5LOPB

Structure of the active form of /k. lactis/ dcp1-dcp2-edc3 decapping complex bound to m7gdp
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
183
structure length
173
Chain Sequence
TETLEIYRKALNFNVIARYDPKIKQLLFHTPHATVYKWGDDNWNKLEYQGVLAIYLRDVGDKEAILPEVSSEANTPHVLTGHDIYNYGLIIMNRINPDNFSLAIAPNSVLNKRKLFAPNREEELEPMKVEVRDDLVMIKTLKKEVYGIWVHTPEDRQNIYELIKYLLENEPTD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Rna binding protein
molecule keywords KLLA0F23980p
publication title Structure of the active form of Dcp1-Dcp2 decapping enzyme bound to m(7)GDP and its Edc3 activator.
pubmed doi rcsb
source organism Kluyveromyces lactis nrrl y-1140
total genus 29
structure length 173
sequence length 183
ec nomenclature
pdb deposition date 2016-08-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF06058 DCP1 Dcp1-like decapping family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 5lopB01
1K5DB 2QKMA 1EAZA 3TFMA 4F7UP 2VKIA 2V76A 4MT7A 1OQNA 2D10A 1MK9B 4K2PA 2KCJA 2DHKA 2LYDA 2OQBA 3SNHA 3HQCA 4NSWA 1NU2A 1B55A 1LW3A 4HHVA 2DKPA 2GCLA 4A6HA 3QBVB 1ISNA 1V5MA 1X05A 3ML4A 3RCPA 2EC1A 3T06A 2YS3A 3IVFA 2GCJA 1U5EA 2Q13A 3V5WA 1K5GB 2YSZA 5D3WA 3GYOA 3F5RA 2R09A 3PP2A 2ADZA 1OY2A 4DXAB 1Y5OA 3MDBC 2RSGA 2UZRA 4HAZB 4CHMA 4C0AA 2D11A 4WJ7A 3KY9A 3G9WA 1UNRA 5JP4A 1TXDA 4KHAA 2VSZA 1FB8A 5CLLB 2HTHB 2GS0A 1WG7A 1NTVA 4HDOA 2W2XD 2RVBB 2H7EA 1V5PA 2EMSA 5J3TA 1M7EA 3KSYA 4WSFA 1XR0B 2Y8GA 4MK0A 3X23A 4PNKA 3QWMA 4TYZA 2P0DA 3M1IB 1U27A 1ZM0A 4KHBB 3DXEA 2DYNA 2DKQA 2UVMA 1NTYA 4EJNA 2BCJA 3KRXA 2MFQA 4GMXB 3VOQA 5D3XA 2DLWA 1OMWA 2LKOA 2Z0QA 1KZGA 2M38A 3WA0A 1UEFA 2CY5A 2D2QA 4HAWB 4Z2MB 3TO1A 3ZDTA 2COFA 4PQ0A 5GOWB 1X86A 3AU5A 4IAPA 5JHHA 1IRSA 2K2UA 2AL6A 1PFJA 3GYPA 3ODWA 2DFKA 3FM8C 2Y8FA 2N23A 2I1JA 3PZDA 1X1FA 3PG7A 2JP2A 2YRYA 1I7AA 1E5WA 4NY0A 5KQ4A 1I2HA 2KGXB 2KUPA 1NI2A 2DHJA 1DROA 2ROVA 2LULA 1Y19B 3KZ1A 4XWXA 1UPRA 3DXDA 1BAKA 2COCA 2CRFA 2MDXA 2M14A 3SYXA 1DDMA 2ROZB 3D8FA 2D9WA 1H4RA 1XKEA 5DI9B 2YT1A 2DA0A 4GMVA 3U8ZA 4ZRIA 2OTXA 4KAXB 1WJMA 4Y94A 2GJYA 1KZ7A 2RUKB 2DYQA 5HE1A 3PVWA 3D8DA 1FHXA 5CLQB 3CXBB 1U29A 1XD4A 3A98B 4HB3B 3BINA 3P7ZA 1MIZB 4YL8A 2IYBA 2DTCA 3HW2B 4GPTB 2D9XA 5JHGA 2COAA 2FJLA 2CAYA 1FGYA 1GG3A 4P7IA 2W2WA 1P3RA 1V5UA 5DHFB 2DN6A 2YT0A 3OANA 2CY4A 1V88A 1MIXA 1EGXA 1FHWA 2W2XC 4CYEA 4B6HA 1TQZA 1PMSA 3QIJA 3TW1A 1RJ2A 1SGHA 4D0NB 3SUZA 1LB1A 2P0HA 1ZVRA 1V89A 2MKRA 4HAXB 4K17A 1M7RA 3NSUA 2L1CA 4HAVB 5KQ1A 4ZRJA 5D27A 2Y7BA 2RLOA 1ZSQA 2NMBA 2E2XA 2MWNB 2ZPYA 4GXBA 3TCAA 1QC6A 2DX1A 2I5FA 5DHAB 1QQGA 5LOPB 1KI1B 4H8SA 2K2JA 4HB4B 1P5TA 2HE7A 3FEHA 2IFSA 2PZ1A 3U7DA 3AJ4A 1J19A 3TVVA 2RGNB 2YS5A 2YS1A 3ZVRA 5JLJB 5C6RA 1ZC4B 4DX90 4L6EA 5J3YA 1WGUA 1FOEA 3ODOA 3SO6A 4A6FB 2DHIA 4HB0B 1WI1A 2ELBA 2K00A 1FGZA 4HB2B 1Q67A 2L2IA 3O96A 4WVFB 1MK7B 4HAYB 1MAIA 2H7DA 3UZTA 2EJ8A 4HATB 3WYFB 2YF0A 4IFSA 1BTNA 2QKLA 4TKNA 1FAOA 2LG1A 2D9ZA 4DX8A 1FHOA 