5CLLB

Truncated ran wild type in complex with gdp-bef and ranbd1
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
139
structure length
139
Chain Sequence
GPHFEPVVPLPDKIEVKTGEEDEEEFFCNRAKLFRFDVESKEWKERGIGNVKILRHKTSGKIRLLMRREQVLKICANHYISPDMKLTPNAGSDRSFVWHALDYADELPKPEQLAIRFKTPEEAALFKCKFEEAQSILKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Catalysis of GTP Hydrolysis by Small GTPases at Atomic Detail by Integration of X-ray Crystallography, Experimental, and Theoretical IR Spectroscopy.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords GTP-binding nuclear protein Ran
total genus 28
structure length 139
sequence length 139
chains with identical sequence D
ec nomenclature ec 6.3.2.-:
pdb deposition date 2015-07-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00638 Ran_BP1 RanBP1 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 5cllB00
2DHJA 3M1IB 4EKUA 3SV1A 1SGHA 2COFA 4GN1A 1AWEA 1MAIA 3ODWA 2YVCA 1RRPB 1UEFA 3ML4A 2CAYA 3DXDA 1XKEA 2D4QA 5KQ4A 4GPTB 1WGQA 2YT1A 3PVWA 5GOWB 4K17A 1FGZA 1BWNA 1V89A 2N0YA 4HB2B 1MK7B 2RVBB 1X11A 5D27A 3TW1A 2W2WA 2BCJA 4L6EA 2YT0A 2RLOA 3AJ4A 1BTKA 4IAPA 5D3VA 4DBBA 3KRWA 1X1FA 1KZGA 5C79A 2COAA 3T06A 1ZM0A 1U5FA 4ZRKA 4A6FA 1OQNA 1E5WA 1V5MA 1UNPA 5J3YA 2K2UA 5DIFB 1LW3A 1WJMA 2LOXA 3LJUX 2I1JA 4WSFA 3FSSA 3PSCA 2RGNB 5J3QA 2AL6A 1NI2A 2ELBA 5CLLB 2L2IA 4B6HA 2FJLA 1XX0A 1RJ2A 3WYFB 5LOPB 1MK9B 2GCJA 1W1GA 5JHGA 3VIAA 3F0WA 3F5RA 1V61A 4NY0A 1EGXA 2EMTA 2CODA 2EJ8A 2D9XA 2DYNA 3TO1A 2VSZA 1FHOA 3O96A 1EAZA 1NTYA 2NMBA 2W2XC 4TKNA 5JLJB 3KY9A 2UVMA 1J19A 1EVHA 2COCA 2N23A 1MIZB 1XODA 2YSZA 2LKOA 2DHKA 2HTHB 1UNQA 2LULA 3AU4A 2I1KA 1BTNA 4KAXB 1DDMA 3P6AA 4BBKA 1FHWA 2LOZA 2DFKA 3TFMA 2LG1A 1WJ1A 2D9ZA 4Y94A 4EJNA 3ULCA 2YS5A 1MPHA 1TXDA 2IYBA 4PQ0A 3P7ZA 1H4RA 4KHBB 2K00A 1FB8A 5EFXA 2E2XA 1WG7A 2Y7BA 1P5TA 1KZ7A 2YS3A 4KVGB 3KRXA 3TCAA 3X23A 1QC6A 1P3RA 3V5WA 1V5UA 2UZSA 4A5KA 1X1GA 2D9VA 1U29A 1Z87A 1ZVRA 4MT7A 2MWNB 1XCGA 1GG3A 3UZTA 2OTXA 2UZRA 1U5GA 