1XX0A

Structure of the c-terminal ph domain of human pleckstrin
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
117
structure length
117
Chain Sequence
DVILKEEFRGVIIKQGCLLKQGHRRKNWKVRKFILREDPAYLHYYDPAGAEDPLGAIHLRGCVVTSVESNSNGRKSEEENLFEIITADEVHYFLQAATPKERTEWIKAIQMASRTGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Lipid binding protein
molecule keywords Pleckstrin
publication title Structure and phosphatidylinositol-(3,4)-bisphosphate binding of the C-terminal PH domain of human pleckstrin
pubmed doi rcsb
source organism Homo sapiens
total genus 25
structure length 117
sequence length 117
ec nomenclature
pdb deposition date 2004-11-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00169 PH PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1xx0A00
4HAZB 2N0YA 1XR0B 4WJ7A 3TFMA 3D8FA 1FOEA 4BBKA 3TW1A 4F7UP 4EMOA 2GJYA 3F5RA 2E2XA 2Y8GA 4EJNA 4KHBB 1DBHA 1Z87A 3AU4A 3PP2A 1H4RA 3SV1A 3VIAA 1V88A 4WSFA 1NTVA 1I7AA 2Q13A 4A5KA 5FI1A 3KSYA 2DX1A 2M38A 3FM8C 3SO6A 3ODWA 5DH9B 3N7CA 4K81A 2D9VA 5J3YA 3DXDA 1FHWA 1V5UA 1M7EA 1XKEA 2GCJA 1BAKA 4NY0A 5C79A 2NZ8B 2H7EA 1WJMA 1NTYA 2LYDA 1UEFA 5EFXA 4PQ0A 2DFKA 2HE7A 5D3WA 2MKRA 3PVLA 4NSWA 5GOWB 3HQCA 1OY2A 4L6EA 3RCPA 2NMBA 1K5DB 2RNRB 4P7IA 3TVVA 3QBVB 1WVHA 2EMTA 5C6RA 4KHOA 2DHJA 3T06A 3SYXA 2DLWA 3ZVRA 2LOZA 2DHKA 5FI0A 4D0NB 3ULBA 4XWXA 2XQNM 3ULCA 4HAYB 1MK7B 3DXCA 2IYBA 3PG7A 2EJ8A 4EKUA 4HAUB 2L2IA 2RGNB 4ZRJA 4K2OA 4GMVA 1DDMA 2D9ZA 4A6FB 2D9WA 2D11A 5CLQB 4CYEA 1PFJA 4TKNA 1V5MA 1PMSA 3AJ4A 2N23A 1RJ2A 2COFA 1X05A 2YS1A 1Q67A 4HB2B 2CODA 2GS0A 5HE0A 2DTCA 2KUPA 1LW3A 2LKOA 3MPXA 4H8SA 2H7DA 4GZUA 5DHAB 1U5GA 2I1KA 3QIJA 1XODA 2JP2A 5CLLB 4DX90 5C5BA 5DIFB 4CHJA 3OANA 2P8VA 1BTNA 2DX5A 1DROA 4GMXB 2OQBA 3P7ZA 3UZTA 5JHHA 2PZ1A 2UVMA 2CY5A 2YRYA 1NU2A 1AQCA 2DN6A 2HTHB 1J19A 4MT7A 2OTXA 3PVWA 2J0MA 4WVFB 2K2JA 3A8PA 5JLJB 1EAZA 1P6SA 3QWMA 4IAPA 3X23A 1SGHA 2DHIA 1ZC4B 4F7HA 1I2HA 2QKLA 1WJ1A 1W1DA 2D2QA 3KY9A 2W2WA 1J0WA 2LULA 3PSCA 2K00A 1AWEA 5DHFB 1P3RA 1X11A 2J0KA 4ZRKA 2RSGA 5HE1A 1H10A 5D3YA 4Z2MB 1V61A 1GG3A 3ML4A 1PLSA 4GXBA 2MDXA 1DYNA 2X18A 2YS5A 2YVCA 4HAWB 3ZDTA 4TYZA 1LB1A 1V89A 3U8ZA 4DX8A 4HDOA 2BCJA 2EC1A 3O96A 4IFSA 5HE2A 1GC7A 3KRWA 1W1HA 4MK0A 2J0JA 2QKMA 2M14A 4MY6A 1FHOA 2AEHA 1WG7A 3GYPA 1U5EA 5D27A 2RUKB 2DYQA 3V5WA 4GN1A 2D9YA 1UPRA 1ZVRA 1Y19B 3KZ1A 5J3QA 2KGXB 2UZRA 1U27A 2YF0A 2R0DA 4HAXB 1Y5OA 3ODXA 3PEGA 2LOXA 1MKEA 4GPTB 4YL8A 4PNKA 4A6KA 5LONB 2W2XC 1EF1A 1DDVA 2W2XD 5D3VA 3FSSA 5DI9B 5KQ4A 1WGUA 4F7GA 1RRPB 3BINA 1ZC3B 5C16A 1QQGA 1M7RA 1X86A 1UPQA 1X1FA 2VSZA 2ADZA 1BWNA 3U7DA 1FB8A 4HB0B 1SHCA 2IFSA 4K17A 2P0FA 3WYFB 1UNQA 5JHGA 1UNRA 3F0WA 2I1JA 4HB3B 1B55A 1XCGA 3P6AA 3MDBC 4HHVA 3G9WA 1TQZA 4HB4B 4HATB 2RLOA 3HK0A 2FJLA 4KVGB 4B6HA 3CIKA 4CHMA 2ELAA 2COCA 1ZM0A 1U5DA 1U2BA 2YT1A 1W1GA 2GCLA 3TCAA 2P0HA 4IOYX 1XX0A 3A98B 3SUZA 2ELBA 2G35A 3D8DA 3BJIA 2CAYA 2I5CA 