1XX0A

Structure of the c-terminal ph domain of human pleckstrin
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
117
structure length
117
Chain Sequence
DVILKEEFRGVIIKQGCLLKQGHRRKNWKVRKFILREDPAYLHYYDPAGAEDPLGAIHLRGCVVTSVESNSNGRKSEEENLFEIITADEVHYFLQAATPKERTEWIKAIQMASRTGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Pleckstrin
publication title Structure and phosphatidylinositol-(3,4)-bisphosphate binding of the C-terminal PH domain of human pleckstrin
pubmed doi rcsb
source organism Homo sapiens
molecule tags Lipid binding protein
total genus 25
structure length 117
sequence length 117
ec nomenclature
pdb deposition date 2004-11-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00169 PH PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1xx0A00
4KVGB 2GCLA 2KCJA 1V5PA 3CIKA 4DX90 2YT1A 2P0DA 4HB2B 1SHCA 3PG7A 3HQCA 1N3HA 3KRWA 5DHAB 3DXCA 4A6HA 3MDBC 5LONB 2ZPYA 4GMXB 4MY6A 1W1DA 2D11A 4EKUA 4Z2NA 2GJYA 1Y19B 4F7GA 1U2BA 1NI2A 1GG3A 5D3WA 1OMWA 3ODOA 1X86A 4WSFA 3NSUA 1J19A 1W1HA 1J0WA 4WVFB 4HAVB 1DBHA 2DLWA 5DH9B 3WYFB 4A6FB 5GOWB 2YVCA 3HK0A 1B55A 1WG7A 1DDMA 2YS5A 3G9WA 3SNHA 1U29A 1E5WA 5HE0A 4IOYX 4IFSA 2W2XD 2KUPA 1X1FA 1OQNA 4HB3B 2J0JA 2P0HA 3HW2B 4P7IA 1RJ2A 3FM8C 5KQ4A 3ZVRA 1I7AA 3SYXA 2D9ZA 1X11A 1UNQA 2D10A 1NTYA 5JP4A 1FHXA 4NY0A 4L6EA 2Z0OA 2YRYA 2EMSA 2DKQA 1BTNA 1FGZA 2MDXA 2W2WA 2J59M 1TJ6A 1V88A 1NTVA 4A6KA 1TXDA 1XKEA 3ZDTA 2DX5A 1QQGA 1FHWA 2NZ8B 1ZVRA 1X05A 4HAZB 3DXDA 3U8ZA 2COFA 2M14A 4H8SA 3BINA 2ELAA 2YF0A 1U27A 1M7EA 1XX0A 4TKNA 4D0NB 2D9WA 1MAIA 2P0FA 2Z0QA 2DN6A 5J3YA 5D3YA 4YL8A 4ZRJA 3RCPA 1DDVA 3OANA 2XQNM 1K5GB 2D4QA 4MT7A 4Z2MB 1NU2A 2Q13A 2I1KA 4K2OA 5LOPB 2D9XA 4HAWB 4B6HA 2Y8FA 1XD4A 5DHFB 5D3XA 1FGYA 1EVHA 2L2IA 2ELBA 1AQCA 1WVHA 2LOXA 1MIZB 2W2XC 1UNPA 4WJ7A 2VRWB 4NSWA 2V76A 1KZ7A 1PMSA 2UVMA 1PFJA 5DI9B 5C5BB 2CY5A 1FAOA 2N23A 1Z87A 3U7DA 5D3VA 3BJIA 4A6FA 2CODA 4K2PA 2PZ1A 1BAKA 2DA0A 2EJ8A 1V89A 1V5UA 2LYDA 1M7RA 1U5FA 1ZSQA 1QC6A 1XR0B 2DHKA 3D8EA 3T06A 3TO1A 2I1JA 3F0WA 3QIJA 4F7HA 1AWEA 2RGNB 4HB0B 2FJLA 3A8PA 2ROVA 2YS1A 1UNRA 1WI1A 3PP2A 5HE2A 2D2QA 3DXEA 2DFKA 3SUZA 2CAYA 2L1CA 3TFMA 2RVBB 2VKIA 1OY2A 2LG1A 4HDQA 1P3RA 1MKEA 4Y94A 2RLOA 1MK7B 2MFQA 2R09A 5D27A 3TVVA 4GN1A 3KY9A 3X23A 3FSSA 2COAA 3MPXA 2D9VA 1U5DA 1P6SA 2Y8GA 3D8FA 1UEFA 2UZSA 3ULCA 2JP2A 1P5TA 5FI1A 3PZDA 1ZC4B 2RUKB 5J3QA 4A5KA 2COCA 2J0MA 1FOEA 5FI0A 3GYPA 4K81A 2HTHB 3QWMA 3QBVB 3LJUX 4YONA 5L81A 2I5FA 1XCGA 4EMOA 4ZRIA 1ZM0A 4HAYB 2DYQA 5JLJB 2QKMA 4GPTB 4HHVA 4DBBA 5KQ1A 2KGXB 1Q67A 4C0AA 2Z0PA 4DXAB 2ROZB 2QKLA 5CLLB 3KRXA 3VIAA 5C16A 1ISNA 4ZRKA 3P7ZA 2Y7BA 4HAUB 2VSZA 1MK9B 3SO6A 2M38A 2LOZA 2J0KA 4CHMA 5CLQB 1GC7A 2BCJA 2DHIA 5C5BA 2EC1A 4GXBA 3PVWA 5KCVA 1SGHA 3FEHA 1W1GA 1V61A 4GZUA 1UPQA 1BWNA 2K00A 2I5CA 1WJMA 2K2UA 4BBKA 2H7DA 3ODWA 4CYEA 2DKPA 3AU4A 3KZ1A 3PEGA 2DHJA 2YT0A 2CY4A 3ML4A 2ADZA 3TCAA 1KI1B 1DYNA 1V5MA 