CA 5D3VA 1U5DA 1NU2A 1U5GA 4KHOA 1PLSA 1UEFA 1K5DB 1DDWA 2EMSA 3VIAA 5HE1A 2DX5A 1GC7A 4HAXB 2YS1A 1GC6A 5C16A 1OQNA 4HAZB 4IFSA 5D3XA 2YT1A 4HDOA 1U2BA 2ROZB 4A5KA 3PVWA 3BJIA 2R09A 2MKRA 2DKQA 2P8VA 3OANA 1UNRA 2D11A 1DYNA 1E5WA 2MFQA 5J3YA 1FHXA 2BCJA 2DA0A 2Z0OA 2J59M 1WVHA 2DX1A 1W1HA 2RGNB 4HAWB 5C5BB 2N23A 1J0WA 3PSCA 2N0YA 2VKIA 1Q67A 2Q13A 1X86A 3AJ4A 3TO1A 1ZSQA 3TW1A 2RUKB 2DN6A 4ZRJA 1FOEA 2IFSA 1DROA 3ODXA 3PZDA 4L6EA 1WG7A 1W1GA 3SO6A 1X1FA 2K2JA 1M7EA 2J0KA 1V88A 4IOYX 2P0FA 4MK0A 2G35A 3A8QA 4H8SA 1UPQA 1H10A 2I1JA 2OQBA 2L2IA 2LULA 1K5GB 4DX90 4A6HA 5CLLB 1SGHA 5JHGA 4KHAA 2VRWB 1Y19B 2ELBA 2M38A 4A6FA 2DTCA 3FM8C 3GYOA 3AU4A 1P5TA 2DHJA 2YSZA 4WVFB 1TJ6A 3X23A 3D8EA 5LONB 1WGUA 5D3YA 2CRFA 3D8FA 4HAVB 3HQCA 2GS0A 2UZSA 2M14A 4YONA 5EFXA 4DXAB 3ODWA 3RCPA 1LW3A 3PVUA 1P6SA 3FEHA 2Y8GA 2DHKA 3HW2B 3ML4A 3ULCA 1B55A 3IVFA 1FHOA 4F7HA 4ZRIA 2QKMA 2KGXB 2YS3A 2Z0QA 5LOPB 1AQCA 1EGXA 2DKPA 1V89A 5DIFB 3KSYA 5C79A 4F7GA 1WI1A 2R0DA 1FHWA 2D9VA 4PQ0A 1IRSA 2JP2A 2NZ8B 2IYBA 4GMXB 1Z87A 2GCJA 2GCLA 1DDMA 2FJLA 2LOZA 3PG7A 1MKEA 2PZ1A 1XODA 2COCA 1U27A 2MDXA 1PMSA 5JLJB 5D3WA 2DLWA 4HB4B 2HE7A 3DXCA 1XR0B 3ZVRA 1MIZB 1I2HA 2P0HA 1XKEA 4P7IA 1J19A 3WA0A 2EMTA 4K2PA 1BWNA 1FB8A 3KRWA 2UZRA 2ADZA 5FI0A 3MPXA 5KQ1A 4KAXB 2CODA 2HTHB 1SHCA 2W2WA 4XWXA 1AWEA 2D9ZA 2VSZA 1M7RA 2RLOA 5HE0A 4B6HA 1KZGA 1XCGA 4HB2B 3V5WA 4HATB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HE2 A;  3SUZ A;  2K00 A;  2H7D A;  1NTV A;  5CLQ B;  3U7D A;  5DI9 B;  1ZM0 A;  4K2O A;  3QWM A;  2YVC A;  2LG1 A;  3M1I B;  3A8P A;  3KZ1 A;  2RNR B;  2COA A;  1U5F A;  3TVV A;  2OTX A;  3A98 B;  3SV1 A;  5C5B A;  4A6F B;  2ZPY A;  4MT7 A;  4GMV A;  2J0J A;  1UNQ A;  4Z2M B;  1DBH A;  5D27 A;  1GG3 A;  3MDB C;  3ODO A;  2V76 A;  4TYZ A;  3PP2 A;  4GZU A;  2AEH A;  3HK0 A;  1KI1 B;  4NSW A;  1X11 A;  2YS5 A;  2LOX A;  1V5P A;  4TKN A;  2KUP A;  4Z2N A;  1NI2 A;  4A6K A;  1FGY A;  4WJ7 A;  2COF A;  3KRX A;  1FGZ A;  4KHB B;  2ELA A;  1MIX A;  1U5E A;  2D10 A;  3NSU A;  1TQZ A;  4GXB A;  3DXD A;  2CY4 A;  2J0M A;  3KY9 A;  1OY2 A;  1X1G A;  2CY5 A;  1V5U