5CLLB

Truncated ran wild type in complex with gdp-bef and ranbd1
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
139
structure length
139
Chain Sequence
GPHFEPVVPLPDKIEVKTGEEDEEEFFCNRAKLFRFDVESKEWKERGIGNVKILRHKTSGKIRLLMRREQVLKICANHYISPDMKLTPNAGSDRSFVWHALDYADELPKPEQLAIRFKTPEEAALFKCKFEEAQSILKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords GTP-binding nuclear protein Ran
publication title Catalysis of GTP Hydrolysis by Small GTPases at Atomic Detail by Integration of X-ray Crystallography, Experimental, and Theoretical IR Spectroscopy.
pubmed doi rcsb
source organism Homo sapiens
total genus 28
structure length 139
sequence length 139
chains with identical sequence D
ec nomenclature ec 6.3.2.-:
pdb deposition date 2015-07-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00638 Ran_BP1 RanBP1 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 5cllB00
4YL8A 4P7IA 1OMWA 2P0HA 1B55A 3QIJA 3UZTA 5FI0A 2D11A 4KVGB 1MIZB 1XKEA 2OTXA 5DIFB 2GS0A 2LOZA 2DFKA 2NZ8B 1PMSA 2UZSA 4A6HA 2YF0A 2D9XA 2KGXB 2YS1A 1Y19B 5D27A 1W1GA 3P6AA 3T06A 2J0MA 2RVBB 2Z0OA 1ZC4B 3KZ1A 2EC1A 3ML4A 1NI2A 3A98B 4ZRJA 2EMTA 4MY6A 4EJNA 4HB4B 2LG1A 2GCJA 3DXCA 3MPXA 4TYZA 5KCVA 5JHHA 5J3TA 1M7RA 3P7ZA 1K5GB 4Z2NA 2K2UA 2V76A 1DDWA 3X23A 1NTVA 5C5BB 2Y7BA 4WJ7A 2CY4A 2RLOA 2YS5A 2W2XC 2UZRA 3HK0A 2YRYA 3KSYA 1X11A 2N23A 2L2IA 4Z2MB 4NSWA 2LKOA 1U5FA 3D8DA 4HAZB 2ROZB 2AL6A 2MDXA 4NY0A 4HAYB 2RUKB 1J0WA 5C16A 1MIXA 2G35A 4HAVB 2D9WA 1KZ7A 4DX8A 2DYNA 1X1FA 4IOYX 4KAXB 1WI1A 2XQNM 2UVMA 3TFMA 3CIKA 3SV1A 1MKEA 3WA0A 2MWNB 2COAA 4DBBA 1KI1B 3VOQA 2I1KA 1XD4A 3AJ4A 4MT7A 3SO6A 3F5RA 5HE2A 2R0DA 1UNPA 5FI1A 4DX90 1ZC3B 5DI9B 3QWMA 1DYNA 3CXBB 2CRFA 2DKQA 1EAZA 1RJ2A 1U27A 3SNHA 4K2OA 1WVHA 1MPHA 4HB2B 3O96A 1P5TA 3ODWA 1U5DA 3U8ZA 2DX1A 1U5GA 1NU2A 1U29A 4D0NB 2ZPYA 1OQNA 3M1IB 1Q67A 2EJ8A 3PEGA 4HDOA 1MK9B 4HATB 2H7DA 5D3WA 1BWNA 1X1GA 1TQZA 2YT0A 2KUPA 1QQGA 1XX0A 3HW2B 2VKIA 3ODXA 3WYFB 3A8PA 4B6HA 1SHCA 1IRSA 4EKUA 4HAWB 1GC7A 2DHIA 2CAYA 2PZ1A 1BAKA 2JP2A 3FM8C 2Q13A 1BTKA 2IYBA 1M7EA 4CHMA 2LULA 3QBVB 3A8QA 2J0JA 4K17A 2VRWB 1DDMA 4F7GA 2D10A 1MAIA 1FHOA 2VSZA 4GXBA 2K2JA 1EGXA 2RGNB 2ELAA 3TW1A 2N0YA 2GJYA 3FSSA 1E5WA 1DBHA 4K2PA 3PG7A 5LONB 2HTHB 4YONA 4C0AA 4HAUB 3RCPA 3SYXA 5D3XA 1GG3A 1P3RA 2LYDA 2Z0PA 4Y94A 5JP4A 2LOXA 1I7AA 4A6FB 2ADZA 1UNQA 1PLSA 3FEHA 2YSZA 2HE7A 2YVCA 3TVVA 4TKNA 2P0FA 1V89A 1W1HA 1WGQA 2KCJA 4HAXB 1ZSQA 3ZDTA 1LB1A 3PP2A 3SUZA 1RRPB 3BINA 2YT1A 3KRXA 3HQCA 4CHJA 2ROVA 5HE0A 1W1DA 1DDVA 4KHAA 3V5WA 5EFXA 5HE1A 2L1CA 3N7CA 5J3QA 1ZM0A 3G9WA 4HHVA 2COCA 2D9ZA 4GZUA 4HB3B 5CLQB 3PVUA 5KQ1A 4F7UP 4DXAB 2RSGA 1XCGA 1WGUA 4PNKA 2D9VA 2DHKA 4A6KA 4GPTB 2Z0QA 3TCAA 2K00A 3KRWA 1WJ1A 1U5EA 1V5UA 4WVFB 4KHOA 2E2XA 3VIAA 4CYEA 1AQCA 2DTCA 4H8SA 1UNRA 2DHJA 2NMBA 4IFSA 3LJUX 1V61A 4XWXA 4ZRIA 1TXDA 2COFA 3ULBA 3DXEA 4L6EA 4BBKA 1XR0B 3TO1A 2H7EA 1Y5OA 1MK7B 5C6RA 1V88A 5HE3A 