4PQ0A 4KAXB 2DX1A 4HAXB 2GS0A 1Y5OA 2K2JA 4XWXA 2AEHA 1LW3A 4HATB 1H4RA 1LB1A 1UPRA 3AU5A 5DIFB 3IVFA 2AL6A 2D9YA 5JHGA 2IYBA 3CXBB 1BTKA 1WGQA 3KSYA 2UZRA 1EF1A 4TYZA 4HDOA 2RNRB 2OTXA 4K17A 4KHBB 5JHHA 4MK0A 3WA0A 4CHJA 1FHOA 2LKOA 2LULA 2YSZA 3N7CA 4KHAA 3UZTA 1H10A 1X1GA 2NMBA 2EMTA 3ODXA 1WGUA 3A98B 3O96A 1DROA 3TW1A 1RRPB 1XODA 3PSCA 2YS3A 4F7UP 3F5RA 5J3TA 2RSGA 1EAZA 1U5EA 2MWNB 4PNKA 2HE7A 4HB4B 1KZGA 2P8VA 1I2HA 2H7EA 1U5GA 4KHOA 2OQBA 1PLSA 5C79A 1GC6A 1ZC3B 2G35A 1EGXA 3PVUA 5HE3A 2E2XA 1K5DB 2R0DA 4EJNA 2MKRA 4DX8A 3PVLA 1MIXA 4GMVA 3VOQA 1IRSA 3D8DA 3GYOA 3M1IB 3A8QA 2N0YA 1MPHA 2DTCA 1WJ1A 4IAPA 1FB8A 2X18A 3SV1A 5HE1A 3AJ4A 2CRFA 3ULBA 3V5WA 5C6RA 2GCJA 1DDWA 1TQZA 2IFSA 3P6AA 5EFXA 2DYNA
chains in the Genus database with same CATH superfamily
4KVGB 2GCLA 2KCJA 1V5PA 3CIKA 4DX90 2YT1A 2P0DA 3HIEA 4HB2B 4QJ3B 1SHCA 3PG7A 3HQCA 1N3HA 1T77A 3KRWA 3DXCA 5DHAB 4A6HA 3MDBC 5LONB 2ZPYA 5I2SA 4GMXB 4MY6A 1W1DA 2D11A 4EKUA 4Z2NA 2GJYA 1Y19B 2K49A 1ZYIA 4F7GA 1U2BA 1NI2A 1GG3A 5D3WA 1OMWA 3ODOA 1X86A 4WSFA 3NSUA 1J19A 1W1HA 1J0WA 4WVFB 4HAVB 1DBHA 2DLWA 5DH9B 3WYFB 4A6FB 5GOWB 2YVCA 3HK0A 1B55A 1WG7A 1DDMA 2YS5A 3G9WA 3SNHA 1U29A 1E5WA 5HE0A 4IOYX 4IFSA 2W2XD 2KUPA 1X1FA 1OQNA 2Z4DA 4HB3B 2J0JA 2P0HA 3HW2B 4P7IA 1RJ2A 3FM8C 5KQ4A 3ZVRA 1I7AA 3SYXA 5LG4B 2D9ZA 1X11A 1UNQA 2D10A 1NTYA 5JP4A 1FHXA 4NY0A 4L6EA 2Z0OA 2YRYA 2EMSA 2Z13A 5I2MA 2DKQA 2KR0A 1BTNA 1FGZA 2MDXA 2W2WA 2J59M 1TJ6A 1V88A 1NTVA 4A6KA 1TXDA 1XKEA 3ZDTA 2DX5A 1QQGA 1FHWA 2NZ8B 1ZVRA 1X05A 4HAZB 3DXDA 3U8ZA 2COFA 2M14A 4H8SA 3BINA 2ELAA 2YF0A 1U27A 1M7EA 1XX0A 4TKNA 4D0NB 2D9WA 1MAIA 2P0FA 2Z0QA 2DN6A 5J3YA 5D3YA 4YL8A 4ZRJA 3RCPA 1DDVA 3NWFA 3OANA 2XQNM 1K5GB 2D4QA 4MT7A 4Z2MB 1NU2A 2Q13A 3DCXA 4QJ4B 2I1KA 4K2OA 5LOPB 2D9XA 4HAWB 4B6HA 2Y8FA 1XD4A 5DHFB 5D3XA 1FGYA 1EVHA 2L2IA 2ELBA 1AQCA 1WVHA 2LOXA 1MIZB 2W2XC 1UNPA 4WJ7A 2VRWB 4NSWA 2V76A 1KZ7A 1PMSA 2UVMA 2ZKMX 1PFJA 5DI9B 5C5BB 2CY5A 1FAOA 2N23A 4GOUA 1Z87A 3U7DA 2NBVA 5D3VA 3BJIA 4A6FA 2CODA 4K2PA 2PZ1A 1BAKA 2DA0A 2EJ8A 1V89A 1V5UA 2LYDA 3U12A 1M7RA 1U5FA 1ZSQA 1QC6A 1XR0B 2DHKA 3D8EA 3T06A 3TO1A 2I1JA 3F0WA 3QIJA 4F7HA 1AWEA 2RGNB 4HB0B 2FJLA 3A8PA 2ROVA 2YS1A 1UNRA 2K8EA 1WI1A 3PP2A 5HE2A 2D2QA 3DXEA 2DFKA 3SUZA 2CAYA 2L1CA 3TFMA 2RVBB 2KIEA 2VKIA 1OY2A 2LG1A 4HDQA 1P3RA 1MKEA 3NWDA 4Y94A 2RLOA 1MK7B 2MFQA 2R09A 5D27A 3TVVA 4GN1A 3KY9A 3X23A 3FSSA 2COAA 3MPXA 2D9VA 1U5DA 1P6SA 2Y8GA 3D8FA 1UEFA 2UZSA 3ULCA 2JP2A 1P5TA 5FI1A 3PZDA 1ZC4B 2RUKB 4CSQA 1MI1A 5J3QA 4A5KA 2COCA 2J0MA 3B77A 1FOEA 5FI0A 3GYPA 4K81A 2HTHB 3QWMA 3QBVB 3LJUX 4YONA 5L81A 2I5FA 1XCGA 4EMOA 4ZRIA 2GUMA 1ZM0A 4HAYB 2DYQA 5JLJB 2QKMA 4GPTB 4HHVA 4DBBA 5KQ1A 2KGXB 1Q67A 4C0AA 4OSNA 2Z0PA 4DXAB 2ROZB 2QKLA 5CLLB 3KRXA 3VIAA 5C16A 1ISNA 4ZRKA 3P7ZA 2Y7BA 4HAUB 2VSZA 1MK9B 3SO6A 2M38A 2LOZA 2J0KA 4CHMA 5CLQB 1GC7A 2BCJA 2DHIA 5C5BA 2EC1A 4GXBA 3PVWA 5KCVA 1SGHA 3FEHA 1W1GA 