2RUKB 2W2XD 4CHJA 2HE7A 4K2PA 3D8DA 5JHHA 2ADZA 4GXBA 1FAOA 4Z2MB 3ZDTA 2GJYA 2QKLA 3GYOA 5C5BA 2VRWB 4YONA 1ZC4B 3GYPA 2J0KA 2L1CA 2J0JA 2M38A 2KCJA 5D3WA 1OMWA 2QKMA 3G9WA 3CIKA 1WI1A 2DX5A 2D9WA 4CYEA 1TQZA 4WVFB 2ELAA 3HW2B 2R09A 3PVUA 2DYQA 2CRFA 3DXCA 4HAXB 4HAUB 2R0DA 2Y8FA 3HQCA 4HAVB 4DXAB 3AU5A 4TYZA 2YF0A 4K81A 2IFSA 5C6RA 4D0NB 4GMXB 1B55A 5D3XA 1U5DA 2Z0OA 3A98B 4PNKA 1J0WA 4HB4B 2I5FA 3SYXA 1Q67A 4K2OA 2ROVA 1FOEA 1M7EA 1TJ6A 3A8PA 2DTCA 3FEHA 2EC1A 2D2QA 5DHFB 5HE3A 3VOQA 3PG7A 4F7UP 2YRYA 1V88A 4HAZB 5D3YA 2OQBA 1ZSQA 3D8EA 3FM8C 5LONB 1DDWA 4Z2NA 1FGYA 1GC7A 3IVFA 4CHMA 5HE0A 3ODOA 4XWXA 3DXEA 3QIJA 4HDOA 1ISNA 2CY5A 2GS0A 2NZ8B 2K2JA 5HE1A 2LYDA 3HK0A 3N7CA 5JP4A 1U5EA 1I2HA 3KSYA 2MFQA 4HHVA 1DROA 1W1DA 4ZRJA 2EMSA 5C5BB 4A6HA 2DX1A 3OANA 3SNHA 3ULBA 5DH9B 1BAKA 4HB0B 5L81A 5CLQB 4F7HA 3SUZA 1NU2A 2MKRA 2Q13A 4HATB 3WA0A 4HDQA 3CXBB 1M7RA 2KUPA 4KHAA 3D8FA 1MIXA 1GC6A 2DA0A 1K5GB 5FI1A 2DN6A 1Y19B 1IRSA 5J3TA 2PZ1A 4GMVA 2I5CA 2P8VA 3BJIA 3BINA 1NTVA 2P0HA 4NSWA 4WJ7A 2CY4A 2GCLA 5KCVA 2J0MA 5FI0A 1K5DB 3TVVA 4H8SA 3ODXA 5HE2A 1UNRA 4P7IA 2M14A 1DBHA 3PZDA 1X05A 4A6FB 2XQNM 4HB3B 4MY6A 3QBVB 2D9YA 1V5PA 2X18A 1U2BA 2V76A 1XR0B 4IFSA 2H7EA 2RSGA 1H10A 2DKPA 3QWMA 3PEGA 1X86A 2DHIA 2RNRB 1W1HA 3RCPA 1WGUA 2G35A 3PP2A 1PFJA 4DX8A 4C0AA 3A8QA 4YL8A 4HAYB 1DDVA 2Z0QA 1UPRA 1PMSA 2DLWA 3MPXA 1SHCA 1WVHA 3U7DA 1PLSA 1UPQA 1LB1A 3NSUA 1U27A 2P0DA 5DHAB 5C16A 4DX90 1FHXA 1ZC3B 1OY2A 1N3HA 1MKEA 2AEHA 3U8ZA 2Y8GA 2DKQA 3MDBC 3PVLA 1EF1A 2VKIA 3KZ1A 1QQGA 2MDXA 2ZPYA 4KHOA 2ROZB 2Z0PA 1XD4A 2H7DA 4IOYX 2KGXB 4HAWB 4A6KA 2P0FA 4EMOA 2D10A 3ZVRA 3SO6A 1AQCA 2YS1A 1P6SA 5KQ1A 1KI1B 5DI9B 2J59M 4F7GA 4GZUA 1Y5OA 4MK0A 4ZRIA 1DYNA 2JP2A 2D11A 1I7AA
chains in the Genus database with same CATH superfamily