A;  1V5M A;  3N7C A;  5L81 A;  5KCV A;  2K2U A;  4C0A A;  1RRP B;  1KZ7 A;  1UPR A;  4GPT B;  2MWN B;  2W2X D;  2XQN M;  2RVB B;  3U8Z A;  2Y7B A;  2RSG A;  2DYN A;  4EMO A;  4DBB A;  1MPH A;  5DH9 B;  3PEG A;  1WJ1 A;  5DHF B;  3O96 A;  3TFM A;  1NTY A;  4PNK A;  4WSF A;  2DFK A;  4GN1 A;  4CHJ A;  2YF0 A;  1XD4 A;  4EJN A;  1V61 A;  1BAK A;  3BIN A;  3QIJ A;  4HB0 B;  1ZC4 B;  1ZC3 B;  2AL6 A;  3QBV B;  1Y5O A;  3SNH A;  4HAU B;  1OMW A;  2ROV A;  2EJ8 A;  1BTN A;  5GOW B;  1XX0 A;  4F7U P;  3F0W A;  3GYP A;  5DHA B;  2D2Q A;  1EAZ A;  3SYX A;  4D0N B;  3ULB A;  1BTK A;  1P3R A;  2X18 A;  4HB3 B;  2L1C A;  4EKU A;  5J3T A;  1EF1 A;  2D4Q A;  2E2X A;  2LYD A;  1WGQ A;  1MK9 B;  1MK7 B;  2DHI A;  2KCJ A;  3D8D A;  1N3H A;  3WYF B;  2YRY A;  3PVL A;  2D9W A;  1DDV A;  3P6A A;  3LJU X;  3TCA A;  1QC6 A;  1UNP A;  4HDQ A;  2UVM A;  3P7Z A;  1QQG A;  2QKL A;  2NMB A;  3CXB B;  4MY6 A;  1H4R A;  4CHM A;  5KQ4 A;  1ZVR A;  4K17 A;  4HAY B;  5HE3 A;  1X05 A;  4DX8 A;  4ZRK A;  1MAI A;  2GJY A;  5J3Q A;  1EVH A;  1U29 A;  1ISN A;  1LB1 A;  4Y94 A;  4NY0 A;  3VOQ A;  1FAO A;  2I5F A;  5FI1 A;  2D9Y A;  1RJ2 A;  3AU5 A;  1W1D A;  2Z0P A;  4BBK A;  3FSS A;  4IAP A;  3DXE A;  1WJM A;  4KVG B;  3G9W A;  2P0D A;  3CIK A;  2EC1 A;  3ZDT A;  2YT0 A;  2CAY A;  5JHH A;  2LKO A;  5JP4 A;  3UZT A;  2DYQ A;  4HHV A;  1TXD A;  2I1K A;  1I7A A;  4CYE A;  3T06 A;  2H7E A;  2D9X A;  3F5R A;  4YL8 A;  1PFJ A;  2Y8F A;  5C6R A;  2W2X C;  4K81 A;  2I5C A;  5D3V A;  1U5D A;  1NU2 A;  1U5G A;  4KHO A;  1PLS A;  1UEF A;  1K5D B;  1DDW A;  2EMS A;  3VIA A;  5HE1 A;  2DX5 A;  1GC7 A;  4HAX B;  2YS1 A;  1GC6 A;  5C16 A;  1OQN A;  4HAZ B;  4IFS A;  5D3X A;  2YT1 A;  4HDO A;  1U2B A;  2ROZ B;  4A5K A;  3PVW A;  3BJI A;  2R09 A;  2MKR A;  2DKQ A;  2P8V A;  3OAN A;  1UNR A;  2D11 A;  1DYN A;  1E5W A;  2MFQ A;  5J3Y A;  1FHX A;  2BCJ A;  2DA0 A;  2Z0O A;  2J59 M;  1WVH A;  2DX1 A;  1W1H A;  2RGN B;  4HAW B;  5C5B B;  2N23 A;  1J0W A;  3PSC A;  2N0Y A;  2VKI A;  1Q67 A;  2Q13 A;  1X86 A;  3AJ4 A;  3TO1 A;  1ZSQ A;  3TW1 A;  2RUK B;  2DN6 A;  4ZRJ A;  1FOE A;  