1WG7A 2YS3A 2Y8GA 5DHFB 2J0KA 2DLWA 3PVLA 3ULCA 1UEFA 1EVHA 2J59M 4WSFA 4K81A 1FGZA 1KZGA 2MKRA 3BJIA 4GMXB 5JHGA 1EF1A 5C5BA 2RNRB 1FGYA 3NSUA 1K5DB 4GMVA 2AEHA 2CODA 3PVWA 2GCLA 2BCJA 3F0WA 1BTNA 2DKPA 2I5CA 4EMOA 1DROA 5DHAB 4ZRKA 1H10A 2W2XD 3PZDA 5DH9B 1AWEA 2P8VA 4F7HA 1ZVRA 3U7DA 4A6FA 1SGHA 2ELBA 3AU4A 2MFQA 3AU5A 4HB0B 1X05A 2W2WA 3IVFA 2I5FA 2EMSA 5GOWB 2OQBA 1U2BA 1UPQA 5LOPB 1FHXA 3D8EA 1NTYA 1X86A 5D3YA 1ISNA 3PSCA 4HDQA 3GYPA 1J19A 2D2QA 2M38A 1Z87A 1FHWA 1V5PA 3ODOA 2QKMA 1P6SA 5C79A 5JLJB 4IAPA 1H4RA 2P0DA 1FOEA 4A5KA 1LW3A 2DA0A 2Y8FA 1V5MA 3KY9A 2IFSA 3OANA 1GC6A 2R09A 1WJMA 5D3VA 4MK0A 3ZVRA 1QC6A 2DN6A 2M14A 2DYQA 5KQ4A 1PFJA 4GN1A 1N3HA 1FB8A 1FAOA 3MDBC 2FJLA 1TJ6A 3DXDA 5L81A 5J3YA 1OY2A 2D4QA 4PQ0A 1UPRA 2X18A 3GYOA 2QKLA 2D9YA 1XODA 4KHBB 5CLLB 2I1JA 1I2HA 2DX5A 2CY5A 3D8FA
chains in the Genus database with same CATH superfamily
4YL8A 4P7IA 1OMWA 2P0HA 3A58A 1B55A 3QIJA 3UZTA 5FI0A 1MI1A 2D11A 4KVGB 1MIZB 1XKEA 2OTXA 5DIFB 2GS0A 2LOZA 3HSAA 2DFKA 2NZ8B 1PMSA 2UZSA 4A6HA 2YF0A 2D9XA 2KGXB 2YS1A 1Y19B 5D27A 4OT1A 1W1GA 1ZYIA 3P6AA 3T06A 2J0MA 5M4YB 2RVBB 2Z0OA 1ZC4B 3KZ1A 2EC1A 3ML4A 1NI2A 3A98B 4ZRJA 2EMTA 4MY6A 5IRSA 4EJNA 2Z59A 4HB4B 2LG1A 2GCJA 3DXCA 3MPXA 4TYZA 5I2MA 5KCVA 5JHHA 5J3TA 1M7RA 3P7ZA 2YT2A 1K5GB 4Z2NA 2R2YA 2K2UA 2V76A 1DDWA 3X23A 1NTVA 5C5BB 2Y7BA 4WJ7A 2CY4A 2RLOA 2YS5A 2W2XC 2UZRA 3HK0A 2YRYA 2KIEA 3KSYA 1X11A 2K8EA 2N23A 2L2IA 4Z2MB 4NSWA 2LKOA 1U5FA 3D8DA 4HAZB 2ROZB 2AL6A 2MDXA 4NY0A 4HAYB 2RUKB 1J0WA 5C16A 1MIXA 2G35A 4HAVB 2D9WA 4HSIA 1KZ7A 4DX8A 2DYNA 1X1FA 4IOYX 4KAXB 1WI1A 2XQNM 2UVMA 3NWDA 3TFMA 3CIKA 3SV1A 3NW8A 1MKEA 3WA0A 2MWNB 2COAA 4DBBA 1KI1B 4KHBA 3VOQA 2I1KA 2K49A 1XD4A 3AJ4A 4MT7A 3SO6A 3F5RA 5HE2A 2R0DA 1UNPA 2Z14A 5FI1A 4DX90 1ZC3B 5DI9B 3QWMA 1DYNA 3CXBB 2CRFA 2DKQA 1EAZA 1RJ2A 1U27A 4D6WA 3SNHA 4K2OA 1WVHA 1MPHA 4HB2B 3O96A 1P5TA 3ODWA 1U5DA 3U8ZA 2DX1A 1U5GA 1NU2A 1U29A 4D0NB 2ZPYA 1OQNA 3M1IB 1Q67A 2EJ8A 3PEGA 4HDOA 1MK9B 4HATB 2H7DA 5D3WA 1BWNA 2NBVA 1X1GA 1TQZA 2YT0A 2KUPA 1QQGA 1XX0A 3HW2B 2VKIA 3ODXA 3WYFB 3A8PA 4B6HA 1SHCA 1IRSA 4EKUA 4HAWB 1GC7A 2DHIA 2CAYA 2PZ1A 1BAKA 2JP2A 3FM8C 2Q13A 1BTKA 2IYBA 1M7EA 4CHMA 2LULA 3QBVB 3A8QA 2J0JA 4K17A 2VRWB 1DDMA 4F7GA 2D10A 1MAIA 1FHOA 2VSZA 4GXBA 2K2JA 1EGXA 2RGNB 4OSNA 2ELAA 3TW1A 2N0YA 2GJYA 3FSSA 1E5WA 1DBHA 4K2PA 2KUQA 3DCXA 3PG7A 4L1RA 5LONB 2HTHB 4YONA 4C0AA 4HAUB 3RCPA 3SYXA 1I2HA 5D3XA 1GG3A 1P3RA 2LYDA 2Z0PA 4Y94A 5JP4A 2LOXA 1I7AA 4GNKB 4A6FB 2ADZA 1UNQA 1PLSA 3FEHA 2YSZA 2HE7A 2YVCA 3TVVA 3B77A 4TKNA 2P0FA 1V89A 1W1HA 1WGQA 4QJ3B 2KCJA 4HAXB 1ZSQA 4GOUA 3ZDTA 1LB1A 3PP2A 3SUZA 1RRPB 3BINA 2YT1A 3KRXA 3HQCA 4CHJA 2ROVA 5HE0A 1W1DA 1DDVA 4KHAA 3V5WA 5EFXA 5HE1A 2L1CA 3N7CA 2Z13A 5J3QA 3OHMB 1ZM0A 3G9WA 4HHVA 2COCA 2D9ZA 4GZUA 4HB3B 5CLQB 3HIEA 4QJ4B 3PVUA 5KQ1A 4F7UP 4DXAB 2RSGA 2ZKMX 3FVCA 1XCGA 1WGUA 4PNKA 2D9VA 2DHKA 4A6KA 4GPTB 2Z0QA 3TCAA 2K00A 3KRWA 