4KHOA 2G35A 3PSCA 5C16A 2AEHA 5D3YA 1H10A 2R0DA 1XODA 5C5BA 1DBHA 1U5DA 3F0WA 1AQCA 4A6FA 4DBBA 5HE0A 3SV1A 5L81A 4ZRKA 4F7HA 1U5FA 2YVCA 3ODXA 3D8EA 4GN1A 2I1KA 1GC6A 2DX5A 4MY6A 1J0WA 4YONA 2X18A 4A5KA 3VIAA 1U5GA 1X11A 1W1DA 3FSSA 1WJ1A 2N0YA 3PVLA 1XX0A 3ULCA 4IOYX 1BTKA 3A8QA 4GZUA 3PEGA 1W1GA 4K81A 5FI0A 2J0JA 2XQNM 2RNRB 3HK0A 5FI1A 2I5CA 2D9YA 4BBKA 2Z0OA 2P0FA 4F7GA 2D9VA 5DH9B 1X1GA 3LJUX 1UNQA 3AU4A 5J3QA 1UNPA 5D3VA 3BJIA 2Z0PA 4EKUA 1ZC3B 1WGQA 2J0KA 1RRPB 2LOXA 2UZSA 2J59M 1PLSA 1MPHA 3P6AA 1P6SA 3A8PA 1Z87A 2ELAA 1U2BA 5EFXA 1GC7A 1TJ6A 2CODA 4CHJA 5HE3A 1V61A 1W1HA 4K2OA 3MPXA 1WVHA 1DYNA 2NZ8B 3ULBA 5C5BB 1AWEA 2J0MA 1EVHA 1N3HA 5HE2A 5C79A 1MKEA 2LOZA 2D4QA 1XCGA 4HAUB 1BWNA 4HDQA 4KVGB 3PVUA 2P8VA 1DDVA 2EMTA 5KCVA 4A6KA 4EMOA 3DXCA 3N7CA 1DDWA 1UPQA 3CIKA 1EF1A 2VRWB 1SHCA 4Z2NA 5LONB 3KRWA 5DIFB
chains in the Genus database with same CATH superfamily
1K5DB 2QKMA 1EAZA 3TFMA 4F7UP 2VKIA 2V76A 4MT7A 1OQNA 2D10A 1MK9B 4K2PA 2KCJA 2DHKA 2LYDA 2OQBA 2Z59A 4QXAB 3SNHA 3HQCA 4NSWA 1NU2A 1B55A 1LW3A 4HHVA 2DKPA 2GCLA 4A6HA 3QBVB 1ISNA 1V5MA 1X05A 3ML4A 3RCPA 2EC1A 3T06A 2YS3A 3IVFA 2GCJA 1U5EA 2Q13A 3V5WA 2Z14A 1K5GB 2YSZA 5D3WA 3GYOA 3F5RA 2R09A 3PP2A 2ADZA 1OY2A 4DXAB 1Y5OA 3MDBC 2RSGA 2UZRA 4HAZB 4CHMA 4C0AA 2D11A 4WJ7A 3KY9A 3G9WA 1UNRA 5JP4A 1TXDA 4KHAA 2VSZA 1FB8A 5CLLB 2HTHB 2GS0A 1WG7A 1NTVA 4HDOA 2W2XD 2RVBB 2H7EA 1V5PA 2EMSA 3HIEA 5J3TA 1M7EA 3KSYA 4WSFA 1XR0B 2Y8GA 4MK0A 3X23A 2Z13A 4PNKA 3QWMA 4TYZA 2P0DA 3M1IB 1U27A 1ZM0A 4KHBB 3DXEA 2DYNA 2DKQA 2UVMA 1NTYA 4EJNA 2BCJA 2MFQA 3KRXA 4GMXB 3VOQA 5D3XA 2DLWA 1OMWA 2LKOA 2Z0QA 1KZGA 2M38A 3WA0A 1UEFA 2CY5A 2D2QA 4HAWB 4Z2MB 3TO1A 3ZDTA 2COFA 4PQ0A 5GOWB 1X86A 3AU5A 4IAPA 5JHHA 1IRSA 2K2UA 2AL6A 1PFJA 3GYPA 3ODWA 2DFKA 3FM8C 2Y8FA 2N23A 2I1JA 3PZDA 1X1FA 3PG7A 2JP2A 2YRYA 1I7AA 1E5WA 4NY0A 5KQ4A 1I2HA 2KGXB 2KUPA 1NI2A 2DHJA 1DROA 2ROVA 2LULA 1Y19B 3KZ1A 4XWXA 1MI1A 1UPRA 3DXDA 1BAKA 2COCA 5IRSA 2CRFA 2MDXA 2M14A 3SYXA 1DDMA 2ROZB 3D8FA 2D9WA 1H4RA 1XKEA 5DI9B 2YT1A 2DA0A 2GUMA 4GMVA 3U8ZA 4ZRIA 2K8EA 2OTXA 4DIXA 4KAXB 1WJMA 4GOUA 4Y94A 2GJYA 1KZ7A 2RUKB 3DCXA 2DYQA 5HE1A 3PVWA 2RRFA 3D8DA 1FHXA 5CLQB 3CXBB 1U29A 1XD4A 3A98B 4HB3B 3HSAA 3BINA 3P7ZA 1MIZB 4YL8A 2IYBA 2DTCA 3HW2B 4GPTB 2D9XA 4GNKB 5JHGA 2COAA 2R2YA 2FJLA 2CAYA 1FGYA 1GG3A 4P7IA 2W2WA 1P3RA 1V5UA 5DHFB 2DN6A 2YT0A 3OANA 4HSIA 2CY4A 1V88A 1MIXA 1EGXA 1FHWA 2W2XC 4CYEA 4B6HA 1TQZA 1PMSA 3QIJA 3FVCA 3TW1A 1RJ2A 4D6WA 1SGHA 4D0NB 3SUZA 2Z4DA 1LB1A 2P0HA 1T77A 1ZVRA 4CSQA 1V89A 2MKRA 4HAXB 4K17A 1M7RA 3NSUA 2L1CA 4HAVB 5KQ1A 4ZRJA 5D27A 2Y7BA 2RLOA 1ZSQA 2NMBA 2E2XA 2MWNB 2ZPYA 4GXBA 3TCAA 1QC6A 2DX1A 2NBVA 2KR0A 2I5FA 5DHAB 1QQGA 5LOPB 1KI1B 4H8SA 2K2JA 4HB4B 1P5TA 2HE7A 3FEHA 2IFSA 2PZ1A 3U7DA 3AJ4A 1J19A 3TVVA 2RGNB 2YS5A 2YS1A 3ZVRA 5JLJB 5C6RA 1ZC4B 4DX90 4L6EA 4QJ3B 5J3YA 1WGUA 1FOEA 3ODOA 3SO6A 4A6FB 2DHIA 4HB0B 1WI1A 2ELBA 2K00A 1FGZA 4HB2B 