2IFS A;  1DRO A;  3ODX A;  3PZD A;  4L6E A;  1WG7 A;  1W1G A;  3SO6 A;  1X1F A;  2K2J A;  1M7E A;  2J0K A;  1V88 A;  4IOY X;  2P0F A;  4MK0 A;  2G35 A;  3A8Q A;  4H8S A;  1UPQ A;  1H10 A;  2I1J A;  2OQB A;  2L2I A;  2LUL A;  1K5G B;  4DX9 0;  4A6H A;  5CLL B;  1SGH A;  5JHG A;  4KHA A;  2VRW B;  1Y19 B;  2ELB A;  2M38 A;  4A6F A;  2DTC A;  3FM8 C;  3GYO A;  3AU4 A;  1P5T A;  2DHJ A;  2YSZ A;  4WVF B;  1TJ6 A;  3X23 A;  3D8E A;  5LON B;  1WGU A;  5D3Y A;  2CRF A;  3D8F A;  4HAV B;  3HQC A;  2GS0 A;  2UZS A;  2M14 A;  4YON A;  5EFX A;  4DXA B;  3ODW A;  3RCP A;  1LW3 A;  3PVU A;  1P6S A;  3FEH A;  2Y8G A;  2DHK A;  3HW2 B;  3ML4 A;  3ULC A;  1B55 A;  3IVF A;  1FHO A;  4F7H A;  4ZRI A;  2QKM A;  2KGX B;  2YS3 A;  2Z0Q A;  5LOP B;  1AQC A;  1EGX A;  2DKP A;  1V89 A;  5DIF B;  3KSY A;  5C79 A;  4F7G A;  1WI1 A;  2R0D A;  1FHW A;  2D9V A;  4PQ0 A;  1IRS A;  2JP2 A;  2NZ8 B;  2IYB A;  4GMX B;  1Z87 A;  2GCJ A;  2GCL A;  1DDM A;  2FJL A;  2LOZ A;  3PG7 A;  1MKE A;  2PZ1 A;  1XOD A;  2COC A;  1U27 A;  2MDX A;  1PMS A;  5JLJ B;  5D3W A;  2DLW A;  4HB4 B;  2HE7 A;  3DXC A;  1XR0 B;  3ZVR A;  1MIZ B;  1I2H A;  2P0H A;  1XKE A;  4P7I A;  1J19 A;  3WA0 A;  2EMT A;  4K2P A;  1BWN A;  1FB8 A;  3KRW A;  2UZR A;  2ADZ A;  5FI0 A;  3MPX A;  5KQ1 A;  4KAX B;  2COD A;  2HTH B;  1SHC A;  2W2W A;  4XWX A;  1AWE A;  2D9Z A;  2VSZ A;  1M7R A;  2RLO A;  5HE0 A;  4B6H A;  1KZG A;  1XCG A;  4HB2 B;  3V5W A;  4HAT B; 
#chains in the Genus database with same CATH topology
 5HE2 A;  3SUZ A;  2K00 A;  2H7D A;  1NTV A;  5CLQ B;  3U7D A;  5DI9 B;  1ZM0 A;  4K2O A;  1ZYI A;  3QWM A;  2YVC A;  3NW8 A;  2LG1 A;  3M1I B;  3A8P A;  3KZ1 A;  2Z4D A;  2RNR B;  2COA A;  1U5F A;  3TVV A;  2OTX A;  3A98 B;  3SV1 A;  5C5B A;  4A6F B;  2ZPY A;  4MT7 A;  4GMV A;  2J0J A;  1UNQ A;  4Z2M B;  2GUM A;  4GOU A;  1DBH A;  5D27 A;  1GG3 A;  3MDB C;  3ODO A;  2V76 A;  4TYZ A;  3PP2 A;  4GZU A;  2AEH A;  3HK0 A;  1KI1 B;  4NSW A;  1X11 A;  2YS5 A;  2LOX A;  1V5P A;  4TKN A;  2KUP A;  4Z2N A;  1NI2 A;  4A6K A;  1FGY A;  4WJ7 A;  2COF A;  4QJ4 B;  3KRX A;  1FGZ A;  4KHB B;  2ELA A;  