1WJ1A 2FJUB 1U5EA 1V5UA 4WVFB 4KHOA 2E2XA 3VIAA 4CYEA 1AQCA 2DTCA 4H8SA 1UNRA 2DHJA 2NMBA 4IFSA 3LJUX 1V61A 4XWXA 4ZRIA 1TXDA 2COFA 3ULBA 3DXEA 4L6EA 4BBKA 1XR0B 3TO1A 2H7EA 1Y5OA 1MK7B 4QJ5B 5C6RA 1V88A 5HE3A 1WG7A 2YS3A 2Y8GA 5DHFB 2J0KA 2DLWA 3PVLA 3ULCA 1UEFA 1T77A 1EVHA 2J59M 4WSFA 4K81A 1FGZA 1KZGA 2MKRA 3BJIA 4GMXB 5JHGA 1EF1A 5C5BA 2RNRB 1FGYA 3NSUA 2RRFA 1K5DB 4GMVA 2AEHA 2CODA 3PVWA 2GCLA 2BCJA 3F0WA 1BTNA 2DKPA 2I5CA 4EMOA 1DROA 5DHAB 4ZRKA 1H10A 2W2XD 3PZDA 5DH9B 1AWEA 2P8VA 4F7HA 1ZVRA 3U7DA 4A6FA 1SGHA 2ELBA 4CSQA 3AU4A 2MFQA 3AU5A 4HB0B 1X05A 2W2WA 3IVFA 2I5FA 2EMSA 5GOWB 2KR0A 2OQBA 5LG4B 1U2BA 1UPQA 5LOPB 1FHXA 2KIGA 3D8EA 1NTYA 2Z4DA 1X86A 5D3YA 1ISNA 3PSCA 4HDQA 3GYPA 1J19A 2D2QA 2M38A 1Z87A 1FHWA 1V5PA 3ODOA 2QKMA 1P6SA 5C79A 5JLJB 4QXAB 4IAPA 1H4RA 2P0DA 1FOEA 4A5KA 1LW3A 2DA0A 2Y8FA 1V5MA 3KY9A 2IFSA 3OANA 1GC6A 3NWAA 2R09A 1WJMA 5D3VA 4MK0A 3ZVRA 1QC6A 2DN6A 2M14A 3U12A 2DYQA 5KQ4A 1PFJA 4GN1A 1N3HA 1FB8A 1FAOA 3MDBC 2FJLA 1TJ6A 3DXDA 5L81A 5I2SA 5J3YA 3NWFA 1OY2A 2D4QA 4PQ0A 4DIXA 1UPRA 2X18A 3GYOA 2QKLA 2D9YA 1XODA 4KHBB 5CLLB 2I1JA 2GUMA 2DX5A 2CY5A 3D8FA
chains in the Genus database with same CATH topology
4YL8A 4P7IA 1OMWA 2P0HA 1B55A 3QIJA 3UZTA 5FI0A 2D11A 4KVGB 1MIZB 1XKEA 2OTXA 5DIFB 2GS0A 2LOZA 2DFKA 2NZ8B 1PMSA 2UZSA 4A6HA 2YF0A 2D9XA 2KGXB 2YS1A 1Y19B 5D27A 1W1GA 3P6AA 3T06A 2J0MA 2RVBB 2Z0OA 1ZC4B 3KZ1A 2EC1A 3ML4A 1NI2A 3A98B 4ZRJA 2EMTA 4MY6A 4EJNA 4HB4B 2LG1A 2GCJA 3DXCA 3MPXA 4TYZA 5KCVA 5JHHA 5J3TA 1M7RA 3P7ZA 1K5GB 4Z2NA 2K2UA 2V76A 1DDWA 3X23A 1NTVA 5C5BB 2Y7BA 4WJ7A 2CY4A 2RLOA 2YS5A 2W2XC 2UZRA 3HK0A 2YRYA 3KSYA 1X11A 2N23A 2L2IA 4Z2MB 4NSWA 2LKOA 1U5FA 3D8DA 4HAZB 2ROZB 2AL6A 2MDXA 4NY0A 4HAYB 2RUKB 1J0WA 5C16A 1MIXA 2G35A 4HAVB 2D9WA 1KZ7A 4DX8A 2DYNA 1X1FA 4IOYX 4KAXB 1WI1A 2XQNM 2UVMA 3TFMA 3CIKA 3SV1A 1MKEA 3WA0A 2MWNB 2COAA 4DBBA 1KI1B 3VOQA 2I1KA 1XD4A 3AJ4A 4MT7A 3SO6A 3F5RA 5HE2A 2R0DA 1UNPA 5FI1A 4DX90 1ZC3B 5DI9B 3QWMA 1DYNA 3CXBB 2CRFA 2DKQA 1EAZA 1RJ2A 1U27A 3SNHA 4K2OA 1WVHA 1MPHA 4HB2B 3O96A 1P5TA 3ODWA 1U5DA 3U8ZA 2DX1A 1U5GA 1NU2A 1U29A 4D0NB 2ZPYA 1OQNA 3M1IB 1Q67A 2EJ8A 3PEGA 4HDOA 1MK9B 4HATB 2H7DA 5D3WA 1BWNA 1X1GA 1TQZA 2YT0A 2KUPA 1QQGA 1XX0A 3HW2B 2VKIA 3ODXA 3WYFB 3A8PA 4B6HA 1SHCA 1IRSA 4EKUA 4HAWB 1GC7A 2DHIA 2CAYA 2PZ1A 1BAKA 2JP2A 3FM8C 2Q13A 1BTKA 2IYBA 1M7EA 4CHMA 2LULA 3QBVB 3A8QA 2J0JA 4K17A 2VRWB 1DDMA 4F7GA 2D10A 1MAIA 1FHOA 2VSZA 4GXBA 2K2JA 1EGXA 2RGNB 2ELAA 3TW1A 2N0YA 2GJYA 3FSSA 1E5WA 1DBHA 4K2PA 3PG7A 5LONB 2HTHB 4YONA 4C0AA 4HAUB 3RCPA 3SYXA 5D3XA 1GG3A 1P3RA 2LYDA 2Z0PA 4Y94A 5JP4A 2LOXA 1I7AA 4A6FB 2ADZA 1UNQA 1PLSA 3FEHA 2YSZA 2HE7A 2YVCA 3TVVA 4TKNA 2P0FA 1V89A 1W1HA 1WGQA 2KCJA 4HAXB 1ZSQA 3ZDTA 1LB1A 3PP2A 3SUZA 1RRPB 3BINA 2YT1A 3KRXA 3HQCA 4CHJA 2ROVA 5HE0A 1W1DA 1DDVA 4KHAA 3V5WA 5EFXA 5HE1A 2L1CA 3N7CA 5J3QA 1ZM0A 3G9WA 4HHVA 2COCA 2D9ZA 4GZUA 4HB3B 5CLQB 3PVUA 5KQ1A 4F7UP 4DXAB 2RSGA 