5LOPB

Structure of the active form of /k. lactis/ dcp1-dcp2-edc3 decapping complex bound to m7gdp
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
183
structure length
173
Chain Sequence
TETLEIYRKALNFNVIARYDPKIKQLLFHTPHATVYKWGDDNWNKLEYQGVLAIYLRDVGDKEAILPEVSSEANTPHVLTGHDIYNYGLIIMNRINPDNFSLAIAPNSVLNKRKLFAPNREEELEPMKVEVRDDLVMIKTLKKEVYGIWVHTPEDRQNIYELIKYLLENEPTD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords KLLA0F23980p
publication title Structure of the active form of Dcp1-Dcp2 decapping enzyme bound to m(7)GDP and its Edc3 activator.
pubmed doi rcsb
source organism Kluyveromyces lactis nrrl y-1140
molecule tags Rna binding protein
total genus 29
structure length 173
sequence length 183
ec nomenclature
pdb deposition date 2016-08-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF06058 DCP1 Dcp1-like decapping family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 5lopB01
1DBHA 4HB3B 3D8EA 2MDXA 5FI0A 1GC6A 4PNKA 2ROVA 4Z2MB 5DIFB 2P8VA 3CXBB 4K17A 1PLSA 1LW3A 1U5EA 1V61A 3D8FA 4CYEA 3M1IB 4GZUA 2FJLA 3VOQA 3FSSA 4EJNA 4CHMA 1TQZA 2CAYA 1J0WA 4D0NB 2K2JA 4HAUB 4KHOA 2MFQA 1ZC4B 3UZTA 1XKEA 1DDVA 4DX8A 1K5GB 2OTXA 3ZDTA 1BWNA 5J3TA 1WJ1A 5LONB 4HAZB 5JHGA 2ELBA 1SHCA 3HQCA 5C79A 2I1JA 1XX0A 5FI1A 2P0FA 1MIZB 2W2XD 1MPHA 4IFSA 1W1HA 4XWXA 2I1KA 1WG7A 3OANA 3FM8C 3ML4A 2CRFA 2D4QA 1DDWA 1X11A 4A6FA 3N7CA 1MIXA 4CHJA 3ULBA 5CLQB 2ELAA 2UVMA 1BAKA 1EGXA 1WGQA 4GPTB 4NSWA 4F7HA 3TCAA 2J0JA 2LOXA 2I5FA 1MK9B 2YF0A 4P7IA 1WVHA 3D8DA 3HK0A 2J0MA 3MDBC 4TYZA 1ZVRA 2DX5A 2AEHA 1N3HA 5C6RA 1I2HA 2RGNB 2LG1A 4ZRKA 1QQGA 2K2UA 1FHXA 1U2BA 4GN1A 2Z0PA 2NZ8B 2N0YA 1U5GA 4F7UP 2GJYA 1M7RA 5J3YA 1DROA 1KZGA 2PZ1A 1KI1B 2YVCA 1I7AA 1XR0B 1MK7B 1RRPB 3AJ4A 1Y5OA 3PG7A 2LYDA 2DKPA 2QKMA 4GXBA 1J19A 5EFXA 2MWNB 1P3RA 1ISNA 4HDQA 2R0DA 4Z2NA 4KAXB 1UNRA 2UZRA 3VIAA 3ODWA 4DBBA 2MKRA 2DHJA 1U5DA 1OMWA 2LULA 2KUPA 1XODA 1IRSA 5CLLB 1DYNA 5GOWB 1WI1A 1U29A 5DI9B 2D10A 3PEGA 2E2XA 2RVBB 4K2OA 3TVVA 2ADZA 2IYBA 1P5TA 3ODOA 4K81A 3SNHA 3CIKA 4YONA 2YT0A 3PZDA 4MT7A 5C5BA 5KQ4A 2V76A 1B55A 1NU2A 1PFJA 2M38A 1V88A 1WJMA 5D3YA 4HAWB 3KSYA 4DXAB 1BTNA 1KZ7A 1P6SA 4WJ7A 2COAA 3U8ZA 2YS5A 2D11A 3G9WA 1QC6A 4MK0A 1GC7A 5D3XA 1UNPA 2ROZB 2R09A 4ZRJA 2LOZA 1FB8A 1Y19B 3TO1A 3KY9A 5HE1A 2DYQA 3F0WA 1OY2A 1ZM0A 1W1GA 2YT1A 2L1CA 2GCJA 1X86A 1U5FA 2GCLA 3DXCA 4A6HA 1V89A 4WSFA 2P0HA 3LJUX 2KCJA 2JP2A 3RCPA 2YS1A 3PVWA 2Z0OA 4BBKA 3FEHA 2W2WA 4Y94A 3V5WA 1TXDA 2DHIA 1FHWA 5DH9B 4A6FB 4HAYB 2Q13A 2EJ8A 3WYFB 4EKUA 2DFKA 5D3WA 2DLWA 2DKQA 1FOEA 5DHFB 1AWEA 2VSZA 4KHBB 4L6EA 1V5MA 1Z87A 3O96A 2D9ZA 2QKLA 4KHAA 4F7GA 3KZ1A 1FGYA 3QWMA 4HB2B 1K5DB 3GYPA 2HE7A 2HTHB 4HAVB 1FAOA 1ZSQA 2RLOA 3AU5A 2RNRB 5D3VA 3ULCA 3A8PA 1H4RA 2RSGA 2K00A 4HB0B 2DHKA 2UZSA 3A98B 1MAIA 2AL6A 1W1DA 3ZVRA 3WA0A 3TW1A 2L2IA 2D2QA 1AQCA 3P7ZA 1LB1A 1NTVA 4TKNA 2EMTA 5HE2A 3HW2B 3ODXA 1PMSA 2XQNM 1NI2A 4ZRIA 2P0DA 2NMBA 5DHAB 4IAPA 