1MIX A;  1U5E A;  2D10 A;  3NSU A;  1TQZ A;  4GXB A;  3DXD A;  2CY4 A;  3KY9 A;  1OY2 A;  1X1G A;  2CY5 A;  1V5U A;  1V5M A;  3N7C A;  5L81 A;  5KCV A;  2K2U A;  4C0A A;  1RRP B;  1KZ7 A;  1UPR A;  4GPT B;  2MWN B;  2W2X D;  2XQN M;  2RVB B;  3U8Z A;  2Y7B A;  2RSG A;  2DYN A;  4EMO A;  2FJU B;  4DBB A;  1MPH A;  5DH9 B;  3B77 A;  3PEG A;  1WJ1 A;  5DHF B;  3O96 A;  3TFM A;  2KUQ A;  1NTY A;  4PNK A;  4WSF A;  2DFK A;  4GN1 A;  3HIE A;  4CHJ A;  2YF0 A;  1XD4 A;  4EJN A;  1V61 A;  1BAK A;  3BIN A;  3QIJ A;  4HB0 B;  1ZC4 B;  1ZC3 B;  2AL6 A;  3QBV B;  1Y5O A;  3SNH A;  4HAU B;  1OMW A;  2ROV A;  2EJ8 A;  1BTN A;  5I2M A;  5GOW B;  1XX0 A;  4F7U P;  3F0W A;  3GYP A;  5DHA B;  2D2Q A;  1EAZ A;  3SYX A;  4D0N B;  3ULB A;  1BTK A;  1P3R A;  2X18 A;  4HB3 B;  2L1C A;  4EKU A;  5J3T A;  1EF1 A;  2D4Q A;  2E2X A;  2LYD A;  1WGQ A;  1MK9 B;  1MK7 B;  2DHI A;  2KCJ A;  3D8D A;  1N3H A;  3WYF B;  2YRY A;  2KIG A;  5IRS A;  3PVL A;  2D9W A;  1DDV A;  3P6A A;  3LJU X;  3TCA A;  1QC6 A;  1UNP A;  3P7Z A;  2UVM A;  4HDQ A;  3NWA A;  1QQG A;  2QKL A;  1MI1 A;  2NMB A;  3CXB B;  2K8E A;  3DCX A;  4MY6 A;  1H4R A;  4CHM A;  5KQ4 A;  4D6W A;  1ZVR A;  4K17 A;  4HAY B;  5HE3 A;  1X05 A;  4DX8 A;  4ZRK A;  1MAI A;  2GJY A;  5J3Q A;  1EVH A;  1U29 A;  1ISN A;  1LB1 A;  4Y94 A;  4NY0 A;  3VOQ A;  1FAO A;  2YT2 A;  2I5F A;  5FI1 A;  2D9Y A;  1RJ2 A;  3AU5 A;  1W1D A;  2Z0P A;  4BBK A;  5LG4 B;  3FSS A;  4IAP A;  3DXE A;  1WJM A;  4KVG B;  3G9W A;  2P0D A;  3CIK A;  2EC1 A;  3ZDT A;  2YT0 A;  2CAY A;  2KIE A;  5JHH A;  2LKO A;  5JP4 A;  3UZT A;  2DYQ A;  4HHV A;  1TXD A;  2KR0 A;  2I1K A;  1I7A A;  4CYE A;  3T06 A;  2H7E A;  2D9X A;  3F5R A;  4YL8 A;  4OT1 A;  1PFJ A;  4QJ3 B;  2Y8F A;  5C6R A;  2W2X C;  4K81 A;  4KHB A;  2I5C A;  5D3V A;  1U5D A;  1NU2 A;  1U5G A;  4KHO A;  1PLS A;  1UEF A;  3A58 A;  1K5D B;  4OSN A;  1DDW A;  2EMS A;  3U12 A;  3VIA A;  5HE1 A;  2DX5 A;  1GC7 A;  4HAX B;  2YS1 A;  1GC6 A;  4HSI A;  5C16 A;  1OQN A;  4HAZ B;  4IFS A;  5D3X A;  2YT1 A;  4HDO A;  1U2B A;  2ROZ B;  4A5K A;  2K49 A;  3PVW A;  4DIX A;  3BJI A;  2R09 