2DHJA 3M1IB 4EKUA 3SV1A 1SGHA 2COFA 4GN1A 2RRFA 1AWEA 1MAIA 3ODWA 2YVCA 1RRPB 1UEFA 4L1RA 3ML4A 2CAYA 3DXDA 1XKEA 2D4QA 2KIGA 5KQ4A 4GPTB 1WGQA 2YT1A 3PVWA 5GOWB 4K17A 1MI1A 1FGZA 1BWNA 1V89A 2N0YA 4HB2B 1MK7B 2RVBB 1X11A 5D27A 3TW1A 2W2WA 2BCJA 4L6EA 5LG4B 2YT0A 2RLOA 3NWDA 3AJ4A 1BTKA 4IAPA 5D3VA 4DBBA 3KRWA 1X1FA 1KZGA 5C79A 2COAA 3T06A 1ZM0A 1U5FA 4ZRKA 4A6FA 1OQNA 1E5WA 1V5MA 1UNPA 5J3YA 2K2UA 5DIFB 1LW3A 1WJMA 2LOXA 3LJUX 2I1JA 4WSFA 3FSSA 3PSCA 2RGNB 5J3QA 2AL6A 1NI2A 2ELBA 5CLLB 2L2IA 4B6HA 2FJLA 1XX0A 1RJ2A 3WYFB 3HIEA 5LOPB 1MK9B 2GCJA 1W1GA 5JHGA 3VIAA 3F0WA 4GNKB 3F5RA 1V61A 4NY0A 1EGXA 2EMTA 2CODA 2EJ8A 2D9XA 2DYNA 3TO1A 2VSZA 1FHOA 3O96A 4QJ5B 1EAZA 1NTYA 2NMBA 2W2XC 4TKNA 5JLJB 2NBVA 3KY9A 2UVMA 1J19A 1EVHA 2COCA 2N23A 1MIZB 1XODA 2YSZA 2LKOA 2DHKA 2HTHB 1UNQA 2LULA 5I2MA 3AU4A 2I1KA 1BTNA 4KAXB 1DDMA 3P6AA 4BBKA 1FHWA 2LOZA 2DFKA 3TFMA 2LG1A 1WJ1A 2D9ZA 4Y94A 4EJNA 3ULCA 2YS5A 1MPHA 1TXDA 2IYBA 4PQ0A 3P7ZA 1H4RA 4KHBB 4HSIA 5I2SA 2K00A 1FB8A 5EFXA 2E2XA 1WG7A 2Y7BA 1P5TA 1KZ7A 2YS3A 4KVGB 3KRXA 3TCAA 3X23A 4DIXA 1QC6A 1P3RA 3V5WA 1V5UA 2UZSA 4A5KA 1X1GA 2D9VA 1U29A 1Z87A 2KR0A 1ZVRA 4MT7A 2MWNB 1XCGA 1GG3A 3UZTA 2OTXA 2UZRA 1U5GA 2RUKB 2W2XD 3HSAA 4CHJA 2HE7A 4K2PA 3D8DA 5JHHA 2ADZA 3A58A 4GXBA 1FAOA 4Z2MB 3ZDTA 2GJYA 2QKLA 3GYOA 5C5BA 2VRWB 4YONA 1ZC4B 2Z59A 3GYPA 1ZYIA 2J0KA 2L1CA 2J0JA 4D6WA 2M38A 2KCJA 2Z13A 5D3WA 1OMWA 2QKMA 3G9WA 3CIKA 1WI1A 2DX5A 2D9WA 4CYEA 1TQZA 4WVFB 2ELAA 3HW2B 2R09A 4QXAB 3PVUA 4KHBA 2DYQA 2CRFA 3DXCA 5M4YB 4HAXB 4HAUB 2R0DA 2Y8FA 3HQCA 4HAVB 4DXAB 3AU5A 4TYZA 2YT2A 2YF0A 2FJUB 4K81A 2IFSA 5C6RA 4D0NB 4GMXB 1B55A 5D3XA 1U5DA 2KIEA 2Z0OA 2K8EA 3A98B 2KUQA 4PNKA 1J0WA 4HB4B 2I5FA 3SYXA 1Q67A 4K2OA 2ROVA 1FOEA 1M7EA 1TJ6A 3A8PA 2DTCA 3FEHA 2EC1A 2D2QA 4OT1A 5DHFB 5HE3A 3VOQA 3PG7A 4F7UP 2YRYA 1V88A 2ZKMX 4HAZB 5D3YA 2OQBA 1ZSQA 3D8EA 3FM8C 3U12A 5LONB 1DDWA 4Z2NA 1FGYA 1GC7A 3IVFA 4CHMA 5HE0A 3ODOA 4XWXA 3DXEA 3QIJA 4HDOA 1ISNA 2CY5A 2GS0A 2NZ8B 2K2JA 5HE1A 3OHMB 2LYDA 3HK0A 3N7CA 5JP4A 1U5EA 1I2HA 3KSYA 2MFQA 4HHVA 1DROA 1W1DA 4ZRJA 2EMSA 5C5BB 4A6HA 2DX1A 3OANA 3SNHA 3ULBA 5DH9B 1BAKA 4HB0B 5L81A 5CLQB 4F7HA 2Z14A 3SUZA 1NU2A 2MKRA 2Q13A 4HATB 3WA0A 4HDQA 3CXBB 1M7RA 2KUPA 4KHAA 