1V61A 4GZUA 1UPQA 1BWNA 2K00A 2I5CA 2R2YA 5IRSA 1WJMA 2K2UA 4BBKA 2KIGA 2H7DA 3ODWA 4CYEA 2RRFA 2DKPA 3AU4A 3KZ1A 3PEGA 2DHJA 3HSAA 2YT0A 2CY4A 3ML4A 2ADZA 3NW8A 3TCAA 1KI1B 1DYNA 1V5MA 4PQ0A 4KAXB 2DX1A 4HAXB 2GS0A 1Y5OA 2K2JA 4XWXA 2AEHA 1LW3A 4QXAB 4HATB 1H4RA 1LB1A 1UPRA 3AU5A 4OT1A 5DIFB 3IVFA 2AL6A 2D9YA 5JHGA 2IYBA 3CXBB 4L1RA 1BTKA 1WGQA 3KSYA 4KHBA 5M4YB 2UZRA 1EF1A 4TYZA 4HDOA 2RNRB 2OTXA 4K17A 4KHBB 5JHHA 4MK0A 2YT2A 2FJUB 3WA0A 4CHJA 1FHOA 2LKOA 2LULA 2YSZA 4DIXA 3N7CA 4KHAA 3UZTA 2Z14A 1H10A 1X1GA 2NMBA 2EMTA 4GNKB 3ODXA 3NWAA 1WGUA 3A98B 3O96A 1DROA 3FVCA 4QJ5B 3TW1A 1RRPB 1XODA 3PSCA 2YS3A 4F7UP 3F5RA 5J3TA 2RSGA 1EAZA 1U5EA 2MWNB 4PNKA 2HE7A 4HB4B 1KZGA 2P8VA 1I2HA 2H7EA 3A58A 1U5GA 4KHOA 2OQBA 3OHMB 1PLSA 5C79A 1GC6A 1ZC3B 2G35A 1EGXA 3PVUA 5HE3A 2E2XA 1K5DB 2R0DA 4D6WA 4EJNA 2MKRA 4DX8A 3PVLA 1MIXA 4GMVA 3VOQA 1IRSA 3D8DA 3GYOA 2Z59A 3M1IB 3A8QA 2N0YA 1MPHA 2DTCA 1WJ1A 4IAPA 1FB8A 2X18A 3SV1A 5HE1A 3AJ4A 2CRFA 3ULBA 3V5WA 5C6RA 2GCJA 1DDWA 1TQZA 2IFSA 3P6AA 5EFXA 2KUQA 2DYNA 4HSIA
chains in the Genus database with same CATH topology
4KVGB 2GCLA 2KCJA 1V5PA 3CIKA 4DX90 2YT1A 2P0DA 4HB2B 1SHCA 3PG7A 3HQCA 1N3HA 3KRWA 5DHAB 3DXCA 4A6HA 3MDBC 5LONB 2ZPYA 4GMXB 4MY6A 1W1DA 2D11A 4EKUA 4Z2NA 2GJYA 1Y19B 4F7GA 1U2BA 1NI2A 1GG3A 5D3WA 1OMWA 3ODOA 1X86A 4WSFA 3NSUA 1J19A 1W1HA 1J0WA 4WVFB 4HAVB 1DBHA 2DLWA 5DH9B 3WYFB 4A6FB 5GOWB 2YVCA 3HK0A 1B55A 1WG7A 1DDMA 2YS5A 3G9WA 3SNHA 1U29A 1E5WA 5HE0A 4IOYX 4IFSA 2W2XD 2KUPA 1X1FA 1OQNA 4HB3B 2J0JA 2P0HA 3HW2B 4P7IA 1RJ2A 3FM8C 5KQ4A 3ZVRA 1I7AA 3SYXA 2D9ZA 1X11A 1UNQA 2D10A 1NTYA 5JP4A 1FHXA 4NY0A 4L6EA 2Z0OA 2YRYA 2EMSA 2DKQA 1BTNA 1FGZA 2MDXA 2W2WA 2J59M 1TJ6A 1V88A 1NTVA 4A6KA 1TXDA 1XKEA 3ZDTA 2DX5A 1QQGA 1FHWA 2NZ8B 1ZVRA 1X05A 4HAZB 3DXDA 3U8ZA 2COFA 2M14A 4H8SA 3BINA 2ELAA 2YF0A 1U27A 1M7EA 1XX0A 4TKNA 4D0NB 2D9WA 1MAIA 2P0FA 2Z0QA 2DN6A 5J3YA 5D3YA 4YL8A 4ZRJA 3RCPA 1DDVA 3OANA 2XQNM 1K5GB 2D4QA 4MT7A 4Z2MB 1NU2A 2Q13A 2I1KA 4K2OA 5LOPB 2D9XA 4HAWB 4B6HA 2Y8FA 1XD4A 5DHFB 5D3XA 1FGYA 1EVHA 2L2IA 2ELBA 1AQCA 1WVHA 2LOXA 1MIZB 2W2XC 1UNPA 4WJ7A 2VRWB 4NSWA 2V76A 1KZ7A 1PMSA 2UVMA 1PFJA 5DI9B 5C5BB 2CY5A 1FAOA 2N23A 1Z87A 3U7DA 5D3VA 3BJIA 4A6FA 2CODA 4K2PA 2PZ1A 1BAKA 2DA0A 2EJ8A 1V89A 1V5UA 2LYDA 1M7RA 1U5FA 1ZSQA 1QC6A 1XR0B 2DHKA 3D8EA 3T06A 3TO1A 2I1JA 3F0WA 3QIJA 4F7HA 1AWEA 2RGNB 4HB0B 2FJLA 3A8PA 2ROVA 2YS1A 1UNRA 1WI1A 3PP2A 5HE2A 2D2QA 3DXEA 2DFKA 3SUZA 2CAYA 2L1CA 3TFMA 2RVBB 2VKIA 1OY2A 2LG1A 4HDQA 1P3RA 1MKEA 4Y94A 2RLOA 1MK7B 2MFQA 2R09A 5D27A 3TVVA 4GN1A 3KY9A 3X23A 3FSSA 2COAA 3MPXA 2D9VA 1U5DA 1P6SA 2Y8GA 3D8FA 1UEFA 2UZSA 3ULCA 2JP2A 1P5TA 5FI1A 3PZDA 1ZC4B 2RUKB 5J3QA 4A5KA 2COCA 2J0MA 1FOEA 5FI0A 3GYPA 4K81A 2HTHB 3QWMA 3QBVB 3LJUX 4YONA 5L81A 2I5FA 1XCGA 4EMOA 4ZRIA 1ZM0A 4HAYB 2DYQA 5JLJB 2QKMA 4GPTB 4HHVA 4DBBA 5KQ1A 2KGXB 1Q67A 4C0AA 2Z0PA 4DXAB 2ROZB 2QKLA 5CLLB 3KRXA 3VIAA 5C16A 