1Q67A 2L2IA 3B77A 3O96A 4WVFB 1MK7B 4HAYB 1MAIA 2H7DA 3A58A 3UZTA 2EJ8A 4HATB 3WYFB 2YF0A 4IFSA 1BTNA 2QKLA 4TKNA 1FAOA 2LG1A 2D9ZA 4DX8A 1FHOA 2YT2A 2KIEA 4KHOA 2K49A 2G35A 3PSCA 5C16A 2AEHA 5D3YA 1H10A 2R0DA 1XODA 4OT1A 5C5BA 1DBHA 1U5DA 3F0WA 1AQCA 4A6FA 4DBBA 5HE0A 3SV1A 5L81A 3NWAA 4ZRKA 2KIGA 4F7HA 1U5FA 2YVCA 3ODXA 3D8EA 3NWDA 3OHMB 4GN1A 2I1KA 1GC6A 2DX5A 4MY6A 1J0WA 4YONA 2X18A 4A5KA 2FJUB 3VIAA 2KUQA 1U5GA 1X11A 2ZKMX 1W1DA 3FSSA 1WJ1A 2N0YA 3PVLA 1XX0A 3ULCA 4IOYX 1BTKA 3A8QA 4GZUA 3PEGA 1W1GA 4K81A 5FI0A 2J0JA 2XQNM 2RNRB 3HK0A 5M4YB 5FI1A 2I5CA 2D9YA 4L1RA 4BBKA 5LG4B 2Z0OA 5I2MA 2P0FA 4F7GA 2D9VA 5DH9B 1X1GA 3LJUX 1UNQA 3AU4A 5J3QA 1UNPA 5D3VA 3BJIA 2Z0PA 4EKUA 1ZC3B 1WGQA 2J0KA 4QJ5B 1RRPB 2LOXA 2UZSA 2J59M 1PLSA 1MPHA 3U12A 3P6AA 1P6SA 3A8PA 1Z87A 2ELAA 1U2BA 5EFXA 1GC7A 5I2SA 1TJ6A 2CODA 4CHJA 5HE3A 4QJ4B 1V61A 1W1HA 4K2OA 3MPXA 3NWFA 4OSNA 1WVHA 1DYNA 2NZ8B 3ULBA 5C5BB 1AWEA 2J0MA 1EVHA 1N3HA 5HE2A 5C79A 3NW8A 1MKEA 2LOZA 2D4QA 1XCGA 4HAUB 1BWNA 4HDQA 4KVGB 3PVUA 2P8VA 4KHBA 1DDVA 2EMTA 5KCVA 4A6KA 4EMOA 3DXCA 3N7CA 1DDWA 1UPQA 3CIKA 1EF1A 1ZYIA 2VRWB 1SHCA 4Z2NA 5LONB 3KRWA 5DIFB
chains in the Genus database with same CATH topology
1K5DB 2QKMA 1EAZA 3TFMA 4F7UP 2VKIA 2V76A 4MT7A 1OQNA 2D10A 1MK9B 4K2PA 2KCJA 2DHKA 2LYDA 2OQBA 3SNHA 3HQCA 4NSWA 1NU2A 1B55A 1LW3A 4HHVA 2DKPA 2GCLA 4A6HA 3QBVB 1ISNA 1V5MA 1X05A 3ML4A 3RCPA 2EC1A 3T06A 2YS3A 3IVFA 2GCJA 1U5EA 2Q13A 3V5WA 1K5GB 2YSZA 5D3WA 3GYOA 3F5RA 2R09A 3PP2A 2ADZA 1OY2A 4DXAB 1Y5OA 3MDBC 2RSGA 2UZRA 4HAZB 4CHMA 4C0AA 2D11A 4WJ7A 3KY9A 3G9WA 1UNRA 5JP4A 1TXDA 4KHAA 2VSZA 1FB8A 5CLLB 2HTHB 2GS0A 1WG7A 1NTVA 4HDOA 2W2XD 2RVBB 2H7EA 1V5PA 2EMSA 5J3TA 1M7EA 3KSYA 4WSFA 1XR0B 2Y8GA 4MK0A 3X23A 4PNKA 3QWMA 4TYZA 2P0DA 3M1IB 1U27A 1ZM0A 4KHBB 3DXEA 2DYNA 2DKQA 2UVMA 1NTYA 4EJNA 2BCJA 3KRXA 2MFQA 4GMXB 3VOQA 5D3XA 2DLWA 1OMWA 2LKOA 2Z0QA 1KZGA 2M38A 3WA0A 1UEFA 2CY5A 2D2QA 4HAWB 4Z2MB 3TO1A 3ZDTA 2COFA 4PQ0A 5GOWB 1X86A 3AU5A 4IAPA 5JHHA 1IRSA 2K2UA 2AL6A 1PFJA 3GYPA 3ODWA 2DFKA 3FM8C 2Y8FA 2N23A 2I1JA 3PZDA 1X1FA 3PG7A 2JP2A 2YRYA 1I7AA 1E5WA 4NY0A 5KQ4A 1I2HA 2KGXB 2KUPA 1NI2A 2DHJA 1DROA 2ROVA 2LULA 1Y19B 3KZ1A 4XWXA 1UPRA 3DXDA 1BAKA 2COCA 2CRFA 2MDXA 2M14A 3SYXA 1DDMA 2ROZB 3D8FA 2D9WA 1H4RA 1XKEA 5DI9B 2YT1A 2DA0A 4GMVA 3U8ZA 4ZRIA 2OTXA 4KAXB 1WJMA 4Y94A 2GJYA 1KZ7A 2RUKB 2DYQA 5HE1A 3PVWA 3D8DA 1FHXA 5CLQB 3CXBB 1U29A 1XD4A 3A98B 4HB3B 3BINA 3P7ZA 1MIZB 4YL8A 2IYBA 2DTCA 3HW2B 4GPTB 2D9XA 5JHGA 2COAA 2FJLA 2CAYA 1FGYA 1GG3A 4P7IA 2W2WA 1P3RA 1V5UA 5DHFB 2DN6A 2YT0A 3OANA 2CY4A 1V88A 1MIXA 1EGXA 1FHWA 2W2XC 4CYEA 4B6HA 1TQZA 1PMSA 3QIJA 3TW1A 1RJ2A 1SGHA 4D0NB 3SUZA 1LB1A 2P0HA 1ZVRA 1V89A 2MKRA 4HAXB 4K17A 1M7RA 3NSUA 2L1CA 4HAVB 5KQ1A 4ZRJA 5D27A 2Y7BA 2RLOA 1ZSQA 2NMBA 2E2XA 2MWNB 2ZPYA 4GXBA 3TCAA 1QC6A 2DX1A 2I5FA 5DHAB 1QQGA 5LOPB 1KI1B 4H8SA 2K2JA 4HB4B 1P5TA 2HE7A 3FEHA 2IFSA 2PZ1A 3U7DA 3AJ4A 1J19A 3TVVA 