4MY6A 1U27A 3A8QA 2RUKB 4A6KA 3PVLA 2DA0A 2D9VA 1UNQA 4KVGB 4NY0A 3U7DA 2YS3A 2YSZA 5J3QA 1EAZA 1UPRA 2Y8FA 2DX1A 1GG3A 2I5CA 2IFSA 1SGHA 5JLJB 1TJ6A 3P6AA 2X18A 4HHVA 1X1FA 1EF1A 2VKIA 2W2XC 5C16A 5D27A 2LKOA 4WVFB 2J0KA 5C5BB 2H7DA 2VRWB 2KGXB 2H7EA 3PVUA 2EMSA 3DXDA 3TFMA 4C0AA 4PQ0A 3QIJA 3F5RA 1NTYA 1MKEA 4H8SA 4B6HA 2DYNA 4YL8A 2ZPYA 1OQNA 1DDMA 1V5UA 3BINA 1UEFA 3KRWA 4GMXB 4HB4B 1Q67A 2DTCA 1XD4A 5JHHA 1FHOA 1M7EA 2DN6A 2N23A 4IOYX 3SUZA 3SV1A 3NSUA 3KRXA 4HDOA 1XCGA 3BJIA 4GMVA 2EC1A 2Y7BA 5HE0A 2D9YA 4A5KA 1EVHA 5JP4A 3AU4A 1RJ2A 4EMOA 4K2PA 3SO6A 5L81A 1ZC3B 2GS0A 3QBVB 3GYOA 2YRYA 3T06A 4HATB 2CY5A 1V5PA 3PP2A 2J59M 1UPQA 4DX90 4HAXB 3X23A 1E5WA 2CODA 3MPXA 2COFA 1WGUA 2CY4A 3DXEA 1FGZA 2Z0QA 2COCA 3IVFA 5KQ1A 5LOPB 1X05A 1BTKA 2M14A 2OQBA 1H10A 3SYXA 1X1GA 2G35A 2D9WA 3PSCA 2Y8GA 2D9XA 2BCJA 5HE3A 5KCVA
chains in the Genus database with same CATH superfamily
1DBHA 4HB3B 3D8EA 2MDXA 5FI0A 1GC6A 4PNKA 2ROVA 4Z2MB 5DIFB 2P8VA 3CXBB 4K17A 1PLSA 1LW3A 1U5EA 1V61A 3D8FA 4CYEA 3M1IB 4GZUA 2FJLA 3VOQA 3FSSA 4EJNA 4CHMA 2K8EA 1TQZA 2CAYA 1J0WA 4D0NB 2K2JA 4HAUB 4KHOA 2MFQA 1ZC4B 3UZTA 1XKEA 1DDVA 4DX8A 1K5GB 2OTXA 3ZDTA 1BWNA 5J3TA 1WJ1A 5LONB 4HAZB 4L1RA 5JHGA 2ELBA 1SHCA 3HQCA 5C79A 2I1JA 1XX0A 5FI1A 2P0FA 1MIZB 2W2XD 1MPHA 4IFSA 1W1HA 4XWXA 3HIEA 4D6WA 2I1KA 1WG7A 3OANA 4GNKB 2RRFA 3FM8C 2CRFA 2D4QA 3ML4A 5M4YB 1DDWA 3NWFA 1X11A 4A6FA 2Z4DA 3N7CA 1MIXA 4CHJA 3ULBA 5CLQB 2ELAA 2UVMA 1BAKA 1EGXA 2KR0A 1WGQA 4GPTB 4NSWA 4F7HA 3TCAA 2J0JA 4KHBA 2LOXA 2I5FA 1MK9B 2YF0A 4P7IA 1WVHA 3D8DA 3HK0A 2J0MA 3MDBC 4TYZA 1ZVRA 2DX5A 2AEHA 1N3HA 5C6RA 1I2HA 2RGNB 2LG1A 4ZRKA 1QQGA 2K2UA 1FHXA 1U2BA 4GN1A 2Z0PA 2NZ8B 2N0YA 1U5GA 3A58A 4F7UP 2GJYA 1M7RA 5J3YA 1DROA 4QJ4B 1KZGA 2PZ1A 1KI1B 2YVCA 1I7AA 1XR0B 1MK7B 1RRPB 3AJ4A 1Y5OA 3PG7A 2LYDA 2DKPA 2QKMA 4GXBA 1J19A 5EFXA 2MWNB 1P3RA 1ISNA 4HDQA 2R0DA 4Z2NA 4KAXB 1UNRA 2UZRA 3VIAA 3ODWA 4DBBA 2MKRA 2DHJA 1U5DA 1OMWA 2LULA 2KUPA 1XODA 1IRSA 5CLLB 1DYNA 5GOWB 1WI1A 1U29A 5DI9B 2D10A 3PEGA 2E2XA 2RVBB 2YT2A 4K2OA 3TVVA 2ADZA 2IYBA 1P5TA 3ODOA 4K81A 3SNHA 3CIKA 4YONA 2YT0A 3PZDA 4MT7A 5C5BA 5KQ4A 2V76A 1B55A 1NU2A 1PFJA 2M38A 1V88A 1WJMA 5D3YA 4HAWB 3KSYA 4DXAB 1BTNA 1KZ7A 1P6SA 4WJ7A 2COAA 3U8ZA 4QJ3B 2YS5A 2D11A 3G9WA 1QC6A 3FVCA 4MK0A 1GC7A 3OHMB 5D3XA 1UNPA 2ROZB 2R09A 4OSNA 2LOZA 4ZRJA 1FB8A 1Y19B 3HSAA 3TO1A 3KY9A 3B77A 5HE1A 2DYQA 3F0WA 1OY2A 1ZM0A 1W1GA 2YT1A 1T77A 2L1CA 2GCJA 1X86A 1U5FA 2GCLA 3DXCA 4A6HA 1V89A 4WSFA 2P0HA 3LJUX 2KCJA 2JP2A 3RCPA 2YS1A 3PVWA 2Z0OA 4BBKA 3FEHA 2W2WA 4Y94A 3V5WA 1TXDA 5LG4B 2DHIA 1FHWA 5DH9B 4A6FB 4HAYB 2Q13A 2EJ8A 3WYFB 4EKUA 2DFKA 5D3WA 2DLWA 2DKQA 1FOEA 5DHFB 2KUQA 1AWEA 2VSZA 4KHBB 4HSIA 4L6EA 1V5MA 1Z87A 3O96A 2D9ZA 2QKLA 4KHAA 4F7GA 5IRSA 2Z59A 3KZ1A 1FGYA 3QWMA 4HB2B 1K5DB 3GYPA 4QXAB 4QJ5B 1MI1A 2HE7A 2HTHB 4HAVB 1FAOA 1ZSQA 2RLOA 3AU5A 2RNRB 5D3VA 3ULCA 3A8PA 1H4RA 2RSGA 2Z13A 3NW8A 2K00A 4HB0B 