1ISNA 4ZRKA 3P7ZA 2Y7BA 4HAUB 2VSZA 1MK9B 3SO6A 2M38A 2LOZA 2J0KA 4CHMA 5CLQB 1GC7A 2BCJA 2DHIA 5C5BA 2EC1A 4GXBA 3PVWA 5KCVA 1SGHA 3FEHA 1W1GA 1V61A 4GZUA 1UPQA 1BWNA 2K00A 2I5CA 1WJMA 2K2UA 4BBKA 2H7DA 3ODWA 4CYEA 2DKPA 3AU4A 3KZ1A 3PEGA 2DHJA 2YT0A 2CY4A 3ML4A 2ADZA 3TCAA 1KI1B 1DYNA 1V5MA 4PQ0A 4KAXB 2DX1A 4HAXB 2GS0A 1Y5OA 2K2JA 4XWXA 2AEHA 1LW3A 4HATB 1H4RA 1LB1A 1UPRA 3AU5A 5DIFB 3IVFA 2AL6A 2D9YA 5JHGA 2IYBA 3CXBB 1BTKA 1WGQA 3KSYA 2UZRA 1EF1A 4TYZA 4HDOA 2RNRB 2OTXA 4K17A 4KHBB 5JHHA 4MK0A 3WA0A 4CHJA 1FHOA 2LKOA 2LULA 2YSZA 3N7CA 4KHAA 3UZTA 1H10A 1X1GA 2NMBA 2EMTA 3ODXA 1WGUA 3A98B 3O96A 1DROA 3TW1A 1RRPB 1XODA 3PSCA 2YS3A 4F7UP 3F5RA 5J3TA 2RSGA 1EAZA 1U5EA 2MWNB 4PNKA 2HE7A 4HB4B 1KZGA 2P8VA 1I2HA 2H7EA 1U5GA 4KHOA 2OQBA 1PLSA 5C79A 1GC6A 1ZC3B 2G35A 1EGXA 3PVUA 5HE3A 2E2XA 1K5DB 2R0DA 4EJNA 2MKRA 4DX8A 3PVLA 1MIXA 4GMVA 3VOQA 1IRSA 3D8DA 3GYOA 3M1IB 3A8QA 2N0YA 1MPHA 2DTCA 1WJ1A 4IAPA 1FB8A 2X18A 3SV1A 5HE1A 3AJ4A 2CRFA 3ULBA 3V5WA 5C6RA 2GCJA 1DDWA 1TQZA 2IFSA 3P6AA 5EFXA 2DYNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KVG B;  2GCL A;  2KCJ A;  1V5P A;  3CIK A;  4DX9 0;  2YT1 A;  2P0D A;  4HB2 B;  1SHC A;  3PG7 A;  3HQC A;  1N3H A;  3KRW A;  5DHA B;  3DXC A;  4A6H A;  3MDB C;  5LON B;  2ZPY A;  4GMX B;  4MY6 A;  1W1D A;  2D11 A;  4EKU A;  4Z2N A;  2GJY A;  1Y19 B;  4F7G A;  1U2B A;  1NI2 A;  1GG3 A;  5D3W A;  1OMW A;  3ODO A;  1X86 A;  4WSF A;  3NSU A;  1J19 A;  1W1H A;  1J0W A;  4WVF B;  4HAV B;  1DBH A;  2DLW A;  5DH9 B;  3WYF B;  4A6F B;  5GOW B;  2YVC A;  3HK0 A;  1B55 A;  1WG7 A;  1DDM A;  2YS5 A;  3G9W A;  3SNH A;  1U29 A;  1E5W A;  5HE0 A;  4IOY X;  4IFS A;  2W2X D;  2KUP A;  1X1F A;  1OQN A;  4HB3 B;  2J0J A;  2P0H A;  3HW2 B;  4P7I A;  1RJ2 A;  3FM8 C;  5KQ4 A;  3ZVR A;  1I7A A;  3SYX A;  2D9Z A;  1X11 A;  1UNQ A;  2D10 A;  1NTY A;  5JP4 A;  1FHX A;  4NY0 A;  4L6E A;  2Z0O A;  2YRY A;  2EMS A;  2DKQ A;  1BTN A;  1FGZ A;  2MDX A;  2W2W A;  2J59 M;  1TJ6 A;  1V88 A;  1NTV A;  4A6K A;  1TXD A;  1XKE A;  3ZDT A;  2DX5 A;  1QQG A;  1FHW A;  2NZ8 B;  1ZVR A;  1X05 A;  4HAZ B;  3DXD A;  3U8Z A;  2COF A;  2M14 A;  4H8S A;  3BIN A;  2ELA A;  2YF0 A;  1U27 A;  1M7E A;  1XX0 A;  4TKN A;  4D0N B;  2D9W A;  1MAI A;  2P0F A;  2Z0Q A;  2DN6 A;  5J3Y A;  5D3Y A;  4YL8 A;  4ZRJ A;  3RCP A;  1DDV A;  3OAN A;  2XQN M;  1K5G B;  2D4Q A;  4MT7 A;  4Z2M B;  1NU2 A;  2Q13 A;  2I1K A;  4K2O A;  5LOP B;  2D9X A;  4HAW B;  4B6H A;  2Y8F A;  1XD4 A;  5DHF B;  5D3X A;  1FGY A;  1EVH A;  2L2I A;  2ELB A;  1AQC A;  1WVH A;  2LOX A;  1MIZ B;  2W2X C;  1UNP A;  4WJ7 A;  2VRW B;  4NSW A;  2V76 A;  1KZ7 A;  1PMS A;  2UVM A;  1PFJ A;  5DI9 B;  5C5B B;  2CY5 A;  1FAO A;  2N23 A;  1Z87 A;  3U7D A;  5D3V A;  3BJI A;  4A6F A;  2COD A;  4K2P A;  2PZ1 A;  1BAK A;  2DA0 A;  2EJ8 A;  1V89 A;  1V5U A;  2LYD A;  1M7R A;  1U5F A;  1ZSQ A;  1QC6 A;  1XR0 B;  2DHK A;  3D8E A;  