2RGNB 2YS5A 2YS1A 3ZVRA 5JLJB 5C6RA 1ZC4B 4DX90 4L6EA 5J3YA 1WGUA 1FOEA 3ODOA 3SO6A 4A6FB 2DHIA 4HB0B 1WI1A 2ELBA 2K00A 1FGZA 4HB2B 1Q67A 2L2IA 3O96A 4WVFB 1MK7B 4HAYB 1MAIA 2H7DA 3UZTA 2EJ8A 4HATB 3WYFB 2YF0A 4IFSA 1BTNA 2QKLA 4TKNA 1FAOA 2LG1A 2D9ZA 4DX8A 1FHOA 4KHOA 2G35A 3PSCA 5C16A 2AEHA 5D3YA 1H10A 2R0DA 1XODA 5C5BA 1DBHA 1U5DA 3F0WA 1AQCA 4A6FA 4DBBA 5HE0A 3SV1A 5L81A 4ZRKA 4F7HA 1U5FA 2YVCA 3ODXA 3D8EA 4GN1A 2I1KA 1GC6A 2DX5A 4MY6A 1J0WA 4YONA 2X18A 4A5KA 3VIAA 1U5GA 1X11A 1W1DA 3FSSA 1WJ1A 2N0YA 3PVLA 1XX0A 3ULCA 4IOYX 1BTKA 3A8QA 4GZUA 3PEGA 1W1GA 4K81A 5FI0A 2J0JA 2XQNM 2RNRB 3HK0A 5FI1A 2I5CA 2D9YA 4BBKA 2Z0OA 2P0FA 4F7GA 2D9VA 5DH9B 1X1GA 3LJUX 1UNQA 3AU4A 5J3QA 1UNPA 5D3VA 3BJIA 2Z0PA 4EKUA 1ZC3B 1WGQA 2J0KA 1RRPB 2LOXA 2UZSA 2J59M 1PLSA 1MPHA 3P6AA 1P6SA 3A8PA 1Z87A 2ELAA 1U2BA 5EFXA 1GC7A 1TJ6A 2CODA 4CHJA 5HE3A 1V61A 1W1HA 4K2OA 3MPXA 1WVHA 1DYNA 2NZ8B 3ULBA 5C5BB 1AWEA 2J0MA 1EVHA 1N3HA 5HE2A 5C79A 1MKEA 2LOZA 2D4QA 1XCGA 4HAUB 1BWNA 4HDQA 4KVGB 3PVUA 2P8VA 1DDVA 2EMTA 5KCVA 4A6KA 4EMOA 3DXCA 3N7CA 1DDWA 1UPQA 3CIKA 1EF1A 2VRWB 1SHCA 4Z2NA 5LONB 3KRWA 5DIFB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1K5D B;  2QKM A;  1EAZ A;  3TFM A;  4F7U P;  2VKI A;  2V76 A;  4MT7 A;  1OQN A;  2D10 A;  1MK9 B;  4K2P A;  2KCJ A;  2DHK A;  2LYD A;  2OQB A;  3SNH A;  3HQC A;  4NSW A;  1NU2 A;  1B55 A;  1LW3 A;  4HHV A;  2DKP A;  2GCL A;  4A6H A;  3QBV B;  1ISN A;  1V5M A;  1X05 A;  3ML4 A;  3RCP A;  2EC1 A;  3T06 A;  2YS3 A;  3IVF A;  2GCJ A;  1U5E A;  2Q13 A;  3V5W A;  1K5G B;  2YSZ A;  5D3W A;  3GYO A;  3F5R A;  2R09 A;  3PP2 A;  2ADZ A;  1OY2 A;  4DXA B;  1Y5O A;  3MDB C;  2RSG A;  2UZR A;  4HAZ B;  4CHM A;  4C0A A;  2D11 A;  4WJ7 A;  3KY9 A;  3G9W A;  1UNR A;  5JP4 A;  1TXD A;  4KHA A;  2VSZ A;  1FB8 A;  5CLL B;  2HTH B;  2GS0 A;  1WG7 A;  1NTV A;  4HDO A;  2W2X D;  2RVB B;  2H7E A;  1V5P A;  2EMS A;  5J3T A;  1M7E A;  3KSY A;  4WSF A;  1XR0 B;  2Y8G A;  4MK0 A;  3X23 A;  4PNK A;  3QWM A;  4TYZ A;  2P0D A;  3M1I B;  1U27 A;  1ZM0 A;  4KHB B;  3DXE A;  2DYN A;  2DKQ A;  2UVM A;  1NTY A;  4EJN A;  2BCJ A;  3KRX A;  2MFQ A;  4GMX B;  3VOQ A;  5D3X A;  2DLW A;  1OMW A;  2LKO A;  2Z0Q A;  1KZG A;  2M38 A;  3WA0 A;  1UEF A;  2CY5 A;  2D2Q A;  4HAW B;  4Z2M B;  3TO1 A;  3ZDT A;  2COF A;  4PQ0 A;  5GOW B;  1X86 A;  3AU5 A;  4IAP A;  5JHH A;  1IRS A;  2K2U A;  2AL6 A;  1PFJ A;  3GYP A;  3ODW A;  2DFK A;  3FM8 C;  2Y8F A;  2N23 A;  2I1J A;  3PZD A;  1X1F A;  3PG7 A;  2JP2 A;  2YRY A;  1I7A A;  1E5W A;  4NY0 A;  5KQ4 A;  1I2H A;  2KGX B;  2KUP A;  1NI2 A;  2DHJ A;  1DRO A;  2ROV A;  2LUL A;  1Y19 B;  3KZ1 A;  4XWX A;  1UPR A;  3DXD A;  1BAK A;  2COC A;  2CRF A;  2MDX A;  2M14 A;  3SYX A;  1DDM A;  2ROZ B;  3D8F A;  2D9W A;  1H4R A;  1XKE A;  5DI9 B;  2YT1 A;  2DA0 A;  4GMV A;  3U8Z A;  4ZRI A;  2OTX A;  4KAX B;  1WJM A;  4Y94 A;  2GJY A;  1KZ7 A;  2RUK B;  2DYQ A;  5HE1 A;  3PVW