2KCJA 1BTKA 3GYOA 1MK9B 1WGQA 4KHAA 1KZGA 2J59M 5LOPB 1KI1B 5J3TA 1FGZA 1OQNA 2L1CA 2P0DA 1NI2A 2DKPA 3FEHA 2YSZA 4Y94A 5KQ1A 3PVUA 4HAVB 2Z0QA 1E5WA 5D3XA 4K2PA 2K2UA 2Z0PA 2VKIA 1K5GB 2ROZB 2UZSA 3SNHA 2D9XA 2V76A 2CRFA 1KZ7A 5HE3A 2LG1A 1MAIA 2DKQA 2YT0A 3CXBB 5JP4A 1P5TA 2MFQA 3VOQA 2DYNA 1DDWA 1TJ6A 2AL6A 1EVHA 2ROVA 2VRWB 3PZDA 1GC6A 2Y8FA 1IRSA 1V5PA 1QC6A 4YONA 1N3HA 2I5FA 4A6FA 1U5FA 4DBBA 2CY4A 2MWNB 3NSUA 1MPHA 3TO1A 1FGYA 4HDQA 3A8QA 1X1GA 2Y7BA 4DXAB 1WI1A 2EMSA 1FAOA 1TXDA 2D10A 4ZRIA 3ODOA 3KRXA 2DA0A 2Z0OA 2ZPYA 2YS3A 1OMWA 4A6HA 3D8EA 3DXEA 4Z2NA 1MIZB 3WA0A 3IVFA 1XD4A 1MIXA 1FHXA 2COAA 1EGXA 3HW2B 5L81A 1UNPA 4C0AA 5KCVA 3LJUX 2R09A 3M1IB 4KAXB 1U29A 3AU5A 5C5BB 2D4QA 1ZSQA 2RVBB 1ISNA
chains in the Genus database with same CATH superfamily
4HAZB 2N0YA 1XR0B 4WJ7A 3TFMA 3D8FA 1FOEA 4BBKA 3TW1A 4D6WA 4F7UP 4EMOA 2GJYA 3F5RA 2E2XA 2Y8GA 4EJNA 2YT2A 4L1RA 4KHBB 1DBHA 2KUQA 1Z87A 3AU4A 3PP2A 1H4RA 3SV1A 3VIAA 1V88A 4WSFA 1NTVA 1I7AA 2Q13A 4A5KA 5FI1A 3KSYA 2DX1A 2M38A 3FM8C 3SO6A 3ODWA 5DH9B 3N7CA 4K81A 2D9VA 5J3YA 3DXDA 1FHWA 4HSIA 1V5UA 1M7EA 1XKEA 2GCJA 1BAKA 4NY0A 5C79A 2NZ8B 2H7EA 1WJMA 1NTYA 2LYDA 1UEFA 5EFXA 4PQ0A 3NW8A 2DFKA 2HE7A 5D3WA 2MKRA 3PVLA 4NSWA 5GOWB 3A58A 2R2YA 3HQCA 1OY2A 3NWFA 4L6EA 3RCPA 2NMBA 1MI1A 1K5DB 2RNRB 4P7IA 3TVVA 3QBVB 1WVHA 2EMTA 5C6RA 4KHOA 2DHJA 3T06A 3SYXA 2DLWA 3ZVRA 2LOZA 2DHKA 5FI0A 4D0NB 3ULBA 5I2MA 4XWXA 2XQNM 3ULCA 4HAYB 1MK7B 3U12A 3DXCA 2IYBA 3PG7A 2EJ8A 4EKUA 4HAUB 2L2IA 2RGNB 4OSNA 4ZRJA 2NBVA 4K2OA 2FJUB 4GMVA 1DDMA 2D9ZA 4A6FB 2D9WA 2D11A 5CLQB 4CYEA 1PFJA 4TKNA 1V5MA 1PMSA 3AJ4A 2N23A 1RJ2A 2COFA 1X05A 2YS1A 1Q67A 2KIGA 4HB2B 2CODA 2GS0A 5HE0A 2DTCA 2KUPA 1LW3A 2LKOA 2K49A 3MPXA 4H8SA 2H7DA 4GZUA 5DHAB 1U5GA 2I1KA 3QIJA 1XODA 2Z13A 2JP2A 5CLLB 4QXAB 4DX90 5C5BA 5DIFB 4CHJA 3OANA 2P8VA 1BTNA 2DX5A 1DROA 4GMXB 5I2SA 2OQBA 3P7ZA 3UZTA 5JHHA 2PZ1A 4GOUA 2UVMA 2CY5A 2YRYA 1NU2A 1AQCA 2DN6A 2HTHB 1J19A 4KHBA 4MT7A 2OTXA 3PVWA 2J0MA 4WVFB 2K2JA 3A8PA 5JLJB 1EAZA 1P6SA 3QWMA 4IAPA 3X23A 1SGHA 4DIXA 2DHIA 1ZC4B 4F7HA 1I2HA 2QKLA 1WJ1A 1W1DA 2D2QA 3KY9A 2W2WA 1J0WA 2LULA 3PSCA 2K00A 1AWEA 5DHFB 1P3RA 1X11A 4QJ5B 2J0KA 4ZRKA 2RSGA 5HE1A 1H10A 5D3YA 4Z2MB 1V61A 3FVCA 1GG3A 3ML4A 5M4YB 1PLSA 4GXBA 4GNKB 2MDXA 1DYNA 2X18A 2YS5A 2YVCA 4HAWB 3ZDTA 4TYZA 1LB1A 1V89A 3U8ZA 4DX8A 4HDOA 2BCJA 2EC1A 3O96A 4IFSA 5HE2A 1GC7A 3KRWA 1W1HA 4MK0A 2J0JA 2QKMA 2M14A 4MY6A 1FHOA 2AEHA 1WG7A 3GYPA 1U5EA 5D27A 2RUKB 2DYQA 3V5WA 4GN1A 2D9YA 1UPRA 1ZVRA 1Y19B 2GUMA 3KZ1A 5J3QA 2KGXB 2UZRA 1U27A 2YF0A 2R0DA 3NWDA 4HAXB 1Y5OA 4OT1A 3ODXA 3PEGA 2LOXA 1MKEA 4GPTB 4YL8A 4PNKA 4A6KA 5LONB 2W2XC 1EF1A 1DDVA 2W2XD 5D3VA 3FSSA 5DI9B 2K8EA 5KQ4A 1WGUA 3HSAA 4F7GA 1RRPB 3BINA 1ZC3B 5C16A 1QQGA 1M7RA 1X86A 1UPQA 4QJ4B 1X1FA 2VSZA 2ADZA 1BWNA 3U7DA 1FB8A 4HB0B 1SHCA 2IFSA 4K17A 2P0FA 3WYFB 1UNQA 5JHGA 1UNRA 3F0WA 2I1JA 4HB3B 1B55A 1XCGA 3P6AA 