3T06 A;  3TO1 A;  2I1J A;  3F0W A;  3QIJ A;  4F7H A;  1AWE A;  2RGN B;  4HB0 B;  2FJL A;  3A8P A;  2ROV A;  2YS1 A;  1UNR A;  1WI1 A;  3PP2 A;  5HE2 A;  2D2Q A;  3DXE A;  2DFK A;  3SUZ A;  2CAY A;  2L1C A;  3TFM A;  2RVB B;  2VKI A;  1OY2 A;  2LG1 A;  4HDQ A;  1P3R A;  1MKE A;  4Y94 A;  2RLO A;  1MK7 B;  2MFQ A;  2R09 A;  5D27 A;  3TVV A;  4GN1 A;  3KY9 A;  3X23 A;  3FSS A;  2COA A;  3MPX A;  2D9V A;  1U5D A;  1P6S A;  2Y8G A;  3D8F A;  1UEF A;  2UZS A;  3ULC A;  2JP2 A;  1P5T A;  5FI1 A;  3PZD A;  1ZC4 B;  2RUK B;  5J3Q A;  4A5K A;  2COC A;  2J0M A;  1FOE A;  5FI0 A;  3GYP A;  4K81 A;  2HTH B;  3QWM A;  3QBV B;  3LJU X;  4YON A;  5L81 A;  2I5F A;  1XCG A;  4EMO A;  4ZRI A;  1ZM0 A;  4HAY B;  2DYQ A;  5JLJ B;  2QKM A;  4GPT B;  4HHV A;  4DBB A;  5KQ1 A;  2KGX B;  1Q67 A;  4C0A A;  2Z0P A;  4DXA B;  2ROZ B;  2QKL A;  5CLL B;  3KRX A;  3VIA A;  5C16 A;  1ISN A;  4ZRK A;  3P7Z A;  2Y7B A;  4HAU B;  2VSZ A;  1MK9 B;  3SO6 A;  2M38 A;  2LOZ A;  2J0K A;  4CHM A;  5CLQ B;  1GC7 A;  2BCJ A;  2DHI A;  5C5B A;  2EC1 A;  4GXB A;  3PVW A;  5KCV A;  1SGH A;  3FEH A;  1W1G A;  1V61 A;  4GZU A;  1UPQ A;  1BWN A;  2K00 A;  2I5C A;  1WJM A;  2K2U A;  4BBK A;  2H7D A;  3ODW A;  4CYE A;  2DKP A;  3AU4 A;  3KZ1 A;  3PEG A;  2DHJ A;  2YT0 A;  2CY4 A;  3ML4 A;  2ADZ A;  3TCA A;  1KI1 B;  1DYN A;  1V5M A;  4PQ0 A;  4KAX B;  2DX1 A;  4HAX B;  2GS0 A;  1Y5O A;  2K2J A;  4XWX A;  2AEH A;  1LW3 A;  4HAT B;  1H4R A;  1LB1 A;  1UPR A;  3AU5 A;  5DIF B;  3IVF A;  2AL6 A;  2D9Y A;  5JHG A;  2IYB A;  3CXB B;  1BTK A;  1WGQ A;  3KSY A;  2UZR A;  1EF1 A;  4TYZ A;  4HDO A;  2RNR B;  2OTX A;  4K17 A;  4KHB B;  5JHH A;  4MK0 A;  3WA0 A;  4CHJ A;  1FHO A;  2LKO A;  2LUL A;  2YSZ A;  3N7C A;  4KHA A;  3UZT A;  1H10 A;  1X1G A;  2NMB A;  2EMT A;  3ODX A;  1WGU A;  3A98 B;  3O96 A;  1DRO A;  3TW1 A;  1RRP B;  1XOD A;  3PSC A;  2YS3 A;  4F7U P;  3F5R A;  5J3T A;  2RSG A;  1EAZ A;  1U5E A;  2MWN B;  4PNK A;  2HE7 A;  4HB4 B;  1KZG A;  2P8V A;  1I2H A;  2H7E A;  1U5G A;  4KHO A;  2OQB A;  1PLS A;  5C79 A;  1GC6 A;  1ZC3 B;  2G35 A;  1EGX A;  3PVU A;  5HE3 A;  2E2X A;  1K5D B;  2R0D A;  4EJN A;  2MKR A;  4DX8 A;  3PVL A;  1MIX A;  4GMV A;  3VOQ A;  1IRS A;  3D8D A;  3GYO A;  3M1I B;  3A8Q A;  2N0Y A;  1MPH A;  2DTC A;  1WJ1 A;  4IAP A;  1FB8 A;  2X18 A;  3SV1 A;  5HE1 A;  3AJ4 A;  2CRF A;  3ULB A;  3V5W A;  5C6R A;  2GCJ A;  1DDW A;  1TQZ A;  2IFS A;  3P6A A;  5EFX A;  2DYN A; 
#chains in the Genus database with same CATH topology