3D8FA 1MIXA 1GC6A 2DA0A 1K5GB 5FI1A 3DCXA 2DN6A 1Y19B 1IRSA 5J3TA 2PZ1A 4GMVA 2GUMA 3NWFA 2I5CA 2P8VA 3BJIA 3BINA 1NTVA 2P0HA 4NSWA 4WJ7A 2K49A 5IRSA 1T77A 2CY4A 2GCLA 5KCVA 2J0MA 5FI0A 1K5DB 3TVVA 4H8SA 3ODXA 5HE2A 1UNRA 4P7IA 2M14A 1DBHA 3PZDA 1X05A 4A6FB 2XQNM 4HB3B 4MY6A 3QBVB 2D9YA 3NW8A 1V5PA 2X18A 1U2BA 2V76A 1XR0B 4IFSA 2H7EA 2RSGA 3FVCA 1H10A 2DKPA 3QWMA 3PEGA 1X86A 2DHIA 2RNRB 1W1HA 3RCPA 1WGUA 2G35A 4QJ3B 2Z4DA 3PP2A 1PFJA 4DX8A 4C0AA 3A8QA 4YL8A 4OSNA 4HAYB 1DDVA 2Z0QA 1UPRA 1PMSA 2DLWA 3MPXA 1SHCA 1WVHA 3U7DA 1PLSA 1UPQA 1LB1A 3NSUA 1U27A 2P0DA 5DHAB 5C16A 3NWAA 4DX90 1FHXA 4GOUA 1ZC3B 1OY2A 1N3HA 1MKEA 2AEHA 3U8ZA 2Y8GA 2DKQA 3MDBC 3PVLA 1EF1A 2VKIA 4CSQA 3KZ1A 1QQGA 2MDXA 2ZPYA 4KHOA 2ROZB 2Z0PA 1XD4A 2H7DA 4IOYX 2KGXB 4HAWB 4A6KA 2P0FA 4EMOA 2D10A 3ZVRA 3SO6A 1AQCA 2YS1A 1P6SA 5KQ1A 4QJ4B 1KI1B 3B77A 5DI9B 2J59M 4F7GA 4GZUA 1Y5OA 2R2YA 4MK0A 4ZRIA 1DYNA 2JP2A 2D11A 1I7AA
chains in the Genus database with same CATH topology
2DHJA 3M1IB 4EKUA 3SV1A 1SGHA 2COFA 4GN1A 1AWEA 1MAIA 3ODWA 2YVCA 1RRPB 1UEFA 3ML4A 2CAYA 3DXDA 1XKEA 2D4QA 5KQ4A 4GPTB 1WGQA 2YT1A 3PVWA 5GOWB 4K17A 1FGZA 1BWNA 1V89A 2N0YA 4HB2B 1MK7B 2RVBB 1X11A 5D27A 3TW1A 2W2WA 2BCJA 4L6EA 2YT0A 2RLOA 3AJ4A 1BTKA 4IAPA 5D3VA 4DBBA 3KRWA 1X1FA 1KZGA 5C79A 2COAA 3T06A 1ZM0A 1U5FA 4ZRKA 4A6FA 1OQNA 1E5WA 1V5MA 1UNPA 5J3YA 2K2UA 5DIFB 1LW3A 1WJMA 2LOXA 3LJUX 2I1JA 4WSFA 3FSSA 3PSCA 2RGNB 5J3QA 2AL6A 1NI2A 2ELBA 5CLLB 2L2IA 4B6HA 2FJLA 1XX0A 1RJ2A 3WYFB 5LOPB 1MK9B 2GCJA 1W1GA 5JHGA 3VIAA 3F0WA 3F5RA 1V61A 4NY0A 1EGXA 2EMTA 2CODA 2EJ8A 2D9XA 2DYNA 3TO1A 2VSZA 1FHOA 3O96A 1EAZA 1NTYA 2NMBA 2W2XC 4TKNA 5JLJB 3KY9A 2UVMA 1J19A 1EVHA 2COCA 2N23A 1MIZB 1XODA 2YSZA 2LKOA 2DHKA 2HTHB 1UNQA 2LULA 3AU4A 2I1KA 1BTNA 4KAXB 1DDMA 3P6AA 4BBKA 1FHWA 2LOZA 2DFKA 3TFMA 2LG1A 1WJ1A 2D9ZA 4Y94A 4EJNA 3ULCA 2YS5A 1MPHA 1TXDA 2IYBA 4PQ0A 3P7ZA 1H4RA 4KHBB 2K00A 1FB8A 5EFXA 2E2XA 1WG7A 2Y7BA 1P5TA 1KZ7A 2YS3A 4KVGB 3KRXA 3TCAA 3X23A 1QC6A 1P3RA 3V5WA 1V5UA 2UZSA 4A5KA 