1XCGA 1WGUA 4PNKA 2D9VA 2DHKA 4A6KA 4GPTB 2Z0QA 3TCAA 2K00A 3KRWA 1WJ1A 1U5EA 1V5UA 4WVFB 4KHOA 2E2XA 3VIAA 4CYEA 1AQCA 2DTCA 4H8SA 1UNRA 2DHJA 2NMBA 4IFSA 3LJUX 1V61A 4XWXA 4ZRIA 1TXDA 2COFA 3ULBA 3DXEA 4L6EA 4BBKA 1XR0B 3TO1A 2H7EA 1Y5OA 1MK7B 5C6RA 1V88A 5HE3A 1WG7A 2YS3A 2Y8GA 5DHFB 2J0KA 2DLWA 3PVLA 3ULCA 1UEFA 1EVHA 2J59M 4WSFA 4K81A 1FGZA 1KZGA 2MKRA 3BJIA 4GMXB 5JHGA 1EF1A 5C5BA 2RNRB 1FGYA 3NSUA 1K5DB 4GMVA 2AEHA 2CODA 3PVWA 2GCLA 2BCJA 3F0WA 1BTNA 2DKPA 2I5CA 4EMOA 1DROA 5DHAB 4ZRKA 1H10A 2W2XD 3PZDA 5DH9B 1AWEA 2P8VA 4F7HA 1ZVRA 3U7DA 4A6FA 1SGHA 2ELBA 3AU4A 2MFQA 3AU5A 4HB0B 1X05A 2W2WA 3IVFA 2I5FA 2EMSA 5GOWB 2OQBA 1U2BA 1UPQA 5LOPB 1FHXA 3D8EA 1NTYA 1X86A 5D3YA 1ISNA 3PSCA 4HDQA 3GYPA 1J19A 2D2QA 2M38A 1Z87A 1FHWA 1V5PA 3ODOA 2QKMA 1P6SA 5C79A 5JLJB 4IAPA 1H4RA 2P0DA 1FOEA 4A5KA 1LW3A 2DA0A 2Y8FA 1V5MA 3KY9A 2IFSA 3OANA 1GC6A 2R09A 1WJMA 5D3VA 4MK0A 3ZVRA 1QC6A 2DN6A 2M14A 2DYQA 5KQ4A 1PFJA 4GN1A 1N3HA 1FB8A 1FAOA 3MDBC 2FJLA 1TJ6A 3DXDA 5L81A 5J3YA 1OY2A 2D4QA 4PQ0A 1UPRA 2X18A 3GYOA 2QKLA 2D9YA 1XODA 4KHBB 5CLLB 2I1JA 1I2HA 2DX5A 2CY5A 3D8FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YL8 A;  4P7I A;  1OMW A;  2P0H A;  1B55 A;  3QIJ A;  3UZT A;  5FI0 A;  2D11 A;  4KVG B;  1MIZ B;  1XKE A;  2OTX A;  5DIF B;  2GS0 A;  2LOZ A;  2DFK A;  2NZ8 B;  1PMS A;  2UZS A;  4A6H A;  2YF0 A;  2D9X A;  2KGX B;  2YS1 A;  1Y19 B;  5D27 A;  1W1G A;  3P6A A;  3T06 A;  2J0M A;  2RVB B;  2Z0O A;  1ZC4 B;  3KZ1 A;  2EC1 A;  3ML4 A;  1NI2 A;  3A98 B;  4ZRJ A;  2EMT A;  4MY6 A;  4EJN A;  4HB4 B;  2LG1 A;  2GCJ A;  3DXC A;  3MPX A;  4TYZ A;  5KCV A;  5JHH A;  5J3T A;  1M7R A;  3P7Z A;  1K5G B;  4Z2N A;  2K2U A;  2V76 A;  1DDW A;  3X23 A;  1NTV A;  5C5B B;  2Y7B A;  4WJ7 A;  2CY4 A;  2RLO A;  2YS5 A;  2W2X C;  2UZR A;  3HK0 A;  2YRY A;  3KSY A;  1X11 A;  2N23 A;  2L2I A;  4Z2M B;  4NSW A;  2LKO A;  1U5F A;  3D8D A;  4HAZ B;  2ROZ B;  2AL6 A;  2MDX A;  4NY0 A;  4HAY B;  2RUK B;  1J0W A;  5C16 A;  1MIX A;  2G35 A;  4HAV B;  2D9W A;  1KZ7 A;  4DX8 A;  2DYN A;  1X1F A;  4IOY X;  4KAX B;  1WI1 A;  2XQN M;  2UVM A;  3TFM A;  3CIK A;  3SV1 A;  1MKE A;  3WA0 A;  2MWN B;  2COA A;  4DBB A;  1KI1 B;  3VOQ A;  2I1K A;  1XD4 A;  3AJ4 A;  4MT7 A;  3SO6 A;  3F5R A;  5HE2 A;  2R0D A;  1UNP A;  5FI1 A;  4DX9 0;  1ZC3 B;  5DI9 B;  3QWM A;  1DYN A;  3CXB B;  2CRF A;  2DKQ A;  1EAZ A;  1RJ2 A;  1U27 A;  3SNH A;  4K2O A;  1WVH A;  1MPH A;  4HB2 B;  3O96 A;  1P5T A;  3ODW A;  1U5D A;  3U8Z A;  2DX1 A;  1U5G A;  1NU2 A;  1U29 A;  4D0N B;  2ZPY A;  1OQN A;  3M1I B;  1Q67 A;  2EJ8 A;  3PEG A;  4HDO A;  1MK9 B;  4HAT B;  2H7D A;  5D3W A;  1BWN A;  1X1G A;  1TQZ A;  2YT0 A;  2KUP A;  1QQG A;  1XX0 A;  3HW2 B;  2VKI A;  3ODX A;  3WYF B;  3A8P A;  4B6H A;  1SHC A;  1IRS A;  4EKU A;  4HAW B;  1GC7 A;  2DHI A;  2CAY A;  2PZ1 A;  1BAK A;  2JP2 A;  3FM8 C;  2Q13 A;  1BTK A;  2IYB A;  1M7E A;  4CHM A;  2LUL A;  