 4KVG B;  2GCL A;  2KCJ A;  1V5P A;  3CIK A;  4DX9 0;  2YT1 A;  2P0D A;  3HIE A;  4HB2 B;  4QJ3 B;  1SHC A;  3PG7 A;  3HQC A;  1N3H A;  1T77 A;  3KRW A;  3DXC A;  5DHA B;  4A6H A;  3MDB C;  5LON B;  2ZPY A;  5I2S A;  4GMX B;  4MY6 A;  1W1D A;  2D11 A;  4EKU A;  4Z2N A;  2GJY A;  1Y19 B;  2K49 A;  1ZYI A;  4F7G A;  1U2B A;  1NI2 A;  1GG3 A;  5D3W A;  1OMW A;  3ODO A;  1X86 A;  4WSF A;  3NSU A;  1J19 A;  1W1H A;  1J0W A;  4WVF B;  4HAV B;  1DBH A;  2DLW A;  5DH9 B;  3WYF B;  4A6F B;  5GOW B;  2YVC A;  3HK0 A;  1B55 A;  1WG7 A;  1DDM A;  2YS5 A;  3G9W A;  3SNH A;  1U29 A;  1E5W A;  5HE0 A;  4IOY X;  4IFS A;  2W2X D;  2KUP A;  1X1F A;  1OQN A;  2Z4D A;  4HB3 B;  2J0J A;  2P0H A;  3HW2 B;  4P7I A;  1RJ2 A;  3FM8 C;  5KQ4 A;  3ZVR A;  1I7A A;  3SYX A;  5LG4 B;  2D9Z A;  1X11 A;  1UNQ A;  2D10 A;  1NTY A;  5JP4 A;  1FHX A;  4NY0 A;  4L6E A;  2Z0O A;  2YRY A;  2EMS A;  2Z13 A;  5I2M A;  2DKQ A;  2KR0 A;  1BTN A;  1FGZ A;  2MDX A;  2W2W A;  2J59 M;  1TJ6 A;  1V88 A;  1NTV A;  4A6K A;  1TXD A;  1XKE A;  3ZDT A;  2DX5 A;  1QQG A;  1FHW A;  2NZ8 B;  1ZVR A;  1X05 A;  4HAZ B;  3DXD A;  3U8Z A;  2COF A;  2M14 A;  4H8S A;  3BIN A;  2ELA A;  2YF0 A;  1U27 A;  1M7E A;  1XX0 A;  4TKN A;  4D0N B;  2D9W A;  1MAI A;  2P0F A;  2Z0Q A;  2DN6 A;  5J3Y A;  5D3Y A;  4YL8 A;  4ZRJ A;  3RCP A;  1DDV A;  3NWF A;  3OAN A;  2XQN M;  1K5G B;  2D4Q A;  4MT7 A;  4Z2M B;  1NU2 A;  2Q13 A;  3DCX A;  4QJ4 B;  2I1K A;  4K2O A;  5LOP B;  2D9X A;  4HAW B;  4B6H A;  2Y8F A;  1XD4 A;  5DHF B;  5D3X A;  1FGY A;  1EVH A;  2L2I A;  2ELB A;  1AQC A;  1WVH A;  2LOX A;  1MIZ B;  2W2X C;  1UNP A;  4WJ7 A;  2VRW B;  4NSW A;  2V76 A;  1KZ7 A;  1PMS A;  2UVM A;  2ZKM X;  1PFJ A;  5DI9 B;  5C5B B;  2CY5 A;  1FAO A;  2N23 A;  4GOU A;  1Z87 A;  3U7D A;  2NBV A;  5D3V A;  3BJI A;  4A6F A;  2COD A;  4K2P A;  2PZ1 A;  1BAK A;  2DA0 A;  2EJ8 A;  1V89 A;  1V5U A;  2LYD A;  3U12 A;  1M7R A;  1U5F A;  1ZSQ A;  1QC6 A;  1XR0 B;  2DHK A;  3D8E A;  3T06 A;  3TO1 A;  2I1J A;  3F0W A;  3QIJ A;  4F7H A;  1AWE A;  2RGN B;  4HB0 B;  2FJL A;  3A8P A;  2ROV A;  2YS1 A;  1UNR A;  2K8E A;  1WI1 A;  3PP2 A;  5HE2 A;  2D2Q A;  3DXE A;  2DFK A;  3SUZ A;  2CAY A;  2L1C A;  3TFM A;  2RVB B;  2KIE A;  2VKI A;  1OY2 A;  2LG1 A;  4HDQ A;  1P3R A;  1MKE A;  3NWD A;  4Y94 A;  2RLO A;  1MK7 B;  2MFQ A;  2R09 A;  5D27 A;  3TVV A;  4GN1 A;  3KY9 A;  3X23 A;  3FSS A;  2COA A;  3MPX A;  2D9V A;  1U5D A;  1P6S A;  2Y8G A;  3D8F A;  1UEF A;  2UZS A;  3ULC A;  2JP2 A;  1P5T A;  5FI1 A;  3PZD A;  1ZC4 B;  2RUK B;  4CSQ A;  1MI1 A;  5J3Q A;  4A5K A;  2COC A;  2J0M A;  3B77 A;  1FOE A;  5FI0 A;  3GYP A;  4K81 A;  2HTH B;  3QWM A;  3QBV B;  3LJU X;  4YON A;  5L81 A;  2I5F A;  1XCG A;  4EMO A;  4ZRI A;  2GUM A;  1ZM0 A;  4HAY B;  2DYQ A;  5JLJ B;  2QKM A;  4GPT B;  4HHV A;  4DBB A;  5KQ1 A;  2KGX B;  1Q67 A;  4C0A A;  4OSN A;  2Z0P A;  4DXA B;  2ROZ B;  2QKL A;  5CLL B;  3KRX A;  3VIA A;  5C16 A;  1ISN A;  4ZRK A;  3P7Z A;  2Y7B A;  4HAU B;  2VSZ A;  1MK9 B;  3SO6 A;  2M38 A;  2LOZ A;  2J0K A;  4CHM A;  5CLQ B;  1GC7 A;  2BCJ A;  2DHI A;  5C5B A;  2EC1 A;  4GXB A;  3PVW A;  5KCV A;  1SGH A;  3FEH A;  1W1G A;  1V61 A;  4GZU A;  1UPQ A;  1BWN A;  2K00 A;  2I5C A;  2R2Y A;  5IRS A;  1WJM A;  2K2U A;  4BBK A;  2KIG A;  2H7D A;  3ODW A;  4CYE