1X1GA 2D9VA 1U29A 1Z87A 1ZVRA 4MT7A 2MWNB 1XCGA 1GG3A 3UZTA 2OTXA 2UZRA 1U5GA 2RUKB 2W2XD 4CHJA 2HE7A 4K2PA 3D8DA 5JHHA 2ADZA 4GXBA 1FAOA 4Z2MB 3ZDTA 2GJYA 2QKLA 3GYOA 5C5BA 2VRWB 4YONA 1ZC4B 3GYPA 2J0KA 2L1CA 2J0JA 2M38A 2KCJA 5D3WA 1OMWA 2QKMA 3G9WA 3CIKA 1WI1A 2DX5A 2D9WA 4CYEA 1TQZA 4WVFB 2ELAA 3HW2B 2R09A 3PVUA 2DYQA 2CRFA 3DXCA 4HAXB 4HAUB 2R0DA 2Y8FA 3HQCA 4HAVB 4DXAB 3AU5A 4TYZA 2YF0A 4K81A 2IFSA 5C6RA 4D0NB 4GMXB 1B55A 5D3XA 1U5DA 2Z0OA 3A98B 4PNKA 1J0WA 4HB4B 2I5FA 3SYXA 1Q67A 4K2OA 2ROVA 1FOEA 1M7EA 1TJ6A 3A8PA 2DTCA 3FEHA 2EC1A 2D2QA 5DHFB 5HE3A 3VOQA 3PG7A 4F7UP 2YRYA 1V88A 4HAZB 5D3YA 2OQBA 1ZSQA 3D8EA 3FM8C 5LONB 1DDWA 4Z2NA 1FGYA 1GC7A 3IVFA 4CHMA 5HE0A 3ODOA 4XWXA 3DXEA 3QIJA 4HDOA 1ISNA 2CY5A 2GS0A 2NZ8B 2K2JA 5HE1A 2LYDA 3HK0A 3N7CA 5JP4A 1U5EA 1I2HA 3KSYA 2MFQA 4HHVA 1DROA 1W1DA 4ZRJA 2EMSA 5C5BB 4A6HA 2DX1A 3OANA 3SNHA 3ULBA 5DH9B 1BAKA 4HB0B 5L81A 5CLQB 4F7HA 3SUZA 1NU2A 2MKRA 2Q13A 4HATB 3WA0A 4HDQA 3CXBB 1M7RA 2KUPA 4KHAA 3D8FA 1MIXA 1GC6A 2DA0A 1K5GB 5FI1A 2DN6A 1Y19B 1IRSA 5J3TA 2PZ1A 4GMVA 2I5CA 2P8VA 3BJIA 3BINA 1NTVA 2P0HA 4NSWA 4WJ7A 2CY4A 2GCLA 5KCVA 2J0MA 5FI0A 1K5DB 3TVVA 4H8SA 3ODXA 5HE2A 1UNRA 4P7IA 2M14A 1DBHA 3PZDA 1X05A 4A6FB 2XQNM 4HB3B 4MY6A 3QBVB 2D9YA 1V5PA 2X18A 1U2BA 2V76A 1XR0B 4IFSA 2H7EA 2RSGA 1H10A 2DKPA 3QWMA 3PEGA 1X86A 2DHIA 2RNRB 1W1HA 3RCPA 1WGUA 2G35A 3PP2A 1PFJA 4DX8A 4C0AA 3A8QA 4YL8A 4HAYB 1DDVA 2Z0QA 1UPRA 1PMSA 2DLWA 3MPXA 1SHCA 1WVHA 3U7DA 1PLSA 1UPQA 1LB1A 3NSUA 1U27A 2P0DA 5DHAB 5C16A 4DX90 1FHXA 1ZC3B 1OY2A 1N3HA 1MKEA 2AEHA 3U8ZA 2Y8GA 2DKQA 3MDBC 3PVLA 1EF1A 2VKIA 3KZ1A 1QQGA 2MDXA 2ZPYA 4KHOA 2ROZB 2Z0PA 1XD4A 2H7DA 4IOYX 2KGXB 4HAWB 4A6KA 2P0FA 4EMOA 2D10A 3ZVRA 3SO6A 1AQCA 2YS1A 1P6SA 5KQ1A 1KI1B 5DI9B 2J59M 4F7GA 4GZUA 1Y5OA 4MK0A 4ZRIA 1DYNA 2JP2A 2D11A 1I7AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DHJ A;  3M1I B;  4EKU A;  3SV1 A;  1SGH A;  2COF A;  4GN1 A;  1AWE A;  1MAI A;  3ODW A;  2YVC A;  1RRP B;  1UEF A;  3ML4 A;  2CAY A;  3DXD