3QBV B;  3A8Q A;  2J0J A;  4K17 A;  2VRW B;  1DDM A;  4F7G A;  2D10 A;  1MAI A;  1FHO A;  2VSZ A;  4GXB A;  2K2J A;  1EGX A;  2RGN B;  2ELA A;  3TW1 A;  2N0Y A;  2GJY A;  3FSS A;  1E5W A;  1DBH A;  4K2P A;  3PG7 A;  5LON B;  2HTH B;  4YON A;  4C0A A;  4HAU B;  3RCP A;  3SYX A;  5D3X A;  1GG3 A;  1P3R A;  2LYD A;  2Z0P A;  4Y94 A;  5JP4 A;  2LOX A;  1I7A A;  4A6F B;  2ADZ A;  1UNQ A;  1PLS A;  3FEH A;  2YSZ A;  2HE7 A;  2YVC A;  3TVV A;  4TKN A;  2P0F A;  1V89 A;  1W1H A;  1WGQ A;  2KCJ A;  4HAX B;  1ZSQ A;  3ZDT A;  1LB1 A;  3PP2 A;  3SUZ A;  1RRP B;  3BIN A;  2YT1 A;  3KRX A;  3HQC A;  4CHJ A;  2ROV A;  5HE0 A;  1W1D A;  1DDV A;  4KHA A;  3V5W A;  5EFX A;  5HE1 A;  2L1C A;  3N7C A;  5J3Q A;  1ZM0 A;  3G9W A;  4HHV A;  2COC A;  2D9Z A;  4GZU A;  4HB3 B;  5CLQ B;  3PVU A;  5KQ1 A;  4F7U P;  4DXA B;  2RSG A;  1XCG A;  1WGU A;  4PNK A;  2D9V A;  2DHK A;  4A6K A;  4GPT B;  2Z0Q A;  3TCA A;  2K00 A;  3KRW A;  1WJ1 A;  1U5E A;  1V5U A;  4WVF B;  4KHO A;  2E2X A;  3VIA A;  4CYE A;  1AQC A;  2DTC A;  4H8S A;  1UNR A;  2DHJ A;  2NMB A;  4IFS A;  3LJU X;  1V61 A;  4XWX A;  4ZRI A;  1TXD A;  2COF A;  3ULB A;  3DXE A;  4L6E A;  4BBK A;  1XR0 B;  3TO1 A;  2H7E A;  1Y5O A;  1MK7 B;  5C6R A;  1V88 A;  5HE3 A;  1WG7 A;  2YS3 A;  2Y8G A;  5DHF B;  2J0K A;  2DLW A;  3PVL A;  3ULC A;  1UEF A;  1EVH A;  2J59 M;  4WSF A;  4K81 A;  1FGZ A;  1KZG A;  2MKR A;  3BJI A;  4GMX B;  5JHG A;  1EF1 A;  5C5B A;  2RNR B;  1FGY A;  3NSU A;  1K5D B;  4GMV A;  2AEH A;  2COD A;  3PVW A;  2GCL A;  2BCJ A;  3F0W A;  1BTN A;  2DKP A;  2I5C A;  4EMO A;  1DRO A;  5DHA B;  4ZRK A;  1H10 A;  2W2X D;  3PZD A;  5DH9 B;  1AWE A;  2P8V A;  4F7H A;  1ZVR A;  3U7D A;  4A6F A;  1SGH A;  2ELB A;  3AU4 A;  2MFQ A;  3AU5 A;  4HB0 B;  1X05 A;  2W2W A;  3IVF A;  2I5F A;  2EMS A;  5GOW B;  2OQB A;  1U2B A;  1UPQ A;  5LOP B;  1FHX A;  3D8E A;  1NTY A;  1X86 A;  5D3Y A;  1ISN A;  3PSC A;  4HDQ A;  3GYP A;  1J19 A;  2D2Q A;  2M38 A;  1Z87 A;  1FHW A;  1V5P A;  3ODO A;  2QKM A;  1P6S A;  5C79 A;  5JLJ B;  4IAP A;  1H4R A;  2P0D A;  1FOE A;  4A5K A;  1LW3 A;  2DA0 A;  2Y8F A;  1V5M A;  3KY9 A;  2IFS A;  3OAN A;  1GC6 A;  2R09 A;  1WJM A;  5D3V A;  4MK0 A;  3ZVR A;  1QC6 A;  2DN6 A;  2M14 A;  2DYQ A;  5KQ4 A;  1PFJ A;  4GN1 A;  1N3H A;  1FB8 A;  1FAO A;  3MDB C;  2FJL A;  1TJ6 A;  3DXD A;  5L81 A;  5J3Y A;  1OY2 A;  2D4Q A;  4PQ0 A;  1UPR A;  2X18 A;  3GYO A;  2QKL A;  2D9Y A;  1XOD A;  4KHB B;  5CLL B;  2I1J A;  1I2H A;  2DX5 A;  2CY5 A;  3D8F A; 
#chains in the Genus database with same CATH topology