2DHKA 2UZSA 3A98B 1MAIA 2AL6A 1W1DA 3ZVRA 3WA0A 3TW1A 2L2IA 4GOUA 2D2QA 1AQCA 3P7ZA 1LB1A 1NTVA 4TKNA 2EMTA 5HE2A 3HW2B 3ODXA 1PMSA 2XQNM 1NI2A 4ZRIA 2P0DA 2NMBA 5DHAB 4IAPA 4MY6A 1U27A 2GUMA 3A8QA 2RUKB 4A6KA 2Z14A 3PVLA 2DA0A 2D9VA 5I2SA 2FJUB 1UNQA 4KVGB 4NY0A 3U7DA 2KIEA 2YS3A 2ZKMX 2YSZA 3NWDA 5J3QA 1EAZA 1UPRA 2Y8FA 2DX1A 1GG3A 2KIGA 2I5CA 2IFSA 1SGHA 5JLJB 1TJ6A 3P6AA 2X18A 4HHVA 1X1FA 1EF1A 2VKIA 2W2XC 5C16A 5D27A 2LKOA 4WVFB 2J0KA 5C5BB 2H7DA 2VRWB 2KGXB 2H7EA 3PVUA 2EMSA 3DXDA 3TFMA 4C0AA 4PQ0A 3QIJA 3F5RA 1NTYA 4CSQA 1MKEA 4H8SA 4B6HA 2DYNA 4YL8A 2ZPYA 1OQNA 1DDMA 1V5UA 3BINA 1UEFA 3KRWA 4GMXB 4HB4B 1Q67A 2DTCA 1XD4A 5JHHA 1FHOA 1M7EA 2DN6A 2N23A 4IOYX 3SUZA 4DIXA 3SV1A 3NSUA 3KRXA 4OT1A 4HDOA 1XCGA 3BJIA 4GMVA 2EC1A 2Y7BA 5HE0A 2D9YA 4A5KA 1EVHA 5JP4A 3AU4A 1RJ2A 4EMOA 4K2PA 3SO6A 5L81A 1ZC3B 3NWAA 2GS0A 3QBVB 3U12A 3GYOA 2YRYA 3T06A 4HATB 2CY5A 1V5PA 3PP2A 2J59M 1UPQA 4DX90 4HAXB 3X23A 2K49A 1E5WA 2NBVA 2CODA 1ZYIA 2R2YA 3MPXA 2COFA 1WGUA 2CY4A 3DXEA 1FGZA 2Z0QA 2COCA 5I2MA 3IVFA 5KQ1A 5LOPB 1X05A 1BTKA 2M14A 2OQBA 1H10A 3SYXA 1X1GA 2G35A 2D9WA 3DCXA 3PSCA 2Y8GA 2D9XA 2BCJA 5HE3A 5KCVA
chains in the Genus database with same CATH topology
1DBHA 4HB3B 3D8EA 2MDXA 5FI0A 1GC6A 4PNKA 2ROVA 4Z2MB 5DIFB 2P8VA 3CXBB 4K17A 1PLSA 1LW3A 1U5EA 1V61A 3D8FA 4CYEA 3M1IB 4GZUA 2FJLA 3VOQA 3FSSA 4EJNA 4CHMA 1TQZA 2CAYA 1J0WA 4D0NB 2K2JA 4HAUB 4KHOA 2MFQA 1ZC4B 3UZTA 1XKEA 1DDVA 4DX8A 1K5GB 2OTXA 3ZDTA 1BWNA 5J3TA 1WJ1A 5LONB 4HAZB 5JHGA 2ELBA 1SHCA 3HQCA 5C79A 2I1JA 1XX0A 5FI1A 2P0FA 1MIZB 2W2XD 1MPHA 4IFSA 1W1HA 4XWXA 2I1KA 1WG7A 3OANA 3FM8C 3ML4A 2CRFA 2D4QA 1DDWA 1X11A 4A6FA 3N7CA 1MIXA 4CHJA 3ULBA 5CLQB 2ELAA 2UVMA 1BAKA 1EGXA 1WGQA 4GPTB 4NSWA 4F7HA 3TCAA 2J0JA 2LOXA 2I5FA 1MK9B 2YF0A 4P7IA 1WVHA 3D8DA 3HK0A 2J0MA 3MDBC 4TYZA 1ZVRA 2DX5A 2AEHA 1N3HA 5C6RA 1I2HA 2RGNB 2LG1A 4ZRKA 1QQGA 2K2UA 1FHXA 1U2BA 4GN1A 2Z0PA 2NZ8B 2N0YA 1U5GA 4F7UP 2GJYA 1M7RA 5J3YA 1DROA 1KZGA 2PZ1A 1KI1B 2YVCA 1I7AA 1XR0B 1MK7B 1RRPB 3AJ4A 1Y5OA 3PG7A 2LYDA 2DKPA 2QKMA 4GXBA 1J19A 5EFXA 2MWNB 1P3RA 1ISNA 4HDQA 2R0DA 4Z2NA 4KAXB 1UNRA 2UZRA 3VIAA 3ODWA 4DBBA 2MKRA 2DHJA 1U5DA 1OMWA 2LULA 2KUPA 1XODA 1IRSA 5CLLB 1DYNA 5GOWB 1WI1A 1U29A 5DI9B 2D10A 3PEGA 2E2XA 2RVBB 4K2OA 3TVVA 2ADZA 2IYBA 1P5TA 3ODOA 4K81A 3SNHA 3CIKA 4YONA 2YT0A 3PZDA 4MT7A 5C5BA 5KQ4A 2V76A 1B55A 1NU2A 1PFJA 2M38A 1V88A 1WJMA 5D3YA 4HAWB 3KSYA 4DXAB 1BTNA 1KZ7A 1P6SA 4WJ7A 2COAA 3U8ZA 2YS5A 2D11A 3G9WA 1QC6A 4MK0A 1GC7A 5D3XA 1UNPA 2ROZB 2R09A 4ZRJA 2LOZA 1FB8A 1Y19B 3TO1A 3KY9A 5HE1A 2DYQA 3F0WA 1OY2A 1ZM0A 1W1GA 2YT1A 2L1CA 2GCJA 1X86A 1U5FA 2GCLA 3DXCA 4A6HA 1V89A 4WSFA 2P0HA 3LJUX 2KCJA 2JP2A 3RCPA 2YS1A 3PVWA 2Z0OA 4BBKA 3FEHA 2W2WA 4Y94A 3V5WA 1TXDA 2DHIA 1FHWA 5DH9B 4A6FB 4HAYB 2Q13A 2EJ8A 3WYFB 4EKUA 2DFKA 5D3WA 2DLWA 2DKQA 1FOEA 5DHFB 1AWEA 2VSZA 4KHBB 4L6EA 1V5MA 1Z87A 3O96A 2D9ZA 2QKLA 4KHAA 4F7GA 3KZ1A 1FGYA 3QWMA 4HB2B 1K5DB 