A;  1XKE A;  2D4Q A;  5KQ4 A;  4GPT B;  1WGQ A;  2YT1 A;  3PVW A;  5GOW B;  4K17 A;  1FGZ A;  1BWN A;  1V89 A;  2N0Y A;  4HB2 B;  1MK7 B;  2RVB B;  1X11 A;  5D27 A;  3TW1 A;  2W2W A;  2BCJ A;  4L6E A;  2YT0 A;  2RLO A;  3AJ4 A;  1BTK A;  4IAP A;  5D3V A;  4DBB A;  3KRW A;  1X1F A;  1KZG A;  5C79 A;  2COA A;  3T06 A;  1ZM0 A;  1U5F A;  4ZRK A;  4A6F A;  1OQN A;  1E5W A;  1V5M A;  1UNP A;  5J3Y A;  2K2U A;  5DIF B;  1LW3 A;  1WJM A;  2LOX A;  3LJU X;  2I1J A;  4WSF A;  3FSS A;  3PSC A;  2RGN B;  5J3Q A;  2AL6 A;  1NI2 A;  2ELB A;  5CLL B;  2L2I A;  4B6H A;  2FJL A;  1XX0 A;  1RJ2 A;  3WYF B;  5LOP B;  1MK9 B;  2GCJ A;  1W1G A;  5JHG A;  3VIA A;  3F0W A;  3F5R A;  1V61 A;  4NY0 A;  1EGX A;  2EMT A;  2COD A;  2EJ8 A;  2D9X A;  2DYN A;  3TO1 A;  2VSZ A;  1FHO A;  3O96 A;  1EAZ A;  1NTY A;  2NMB A;  2W2X C;  4TKN A;  5JLJ B;  3KY9 A;  2UVM A;  1J19 A;  1EVH A;  2COC A;  2N23 A;  1MIZ B;  1XOD A;  2YSZ A;  2LKO A;  2DHK A;  2HTH B;  1UNQ A;  2LUL A;  3AU4 A;  2I1K A;  1BTN A;  4KAX B;  1DDM A;  3P6A A;  4BBK A;  1FHW A;  2LOZ A;  2DFK A;  3TFM A;  2LG1 A;  1WJ1 A;  2D9Z A;  4Y94 A;  4EJN A;  3ULC A;  2YS5 A;  1MPH A;  1TXD A;  2IYB A;  4PQ0 A;  3P7Z A;  1H4R A;  4KHB B;  2K00 A;  1FB8 A;  5EFX A;  2E2X A;  1WG7 A;  2Y7B A;  1P5T A;  1KZ7 A;  2YS3 A;  4KVG B;  3KRX A;  3TCA A;  3X23 A;  1QC6 A;  1P3R A;  3V5W A;  1V5U A;  2UZS A;  4A5K A;  1X1G A;  2D9V A;  1U29 A;  1Z87 A;  1ZVR A;  4MT7 A;  2MWN B;  1XCG A;  1GG3 A;  3UZT A;  2OTX A;  2UZR A;  1U5G A;  2RUK B;  2W2X D;  4CHJ A;  2HE7 A;  4K2P A;  3D8D A;  5JHH A;  2ADZ A;  4GXB A;  1FAO A;  4Z2M B;  3ZDT A;  2GJY A;  2QKL A;  3GYO A;  5C5B A;  2VRW B;  4YON A;  1ZC4 B;  3GYP A;  2J0K A;  2L1C A;  2J0J A;  2M38 A;  2KCJ A;  5D3W A;  1OMW A;  2QKM A;  3G9W A;  3CIK A;  1WI1 A;  2DX5 A;  2D9W A;  4CYE A;  1TQZ A;  4WVF B;  2ELA A;  3HW2 B;  2R09 A;  3PVU A;  2DYQ A;  2CRF A;  3DXC A;  4HAX B;  4HAU B;  2R0D A;  2Y8F A;  3HQC A;  4HAV B;  4DXA B;  3AU5 A;  4TYZ A;  2YF0 