 4YL8 A;  4P7I A;  1OMW A;  2P0H A;  3A58 A;  1B55 A;  3QIJ A;  3UZT A;  5FI0 A;  1MI1 A;  2D11 A;  4KVG B;  1MIZ B;  1XKE A;  2OTX A;  5DIF B;  2GS0 A;  2LOZ A;  3HSA A;  2DFK A;  2NZ8 B;  1PMS A;  2UZS A;  4A6H A;  2YF0 A;  2D9X A;  2KGX B;  2YS1 A;  1Y19 B;  5D27 A;  4OT1 A;  1W1G A;  1ZYI A;  3P6A A;  3T06 A;  2J0M A;  5M4Y B;  2RVB B;  2Z0O A;  1ZC4 B;  3KZ1 A;  2EC1 A;  3ML4 A;  1NI2 A;  3A98 B;  4ZRJ A;  2EMT A;  4MY6 A;  5IRS A;  4EJN A;  2Z59 A;  4HB4 B;  2LG1 A;  2GCJ A;  3DXC A;  3MPX A;  4TYZ A;  5I2M A;  5KCV A;  5JHH A;  5J3T A;  1M7R A;  3P7Z A;  2YT2 A;  1K5G B;  4Z2N A;  2R2Y A;  2K2U A;  2V76 A;  1DDW A;  3X23 A;  1NTV A;  5C5B B;  2Y7B A;  4WJ7 A;  2CY4 A;  2RLO A;  2YS5 A;  2W2X C;  2UZR A;  3HK0 A;  2YRY A;  2KIE A;  3KSY A;  1X11 A;  2K8E A;  2N23 A;  2L2I A;  4Z2M B;  4NSW A;  2LKO A;  1U5F A;  3D8D A;  4HAZ B;  2ROZ B;  2AL6 A;  2MDX A;  4NY0 A;  4HAY B;  2RUK B;  1J0W A;  5C16 A;  1MIX A;  2G35 A;  4HAV B;  2D9W A;  4HSI A;  1KZ7 A;  4DX8 A;  2DYN A;  1X1F A;  4IOY X;  4KAX B;  1WI1 A;  2XQN M;  2UVM A;  3NWD A;  3TFM A;  3CIK A;  3SV1 A;  3NW8 A;  1MKE A;  3WA0 A;  2MWN B;  2COA A;  4DBB A;  1KI1 B;  4KHB A;  3VOQ A;  2I1K A;  2K49 A;  1XD4 A;  3AJ4 A;  4MT7 A;  3SO6 A;  3F5R A;  5HE2 A;  2R0D A;  1UNP A;  2Z14 A;  5FI1 A;  4DX9 0;  1ZC3 B;  5DI9 B;  3QWM A;  1DYN A;  3CXB B;  2CRF A;  2DKQ A;  1EAZ A;  1RJ2 A;  1U27 A;  4D6W A;  3SNH A;  4K2O A;  1WVH A;  1MPH A;  4HB2 B;  3O96 A;  1P5T A;  3ODW A;  1U5D A;  3U8Z A;  2DX1 A;  1U5G A;  1NU2 A;  1U29 A;  4D0N B;  2ZPY A;  1OQN A;  3M1I B;  1Q67 A;  2EJ8 A;  3PEG A;  4HDO A;  1MK9 B;  4HAT B;  2H7D A;  5D3W A;  1BWN A;  2NBV A;  1X1G A;  1TQZ A;  2YT0 A;  2KUP A;  1QQG A;  1XX0 A;  3HW2 B;  2VKI A;  3ODX A;  3WYF B;  3A8P A;  4B6H A;  1SHC A;  1IRS A;  4EKU A;  4HAW B;  1GC7 A;  2DHI A;  2CAY A;  2PZ1 A;  1BAK A;  2JP2 A;  3FM8 C;  2Q13 A;  1BTK A;  2IYB A;  1M7E A;  4CHM A;  2LUL A;  3QBV B;  3A8Q A;  2J0J A;  4K17 A;  2VRW B;  1DDM A;  4F7G A;  2D10 A;  1MAI A;  1FHO A;  2VSZ A;  4GXB A;  2K2J A;  1EGX A;  2RGN B;  4OSN A;  2ELA A;  3TW1 A;  2N0Y A;  2GJY A;  3FSS A;  1E5W A;  1DBH A;  4K2P A;  2KUQ A;  3DCX A;  3PG7 A;  4L1R A;  5LON B;  2HTH B;  4YON A;  4C0A A;  4HAU B;  3RCP A;  3SYX A;  1I2H A;  5D3X A;  1GG3 A;  1P3R A;  2LYD A;  2Z0P A;  4Y94 A;  5JP4 A;  2LOX A;  1I7A A;  4GNK B;  4A6F B;  2ADZ A;  1UNQ A;  1PLS A;  3FEH A;  2YSZ A;  2HE7 A;  2YVC A;  3TVV A;  3B77 A;  4TKN A;  2P0F A;  1V89 A;  1W1H A;  1WGQ A;  4QJ3 B;  2KCJ A;  4HAX B;  1ZSQ A;  4GOU A;  3ZDT A;  1LB1 A;  3PP2 A;  3SUZ A;  1RRP B;  3BIN A;  2YT1 A;  3KRX A;  3HQC A;  4CHJ A;  2ROV A;  5HE0 A;  1W1D A;  1DDV A;  4KHA A;  3V5W A;  5EFX A;  5HE1 A;  2L1C A;  3N7C A;  2Z13 A;  5J3Q A;  3OHM B;  1ZM0 A;  3G9W A;  4HHV A;  2COC A;  2D9Z A;  4GZU A;  4HB3 B;  5CLQ B;  3HIE A;  4QJ4 B;  3PVU A;  5KQ1 A;  4F7U P;  4DXA B;  2RSG A;  2ZKM X;  3FVC A;  1XCG A;  1WGU A;  4PNK A;  2D9V A;  2DHK A;  4A6K A;  4GPT B;  2Z0Q A;  3TCA A;  2K00 A;  3KRW A;  1WJ1 A;  2FJU B;  1U5E A;  1V5U A;  4WVF B;  4KHO A;  2E2X A;  3VIA A;  4CYE A;  1AQC A;  2DTC A;  4H8S A;  1UNR A;  2DHJ A;  2NMB A;  4IFS A;  3LJU X;  1V61 A;  4XWX A;  4ZRI A;  1TXD A;  2COF A;  3ULB A;  3DXE A;  4L6E A;  4BBK