A;  3D8D A;  1FHX A;  5CLQ B;  3CXB B;  1U29 A;  1XD4 A;  3A98 B;  4HB3 B;  3BIN A;  3P7Z A;  1MIZ B;  4YL8 A;  2IYB A;  2DTC A;  3HW2 B;  4GPT B;  2D9X A;  5JHG A;  2COA A;  2FJL A;  2CAY A;  1FGY A;  1GG3 A;  4P7I A;  2W2W A;  1P3R A;  1V5U A;  5DHF B;  2DN6 A;  2YT0 A;  3OAN A;  2CY4 A;  1V88 A;  1MIX A;  1EGX A;  1FHW A;  2W2X C;  4CYE A;  4B6H A;  1TQZ A;  1PMS A;  3QIJ A;  3TW1 A;  1RJ2 A;  1SGH A;  4D0N B;  3SUZ A;  1LB1 A;  2P0H A;  1ZVR A;  1V89 A;  2MKR A;  4HAX B;  4K17 A;  1M7R A;  3NSU A;  2L1C A;  4HAV B;  5KQ1 A;  4ZRJ A;  5D27 A;  2Y7B A;  2RLO A;  1ZSQ A;  2NMB A;  2E2X A;  2MWN B;  2ZPY A;  4GXB A;  3TCA A;  1QC6 A;  2DX1 A;  2I5F A;  5DHA B;  1QQG A;  5LOP B;  1KI1 B;  4H8S A;  2K2J A;  4HB4 B;  1P5T A;  2HE7 A;  3FEH A;  2IFS A;  2PZ1 A;  3U7D A;  3AJ4 A;  1J19 A;  3TVV A;  2RGN B;  2YS5 A;  2YS1 A;  3ZVR A;  5JLJ B;  5C6R A;  1ZC4 B;  4DX9 0;  4L6E A;  5J3Y A;  1WGU A;  1FOE A;  3ODO A;  3SO6 A;  4A6F B;  2DHI A;  4HB0 B;  1WI1 A;  2ELB A;  2K00 A;  1FGZ A;  4HB2 B;  1Q67 A;  2L2I A;  3O96 A;  4WVF B;  1MK7 B;  4HAY B;  1MAI A;  2H7D A;  3UZT A;  2EJ8 A;  4HAT B;  3WYF B;  2YF0 A;  4IFS A;  1BTN A;  2QKL A;  4TKN A;  1FAO A;  2LG1 A;  2D9Z A;  4DX8 A;  1FHO A;  4KHO A;  2G35 A;  3PSC A;  5C16 A;  2AEH A;  5D3Y A;  1H10 A;  2R0D A;  1XOD A;  5C5B A;  1DBH A;  1U5D A;  3F0W A;  1AQC A;  4A6F A;  4DBB A;  5HE0 A;  3SV1 A;  5L81 A;  4ZRK A;  4F7H A;  1U5F A;  2YVC A;  3ODX A;  3D8E A;  4GN1 A;  2I1K A;  1GC6 A;  2DX5 A;  4MY6 A;  1J0W A;  4YON A;  2X18 A;  4A5K A;  3VIA A;  1U5G A;  1X11 A;  1W1D A;  3FSS A;  1WJ1 A;  2N0Y A;  3PVL A;  1XX0 A;  3ULC A;  4IOY X;  1BTK A;  3A8Q A;  4GZU A;  3PEG A;  1W1G A;  4K81 A;  5FI0 A;  2J0J A;  2XQN M;  2RNR B;  3HK0 A;  5FI1 A;  2I5C A;  2D9Y A;  4BBK A;  2Z0O A;  2P0F A;  4F7G A;  2D9V A;  5DH9 B;  1X1G A;  3LJU X;  1UNQ A;  3AU4 A;  5J3Q A;  1UNP A;  5D3V A;  3BJI A;  2Z0P A;  4EKU A;  1ZC3 B;  1WGQ A;  2J0K A;  1RRP B;  2LOX A;  2UZS A;  2J59 M;  1PLS A;  1MPH A;  3P6A A;  1P6S A;  3A8P A;  1Z87 A;  2ELA A;  1U2B A;  5EFX A;  1GC7 A;  1TJ6 A;  2COD A;  4CHJ A;  5HE3 A;  1V61 A;  1W1H A;  4K2O A;  3MPX A;  1WVH A;  1DYN A;  2NZ8 B;  3ULB A;  5C5B B;  1AWE A;  2J0M A;  1EVH A;  1N3H A;  5HE2 A;  5C79 A;  1MKE A;  2LOZ A;  2D4Q A;  1XCG A;  4HAU B;  1BWN A;  4HDQ A;  4KVG B;  3PVU A;  2P8V A;  1DDV A;  2EMT A;  5KCV A;  4A6K A;  4EMO A;  3DXC A;  3N7C A;  1DDW A;  1UPQ A;  3CIK A;  1EF1 A;  2VRW B;  1SHC A;  4Z2N A;  5LON B;  3KRW A;  5DIF B; 
#chains in the Genus database with same CATH topology