3GYPA 2HE7A 2HTHB 4HAVB 1FAOA 1ZSQA 2RLOA 3AU5A 2RNRB 5D3VA 3ULCA 3A8PA 1H4RA 2RSGA 2K00A 4HB0B 2DHKA 2UZSA 3A98B 1MAIA 2AL6A 1W1DA 3ZVRA 3WA0A 3TW1A 2L2IA 2D2QA 1AQCA 3P7ZA 1LB1A 1NTVA 4TKNA 2EMTA 5HE2A 3HW2B 3ODXA 1PMSA 2XQNM 1NI2A 4ZRIA 2P0DA 2NMBA 5DHAB 4IAPA 4MY6A 1U27A 3A8QA 2RUKB 4A6KA 3PVLA 2DA0A 2D9VA 1UNQA 4KVGB 4NY0A 3U7DA 2YS3A 2YSZA 5J3QA 1EAZA 1UPRA 2Y8FA 2DX1A 1GG3A 2I5CA 2IFSA 1SGHA 5JLJB 1TJ6A 3P6AA 2X18A 4HHVA 1X1FA 1EF1A 2VKIA 2W2XC 5C16A 5D27A 2LKOA 4WVFB 2J0KA 5C5BB 2H7DA 2VRWB 2KGXB 2H7EA 3PVUA 2EMSA 3DXDA 3TFMA 4C0AA 4PQ0A 3QIJA 3F5RA 1NTYA 1MKEA 4H8SA 4B6HA 2DYNA 4YL8A 2ZPYA 1OQNA 1DDMA 1V5UA 3BINA 1UEFA 3KRWA 4GMXB 4HB4B 1Q67A 2DTCA 1XD4A 5JHHA 1FHOA 1M7EA 2DN6A 2N23A 4IOYX 3SUZA 3SV1A 3NSUA 3KRXA 4HDOA 1XCGA 3BJIA 4GMVA 2EC1A 2Y7BA 5HE0A 2D9YA 4A5KA 1EVHA 5JP4A 3AU4A 1RJ2A 4EMOA 4K2PA 3SO6A 5L81A 1ZC3B 2GS0A 3QBVB 3GYOA 2YRYA 3T06A 4HATB 2CY5A 1V5PA 3PP2A 2J59M 1UPQA 4DX90 4HAXB 3X23A 1E5WA 2CODA 3MPXA 2COFA 1WGUA 2CY4A 3DXEA 1FGZA 2Z0QA 2COCA 3IVFA 5KQ1A 5LOPB 1X05A 1BTKA 2M14A 2OQBA 1H10A 3SYXA 1X1GA 2G35A 2D9WA 3PSCA 2Y8GA 2D9XA 2BCJA 5HE3A 5KCVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DBH A;  4HB3 B;  3D8E A;  2MDX A;  5FI0 A;  1GC6 A;  4PNK A;  2ROV A;  4Z2M B;  5DIF B;  2P8V A;  3CXB B;  4K17 A;  1PLS A;  1LW3 A;  1U5E A;  1V61 A;  3D8F A;  4CYE A;  3M1I B;  4GZU A;  2FJL A;  3VOQ A;  3FSS A;  4EJN A;  4CHM A;  1TQZ A;  2CAY A;  1J0W A;  4D0N B;  2K2J A;  4HAU B;  4KHO A;  2MFQ A;  1ZC4 B;  3UZT A;  1XKE A;  1DDV A;  4DX8 A;  1K5G B;  2OTX A;  3ZDT A;  1BWN A;  5J3T A;  1WJ1 A;  5LON B;  4HAZ B;  5JHG A;  2ELB A;  1SHC A;  3HQC A;  5C79 A;  2I1J A;  1XX0 A;  5FI1 A;  2P0F A;  1MIZ B;  2W2X D;  1MPH A;  4IFS A;  1W1H A;  4XWX A;  2I1K A;  1WG7 A;  3OAN A;  3FM8 C;  3ML4 A;  2CRF A;  2D4Q A;  1DDW A;  1X11 A;  4A6F A;  3N7C A;  1MIX A;  4CHJ A;  3ULB A;  5CLQ B;  2ELA A;  2UVM A;  1BAK A;  1EGX A;  1WGQ A;  4GPT B;  4NSW A;  4F7H A;  3TCA A;  2J0J A;  2LOX A;  2I5F A;  1MK9 B;  2YF0 A;  4P7I A;  1WVH A;  3D8D A;  3HK0 A;  2J0M A;  3MDB C;  4TYZ A;  1ZVR A;  2DX5 A;  2AEH A;  1N3H A;  5C6R A;  1I2H A;  2RGN B;  2LG1 A;  4ZRK A;  1QQG A;  2K2U A;  1FHX A;  1U2B A;  4GN1 A;  2Z0P A;  2NZ8 B;  2N0Y A;  1U5G A;  4F7U P;  2GJY A;  1M7R A;  5J3Y A;  1DRO A;  1KZG A;  2PZ1 A;  1KI1 B;  2YVC A;  1I7A A;  1XR0 B;  1MK7 B;  1RRP B;  3AJ4 A;  1Y5O A;  3PG7 A;  2LYD A;  2DKP A;  2QKM A;  4GXB A;  1J19 A;  5EFX A;  2MWN B;  1P3R A;  1ISN A;  4HDQ A;  2R0D A;  4Z2N A;  4KAX B;  1UNR A;  2UZR A;  3VIA A;  3ODW A;  4DBB A;  2MKR A;  2DHJ A;  1U5D A;  1OMW A;  2LUL A;  2KUP A;  1XOD A;  1IRS A;  5CLL B;  1DYN A;  5GOW B;  1WI1 A;  1U29 A;  5DI9 B;  2D10 A;  3PEG A;  2E2X A;  2RVB B;  4K2O A;  3TVV A;  2ADZ A;  2IYB A;  1P5T A;  3ODO A;  4K81 A;  3SNH A;  3CIK A;  4YON A;  2YT0 A;  3PZD A;  4MT7 A;  5C5B A;  5KQ4 A;  2V76 A;  1B55 A;  1NU2 A;  1PFJ A;  2M38 