A;  2MKR A;  2DKQ A;  2P8V A;  3OAN A;  1UNR A;  2D11 A;  1DYN A;  1E5W A;  2MFQ A;  5J3Y A;  1FHX A;  2BCJ A;  2DA0 A;  2Z0O A;  2J59 M;  1WVH A;  2DX1 A;  1W1H A;  2RGN B;  4HAW B;  5C5B B;  2N23 A;  3NWF A;  1J0W A;  3PSC A;  2N0Y A;  2VKI A;  1Q67 A;  2Q13 A;  1X86 A;  3AJ4 A;  3TO1 A;  2Z59 A;  1ZSQ A;  3TW1 A;  2RUK B;  2DN6 A;  2NBV A;  4ZRJ A;  1FOE A;  2IFS A;  1DRO A;  3ODX A;  3PZD A;  4L6E A;  5I2S A;  1WG7 A;  1W1G A;  3SO6 A;  1X1F A;  2K2J A;  1M7E A;  2J0K A;  1V88 A;  4IOY X;  2P0F A;  4MK0 A;  2G35 A;  3A8Q A;  4H8S A;  1UPQ A;  2Z13 A;  4HAT B;  1H10 A;  2I1J A;  2OQB A;  2L2I A;  2LUL A;  1K5G B;  4DX9 0;  4A6H A;  5CLL B;  4QXA B;  1SGH A;  5JHG A;  4KHA A;  2VRW B;  1Y19 B;  2ELB A;  2M38 A;  4A6F A;  2DTC A;  3FM8 C;  3GYO A;  3AU4 A;  1P5T A;  2DHJ A;  2YSZ A;  4WVF B;  1TJ6 A;  3X23 A;  3D8E A;  5LON B;  2R2Y A;  1WGU A;  5D3Y A;  4GNK B;  2CRF A;  3D8F A;  4HAV B;  3HQC A;  4L1R A;  2GS0 A;  2UZS A;  2M14 A;  4YON A;  5EFX A;  4DXA B;  3ODW A;  3RCP A;  1LW3 A;  3PVU A;  1P6S A;  3FEH A;  2Y8G A;  2DHK A;  3HW2 B;  3ML4 A;  4CSQ A;  3FVC A;  2Z14 A;  3ULC A;  1B55 A;  3IVF A;  1FHO A;  4F7H A;  4ZRI A;  2QKM A;  3OHM B;  2KGX B;  2YS3 A;  2Z0Q A;  5LOP B;  1AQC A;  1EGX A;  2DKP A;  1V89 A;  5DIF B;  3KSY A;  5C79 A;  4F7G A;  1WI1 A;  2R0D A;  1FHW A;  2D9V A;  4PQ0 A;  1IRS A;  2JP2 A;  2NZ8 B;  2IYB A;  4GMX B;  1Z87 A;  2GCJ A;  2GCL A;  1DDM A;  2FJL A;  2LOZ A;  3PG7 A;  2ZKM X;  1MKE A;  4QJ5 B;  2PZ1 A;  1XOD A;  2COC A;  1U27 A;  2MDX A;  1PMS A;  5JLJ B;  3HSA A;  5D3W A;  2DLW A;  4HB4 B;  2HE7 A;  3DXC A;  1XR0 B;  3ZVR A;  1MIZ B;  1I2H A;  2P0H A;  1XKE A;  4P7I A;  1J19 A;  3WA0 A;  1T77 A;  2EMT A;  4K2P A;  1BWN A;  1FB8 A;  3NWD A;  3KRW A;  2UZR A;  2ADZ A;  5FI0 A;  3MPX A;  5KQ1 A;  4KAX B;  2COD A;  2HTH B;  1SHC A;  2W2W A;  4XWX A;  2RRF A;  1AWE A;  2D9Z A;  2VSZ A;  1M7R A;  2RLO A;  5HE0 A;  4B6H A;  5M4Y B;  1KZG A;  1XCG A;  4HB2 B;  3V5W A;  2J0M A; 
#chains in the Genus database with same CATH homology