A;  2RRF A;  2DKP A;  3AU4 A;  3KZ1 A;  3PEG A;  2DHJ A;  3HSA A;  2YT0 A;  2CY4 A;  3ML4 A;  2ADZ A;  3NW8 A;  3TCA A;  1KI1 B;  1DYN A;  1V5M A;  4PQ0 A;  4KAX B;  2DX1 A;  4HAX B;  2GS0 A;  1Y5O A;  2K2J A;  4XWX A;  2AEH A;  1LW3 A;  4QXA B;  4HAT B;  1H4R A;  1LB1 A;  1UPR A;  3AU5 A;  4OT1 A;  5DIF B;  3IVF A;  2AL6 A;  2D9Y A;  5JHG A;  2IYB A;  3CXB B;  4L1R A;  1BTK A;  1WGQ A;  3KSY A;  4KHB A;  5M4Y B;  2UZR A;  1EF1 A;  4TYZ A;  4HDO A;  2RNR B;  2OTX A;  4K17 A;  4KHB B;  5JHH A;  4MK0 A;  2YT2 A;  2FJU B;  3WA0 A;  4CHJ A;  1FHO A;  2LKO A;  2LUL A;  2YSZ A;  4DIX A;  3N7C A;  4KHA A;  3UZT A;  2Z14 A;  1H10 A;  1X1G A;  2NMB A;  2EMT A;  4GNK B;  3ODX A;  3NWA A;  1WGU A;  3A98 B;  3O96 A;  1DRO A;  3FVC A;  4QJ5 B;  3TW1 A;  1RRP B;  1XOD A;  3PSC A;  2YS3 A;  4F7U P;  3F5R A;  5J3T A;  2RSG A;  1EAZ A;  1U5E A;  2MWN B;  4PNK A;  2HE7 A;  4HB4 B;  1KZG A;  2P8V A;  1I2H A;  2H7E A;  3A58 A;  1U5G A;  4KHO A;  2OQB A;  3OHM B;  1PLS A;  5C79 A;  1GC6 A;  1ZC3 B;  2G35 A;  1EGX A;  3PVU A;  5HE3 A;  2E2X A;  1K5D B;  2R0D A;  4D6W A;  4EJN A;  2MKR A;  4DX8 A;  3PVL A;  1MIX A;  4GMV A;  3VOQ A;  1IRS A;  3D8D A;  3GYO A;  2Z59 A;  3M1I B;  3A8Q A;  2N0Y A;  1MPH A;  2DTC A;  1WJ1 A;  4IAP A;  1FB8 A;  2X18 A;  3SV1 A;  5HE1 A;  3AJ4 A;  2CRF A;  3ULB A;  3V5W A;  5C6R A;  2GCJ A;  1DDW A;  1TQZ A;  2IFS A;  3P6A A;  5EFX A;  2KUQ A;  2DYN A;  4HSI A; 
#chains in the Genus database with same CATH homology
 4KVG B;  2GCL A;  2KCJ A;  1V5P A;  3CIK A;  4DX9 0;  2YT1 A;  2P0D A;  4HB2 B;  1SHC A;  3PG7 A;  3HQC A;  1N3H A;  3KRW A;  5DHA B;  3DXC A;  4A6H A;  3MDB C;  5LON B;  2ZPY A;  4GMX B;  4MY6 A;  1W1D A;  2D11 A;  4EKU A;  4Z2N A;  2GJY A;  1Y19 B;  4F7G A;  1U2B A;  1NI2 A;  1GG3 A;  5D3W A;  1OMW A;  3ODO A;  1X86 A;  4WSF A;  3NSU A;  1J19 A;  1W1H A;  1J0W A;  4WVF B;  4HAV B;  1DBH A;  2DLW A;  5DH9 B;  3WYF B;  4A6F B;  5GOW B;  2YVC A;  3HK0 A;  1B55 A;  1WG7 A;  1DDM A;  2YS5 A;  3G9W A;  3SNH A;  1U29 A;  1E5W A;  5HE0 A;  4IOY X;  4IFS A;  2W2X D;  2KUP A;  1X1F A;  1OQN A;  4HB3 B;  2J0J A;  2P0H A;  3HW2 B;  4P7I A;  1RJ2 A;  3FM8 C;  5KQ4 A;  3ZVR A;  1I7A A;  3SYX A;  2D9Z A;  1X11 A;  1UNQ A;  2D10 A;  1NTY A;  5JP4 A;  1FHX A;  4NY0 A;  4L6E A;  2Z0O A;  2YRY A;  2EMS A;  2DKQ A;  1BTN A;  1FGZ A;  2MDX A;  2W2W A;  2J59 M;  1TJ6 A;  1V88 A;  1NTV A;  4A6K A;  1TXD A;  1XKE A;  3ZDT A;  2DX5 A;  1QQG A;  1FHW A;  2NZ8 B;  1ZVR A;  1X05 A;  4HAZ B;  3DXD A;  3U8Z A;  2COF A;  2M14 A;  4H8S A;  3BIN A;  2ELA A;  2YF0 A;  1U27 A;  1M7E A;  1XX0 A;  4TKN A;  4D0N B;  2D9W A;  1MAI A;  2P0F A;  2Z0Q A;  2DN6 A;  5J3Y A;  5D3Y A;  4YL8 A;  4ZRJ A;  3RCP A;  1DDV A;  3OAN A;  2XQN M;  1K5G B;  2D4Q A;  4MT7 A;  4Z2M B;  1NU2 A;  2Q13 A;  2I1K A;  4K2O A;  5LOP B;  2D9X A;  4HAW B;  4B6H A;  2Y8F A;  1XD4 A;  5DHF B;  5D3X A;  1FGY A;  