A;  1XR0 B;  3TO1 A;  2H7E A;  1Y5O A;  1MK7 B;  4QJ5 B;  5C6R A;  1V88 A;  5HE3 A;  1WG7 A;  2YS3 A;  2Y8G A;  5DHF B;  2J0K A;  2DLW A;  3PVL A;  3ULC A;  1UEF A;  1T77 A;  1EVH A;  2J59 M;  4WSF A;  4K81 A;  1FGZ A;  1KZG A;  2MKR A;  3BJI A;  4GMX B;  5JHG A;  1EF1 A;  5C5B A;  2RNR B;  1FGY A;  3NSU A;  2RRF A;  1K5D B;  4GMV A;  2AEH A;  2COD A;  3PVW A;  2GCL A;  2BCJ A;  3F0W A;  1BTN A;  2DKP A;  2I5C A;  4EMO A;  1DRO A;  5DHA B;  4ZRK A;  1H10 A;  2W2X D;  3PZD A;  5DH9 B;  1AWE A;  2P8V A;  4F7H A;  1ZVR A;  3U7D A;  4A6F A;  1SGH A;  2ELB A;  4CSQ A;  3AU4 A;  2MFQ A;  3AU5 A;  4HB0 B;  1X05 A;  2W2W A;  3IVF A;  2I5F A;  2EMS A;  5GOW B;  2KR0 A;  2OQB A;  5LG4 B;  1U2B A;  1UPQ A;  5LOP B;  1FHX A;  2KIG A;  3D8E A;  1NTY A;  2Z4D A;  1X86 A;  5D3Y A;  1ISN A;  3PSC A;  4HDQ A;  3GYP A;  1J19 A;  2D2Q A;  2M38 A;  1Z87 A;  1FHW A;  1V5P A;  3ODO A;  2QKM A;  1P6S A;  5C79 A;  5JLJ B;  4QXA B;  4IAP A;  1H4R A;  2P0D A;  1FOE A;  4A5K A;  1LW3 A;  2DA0 A;  2Y8F A;  1V5M A;  3KY9 A;  2IFS A;  3OAN A;  1GC6 A;  3NWA A;  2R09 A;  1WJM A;  5D3V A;  4MK0 A;  3ZVR A;  1QC6 A;  2DN6 A;  2M14 A;  3U12 A;  2DYQ A;  5KQ4 A;  1PFJ A;  4GN1 A;  1N3H A;  1FB8 A;  1FAO A;  3MDB C;  2FJL A;  1TJ6 A;  3DXD A;  5L81 A;  5I2S A;  5J3Y A;  3NWF A;  1OY2 A;  2D4Q A;  4PQ0 A;  4DIX A;  1UPR A;  2X18 A;  3GYO A;  2QKL A;  2D9Y A;  1XOD A;  4KHB B;  5CLL B;  2I1J A;  2GUM A;  2DX5 A;  2CY5 A;  3D8F A; 
#chains in the Genus database with same CATH homology
 4YL8 A;  4P7I A;  1OMW A;  2P0H A;  1B55 A;  3QIJ A;  3UZT A;  5FI0 A;  2D11 A;  4KVG B;  1MIZ B;  1XKE A;  2OTX A;  5DIF B;  2GS0 A;  2LOZ A;  2DFK A;  2NZ8 B;  1PMS A;  2UZS A;  4A6H A;  2YF0 A;  2D9X A;  2KGX B;  2YS1 A;  1Y19 B;  5D27 A;  1W1G A;  3P6A A;  3T06 A;  2J0M A;  2RVB B;  2Z0O A;  1ZC4 B;  3KZ1 A;  2EC1 A;  3ML4 A;  1NI2 A;  3A98 B;  4ZRJ A;  2EMT A;  4MY6 A;  4EJN A;  4HB4 B;  2LG1 A;  2GCJ A;  3DXC A;  3MPX A;  4TYZ A;  5KCV A;  5JHH A;  5J3T A;  1M7R A;  3P7Z A;  1K5G B;  4Z2N A;  2K2U A;  2V76 A;  1DDW A;  3X23 A;  1NTV A;  5C5B B;  2Y7B A;  4WJ7 A;  2CY4 A;  2RLO A;  2YS5 A;  2W2X C;  2UZR A;  3HK0 A;  2YRY A;  3KSY A;  1X11 A;  2N23 A;  2L2I A;  4Z2M B;  4NSW A;  2LKO A;  1U5F A;  3D8D A;  4HAZ B;  2ROZ B;  2AL6 A;  2MDX A;  4NY0 A;  4HAY B;  2RUK B;  1J0W A;  5C16 A;  1MIX A;  2G35 A;  4HAV B;  2D9W A;  1KZ7 A;  4DX8 A;  2DYN A;  1X1F A;  4IOY X;  4KAX B;  1WI1 A;  2XQN M;  2UVM A;  3TFM A;  3CIK A;  3SV1 A;  1MKE A;  3WA0 A;  2MWN B;  2COA A;  4DBB A;  1KI1 B;  3VOQ A;  2I1K A;  1XD4 A;  3AJ4 A;  4MT7 A;  3SO6 A;  3F5R A;  5HE2 A;  2R0D A;  1UNP A;  5FI1 A;  4DX9 0;  1ZC3 B;  5DI9 B;  3QWM A;  1DYN A;  3CXB B;  2CRF A;  2DKQ A;  1EAZ A;  1RJ2 A;  1U27 A;  3SNH A;  4K2O A;  1WVH A;  1MPH A;  4HB2 B;  3O96 A;  1P5T A;  3ODW A;  1U5D A;  3U8Z A;  2DX1 A;  1U5G A;  1NU2 A;  1U29 A;  4D0N B;  2ZPY A;  1OQN A;  3M1I