3MDBC 4HHVA 3G9WA 1TQZA 4HB4B 2Z4DA 4HATB 2Z14A 2RLOA 3HK0A 2FJLA 4KVGB 4B6HA 3CIKA 4CHMA 2ELAA 2COCA 1ZM0A 1U5DA 1U2BA 2YT1A 2Z59A 1W1GA 3HIEA 2GCLA 3TCAA 2P0HA 4IOYX 1XX0A 5LG4B 3A98B 3SUZA 2ELBA 2G35A 3D8DA 3BJIA 2CAYA 2I5CA 2KCJA 1BTKA 3GYOA 1MK9B 1WGQA 4KHAA 1KZGA 2J59M 5LOPB 1ZYIA 1KI1B 5J3TA 1FGZA 1OQNA 2L1CA 2P0DA 1NI2A 2RRFA 2DKPA 3NWAA 3FEHA 2YSZA 4Y94A 5KQ1A 3PVUA 4HAVB 2Z0QA 1E5WA 5D3XA 4K2PA 2K2UA 2Z0PA 2VKIA 1K5GB 2ROZB 2UZSA 3SNHA 2D9XA 2V76A 2CRFA 1KZ7A 5HE3A 2LG1A 1MAIA 2DKQA 2YT0A 3CXBB 5JP4A 1P5TA 2KR0A 2MFQA 2ZKMX 3VOQA 2DYNA 1DDWA 1TJ6A 2AL6A 1EVHA 2ROVA 2VRWB 3PZDA 4QJ3B 1GC6A 2Y8FA 1IRSA 1V5PA 1QC6A 4YONA 1N3HA 2I5FA 4A6FA 1U5FA 4DBBA 2CY4A 2MWNB 3NSUA 1MPHA 3TO1A 1FGYA 4HDQA 3A8QA 1X1GA 2Y7BA 4DXAB 3OHMB 1WI1A 2EMSA 1FAOA 1TXDA 2D10A 4ZRIA 3ODOA 3KRXA 2DA0A 2Z0OA 2ZPYA 2YS3A 1OMWA 3B77A 4A6HA 3D8EA 5IRSA 3DXEA 1T77A 4Z2NA 1MIZB 3WA0A 3IVFA 1XD4A 1MIXA 1FHXA 2COAA 1EGXA 3HW2B 4CSQA 2KIEA 3DCXA 5L81A 1UNPA 4C0AA 5KCVA 3LJUX 2R09A 3M1IB 4KAXB 1U29A 3AU5A 5C5BB 2D4QA 1ZSQA 2RVBB 1ISNA
chains in the Genus database with same CATH topology
4HAZB 2N0YA 1XR0B 4WJ7A 3TFMA 3D8FA 1FOEA 4BBKA 3TW1A 4F7UP 4EMOA 2GJYA 3F5RA 2E2XA 2Y8GA 4EJNA 4KHBB 1DBHA 1Z87A 3AU4A 3PP2A 1H4RA 3SV1A 3VIAA 1V88A 4WSFA 1NTVA 1I7AA 2Q13A 4A5KA 5FI1A 3KSYA 2DX1A 2M38A 3FM8C 3SO6A 3ODWA 5DH9B 3N7CA 4K81A 2D9VA 5J3YA 3DXDA 1FHWA 1V5UA 1M7EA 1XKEA 2GCJA 1BAKA 4NY0A 5C79A 2NZ8B 2H7EA 1WJMA 1NTYA 2LYDA 1UEFA 5EFXA 4PQ0A 2DFKA 2HE7A 5D3WA 2MKRA 3PVLA 4NSWA 5GOWB 3HQCA 1OY2A 4L6EA 3RCPA 2NMBA 1K5DB 2RNRB 4P7IA 3TVVA 3QBVB 1WVHA 2EMTA 5C6RA 4KHOA 2DHJA 3T06A 3SYXA 2DLWA 3ZVRA 2LOZA 2DHKA 5FI0A 4D0NB 3ULBA 4XWXA 2XQNM 3ULCA 4HAYB 1MK7B 3DXCA 2IYBA 3PG7A 2EJ8A 4EKUA 4HAUB 2L2IA 2RGNB 4ZRJA 4K2OA 4GMVA 1DDMA 2D9ZA 4A6FB 2D9WA 2D11A 5CLQB 4CYEA 1PFJA 4TKNA 1V5MA 1PMSA 3AJ4A 2N23A 1RJ2A 2COFA 1X05A 2YS1A 1Q67A 4HB2B 2CODA 2GS0A 5HE0A 2DTCA 2KUPA 1LW3A 2LKOA 3MPXA 4H8SA 2H7DA 4GZUA 5DHAB 1U5GA 2I1KA 3QIJA 1XODA 2JP2A 5CLLB 4DX90 5C5BA 5DIFB 4CHJA 3OANA 2P8VA 1BTNA 2DX5A 1DROA 4GMXB 2OQBA 3P7ZA 3UZTA 5JHHA 2PZ1A 2UVMA 2CY5A 2YRYA 1NU2A 1AQCA 2DN6A 2HTHB 1J19A 4MT7A 2OTXA 3PVWA 2J0MA 4WVFB 2K2JA 3A8PA 5JLJB 1EAZA 1P6SA 3QWMA 4IAPA 3X23A 1SGHA 2DHIA 1ZC4B 4F7HA 1I2HA 2QKLA 1WJ1A 1W1DA 2D2QA 3KY9A 2W2WA 1J0WA 2LULA 3PSCA 2K00A 1AWEA 5DHFB 1P3RA 1X11A 2J0KA 4ZRKA 2RSGA 5HE1A 1H10A 5D3YA 4Z2MB 1V61A 1GG3A 3ML4A 1PLSA 4GXBA 2MDXA 1DYNA 2X18A 2YS5A 2YVCA 4HAWB 3ZDTA 4TYZA 1LB1A 1V89A 3U8ZA 4DX8A 4HDOA 2BCJA 2EC1A 3O96A 4IFSA 5HE2A 1GC7A 3KRWA 1W1HA 4MK0A 2J0JA 2QKMA 2M14A 4MY6A 1FHOA 2AEHA 1WG7A 3GYPA 1U5EA 5D27A 2RUKB 2DYQA 3V5WA 4GN1A 2D9YA 1UPRA 1ZVRA 1Y19B 3KZ1A 5J3QA 2KGXB 2UZRA 1U27A 2YF0A 2R0DA 4HAXB 1Y5OA 3ODXA 3PEGA 2LOXA 1MKEA 4GPTB 4YL8A 4PNKA 4A6KA 5LONB 2W2XC 1EF1A 1DDVA 2W2XD 5D3VA 3FSSA 5DI9B 5KQ4A 1WGUA 4F7GA 1RRPB 3BINA 1ZC3B 5C16A 1QQGA 1M7RA 1X86A 1UPQA 1X1FA 2VSZA 2ADZA 1BWNA 3U7DA 