 5HE2 A;  3SUZ A;  2K00 A;  2H7D A;  1NTV A;  5CLQ B;  3U7D A;  5DI9 B;  1ZM0 A;  4K2O A;  3QWM A;  2YVC A;  2LG1 A;  3M1I B;  3A8P A;  3KZ1 A;  2RNR B;  2COA A;  1U5F A;  3TVV A;  2OTX A;  3A98 B;  3SV1 A;  5C5B A;  4A6F B;  2ZPY A;  4MT7 A;  4GMV A;  2J0J A;  1UNQ A;  4Z2M B;  1DBH A;  5D27 A;  1GG3 A;  3MDB C;  3ODO A;  2V76 A;  4TYZ A;  3PP2 A;  4GZU A;  2AEH A;  3HK0 A;  1KI1 B;  4NSW A;  1X11 A;  2YS5 A;  2LOX A;  1V5P A;  4TKN A;  2KUP A;  4Z2N A;  1NI2 A;  4A6K A;  1FGY A;  4WJ7 A;  2COF A;  3KRX A;  1FGZ A;  4KHB B;  2ELA A;  1MIX A;  1U5E A;  2D10 A;  3NSU A;  1TQZ A;  4GXB A;  3DXD A;  2CY4 A;  2J0M A;  3KY9 A;  1OY2 A;  1X1G A;  2CY5 A;  1V5U A;  1V5M A;  3N7C A;  5L81 A;  5KCV A;  2K2U A;  4C0A A;  1RRP B;  1KZ7 A;  1UPR A;  4GPT B;  2MWN B;  2W2X D;  2XQN M;  2RVB B;  3U8Z A;  2Y7B A;  2RSG A;  2DYN A;  4EMO A;  4DBB A;  1MPH A;  5DH9 B;  3PEG A;  1WJ1 A;  5DHF B;  3O96 A;  3TFM A;  1NTY A;  4PNK A;  4WSF A;  2DFK A;  4GN1 A;  4CHJ A;  2YF0 A;  1XD4 A;  4EJN A;  1V61 A;  1BAK A;  3BIN A;  3QIJ A;  4HB0 B;  1ZC4 B;  1ZC3 B;  2AL6 A;  3QBV B;  1Y5O A;  3SNH A;  4HAU B;  1OMW A;  2ROV A;  2EJ8 A;  1BTN A;  5GOW B;  1XX0 A;  4F7U P;  3F0W A;  3GYP A;  5DHA B;  2D2Q A;  1EAZ A;  3SYX A;  4D0N B;  3ULB A;  1BTK A;  1P3R A;  2X18 A;  4HB3 B;  2L1C A;  4EKU A;  5J3T A;  1EF1 A;  2D4Q A;  2E2X A;  2LYD A;  1WGQ A;  1MK9 B;  1MK7 B;  2DHI A;  2KCJ A;  3D8D A;  1N3H A;  3WYF B;  2YRY A;  3PVL A;  2D9W A;  1DDV A;  3P6A A;  3LJU X;  3TCA A;  1QC6 A;  1UNP A;  4HDQ A;  2UVM A;  3P7Z A;  1QQG A;  2QKL A;  2NMB A;  3CXB B;  4MY6 A;  1H4R A;  4CHM A;  5KQ4 A;  1ZVR A;  4K17 A;  4HAY B;  5HE3 A;  1X05 A;  4DX8 A;  4ZRK A;  1MAI A;  2GJY A;  5J3Q A;  1EVH A;  1U29 A;  1ISN A;  1LB1 A;  4Y94 A;  4NY0 A;  3VOQ A;  1FAO A;  2I5F A;  5FI1 A;  2D9Y A;  1RJ2 A;  3AU5 A;  1W1D A;  2Z0P A;  4BBK A;  3FSS A;  4IAP A;  3DXE A;  1WJM A;  4KVG B;  3G9W A;  2P0D A;  3CIK A;  2EC1 A;  3ZDT A;  2YT0 A;  2CAY A;  5JHH A;  2LKO A;  5JP4 A;  3UZT A;  2DYQ A;  4HHV A;  1TXD A;  2I1K A;  1I7A A;  4CYE A;  3T06 A;  2H7E A;  2D9X A;  3F5R A;  4YL8 A;  1PFJ A;  2Y8F A;  5C6R A;  2W2X C;  4K81 A;  2I5C A;  5D3V A;  