B;  1Q67 A;  2EJ8 A;  3PEG A;  4HDO A;  1MK9 B;  4HAT B;  2H7D A;  5D3W A;  1BWN A;  1X1G A;  1TQZ A;  2YT0 A;  2KUP A;  1QQG A;  1XX0 A;  3HW2 B;  2VKI A;  3ODX A;  3WYF B;  3A8P A;  4B6H A;  1SHC A;  1IRS A;  4EKU A;  4HAW B;  1GC7 A;  2DHI A;  2CAY A;  2PZ1 A;  1BAK A;  2JP2 A;  3FM8 C;  2Q13 A;  1BTK A;  2IYB A;  1M7E A;  4CHM A;  2LUL A;  3QBV B;  3A8Q A;  2J0J A;  4K17 A;  2VRW B;  1DDM A;  4F7G A;  2D10 A;  1MAI A;  1FHO A;  2VSZ A;  4GXB A;  2K2J A;  1EGX A;  2RGN B;  2ELA A;  3TW1 A;  2N0Y A;  2GJY A;  3FSS A;  1E5W A;  1DBH A;  4K2P A;  3PG7 A;  5LON B;  2HTH B;  4YON A;  4C0A A;  4HAU B;  3RCP A;  3SYX A;  5D3X A;  1GG3 A;  1P3R A;  2LYD A;  2Z0P A;  4Y94 A;  5JP4 A;  2LOX A;  1I7A A;  4A6F B;  2ADZ A;  1UNQ A;  1PLS A;  3FEH A;  2YSZ A;  2HE7 A;  2YVC A;  3TVV A;  4TKN A;  2P0F A;  1V89 A;  1W1H A;  1WGQ A;  2KCJ A;  4HAX B;  1ZSQ A;  3ZDT A;  1LB1 A;  3PP2 A;  3SUZ A;  1RRP B;  3BIN A;  2YT1 A;  3KRX A;  3HQC A;  4CHJ A;  2ROV A;  5HE0 A;  1W1D A;  1DDV A;  4KHA A;  3V5W A;  5EFX A;  5HE1 A;  2L1C A;  3N7C A;  5J3Q A;  1ZM0 A;  3G9W A;  4HHV A;  2COC A;  2D9Z A;  4GZU A;  4HB3 B;  5CLQ B;  3PVU A;  5KQ1 A;  4F7U P;  4DXA B;  2RSG A;  1XCG A;  1WGU A;  4PNK A;  2D9V A;  2DHK A;  4A6K A;  4GPT B;  2Z0Q A;  3TCA A;  2K00 A;  3KRW A;  1WJ1 A;  1U5E A;  1V5U A;  4WVF B;  4KHO A;  2E2X A;  3VIA A;  4CYE A;  1AQC A;  2DTC A;  4H8S A;  1UNR A;  2DHJ A;  2NMB A;  4IFS A;  3LJU X;  1V61 A;  4XWX A;  4ZRI A;  1TXD A;  2COF A;  3ULB A;  3DXE A;  4L6E A;  4BBK A;  1XR0 B;  3TO1 A;  2H7E A;  1Y5O A;  1MK7 B;  5C6R A;  1V88 A;  5HE3 A;  1WG7 A;  2YS3 A;  2Y8G A;  5DHF B;  2J0K A;  2DLW A;  3PVL A;  3ULC A;  1UEF A;  1EVH A;  2J59 M;  4WSF A;  4K81 A;  1FGZ A;  1KZG A;  2MKR A;  3BJI A;  4GMX B;  5JHG A;  1EF1 A;  5C5B A;  2RNR B;  1FGY A;  3NSU A;  1K5D B;  4GMV A;  2AEH A;  2COD A;  3PVW A;  2GCL A;  2BCJ A;  3F0W A;  1BTN A;  2DKP A;  2I5C A;  4EMO A;  1DRO A;  5DHA B;  4ZRK A;  1H10 A;  2W2X D;  3PZD A;  5DH9 B;  1AWE A;  2P8V A;  4F7H A;  1ZVR A;  3U7D A;  4A6F A;  1SGH A;  2ELB A;  3AU4 A;  2MFQ A;  3AU5 A;  4HB0 B;  1X05 A;  2W2W A;  3IVF A;  2I5F A;  2EMS A;  5GOW B;  2OQB A;  1U2B A;  1UPQ A;  5LOP B;  1FHX A;  3D8E A;  1NTY A;  1X86 A;  5D3Y A;  1ISN A;  3PSC A;  4HDQ A;  3GYP A;  1J19 A;  2D2Q A;  2M38 A;  1Z87 A;  1FHW A;  1V5P A;  3ODO A;  2QKM A;  1P6S A;  5C79 A;  5JLJ B;  4IAP A;  1H4R A;  2P0D A;  1FOE A;  4A5K A;  1LW3 A;  2DA0 A;  2Y8F A;  1V5M A;  3KY9 A;  2IFS A;  3OAN A;  1GC6 A;  2R09 A;  1WJM A;  5D3V A;  4MK0 A;  3ZVR A;  1QC6 A;  2DN6 A;  2M14 A;  2DYQ A;  5KQ4 A;  1PFJ A;  4GN1 A;  1N3H A;  1FB8 A;  1FAO A;  3MDB C;  2FJL A;  1TJ6 A;  3DXD A;  5L81 A;  5J3Y A;  1OY2 A;  2D4Q A;  4PQ0 A;  1UPR A;  2X18 A;  3GYO A;  2QKL A;  2D9Y A;  1XOD A;  4KHB B;  5CLL B;  2I1J A;  1I2H A;  2DX5 A;  2CY5 A;  3D8F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...