1FB8A 4HB0B 1SHCA 2IFSA 4K17A 2P0FA 3WYFB 1UNQA 5JHGA 1UNRA 3F0WA 2I1JA 4HB3B 1B55A 1XCGA 3P6AA 3MDBC 4HHVA 3G9WA 1TQZA 4HB4B 4HATB 2RLOA 3HK0A 2FJLA 4KVGB 4B6HA 3CIKA 4CHMA 2ELAA 2COCA 1ZM0A 1U5DA 1U2BA 2YT1A 1W1GA 2GCLA 3TCAA 2P0HA 4IOYX 1XX0A 3A98B 3SUZA 2ELBA 2G35A 3D8DA 3BJIA 2CAYA 2I5CA 2KCJA 1BTKA 3GYOA 1MK9B 1WGQA 4KHAA 1KZGA 2J59M 5LOPB 1KI1B 5J3TA 1FGZA 1OQNA 2L1CA 2P0DA 1NI2A 2DKPA 3FEHA 2YSZA 4Y94A 5KQ1A 3PVUA 4HAVB 2Z0QA 1E5WA 5D3XA 4K2PA 2K2UA 2Z0PA 2VKIA 1K5GB 2ROZB 2UZSA 3SNHA 2D9XA 2V76A 2CRFA 1KZ7A 5HE3A 2LG1A 1MAIA 2DKQA 2YT0A 3CXBB 5JP4A 1P5TA 2MFQA 3VOQA 2DYNA 1DDWA 1TJ6A 2AL6A 1EVHA 2ROVA 2VRWB 3PZDA 1GC6A 2Y8FA 1IRSA 1V5PA 1QC6A 4YONA 1N3HA 2I5FA 4A6FA 1U5FA 4DBBA 2CY4A 2MWNB 3NSUA 1MPHA 3TO1A 1FGYA 4HDQA 3A8QA 1X1GA 2Y7BA 4DXAB 1WI1A 2EMSA 1FAOA 1TXDA 2D10A 4ZRIA 3ODOA 3KRXA 2DA0A 2Z0OA 2ZPYA 2YS3A 1OMWA 4A6HA 3D8EA 3DXEA 4Z2NA 1MIZB 3WA0A 3IVFA 1XD4A 1MIXA 1FHXA 2COAA 1EGXA 3HW2B 5L81A 1UNPA 4C0AA 5KCVA 3LJUX 2R09A 3M1IB 4KAXB 1U29A 3AU5A 5C5BB 2D4QA 1ZSQA 2RVBB 1ISNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HAZ B;  2N0Y A;  1XR0 B;  4WJ7 A;  3TFM A;  3D8F A;  1FOE A;  4BBK A;  3TW1 A;  4F7U P;  4EMO A;  2GJY A;  3F5R A;  2E2X A;  2Y8G A;  4EJN A;  4KHB B;  1DBH A;  1Z87 A;  3AU4 A;  3PP2 A;  1H4R A;  3SV1 A;  3VIA A;  1V88 A;  4WSF A;  1NTV A;  1I7A A;  2Q13 A;  4A5K A;  5FI1 A;  3KSY A;  2DX1 A;  2M38 A;  3FM8 C;  3SO6 A;  3ODW A;  5DH9 B;  3N7C A;  4K81 A;  2D9V A;  5J3Y A;  3DXD A;  1FHW A;  1V5U A;  1M7E A;  1XKE A;  2GCJ A;  1BAK A;  4NY0 A;  5C79 A;  2NZ8 B;  2H7E A;  1WJM A;  1NTY A;  2LYD A;  1UEF A;  5EFX A;  4PQ0 A;  2DFK A;  2HE7 A;  5D3W A;  2MKR A;  3PVL A;  4NSW A;  5GOW B;  3HQC A;  1OY2 A;  4L6E A;  3RCP A;  2NMB A;  1K5D B;  2RNR B;  4P7I A;  3TVV A;  3QBV B;  1WVH A;  2EMT A;  5C6R A;  4KHO A;  2DHJ A;  3T06 A;  3SYX A;  2DLW A;  3ZVR A;  2LOZ A;  2DHK A;  5FI0 A;  4D0N B;  3ULB A;  4XWX A;  2XQN M;  3ULC A;  4HAY B;  1MK7 B;  3DXC A;  2IYB A;  3PG7 A;  2EJ8 A;  4EKU A;  4HAU B;  2L2I A;  2RGN B;  4ZRJ A;  4K2O A;  4GMV A;  1DDM A;  2D9Z A;  4A6F B;  2D9W A;  2D11 A;  5CLQ B;  4CYE A;  1PFJ A;  4TKN A;  1V5M A;  1PMS A;  3AJ4 A;  2N23 A;  1RJ2 A;  2COF A;  1X05 A;  2YS1 A;  1Q67 A;  4HB2 B;  2COD A;  2GS0 A;  5HE0 A;  2DTC A;  2KUP A;  1LW3 A;  2LKO A;  3MPX A;  4H8S A;  2H7D A;  4GZU A;  5DHA B;  1U5G A;  2I1K A;  3QIJ A;  1XOD A;  2JP2 A;  5CLL B;  4DX9 0;  5C5B A;  5DIF B;  4CHJ A;  3OAN A;  2P8V A;  1BTN A;  2DX5 A;  1DRO A;  4GMX B;  2OQB A;  3P7Z A;  3UZT A;  5JHH A;  2PZ1 A;  2UVM A;  2CY5 A;  2YRY A;  1NU2 A;  1AQC A;  2DN6 A;  2HTH B;  1J19 A;  4MT7 A;  2OTX A;  3PVW A;  2J0M A;  4WVF B;  2K2J A;  3A8P A;  5JLJ B;  1EAZ A;  1P6S A;  3QWM A;  4IAP A;  3X23 A;  1SGH A;  2DHI A;  1ZC4 B;  4F7H A;  1I2H A;  2QKL A;  1WJ1 A;  1W1D A;  2D2Q A;  3KY9 A;  2W2W A;  1J0W A;  2LUL A;  3PSC A;  2K00 A;  1AWE A;  