1EVH A;  2L2I A;  2ELB A;  1AQC A;  1WVH A;  2LOX A;  1MIZ B;  2W2X C;  1UNP A;  4WJ7 A;  2VRW B;  4NSW A;  2V76 A;  1KZ7 A;  1PMS A;  2UVM A;  1PFJ A;  5DI9 B;  5C5B B;  2CY5 A;  1FAO A;  2N23 A;  1Z87 A;  3U7D A;  5D3V A;  3BJI A;  4A6F A;  2COD A;  4K2P A;  2PZ1 A;  1BAK A;  2DA0 A;  2EJ8 A;  1V89 A;  1V5U A;  2LYD A;  1M7R A;  1U5F A;  1ZSQ A;  1QC6 A;  1XR0 B;  2DHK A;  3D8E A;  3T06 A;  3TO1 A;  2I1J A;  3F0W A;  3QIJ A;  4F7H A;  1AWE A;  2RGN B;  4HB0 B;  2FJL A;  3A8P A;  2ROV A;  2YS1 A;  1UNR A;  1WI1 A;  3PP2 A;  5HE2 A;  2D2Q A;  3DXE A;  2DFK A;  3SUZ A;  2CAY A;  2L1C A;  3TFM A;  2RVB B;  2VKI A;  1OY2 A;  2LG1 A;  4HDQ A;  1P3R A;  1MKE A;  4Y94 A;  2RLO A;  1MK7 B;  2MFQ A;  2R09 A;  5D27 A;  3TVV A;  4GN1 A;  3KY9 A;  3X23 A;  3FSS A;  2COA A;  3MPX A;  2D9V A;  1U5D A;  1P6S A;  2Y8G A;  3D8F A;  1UEF A;  2UZS A;  3ULC A;  2JP2 A;  1P5T A;  5FI1 A;  3PZD A;  1ZC4 B;  2RUK B;  5J3Q A;  4A5K A;  2COC A;  2J0M A;  1FOE A;  5FI0 A;  3GYP A;  4K81 A;  2HTH B;  3QWM A;  3QBV B;  3LJU X;  4YON A;  5L81 A;  2I5F A;  1XCG A;  4EMO A;  4ZRI A;  1ZM0 A;  4HAY B;  2DYQ A;  5JLJ B;  2QKM A;  4GPT B;  4HHV A;  4DBB A;  5KQ1 A;  2KGX B;  1Q67 A;  4C0A A;  2Z0P A;  4DXA B;  2ROZ B;  2QKL A;  5CLL B;  3KRX A;  3VIA A;  5C16 A;  1ISN A;  4ZRK A;  3P7Z A;  2Y7B A;  4HAU B;  2VSZ A;  1MK9 B;  3SO6 A;  2M38 A;  2LOZ A;  2J0K A;  4CHM A;  5CLQ B;  1GC7 A;  2BCJ A;  2DHI A;  5C5B A;  2EC1 A;  4GXB A;  3PVW A;  5KCV A;  1SGH A;  3FEH A;  1W1G A;  1V61 A;  4GZU A;  1UPQ A;  1BWN A;  2K00 A;  2I5C A;  1WJM A;  2K2U A;  4BBK A;  2H7D A;  3ODW A;  4CYE A;  2DKP A;  3AU4 A;  3KZ1 A;  3PEG A;  2DHJ A;  2YT0 A;  2CY4 A;  3ML4 A;  2ADZ A;  3TCA A;  1KI1 B;  1DYN A;  1V5M A;  4PQ0 A;  4KAX B;  2DX1 A;  4HAX B;  2GS0 A;  1Y5O A;  2K2J A;  4XWX A;  2AEH A;  1LW3 A;  4HAT B;  1H4R A;  1LB1 A;  1UPR A;  3AU5 A;  5DIF B;  3IVF A;  2AL6 A;  2D9Y A;  5JHG A;  2IYB A;  3CXB B;  1BTK A;  1WGQ A;  3KSY A;  2UZR A;  1EF1 A;  4TYZ A;  4HDO A;  2RNR B;  2OTX A;  4K17 A;  4KHB B;  5JHH A;  4MK0 A;  3WA0 A;  4CHJ A;  1FHO A;  2LKO A;  2LUL A;  2YSZ A;  3N7C A;  4KHA A;  3UZT A;  1H10 A;  1X1G A;  2NMB A;  2EMT A;  3ODX A;  1WGU A;  3A98 B;  3O96 A;  1DRO A;  3TW1 A;  1RRP B;  1XOD A;  3PSC A;  2YS3 A;  4F7U P;  3F5R A;  5J3T A;  2RSG A;  1EAZ A;  1U5E A;  2MWN B;  4PNK A;  2HE7 A;  4HB4 B;  1KZG A;  2P8V A;  1I2H A;  2H7E A;  1U5G A;  4KHO A;  2OQB A;  1PLS A;  5C79 A;  1GC6 A;  1ZC3 B;  2G35 A;  1EGX A;  3PVU A;  5HE3 A;  2E2X A;  1K5D B;  2R0D A;  4EJN A;  2MKR A;  4DX8 A;  3PVL A;  1MIX A;  4GMV A;  3VOQ A;  1IRS A;  3D8D A;  3GYO A;  3M1I B;  3A8Q A;  2N0Y A;  1MPH A;  2DTC A;  1WJ1 A;  4IAP A;  1FB8 A;  2X18 A;  3SV1 A;  5HE1 A;  3AJ4 A;  2CRF A;  3ULB A;  3V5W A;  5C6R A;  2GCJ A;  1DDW A;  1TQZ A;  2IFS A;  3P6A A;  5EFX A;  2DYN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...