 1K5D B;  2QKM A;  1EAZ A;  3TFM A;  4F7U P;  2VKI A;  2V76 A;  4MT7 A;  1OQN A;  2D10 A;  1MK9 B;  4K2P A;  2KCJ A;  2DHK A;  2LYD A;  2OQB A;  2Z59 A;  4QXA B;  3SNH A;  3HQC A;  4NSW A;  1NU2 A;  1B55 A;  1LW3 A;  4HHV A;  2DKP A;  2GCL A;  4A6H A;  3QBV B;  1ISN A;  1V5M A;  1X05 A;  3ML4 A;  3RCP A;  2EC1 A;  3T06 A;  2YS3 A;  3IVF A;  2GCJ A;  1U5E A;  2Q13 A;  3V5W A;  2Z14 A;  1K5G B;  2YSZ A;  5D3W A;  3GYO A;  3F5R A;  2R09 A;  3PP2 A;  2ADZ A;  1OY2 A;  4DXA B;  1Y5O A;  3MDB C;  2RSG A;  2UZR A;  4HAZ B;  4CHM A;  4C0A A;  2D11 A;  4WJ7 A;  3KY9 A;  3G9W A;  1UNR A;  5JP4 A;  1TXD A;  4KHA A;  2VSZ A;  1FB8 A;  5CLL B;  2HTH B;  2GS0 A;  1WG7 A;  1NTV A;  4HDO A;  2W2X D;  2RVB B;  2H7E A;  1V5P A;  2EMS A;  3HIE A;  5J3T A;  1M7E A;  3KSY A;  4WSF A;  1XR0 B;  2Y8G A;  4MK0 A;  3X23 A;  2Z13 A;  4PNK A;  3QWM A;  4TYZ A;  2P0D A;  3M1I B;  1U27 A;  1ZM0 A;  4KHB B;  3DXE A;  2DYN A;  2DKQ A;  2UVM A;  1NTY A;  4EJN A;  2BCJ A;  2MFQ A;  3KRX A;  4GMX B;  3VOQ A;  5D3X A;  2DLW A;  1OMW A;  2LKO A;  2Z0Q A;  1KZG A;  2M38 A;  3WA0 A;  1UEF A;  2CY5 A;  2D2Q A;  4HAW B;  4Z2M B;  3TO1 A;  3ZDT A;  2COF A;  4PQ0 A;  5GOW B;  1X86 A;  3AU5 A;  4IAP A;  5JHH A;  1IRS A;  2K2U A;  2AL6 A;  1PFJ A;  3GYP A;  3ODW A;  2DFK A;  3FM8 C;  2Y8F A;  2N23 A;  2I1J A;  3PZD A;  1X1F A;  3PG7 A;  2JP2 A;  2YRY A;  1I7A A;  1E5W A;  4NY0 A;  5KQ4 A;  1I2H A;  2KGX B;  2KUP A;  1NI2 A;  2DHJ A;  1DRO A;  2ROV A;  2LUL A;  1Y19 B;  3KZ1 A;  4XWX A;  1MI1 A;  1UPR A;  3DXD A;  1BAK A;  2COC A;  5IRS A;  2CRF A;  2MDX A;  2M14 A;  3SYX A;  1DDM A;  2ROZ B;  3D8F A;  2D9W A;  1H4R A;  1XKE A;  5DI9 B;  2YT1 A;  2DA0 A;  2GUM A;  4GMV A;  3U8Z A;  4ZRI A;  2K8E A;  2OTX A;  4DIX A;  4KAX B;  1WJM A;  4GOU A;  4Y94 A;  2GJY A;  1KZ7 A;  2RUK B;  3DCX A;  2DYQ A;  5HE1 A;  3PVW A;  2RRF A;  3D8D A;  1FHX A;  5CLQ B;  3CXB B;  1U29 A;  1XD4 A;  3A98 B;  4HB3 B;  3HSA A;  3BIN A;  3P7Z A;  1MIZ B;  4YL8 A;  2IYB A;  2DTC A;  3HW2 B;  4GPT B;  2D9X A;  4GNK B;  5JHG A;  2COA A;  2R2Y A;  2FJL A;  2CAY A;  1FGY A;  1GG3 A;  4P7I A;  2W2W A;  1P3R A;  1V5U A;  5DHF B;  2DN6 A;  2YT0 A;  3OAN A;  4HSI A;  2CY4 A;  1V88 A;  1MIX A;  1EGX A;  1FHW A;  2W2X C;  4CYE A;  4B6H A;  1TQZ A;  1PMS A;  3QIJ A;  3FVC A;  3TW1 A;  1RJ2 A;  4D6W A;  1SGH A;  4D0N B;  3SUZ A;  2Z4D A;  1LB1 A;  2P0H A;  1T77 A;  1ZVR A;  4CSQ A;  1V89 A;  2MKR A;  4HAX B;  4K17 A;  1M7R A;  3NSU A;  2L1C A;  4HAV B;  5KQ1 A;  4ZRJ A;  5D27 A;  2Y7B A;  2RLO A;  1ZSQ A;  2NMB A;  2E2X A;  2MWN B;  2ZPY A;  4GXB A;  3TCA A;  1QC6 A;  2DX1 A;  2NBV A;  2KR0 A;  2I5F A;  5DHA B;  1QQG A;  5LOP B;  1KI1 B;  4H8S A;  2K2J A;  4HB4 B;  1P5T A;  2HE7 A;  3FEH A;  2IFS A;  2PZ1 A;  3U7D A;  3AJ4 A;  1J19 A;  3TVV A;  2RGN B;  2YS5 A;  2YS1 A;  3ZVR A;  5JLJ B;  5C6R A;  1ZC4 B;  4DX9 0;  4L6E A;  4QJ3 B;  5J3Y A;  1WGU A;  1FOE A;  3ODO A;  3SO6 A;  4A6F B;  2DHI A;  4HB0 B;  1WI1 A;  2ELB A;  2K00 A;  1FGZ A;  4HB2 B;  1Q67 A;  2L2I A;  3B77 A;  3O96 A;  4WVF B;  1MK7 B;  4HAY B;  1MAI A;  2H7D A;  3A58 A;  3UZT A;  2EJ8 A;  4HAT B;  3WYF B;  2YF0 A;  4IFS A;  1BTN A;  2QKL A;  4TKN A;  1FAO A;  2LG1 A;  2D9Z A;  4DX8 A;  1FHO A;  2YT2 A;  2KIE A;  4KHO A;  2K49 A;  