5DHF B;  1P3R A;  1X11 A;  2J0K A;  4ZRK A;  2RSG A;  5HE1 A;  1H10 A;  5D3Y A;  4Z2M B;  1V61 A;  1GG3 A;  3ML4 A;  1PLS A;  4GXB A;  2MDX A;  1DYN A;  2X18 A;  2YS5 A;  2YVC A;  4HAW B;  3ZDT A;  4TYZ A;  1LB1 A;  1V89 A;  3U8Z A;  4DX8 A;  4HDO A;  2BCJ A;  2EC1 A;  3O96 A;  4IFS A;  5HE2 A;  1GC7 A;  3KRW A;  1W1H A;  4MK0 A;  2J0J A;  2QKM A;  2M14 A;  4MY6 A;  1FHO A;  2AEH A;  1WG7 A;  3GYP A;  1U5E A;  5D27 A;  2RUK B;  2DYQ A;  3V5W A;  4GN1 A;  2D9Y A;  1UPR A;  1ZVR A;  1Y19 B;  3KZ1 A;  5J3Q A;  2KGX B;  2UZR A;  1U27 A;  2YF0 A;  2R0D A;  4HAX B;  1Y5O A;  3ODX A;  3PEG A;  2LOX A;  1MKE A;  4GPT B;  4YL8 A;  4PNK A;  4A6K A;  5LON B;  2W2X C;  1EF1 A;  1DDV A;  2W2X D;  5D3V A;  3FSS A;  5DI9 B;  5KQ4 A;  1WGU A;  4F7G A;  1RRP B;  3BIN A;  1ZC3 B;  5C16 A;  1QQG A;  1M7R A;  1X86 A;  1UPQ A;  1X1F A;  2VSZ A;  2ADZ A;  1BWN A;  3U7D A;  1FB8 A;  4HB0 B;  1SHC A;  2IFS A;  4K17 A;  2P0F A;  3WYF B;  1UNQ A;  5JHG A;  1UNR A;  3F0W A;  2I1J A;  4HB3 B;  1B55 A;  1XCG A;  3P6A A;  3MDB C;  4HHV A;  3G9W A;  1TQZ A;  4HB4 B;  4HAT B;  2RLO A;  3HK0 A;  2FJL A;  4KVG B;  4B6H A;  3CIK A;  4CHM A;  2ELA A;  2COC A;  1ZM0 A;  1U5D A;  1U2B A;  2YT1 A;  1W1G A;  2GCL A;  3TCA A;  2P0H A;  4IOY X;  1XX0 A;  3A98 B;  3SUZ A;  2ELB A;  2G35 A;  3D8D A;  3BJI A;  2CAY A;  2I5C A;  2KCJ A;  1BTK A;  3GYO A;  1MK9 B;  1WGQ A;  4KHA A;  1KZG A;  2J59 M;  5LOP B;  1KI1 B;  5J3T A;  1FGZ A;  1OQN A;  2L1C A;  2P0D A;  1NI2 A;  2DKP A;  3FEH A;  2YSZ A;  4Y94 A;  5KQ1 A;  3PVU A;  4HAV B;  2Z0Q A;  1E5W A;  5D3X A;  4K2P A;  2K2U A;  2Z0P A;  2VKI A;  1K5G B;  2ROZ B;  2UZS A;  3SNH A;  2D9X A;  2V76 A;  2CRF A;  1KZ7 A;  5HE3 A;  2LG1 A;  1MAI A;  2DKQ A;  2YT0 A;  3CXB B;  5JP4 A;  1P5T A;  2MFQ A;  3VOQ A;  2DYN A;  1DDW A;  1TJ6 A;  2AL6 A;  1EVH A;  2ROV A;  2VRW B;  3PZD A;  1GC6 A;  2Y8F A;  1IRS A;  1V5P A;  1QC6 A;  4YON A;  1N3H A;  2I5F A;  4A6F A;  1U5F A;  4DBB A;  2CY4 A;  2MWN B;  3NSU A;  1MPH A;  3TO1 A;  1FGY A;  4HDQ A;  3A8Q A;  1X1G A;  2Y7B A;  4DXA B;  1WI1 A;  2EMS A;  1FAO A;  1TXD A;  2D10 A;  4ZRI A;  3ODO A;  3KRX A;  2DA0 A;  2Z0O A;  2ZPY A;  2YS3 A;  1OMW A;  4A6H A;  3D8E A;  3DXE A;  4Z2N A;  1MIZ B;  3WA0 A;  3IVF A;  1XD4 A;  1MIX A;  1FHX A;  2COA A;  1EGX A;  3HW2 B;  5L81 A;  1UNP A;  4C0A A;  5KCV A;  3LJU X;  2R09 A;  3M1I B;  4KAX B;  1U29 A;  3AU5 A;  5C5B B;  2D4Q A;  1ZSQ A;  2RVB B;  1ISN A; 
#chains in the Genus database with same CATH topology