1U5D A;  1NU2 A;  1U5G A;  4KHO A;  1PLS A;  1UEF A;  1K5D B;  1DDW A;  2EMS A;  3VIA A;  5HE1 A;  2DX5 A;  1GC7 A;  4HAX B;  2YS1 A;  1GC6 A;  5C16 A;  1OQN A;  4HAZ B;  4IFS A;  5D3X A;  2YT1 A;  4HDO A;  1U2B A;  2ROZ B;  4A5K A;  3PVW A;  3BJI A;  2R09 A;  2MKR A;  2DKQ A;  2P8V A;  3OAN A;  1UNR A;  2D11 A;  1DYN A;  1E5W A;  2MFQ A;  5J3Y A;  1FHX A;  2BCJ A;  2DA0 A;  2Z0O A;  2J59 M;  1WVH A;  2DX1 A;  1W1H A;  2RGN B;  4HAW B;  5C5B B;  2N23 A;  1J0W A;  3PSC A;  2N0Y A;  2VKI A;  1Q67 A;  2Q13 A;  1X86 A;  3AJ4 A;  3TO1 A;  1ZSQ A;  3TW1 A;  2RUK B;  2DN6 A;  4ZRJ A;  1FOE A;  2IFS A;  1DRO A;  3ODX A;  3PZD A;  4L6E A;  1WG7 A;  1W1G A;  3SO6 A;  1X1F A;  2K2J A;  1M7E A;  2J0K A;  1V88 A;  4IOY X;  2P0F A;  4MK0 A;  2G35 A;  3A8Q A;  4H8S A;  1UPQ A;  1H10 A;  2I1J A;  2OQB A;  2L2I A;  2LUL A;  1K5G B;  4DX9 0;  4A6H A;  5CLL B;  1SGH A;  5JHG A;  4KHA A;  2VRW B;  1Y19 B;  2ELB A;  2M38 A;  4A6F A;  2DTC A;  3FM8 C;  3GYO A;  3AU4 A;  1P5T A;  2DHJ A;  2YSZ A;  4WVF B;  1TJ6 A;  3X23 A;  3D8E A;  5LON B;  1WGU A;  5D3Y A;  2CRF A;  3D8F A;  4HAV B;  3HQC A;  2GS0 A;  2UZS A;  2M14 A;  4YON A;  5EFX A;  4DXA B;  3ODW A;  3RCP A;  1LW3 A;  3PVU A;  1P6S A;  3FEH A;  2Y8G A;  2DHK A;  3HW2 B;  3ML4 A;  3ULC A;  1B55 A;  3IVF A;  1FHO A;  4F7H A;  4ZRI A;  2QKM A;  2KGX B;  2YS3 A;  2Z0Q A;  5LOP B;  1AQC A;  1EGX A;  2DKP A;  1V89 A;  5DIF B;  3KSY A;  5C79 A;  4F7G A;  1WI1 A;  2R0D A;  1FHW A;  2D9V A;  4PQ0 A;  1IRS A;  2JP2 A;  2NZ8 B;  2IYB A;  4GMX B;  1Z87 A;  2GCJ A;  2GCL A;  1DDM A;  2FJL A;  2LOZ A;  3PG7 A;  1MKE A;  2PZ1 A;  1XOD A;  2COC A;  1U27 A;  2MDX A;  1PMS A;  5JLJ B;  5D3W A;  2DLW A;  4HB4 B;  2HE7 A;  3DXC A;  1XR0 B;  3ZVR A;  1MIZ B;  1I2H A;  2P0H A;  1XKE A;  4P7I A;  1J19 A;  3WA0 A;  2EMT A;  4K2P A;  1BWN A;  1FB8 A;  3KRW A;  2UZR A;  2ADZ A;  5FI0 A;  3MPX A;  5KQ1 A;  4KAX B;  2COD A;  2HTH B;  1SHC A;  2W2W A;  4XWX A;  1AWE A;  2D9Z A;  2VSZ A;  1M7R A;  2RLO A;  5HE0 A;  4B6H A;  1KZG A;  1XCG A;  4HB2 B;  3V5W A;  4HAT B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...