A;  1V88 A;  1WJM A;  5D3Y A;  4HAW B;  3KSY A;  4DXA B;  1BTN A;  1KZ7 A;  1P6S A;  4WJ7 A;  2COA A;  3U8Z A;  2YS5 A;  2D11 A;  3G9W A;  1QC6 A;  4MK0 A;  1GC7 A;  5D3X A;  1UNP A;  2ROZ B;  2R09 A;  4ZRJ A;  2LOZ A;  1FB8 A;  1Y19 B;  3TO1 A;  3KY9 A;  5HE1 A;  2DYQ A;  3F0W A;  1OY2 A;  1ZM0 A;  1W1G A;  2YT1 A;  2L1C A;  2GCJ A;  1X86 A;  1U5F A;  2GCL A;  3DXC A;  4A6H A;  1V89 A;  4WSF A;  2P0H A;  3LJU X;  2KCJ A;  2JP2 A;  3RCP A;  2YS1 A;  3PVW A;  2Z0O A;  4BBK A;  3FEH A;  2W2W A;  4Y94 A;  3V5W A;  1TXD A;  2DHI A;  1FHW A;  5DH9 B;  4A6F B;  4HAY B;  2Q13 A;  2EJ8 A;  3WYF B;  4EKU A;  2DFK A;  5D3W A;  2DLW A;  2DKQ A;  1FOE A;  5DHF B;  1AWE A;  2VSZ A;  4KHB B;  4L6E A;  1V5M A;  1Z87 A;  3O96 A;  2D9Z A;  2QKL A;  4KHA A;  4F7G A;  3KZ1 A;  1FGY A;  3QWM A;  4HB2 B;  1K5D B;  3GYP A;  2HE7 A;  2HTH B;  4HAV B;  1FAO A;  1ZSQ A;  2RLO A;  3AU5 A;  2RNR B;  5D3V A;  3ULC A;  3A8P A;  1H4R A;  2RSG A;  2K00 A;  4HB0 B;  2DHK A;  2UZS A;  3A98 B;  1MAI A;  2AL6 A;  1W1D A;  3ZVR A;  3WA0 A;  3TW1 A;  2L2I A;  2D2Q A;  1AQC A;  3P7Z A;  1LB1 A;  1NTV A;  4TKN A;  2EMT A;  5HE2 A;  3HW2 B;  3ODX A;  1PMS A;  2XQN M;  1NI2 A;  4ZRI A;  2P0D A;  2NMB A;  5DHA B;  4IAP A;  4MY6 A;  1U27 A;  3A8Q A;  2RUK B;  4A6K A;  3PVL A;  2DA0 A;  2D9V A;  1UNQ A;  4KVG B;  4NY0 A;  3U7D A;  2YS3 A;  2YSZ A;  5J3Q A;  1EAZ A;  1UPR A;  2Y8F A;  2DX1 A;  1GG3 A;  2I5C A;  2IFS A;  1SGH A;  5JLJ B;  1TJ6 A;  3P6A A;  2X18 A;  4HHV A;  1X1F A;  1EF1 A;  2VKI A;  2W2X C;  5C16 A;  5D27 A;  2LKO A;  4WVF B;  2J0K A;  5C5B B;  2H7D A;  2VRW B;  2KGX B;  2H7E A;  3PVU A;  2EMS A;  3DXD A;  3TFM A;  4C0A A;  4PQ0 A;  3QIJ A;  3F5R A;  1NTY A;  1MKE A;  4H8S A;  4B6H A;  2DYN A;  4YL8 A;  2ZPY A;  1OQN A;  1DDM A;  1V5U A;  3BIN A;  1UEF A;  3KRW A;  4GMX B;  4HB4 B;  1Q67 A;  2DTC A;  1XD4 A;  5JHH A;  1FHO A;  1M7E A;  2DN6 A;  2N23 A;  4IOY X;  3SUZ A;  3SV1 A;  3NSU A;  3KRX A;  4HDO A;  1XCG A;  3BJI A;  4GMV A;  2EC1 A;  2Y7B A;  5HE0 A;  2D9Y A;  4A5K A;  1EVH A;  5JP4 A;  3AU4 A;  1RJ2 A;  4EMO A;  4K2P A;  3SO6 A;  5L81 A;  1ZC3 B;  2GS0 A;  3QBV B;  3GYO A;  2YRY A;  3T06 A;  4HAT B;  2CY5 A;  1V5P A;  3PP2 A;  2J59 M;  1UPQ A;  4DX9 0;  4HAX B;  3X23 A;  1E5W A;  2COD A;  3MPX A;  2COF A;  1WGU A;  2CY4 A;  3DXE A;  1FGZ A;  2Z0Q A;  2COC A;  3IVF A;  5KQ1 A;  5LOP B;  1X05 A;  1BTK A;  2M14 A;  2OQB A;  1H10 A;  3SYX A;  1X1G A;  2G35 A;  2D9W A;  3PSC A;  2Y8G A;  2D9X A;  2BCJ A;  5HE3 A;  5KCV A; 
#chains in the Genus database with same CATH topology