 4HAZ B;  2N0Y A;  1XR0 B;  4WJ7 A;  3TFM A;  3D8F A;  1FOE A;  4BBK A;  3TW1 A;  4D6W A;  4F7U P;  4EMO A;  2GJY A;  3F5R A;  2E2X A;  2Y8G A;  4EJN A;  2YT2 A;  4L1R A;  4KHB B;  1DBH A;  2KUQ A;  1Z87 A;  3AU4 A;  3PP2 A;  1H4R A;  3SV1 A;  3VIA A;  1V88 A;  4WSF A;  1NTV A;  1I7A A;  2Q13 A;  4A5K A;  5FI1 A;  3KSY A;  2DX1 A;  2M38 A;  3FM8 C;  3SO6 A;  3ODW A;  5DH9 B;  3N7C A;  4K81 A;  2D9V A;  5J3Y A;  3DXD A;  1FHW A;  4HSI A;  1V5U A;  1M7E A;  1XKE A;  2GCJ A;  1BAK A;  4NY0 A;  5C79 A;  2NZ8 B;  2H7E A;  1WJM A;  1NTY A;  2LYD A;  1UEF A;  5EFX A;  4PQ0 A;  3NW8 A;  2DFK A;  2HE7 A;  5D3W A;  2MKR A;  3PVL A;  4NSW A;  5GOW B;  3A58 A;  2R2Y A;  3HQC A;  1OY2 A;  3NWF A;  4L6E A;  3RCP A;  2NMB A;  1MI1 A;  1K5D B;  2RNR B;  4P7I A;  3TVV A;  3QBV B;  1WVH A;  2EMT A;  5C6R A;  4KHO A;  2DHJ A;  3T06 A;  3SYX A;  2DLW A;  3ZVR A;  2LOZ A;  2DHK A;  5FI0 A;  4D0N B;  3ULB A;  5I2M A;  4XWX A;  2XQN M;  3ULC A;  4HAY B;  1MK7 B;  3U12 A;  3DXC A;  2IYB A;  3PG7 A;  2EJ8 A;  4EKU A;  4HAU B;  2L2I A;  2RGN B;  4OSN A;  4ZRJ A;  2NBV A;  4K2O A;  2FJU B;  4GMV A;  1DDM A;  2D9Z A;  4A6F B;  2D9W A;  2D11 A;  5CLQ B;  4CYE A;  1PFJ A;  4TKN A;  1V5M A;  1PMS A;  3AJ4 A;  2N23 A;  1RJ2 A;  2COF A;  1X05 A;  2YS1 A;  1Q67 A;  2KIG A;  4HB2 B;  2COD A;  2GS0 A;  5HE0 A;  2DTC A;  2KUP A;  1LW3 A;  2LKO A;  2K49 A;  3MPX A;  4H8S A;  2H7D A;  4GZU A;  5DHA B;  1U5G A;  2I1K A;  3QIJ A;  1XOD A;  2Z13 A;  2JP2 A;  5CLL B;  4QXA B;  4DX9 0;  5C5B A;  5DIF B;  4CHJ A;  3OAN A;  2P8V A;  1BTN A;  2DX5 A;  1DRO A;  4GMX B;  5I2S A;  2OQB A;  3P7Z A;  3UZT A;  5JHH A;  2PZ1 A;  4GOU A;  2UVM A;  2CY5 A;  2YRY A;  1NU2 A;  1AQC A;  2DN6 A;  2HTH B;  1J19 A;  4KHB A;  4MT7 A;  2OTX A;  3PVW A;  2J0M A;  4WVF B;  2K2J A;  3A8P A;  5JLJ B;  1EAZ A;  1P6S A;  3QWM A;  4IAP A;  3X23 A;  1SGH A;  4DIX A;  2DHI A;  1ZC4 B;  4F7H A;  1I2H A;  2QKL A;  1WJ1 A;  1W1D A;  2D2Q A;  3KY9 A;  2W2W A;  1J0W A;  2LUL A;  3PSC A;  2K00 A;  1AWE A;  5DHF B;  1P3R A;  1X11 A;  4QJ5 B;  2J0K A;  4ZRK A;  2RSG A;  5HE1 A;  1H10 A;  5D3Y A;  4Z2M B;  1V61 A;  3FVC A;  1GG3 A;  3ML4 A;  5M4Y B;  1PLS A;  4GXB A;  4GNK B;  2MDX A;  1DYN A;  2X18 A;  2YS5 A;  2YVC A;  4HAW B;  3ZDT A;  4TYZ A;  1LB1 A;  1V89 A;  3U8Z A;  4DX8 A;  4HDO A;  2BCJ A;  2EC1 A;  3O96 A;  4IFS A;  5HE2 A;  1GC7 A;  3KRW A;  1W1H A;  4MK0 A;  2J0J A;  2QKM A;  2M14 A;  4MY6 A;  1FHO A;  2AEH A;  1WG7 A;  3GYP A;  1U5E A;  5D27 A;  2RUK B;  2DYQ A;  3V5W A;  4GN1 A;  2D9Y A;  1UPR A;  1ZVR A;  1Y19 B;  2GUM A;  3KZ1 A;  5J3Q A;  2KGX B;  2UZR A;  1U27 A;  2YF0 A;  2R0D A;  3NWD A;  4HAX B;  1Y5O A;  4OT1 A;  3ODX A;  3PEG A;  2LOX A;  1MKE A;  4GPT B;  4YL8 A;  4PNK A;  4A6K A;  5LON B;  2W2X C;  1EF1 A;  1DDV A;  2W2X D;  5D3V A;  3FSS A;  5DI9 B;  2K8E A;  5KQ4 A;  1WGU A;  3HSA A;  4F7G A;  1RRP B;  3BIN A;  1ZC3 B;  5C16 A;  1QQG A;  1M7R A;  1X86 A;  1UPQ A;  4QJ4 B;  1X1F A;  2VSZ A;  2ADZ A;  1BWN A;  3U7D A;  1FB8 A;  4HB0 B;  1SHC A;  2IFS A;  4K17 A;  2P0F A;  3WYF B;  1UNQ A;  5JHG A;  1UNR A;  3F0W A;  2I1J A;  4HB3 B;  1B55 A;  1XCG A;  3P6A A;  3MDB C;  4HHV A;  3G9W A;  1TQZ A;  4HB4 B;  2Z4D A;  4HAT B;  2Z14 A;  2RLO A;  3HK0 A;  2FJL A;  4KVG B;  4B6H A;  3CIK A;  4CHM A;  2ELA