2G35 A;  3PSC A;  5C16 A;  2AEH A;  5D3Y A;  1H10 A;  2R0D A;  1XOD A;  4OT1 A;  5C5B A;  1DBH A;  1U5D A;  3F0W A;  1AQC A;  4A6F A;  4DBB A;  5HE0 A;  3SV1 A;  5L81 A;  3NWA A;  4ZRK A;  2KIG A;  4F7H A;  1U5F A;  2YVC A;  3ODX A;  3D8E A;  3NWD A;  3OHM B;  4GN1 A;  2I1K A;  1GC6 A;  2DX5 A;  4MY6 A;  1J0W A;  4YON A;  2X18 A;  4A5K A;  2FJU B;  3VIA A;  2KUQ A;  1U5G A;  1X11 A;  2ZKM X;  1W1D A;  3FSS A;  1WJ1 A;  2N0Y A;  3PVL A;  1XX0 A;  3ULC A;  4IOY X;  1BTK A;  3A8Q A;  4GZU A;  3PEG A;  1W1G A;  4K81 A;  5FI0 A;  2J0J A;  2XQN M;  2RNR B;  3HK0 A;  5M4Y B;  5FI1 A;  2I5C A;  2D9Y A;  4L1R A;  4BBK A;  5LG4 B;  2Z0O A;  5I2M A;  2P0F A;  4F7G A;  2D9V A;  5DH9 B;  1X1G A;  3LJU X;  1UNQ A;  3AU4 A;  5J3Q A;  1UNP A;  5D3V A;  3BJI A;  2Z0P A;  4EKU A;  1ZC3 B;  1WGQ A;  2J0K A;  4QJ5 B;  1RRP B;  2LOX A;  2UZS A;  2J59 M;  1PLS A;  1MPH A;  3U12 A;  3P6A A;  1P6S A;  3A8P A;  1Z87 A;  2ELA A;  1U2B A;  5EFX A;  1GC7 A;  5I2S A;  1TJ6 A;  2COD A;  4CHJ A;  5HE3 A;  4QJ4 B;  1V61 A;  1W1H A;  4K2O A;  3MPX A;  3NWF A;  4OSN A;  1WVH A;  1DYN A;  2NZ8 B;  3ULB A;  5C5B B;  1AWE A;  2J0M A;  1EVH A;  1N3H A;  5HE2 A;  5C79 A;  3NW8 A;  1MKE A;  2LOZ A;  2D4Q A;  1XCG A;  4HAU B;  1BWN A;  4HDQ A;  4KVG B;  3PVU A;  2P8V A;  4KHB A;  1DDV A;  2EMT A;  5KCV A;  4A6K A;  4EMO A;  3DXC A;  3N7C A;  1DDW A;  1UPQ A;  3CIK A;  1EF1 A;  1ZYI A;  2VRW B;  1SHC A;  4Z2N A;  5LON B;  3KRW A;  5DIF B; 
#chains in the Genus database with same CATH homology
 1K5D B;  2QKM A;  1EAZ A;  3TFM A;  4F7U P;  2VKI A;  2V76 A;  4MT7 A;  1OQN A;  2D10 A;  1MK9 B;  4K2P A;  2KCJ A;  2DHK A;  2LYD A;  2OQB A;  3SNH A;  3HQC A;  4NSW A;  1NU2 A;  1B55 A;  1LW3 A;  4HHV A;  2DKP A;  2GCL A;  4A6H A;  3QBV B;  1ISN A;  1V5M A;  1X05 A;  3ML4 A;  3RCP A;  2EC1 A;  3T06 A;  2YS3 A;  3IVF A;  2GCJ A;  1U5E A;  2Q13 A;  3V5W A;  1K5G B;  2YSZ A;  5D3W A;  3GYO A;  3F5R A;  2R09 A;  3PP2 A;  2ADZ A;  1OY2 A;  4DXA B;  1Y5O A;  3MDB C;  2RSG A;  2UZR A;  4HAZ B;  4CHM A;  4C0A A;  2D11 A;  4WJ7 A;  3KY9 A;  3G9W A;  1UNR A;  5JP4 A;  1TXD A;  4KHA A;  2VSZ A;  1FB8 A;  5CLL B;  2HTH B;  2GS0 A;  1WG7 A;  1NTV A;  4HDO A;  2W2X D;  2RVB B;  2H7E A;  1V5P A;  2EMS A;  5J3T A;  1M7E A;  3KSY A;  4WSF A;  1XR0 B;  2Y8G A;  4MK0 A;  3X23 A;  4PNK A;  3QWM A;  4TYZ A;  2P0D A;  3M1I B;  1U27 A;  1ZM0 A;  4KHB B;  3DXE A;  2DYN A;  2DKQ A;  2UVM A;  1NTY A;  4EJN A;  2BCJ A;  3KRX A;  2MFQ A;  4GMX B;  3VOQ A;  5D3X A;  2DLW A;  1OMW A;  2LKO A;  2Z0Q A;  1KZG A;  2M38 A;  3WA0 A;  1UEF A;  2CY5 A;  2D2Q A;  4HAW B;  4Z2M B;  3TO1 A;  3ZDT A;  2COF A;  4PQ0 A;  5GOW B;  1X86 A;  3AU5 A;  4IAP A;  5JHH A;  1IRS A;  2K2U A;  2AL6 A;  1PFJ A;  3GYP A;  3ODW A;  2DFK A;  3FM8 C;  2Y8F A;  2N23 A;  2I1J A;  3PZD A;  1X1F A;  3PG7 A;  2JP2 A;  2YRY A;  1I7A A;  1E5W A;  4NY0 A;  5KQ4 A;  1I2H A;  2KGX B;  2KUP A;  1NI2 