 1DBH A;  4HB3 B;  3D8E A;  2MDX A;  5FI0 A;  1GC6 A;  4PNK A;  2ROV A;  4Z2M B;  5DIF B;  2P8V A;  3CXB B;  4K17 A;  1PLS A;  1LW3 A;  1U5E A;  1V61 A;  3D8F A;  4CYE A;  3M1I B;  4GZU A;  2FJL A;  3VOQ A;  3FSS A;  4EJN A;  4CHM A;  2K8E A;  1TQZ A;  2CAY A;  1J0W A;  4D0N B;  2K2J A;  4HAU B;  4KHO A;  2MFQ A;  1ZC4 B;  3UZT A;  1XKE A;  1DDV A;  4DX8 A;  1K5G B;  2OTX A;  3ZDT A;  1BWN A;  5J3T A;  1WJ1 A;  5LON B;  4HAZ B;  4L1R A;  5JHG A;  2ELB A;  1SHC A;  3HQC A;  5C79 A;  2I1J A;  1XX0 A;  5FI1 A;  2P0F A;  1MIZ B;  2W2X D;  1MPH A;  4IFS A;  1W1H A;  4XWX A;  3HIE A;  4D6W A;  2I1K A;  1WG7 A;  3OAN A;  4GNK B;  2RRF A;  3FM8 C;  2CRF A;  2D4Q A;  3ML4 A;  5M4Y B;  1DDW A;  3NWF A;  1X11 A;  4A6F A;  2Z4D A;  3N7C A;  1MIX A;  4CHJ A;  3ULB A;  5CLQ B;  2ELA A;  2UVM A;  1BAK A;  1EGX A;  2KR0 A;  1WGQ A;  4GPT B;  4NSW A;  4F7H A;  3TCA A;  2J0J A;  4KHB A;  2LOX A;  2I5F A;  1MK9 B;  2YF0 A;  4P7I A;  1WVH A;  3D8D A;  3HK0 A;  2J0M A;  3MDB C;  4TYZ A;  1ZVR A;  2DX5 A;  2AEH A;  1N3H A;  5C6R A;  1I2H A;  2RGN B;  2LG1 A;  4ZRK A;  1QQG A;  2K2U A;  1FHX A;  1U2B A;  4GN1 A;  2Z0P A;  2NZ8 B;  2N0Y A;  1U5G A;  3A58 A;  4F7U P;  2GJY A;  1M7R A;  5J3Y A;  1DRO A;  4QJ4 B;  1KZG A;  2PZ1 A;  1KI1 B;  2YVC A;  1I7A A;  1XR0 B;  1MK7 B;  1RRP B;  3AJ4 A;  1Y5O A;  3PG7 A;  2LYD A;  2DKP A;  2QKM A;  4GXB A;  1J19 A;  5EFX A;  2MWN B;  1P3R A;  1ISN A;  4HDQ A;  2R0D A;  4Z2N A;  4KAX B;  1UNR A;  2UZR A;  3VIA A;  3ODW A;  4DBB A;  2MKR A;  2DHJ A;  1U5D A;  1OMW A;  2LUL A;  2KUP A;  1XOD A;  1IRS A;  5CLL B;  1DYN A;  5GOW B;  1WI1 A;  1U29 A;  5DI9 B;  2D10 A;  3PEG A;  2E2X A;  2RVB B;  2YT2 A;  4K2O A;  3TVV A;  2ADZ A;  2IYB A;  1P5T A;  3ODO A;  4K81 A;  3SNH A;  3CIK A;  4YON A;  2YT0 A;  3PZD A;  4MT7 A;  5C5B A;  5KQ4 A;  2V76 A;  1B55 A;  1NU2 A;  1PFJ A;  2M38 A;  1V88 A;  1WJM A;  5D3Y A;  4HAW B;  3KSY A;  4DXA B;  1BTN A;  1KZ7 A;  1P6S A;  4WJ7 A;  2COA A;  3U8Z A;  4QJ3 B;  2YS5 A;  2D11 A;  3G9W A;  1QC6 A;  3FVC A;  4MK0 A;  1GC7 A;  3OHM B;  5D3X A;  1UNP A;  2ROZ B;  2R09 A;  4OSN A;  2LOZ A;  4ZRJ A;  1FB8 A;  1Y19 B;  3HSA A;  3TO1 A;  3KY9 A;  3B77 A;  5HE1 A;  2DYQ A;  3F0W A;  1OY2 A;  1ZM0 A;  1W1G A;  2YT1 A;  1T77 A;  2L1C A;  2GCJ A;  1X86 A;  1U5F A;  2GCL A;  3DXC A;  4A6H A;  1V89 A;  4WSF A;  2P0H A;  3LJU X;  2KCJ A;  2JP2 A;  3RCP A;  2YS1 A;  3PVW A;  2Z0O A;  4BBK A;  3FEH A;  2W2W A;  4Y94 A;  3V5W A;  1TXD A;  5LG4 B;  2DHI A;  1FHW A;  5DH9 B;  4A6F B;  4HAY B;  2Q13 A;  2EJ8 A;  3WYF B;  4EKU A;  2DFK A;  5D3W A;  2DLW A;  2DKQ A;  1FOE A;  5DHF B;  2KUQ A;  1AWE A;  2VSZ A;  4KHB B;  4HSI A;  4L6E A;  1V5M A;  1Z87 A;  3O96 A;  2D9Z A;  2QKL A;  4KHA A;  4F7G A;  5IRS A;  2Z59 A;  3KZ1 A;  1FGY A;  3QWM A;  4HB2 B;  1K5D B;  3GYP A;  4QXA B;  4QJ5 B;  1MI1 A;  2HE7 A;  2HTH B;  4HAV B;  1FAO A;  1ZSQ A;  2RLO A;  3AU5 A;  2RNR B;  5D3V A;  3ULC A;  3A8P A;  1H4R A;  2RSG A;  2Z13 A;  3NW8 A;  2K00 A;  4HB0 B;  2DHK A;  2UZS A;  3A98 B;  1MAI A;  2AL6 A;  1W1D A;  3ZVR A;  3WA0 A;  3TW1 A;  2L2I A;  4GOU A;  2D2Q A;  1AQC A;  3P7Z A;  1LB1 A;  1NTV A;  4TKN A;  2EMT A;  5HE2 A;  3HW2 B;  3ODX A;  1PMS A;  2XQN M;  1NI2 A;  4ZRI A;  2P0D A;  2NMB A;  5DHA