A;  2COC A;  1ZM0 A;  1U5D A;  1U2B A;  2YT1 A;  2Z59 A;  1W1G A;  3HIE A;  2GCL A;  3TCA A;  2P0H A;  4IOY X;  1XX0 A;  5LG4 B;  3A98 B;  3SUZ A;  2ELB A;  2G35 A;  3D8D A;  3BJI A;  2CAY A;  2I5C A;  2KCJ A;  1BTK A;  3GYO A;  1MK9 B;  1WGQ A;  4KHA A;  1KZG A;  2J59 M;  5LOP B;  1ZYI A;  1KI1 B;  5J3T A;  1FGZ A;  1OQN A;  2L1C A;  2P0D A;  1NI2 A;  2RRF A;  2DKP A;  3NWA A;  3FEH A;  2YSZ A;  4Y94 A;  5KQ1 A;  3PVU A;  4HAV B;  2Z0Q A;  1E5W A;  5D3X A;  4K2P A;  2K2U A;  2Z0P A;  2VKI A;  1K5G B;  2ROZ B;  2UZS A;  3SNH A;  2D9X A;  2V76 A;  2CRF A;  1KZ7 A;  5HE3 A;  2LG1 A;  1MAI A;  2DKQ A;  2YT0 A;  3CXB B;  5JP4 A;  1P5T A;  2KR0 A;  2MFQ A;  2ZKM X;  3VOQ A;  2DYN A;  1DDW A;  1TJ6 A;  2AL6 A;  1EVH A;  2ROV A;  2VRW B;  3PZD A;  4QJ3 B;  1GC6 A;  2Y8F A;  1IRS A;  1V5P A;  1QC6 A;  4YON A;  1N3H A;  2I5F A;  4A6F A;  1U5F A;  4DBB A;  2CY4 A;  2MWN B;  3NSU A;  1MPH A;  3TO1 A;  1FGY A;  4HDQ A;  3A8Q A;  1X1G A;  2Y7B A;  4DXA B;  3OHM B;  1WI1 A;  2EMS A;  1FAO A;  1TXD A;  2D10 A;  4ZRI A;  3ODO A;  3KRX A;  2DA0 A;  2Z0O A;  2ZPY A;  2YS3 A;  1OMW A;  3B77 A;  4A6H A;  3D8E A;  5IRS A;  3DXE A;  1T77 A;  4Z2N A;  1MIZ B;  3WA0 A;  3IVF A;  1XD4 A;  1MIX A;  1FHX A;  2COA A;  1EGX A;  3HW2 B;  4CSQ A;  2KIE A;  3DCX A;  5L81 A;  1UNP A;  4C0A A;  5KCV A;  3LJU X;  2R09 A;  3M1I B;  4KAX B;  1U29 A;  3AU5 A;  5C5B B;  2D4Q A;  1ZSQ A;  2RVB B;  1ISN A; 
#chains in the Genus database with same CATH homology
 4HAZ B;  2N0Y A;  1XR0 B;  4WJ7 A;  3TFM A;  3D8F A;  1FOE A;  4BBK A;  3TW1 A;  4F7U P;  4EMO A;  2GJY A;  3F5R A;  2E2X A;  2Y8G A;  4EJN A;  4KHB B;  1DBH A;  1Z87 A;  3AU4 A;  3PP2 A;  1H4R A;  3SV1 A;  3VIA A;  1V88 A;  4WSF A;  1NTV A;  1I7A A;  2Q13 A;  4A5K A;  5FI1 A;  3KSY A;  2DX1 A;  2M38 A;  3FM8 C;  3SO6 A;  3ODW A;  5DH9 B;  3N7C A;  4K81 A;  2D9V A;  5J3Y A;  3DXD A;  1FHW A;  1V5U A;  1M7E A;  1XKE A;  2GCJ A;  1BAK A;  4NY0 A;  5C79 A;  2NZ8 B;  2H7E A;  1WJM A;  1NTY A;  2LYD A;  1UEF A;  5EFX A;  4PQ0 A;  2DFK A;  2HE7 A;  5D3W A;  2MKR A;  3PVL A;  4NSW A;  5GOW B;  3HQC A;  1OY2 A;  4L6E A;  3RCP A;  2NMB A;  1K5D B;  2RNR B;  4P7I A;  3TVV A;  3QBV B;  1WVH A;  2EMT A;  5C6R A;  4KHO A;  2DHJ A;  3T06 A;  3SYX A;  2DLW A;  3ZVR A;  2LOZ A;  2DHK A;  5FI0 A;  4D0N B;  3ULB A;  4XWX A;  2XQN M;  3ULC A;  4HAY B;  1MK7 B;  3DXC A;  2IYB A;  3PG7 A;  2EJ8 A;  4EKU A;  4HAU B;  2L2I A;  2RGN B;  4ZRJ A;  4K2O A;  4GMV A;  1DDM A;  2D9Z A;  4A6F B;  2D9W A;  2D11 A;  5CLQ B;  4CYE A;  1PFJ A;  4TKN A;  1V5M A;  1PMS A;  3AJ4 A;  2N23 A;  1RJ2 A;  2COF A;  1X05 A;  2YS1 A;  1Q67 A;  4HB2 B;  2COD A;  2GS0 A;  5HE0 A;  2DTC A;  2KUP A;  1LW3 A;  2LKO A;  3MPX A;  4H8S A;  2H7D A;  4GZU A;  5DHA B;  1U5G A;  2I1K A;  3QIJ A;  1XOD A;  2JP2 A;  5CLL B;  4DX9 0;  5C5B A;  5DIF B;  4CHJ A;  3OAN A;  2P8V A;  1BTN A;  2DX5 A;  1DRO A;  