A;  2DHJ A;  1DRO A;  2ROV A;  2LUL A;  1Y19 B;  3KZ1 A;  4XWX A;  1UPR A;  3DXD A;  1BAK A;  2COC A;  2CRF A;  2MDX A;  2M14 A;  3SYX A;  1DDM A;  2ROZ B;  3D8F A;  2D9W A;  1H4R A;  1XKE A;  5DI9 B;  2YT1 A;  2DA0 A;  4GMV A;  3U8Z A;  4ZRI A;  2OTX A;  4KAX B;  1WJM A;  4Y94 A;  2GJY A;  1KZ7 A;  2RUK B;  2DYQ A;  5HE1 A;  3PVW A;  3D8D A;  1FHX A;  5CLQ B;  3CXB B;  1U29 A;  1XD4 A;  3A98 B;  4HB3 B;  3BIN A;  3P7Z A;  1MIZ B;  4YL8 A;  2IYB A;  2DTC A;  3HW2 B;  4GPT B;  2D9X A;  5JHG A;  2COA A;  2FJL A;  2CAY A;  1FGY A;  1GG3 A;  4P7I A;  2W2W A;  1P3R A;  1V5U A;  5DHF B;  2DN6 A;  2YT0 A;  3OAN A;  2CY4 A;  1V88 A;  1MIX A;  1EGX A;  1FHW A;  2W2X C;  4CYE A;  4B6H A;  1TQZ A;  1PMS A;  3QIJ A;  3TW1 A;  1RJ2 A;  1SGH A;  4D0N B;  3SUZ A;  1LB1 A;  2P0H A;  1ZVR A;  1V89 A;  2MKR A;  4HAX B;  4K17 A;  1M7R A;  3NSU A;  2L1C A;  4HAV B;  5KQ1 A;  4ZRJ A;  5D27 A;  2Y7B A;  2RLO A;  1ZSQ A;  2NMB A;  2E2X A;  2MWN B;  2ZPY A;  4GXB A;  3TCA A;  1QC6 A;  2DX1 A;  2I5F A;  5DHA B;  1QQG A;  5LOP B;  1KI1 B;  4H8S A;  2K2J A;  4HB4 B;  1P5T A;  2HE7 A;  3FEH A;  2IFS A;  2PZ1 A;  3U7D A;  3AJ4 A;  1J19 A;  3TVV A;  2RGN B;  2YS5 A;  2YS1 A;  3ZVR A;  5JLJ B;  5C6R A;  1ZC4 B;  4DX9 0;  4L6E A;  5J3Y A;  1WGU A;  1FOE A;  3ODO A;  3SO6 A;  4A6F B;  2DHI A;  4HB0 B;  1WI1 A;  2ELB A;  2K00 A;  1FGZ A;  4HB2 B;  1Q67 A;  2L2I A;  3O96 A;  4WVF B;  1MK7 B;  4HAY B;  1MAI A;  2H7D A;  3UZT A;  2EJ8 A;  4HAT B;  3WYF B;  2YF0 A;  4IFS A;  1BTN A;  2QKL A;  4TKN A;  1FAO A;  2LG1 A;  2D9Z A;  4DX8 A;  1FHO A;  4KHO A;  2G35 A;  3PSC A;  5C16 A;  2AEH A;  5D3Y A;  1H10 A;  2R0D A;  1XOD A;  5C5B A;  1DBH A;  1U5D A;  3F0W A;  1AQC A;  4A6F A;  4DBB A;  5HE0 A;  3SV1 A;  5L81 A;  4ZRK A;  4F7H A;  1U5F A;  2YVC A;  3ODX A;  3D8E A;  4GN1 A;  2I1K A;  1GC6 A;  2DX5 A;  4MY6 A;  1J0W A;  4YON A;  2X18 A;  4A5K A;  3VIA A;  1U5G A;  1X11 A;  1W1D A;  3FSS A;  1WJ1 A;  2N0Y A;  3PVL A;  1XX0 A;  3ULC A;  4IOY X;  1BTK A;  3A8Q A;  4GZU A;  3PEG A;  1W1G A;  4K81 A;  5FI0 A;  2J0J A;  2XQN M;  2RNR B;  3HK0 A;  5FI1 A;  2I5C A;  2D9Y A;  4BBK A;  2Z0O A;  2P0F A;  4F7G A;  2D9V A;  5DH9 B;  1X1G A;  3LJU X;  1UNQ A;  3AU4 A;  5J3Q A;  1UNP A;  5D3V A;  3BJI A;  2Z0P A;  4EKU A;  1ZC3 B;  1WGQ A;  2J0K A;  1RRP B;  2LOX A;  2UZS A;  2J59 M;  1PLS A;  1MPH A;  3P6A A;  1P6S A;  3A8P A;  1Z87 A;  2ELA A;  1U2B A;  5EFX A;  1GC7 A;  1TJ6 A;  2COD A;  4CHJ A;  5HE3 A;  1V61 A;  1W1H A;  4K2O A;  3MPX A;  1WVH A;  1DYN A;  2NZ8 B;  3ULB A;  5C5B B;  1AWE A;  2J0M A;  1EVH A;  1N3H A;  5HE2 A;  5C79 A;  1MKE A;  2LOZ A;  2D4Q A;  1XCG A;  4HAU B;  1BWN A;  4HDQ A;  4KVG B;  3PVU A;  2P8V A;  1DDV A;  2EMT A;  5KCV A;  4A6K A;  4EMO A;  3DXC A;  3N7C A;  1DDW A;  1UPQ A;  3CIK A;  1EF1 A;  2VRW B;  1SHC A;  4Z2N A;  5LON B;  3KRW A;  5DIF B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...