B;  4IAP A;  4MY6 A;  1U27 A;  2GUM A;  3A8Q A;  2RUK B;  4A6K A;  2Z14 A;  3PVL A;  2DA0 A;  2D9V A;  5I2S A;  2FJU B;  1UNQ A;  4KVG B;  4NY0 A;  3U7D A;  2KIE A;  2YS3 A;  2ZKM X;  2YSZ A;  3NWD A;  5J3Q A;  1EAZ A;  1UPR A;  2Y8F A;  2DX1 A;  1GG3 A;  2KIG A;  2I5C A;  2IFS A;  1SGH A;  5JLJ B;  1TJ6 A;  3P6A A;  2X18 A;  4HHV A;  1X1F A;  1EF1 A;  2VKI A;  2W2X C;  5C16 A;  5D27 A;  2LKO A;  4WVF B;  2J0K A;  5C5B B;  2H7D A;  2VRW B;  2KGX B;  2H7E A;  3PVU A;  2EMS A;  3DXD A;  3TFM A;  4C0A A;  4PQ0 A;  3QIJ A;  3F5R A;  1NTY A;  4CSQ A;  1MKE A;  4H8S A;  4B6H A;  2DYN A;  4YL8 A;  2ZPY A;  1OQN A;  1DDM A;  1V5U A;  3BIN A;  1UEF A;  3KRW A;  4GMX B;  4HB4 B;  1Q67 A;  2DTC A;  1XD4 A;  5JHH A;  1FHO A;  1M7E A;  2DN6 A;  2N23 A;  4IOY X;  3SUZ A;  4DIX A;  3SV1 A;  3NSU A;  3KRX A;  4OT1 A;  4HDO A;  1XCG A;  3BJI A;  4GMV A;  2EC1 A;  2Y7B A;  5HE0 A;  2D9Y A;  4A5K A;  1EVH A;  5JP4 A;  3AU4 A;  1RJ2 A;  4EMO A;  4K2P A;  3SO6 A;  5L81 A;  1ZC3 B;  3NWA A;  2GS0 A;  3QBV B;  3U12 A;  3GYO A;  2YRY A;  3T06 A;  4HAT B;  2CY5 A;  1V5P A;  3PP2 A;  2J59 M;  1UPQ A;  4DX9 0;  4HAX B;  3X23 A;  2K49 A;  1E5W A;  2NBV A;  2COD A;  1ZYI A;  2R2Y A;  3MPX A;  2COF A;  1WGU A;  2CY4 A;  3DXE A;  1FGZ A;  2Z0Q A;  2COC A;  5I2M A;  3IVF A;  5KQ1 A;  5LOP B;  1X05 A;  1BTK A;  2M14 A;  2OQB A;  1H10 A;  3SYX A;  1X1G A;  2G35 A;  2D9W A;  3DCX A;  3PSC A;  2Y8G A;  2D9X A;  2BCJ A;  5HE3 A;  5KCV A; 
#chains in the Genus database with same CATH homology
 1DBH A;  4HB3 B;  3D8E A;  2MDX A;  5FI0 A;  1GC6 A;  4PNK A;  2ROV A;  4Z2M B;  5DIF B;  2P8V A;  3CXB B;  4K17 A;  1PLS A;  1LW3 A;  1U5E A;  1V61 A;  3D8F A;  4CYE A;  3M1I B;  4GZU A;  2FJL A;  3VOQ A;  3FSS A;  4EJN A;  4CHM A;  1TQZ A;  2CAY A;  1J0W A;  4D0N B;  2K2J A;  4HAU B;  4KHO A;  2MFQ A;  1ZC4 B;  3UZT A;  1XKE A;  1DDV A;  4DX8 A;  1K5G B;  2OTX A;  3ZDT A;  1BWN A;  5J3T A;  1WJ1 A;  5LON B;  4HAZ B;  5JHG A;  2ELB A;  1SHC A;  3HQC A;  5C79 A;  2I1J A;  1XX0 A;  5FI1 A;  2P0F A;  1MIZ B;  2W2X D;  1MPH A;  4IFS A;  1W1H A;  4XWX A;  2I1K A;  1WG7 A;  3OAN A;  3FM8 C;  3ML4 A;  2CRF A;  2D4Q A;  1DDW A;  1X11 A;  4A6F A;  3N7C A;  1MIX A;  4CHJ A;  3ULB A;  5CLQ B;  2ELA A;  2UVM A;  1BAK A;  1EGX A;  1WGQ A;  4GPT B;  4NSW A;  4F7H A;  3TCA A;  2J0J A;  2LOX A;  2I5F A;  1MK9 B;  2YF0 A;  4P7I A;  1WVH A;  3D8D A;  3HK0 A;  2J0M A;  3MDB C;  4TYZ A;  1ZVR A;  2DX5 A;  2AEH A;  1N3H A;  5C6R A;  1I2H A;  2RGN B;  2LG1 A;  4ZRK A;  1QQG A;  2K2U A;  1FHX A;  1U2B A;  4GN1 A;  2Z0P A;  2NZ8 B;  2N0Y A;  1U5G A;  4F7U P;  2GJY A;  1M7R A;  5J3Y A;  1DRO A;  1KZG A;  2PZ1 A;  1KI1 B;  2YVC A;  1I7A A;  1XR0 B;  1MK7 B;  1RRP B;  3AJ4 A;  1Y5O A;  3PG7 A;  2LYD A;  2DKP A;  2QKM A;  4GXB A;  1J19 A;  5EFX A;  2MWN B;  1P3R A;  1ISN A;  4HDQ A;  2R0D A;  4Z2N A;  4KAX B;  1UNR A;  2UZR A;  3VIA A;  3ODW A;  4DBB A;  