4GMX B;  2OQB A;  3P7Z A;  3UZT A;  5JHH A;  2PZ1 A;  2UVM A;  2CY5 A;  2YRY A;  1NU2 A;  1AQC A;  2DN6 A;  2HTH B;  1J19 A;  4MT7 A;  2OTX A;  3PVW A;  2J0M A;  4WVF B;  2K2J A;  3A8P A;  5JLJ B;  1EAZ A;  1P6S A;  3QWM A;  4IAP A;  3X23 A;  1SGH A;  2DHI A;  1ZC4 B;  4F7H A;  1I2H A;  2QKL A;  1WJ1 A;  1W1D A;  2D2Q A;  3KY9 A;  2W2W A;  1J0W A;  2LUL A;  3PSC A;  2K00 A;  1AWE A;  5DHF B;  1P3R A;  1X11 A;  2J0K A;  4ZRK A;  2RSG A;  5HE1 A;  1H10 A;  5D3Y A;  4Z2M B;  1V61 A;  1GG3 A;  3ML4 A;  1PLS A;  4GXB A;  2MDX A;  1DYN A;  2X18 A;  2YS5 A;  2YVC A;  4HAW B;  3ZDT A;  4TYZ A;  1LB1 A;  1V89 A;  3U8Z A;  4DX8 A;  4HDO A;  2BCJ A;  2EC1 A;  3O96 A;  4IFS A;  5HE2 A;  1GC7 A;  3KRW A;  1W1H A;  4MK0 A;  2J0J A;  2QKM A;  2M14 A;  4MY6 A;  1FHO A;  2AEH A;  1WG7 A;  3GYP A;  1U5E A;  5D27 A;  2RUK B;  2DYQ A;  3V5W A;  4GN1 A;  2D9Y A;  1UPR A;  1ZVR A;  1Y19 B;  3KZ1 A;  5J3Q A;  2KGX B;  2UZR A;  1U27 A;  2YF0 A;  2R0D A;  4HAX B;  1Y5O A;  3ODX A;  3PEG A;  2LOX A;  1MKE A;  4GPT B;  4YL8 A;  4PNK A;  4A6K A;  5LON B;  2W2X C;  1EF1 A;  1DDV A;  2W2X D;  5D3V A;  3FSS A;  5DI9 B;  5KQ4 A;  1WGU A;  4F7G A;  1RRP B;  3BIN A;  1ZC3 B;  5C16 A;  1QQG A;  1M7R A;  1X86 A;  1UPQ A;  1X1F A;  2VSZ A;  2ADZ A;  1BWN A;  3U7D A;  1FB8 A;  4HB0 B;  1SHC A;  2IFS A;  4K17 A;  2P0F A;  3WYF B;  1UNQ A;  5JHG A;  1UNR A;  3F0W A;  2I1J A;  4HB3 B;  1B55 A;  1XCG A;  3P6A A;  3MDB C;  4HHV A;  3G9W A;  1TQZ A;  4HB4 B;  4HAT B;  2RLO A;  3HK0 A;  2FJL A;  4KVG B;  4B6H A;  3CIK A;  4CHM A;  2ELA A;  2COC A;  1ZM0 A;  1U5D A;  1U2B A;  2YT1 A;  1W1G A;  2GCL A;  3TCA A;  2P0H A;  4IOY X;  1XX0 A;  3A98 B;  3SUZ A;  2ELB A;  2G35 A;  3D8D A;  3BJI A;  2CAY A;  2I5C A;  2KCJ A;  1BTK A;  3GYO A;  1MK9 B;  1WGQ A;  4KHA A;  1KZG A;  2J59 M;  5LOP B;  1KI1 B;  5J3T A;  1FGZ A;  1OQN A;  2L1C A;  2P0D A;  1NI2 A;  2DKP A;  3FEH A;  2YSZ A;  4Y94 A;  5KQ1 A;  3PVU A;  4HAV B;  2Z0Q A;  1E5W A;  5D3X A;  4K2P A;  2K2U A;  2Z0P A;  2VKI A;  1K5G B;  2ROZ B;  2UZS A;  3SNH A;  2D9X A;  2V76 A;  2CRF A;  1KZ7 A;  5HE3 A;  2LG1 A;  1MAI A;  2DKQ A;  2YT0 A;  3CXB B;  5JP4 A;  1P5T A;  2MFQ A;  3VOQ A;  2DYN A;  1DDW A;  1TJ6 A;  2AL6 A;  1EVH A;  2ROV A;  2VRW B;  3PZD A;  1GC6 A;  2Y8F A;  1IRS A;  1V5P A;  1QC6 A;  4YON A;  1N3H A;  2I5F A;  4A6F A;  1U5F A;  4DBB A;  2CY4 A;  2MWN B;  3NSU A;  1MPH A;  3TO1 A;  1FGY A;  4HDQ A;  3A8Q A;  1X1G A;  2Y7B A;  4DXA B;  1WI1 A;  2EMS A;  1FAO A;  1TXD A;  2D10 A;  4ZRI A;  3ODO A;  3KRX A;  2DA0 A;  2Z0O A;  2ZPY A;  2YS3 A;  1OMW A;  4A6H A;  3D8E A;  3DXE A;  4Z2N A;  1MIZ B;  3WA0 A;  3IVF A;  1XD4 A;  1MIX A;  1FHX A;  2COA A;  1EGX A;  3HW2 B;  5L81 A;  1UNP A;  4C0A A;  5KCV A;  3LJU X;  2R09 A;  3M1I B;  4KAX B;  1U29 A;  3AU5 A;  5C5B B;  2D4Q A;  1ZSQ A;  2RVB B;  1ISN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...