2MKR A;  2DHJ A;  1U5D A;  1OMW A;  2LUL A;  2KUP A;  1XOD A;  1IRS A;  5CLL B;  1DYN A;  5GOW B;  1WI1 A;  1U29 A;  5DI9 B;  2D10 A;  3PEG A;  2E2X A;  2RVB B;  4K2O A;  3TVV A;  2ADZ A;  2IYB A;  1P5T A;  3ODO A;  4K81 A;  3SNH A;  3CIK A;  4YON A;  2YT0 A;  3PZD A;  4MT7 A;  5C5B A;  5KQ4 A;  2V76 A;  1B55 A;  1NU2 A;  1PFJ A;  2M38 A;  1V88 A;  1WJM A;  5D3Y A;  4HAW B;  3KSY A;  4DXA B;  1BTN A;  1KZ7 A;  1P6S A;  4WJ7 A;  2COA A;  3U8Z A;  2YS5 A;  2D11 A;  3G9W A;  1QC6 A;  4MK0 A;  1GC7 A;  5D3X A;  1UNP A;  2ROZ B;  2R09 A;  4ZRJ A;  2LOZ A;  1FB8 A;  1Y19 B;  3TO1 A;  3KY9 A;  5HE1 A;  2DYQ A;  3F0W A;  1OY2 A;  1ZM0 A;  1W1G A;  2YT1 A;  2L1C A;  2GCJ A;  1X86 A;  1U5F A;  2GCL A;  3DXC A;  4A6H A;  1V89 A;  4WSF A;  2P0H A;  3LJU X;  2KCJ A;  2JP2 A;  3RCP A;  2YS1 A;  3PVW A;  2Z0O A;  4BBK A;  3FEH A;  2W2W A;  4Y94 A;  3V5W A;  1TXD A;  2DHI A;  1FHW A;  5DH9 B;  4A6F B;  4HAY B;  2Q13 A;  2EJ8 A;  3WYF B;  4EKU A;  2DFK A;  5D3W A;  2DLW A;  2DKQ A;  1FOE A;  5DHF B;  1AWE A;  2VSZ A;  4KHB B;  4L6E A;  1V5M A;  1Z87 A;  3O96 A;  2D9Z A;  2QKL A;  4KHA A;  4F7G A;  3KZ1 A;  1FGY A;  3QWM A;  4HB2 B;  1K5D B;  3GYP A;  2HE7 A;  2HTH B;  4HAV B;  1FAO A;  1ZSQ A;  2RLO A;  3AU5 A;  2RNR B;  5D3V A;  3ULC A;  3A8P A;  1H4R A;  2RSG A;  2K00 A;  4HB0 B;  2DHK A;  2UZS A;  3A98 B;  1MAI A;  2AL6 A;  1W1D A;  3ZVR A;  3WA0 A;  3TW1 A;  2L2I A;  2D2Q A;  1AQC A;  3P7Z A;  1LB1 A;  1NTV A;  4TKN A;  2EMT A;  5HE2 A;  3HW2 B;  3ODX A;  1PMS A;  2XQN M;  1NI2 A;  4ZRI A;  2P0D A;  2NMB A;  5DHA B;  4IAP A;  4MY6 A;  1U27 A;  3A8Q A;  2RUK B;  4A6K A;  3PVL A;  2DA0 A;  2D9V A;  1UNQ A;  4KVG B;  4NY0 A;  3U7D A;  2YS3 A;  2YSZ A;  5J3Q A;  1EAZ A;  1UPR A;  2Y8F A;  2DX1 A;  1GG3 A;  2I5C A;  2IFS A;  1SGH A;  5JLJ B;  1TJ6 A;  3P6A A;  2X18 A;  4HHV A;  1X1F A;  1EF1 A;  2VKI A;  2W2X C;  5C16 A;  5D27 A;  2LKO A;  4WVF B;  2J0K A;  5C5B B;  2H7D A;  2VRW B;  2KGX B;  2H7E A;  3PVU A;  2EMS A;  3DXD A;  3TFM A;  4C0A A;  4PQ0 A;  3QIJ A;  3F5R A;  1NTY A;  1MKE A;  4H8S A;  4B6H A;  2DYN A;  4YL8 A;  2ZPY A;  1OQN A;  1DDM A;  1V5U A;  3BIN A;  1UEF A;  3KRW A;  4GMX B;  4HB4 B;  1Q67 A;  2DTC A;  1XD4 A;  5JHH A;  1FHO A;  1M7E A;  2DN6 A;  2N23 A;  4IOY X;  3SUZ A;  3SV1 A;  3NSU A;  3KRX A;  4HDO A;  1XCG A;  3BJI A;  4GMV A;  2EC1 A;  2Y7B A;  5HE0 A;  2D9Y A;  4A5K A;  1EVH A;  5JP4 A;  3AU4 A;  1RJ2 A;  4EMO A;  4K2P A;  3SO6 A;  5L81 A;  1ZC3 B;  2GS0 A;  3QBV B;  3GYO A;  2YRY A;  3T06 A;  4HAT B;  2CY5 A;  1V5P A;  3PP2 A;  2J59 M;  1UPQ A;  4DX9 0;  4HAX B;  3X23 A;  1E5W A;  2COD A;  3MPX A;  2COF A;  1WGU A;  2CY4 A;  3DXE A;  1FGZ A;  2Z0Q A;  2COC A;  3IVF A;  5KQ1 A;  5LOP B;  1X05 A;  1BTK A;  2M14 A;  2OQB A;  1H10 A;  3SYX A;  1X1G A;  2G35 A;  2D9W A;  3PSC A;  2Y8G A;  2D9X A;  2BCJ A;  5HE3 A;  5KCV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...