A;  4K81 A;  2IFS A;  5C6R A;  4D0N B;  4GMX B;  1B55 A;  5D3X A;  1U5D A;  2Z0O A;  3A98 B;  4PNK A;  1J0W A;  4HB4 B;  2I5F A;  3SYX A;  1Q67 A;  4K2O A;  2ROV A;  1FOE A;  1M7E A;  1TJ6 A;  3A8P A;  2DTC A;  3FEH A;  2EC1 A;  2D2Q A;  5DHF B;  5HE3 A;  3VOQ A;  3PG7 A;  4F7U P;  2YRY A;  1V88 A;  4HAZ B;  5D3Y A;  2OQB A;  1ZSQ A;  3D8E A;  3FM8 C;  5LON B;  1DDW A;  4Z2N A;  1FGY A;  1GC7 A;  3IVF A;  4CHM A;  5HE0 A;  3ODO A;  4XWX A;  3DXE A;  3QIJ A;  4HDO A;  1ISN A;  2CY5 A;  2GS0 A;  2NZ8 B;  2K2J A;  5HE1 A;  2LYD A;  3HK0 A;  3N7C A;  5JP4 A;  1U5E A;  1I2H A;  3KSY A;  2MFQ A;  4HHV A;  1DRO A;  1W1D A;  4ZRJ A;  2EMS A;  5C5B B;  4A6H A;  2DX1 A;  3OAN A;  3SNH A;  3ULB A;  5DH9 B;  1BAK A;  4HB0 B;  5L81 A;  5CLQ B;  4F7H A;  3SUZ A;  1NU2 A;  2MKR A;  2Q13 A;  4HAT B;  3WA0 A;  4HDQ A;  3CXB B;  1M7R A;  2KUP A;  4KHA A;  3D8F A;  1MIX A;  1GC6 A;  2DA0 A;  1K5G B;  5FI1 A;  2DN6 A;  1Y19 B;  1IRS A;  5J3T A;  2PZ1 A;  4GMV A;  2I5C A;  2P8V A;  3BJI A;  3BIN A;  1NTV A;  2P0H A;  4NSW A;  4WJ7 A;  2CY4 A;  2GCL A;  5KCV A;  2J0M A;  5FI0 A;  1K5D B;  3TVV A;  4H8S A;  3ODX A;  5HE2 A;  1UNR A;  4P7I A;  2M14 A;  1DBH A;  3PZD A;  1X05 A;  4A6F B;  2XQN M;  4HB3 B;  4MY6 A;  3QBV B;  2D9Y A;  1V5P A;  2X18 A;  1U2B A;  2V76 A;  1XR0 B;  4IFS A;  2H7E A;  2RSG A;  1H10 A;  2DKP A;  3QWM A;  3PEG A;  1X86 A;  2DHI A;  2RNR B;  1W1H A;  3RCP A;  1WGU A;  2G35 A;  3PP2 A;  1PFJ A;  4DX8 A;  4C0A A;  3A8Q A;  4YL8 A;  4HAY B;  1DDV A;  2Z0Q A;  1UPR A;  1PMS A;  2DLW A;  3MPX A;  1SHC A;  1WVH A;  3U7D A;  1PLS A;  1UPQ A;  1LB1 A;  3NSU A;  1U27 A;  2P0D A;  5DHA B;  5C16 A;  4DX9 0;  1FHX A;  1ZC3 B;  1OY2 A;  1N3H A;  1MKE A;  2AEH A;  3U8Z A;  2Y8G A;  2DKQ A;  3MDB C;  3PVL A;  1EF1 A;  2VKI A;  3KZ1 A;  1QQG A;  2MDX A;  2ZPY A;  4KHO A;  2ROZ B;  2Z0P A;  1XD4 A;  2H7D A;  4IOY X;  2KGX B;  4HAW B;  4A6K A;  2P0F A;  4EMO A;  2D10 A;  3ZVR A;  3SO6 A;  1AQC A;  2YS1 A;  1P6S A;  5KQ1 A;  1KI1 B;  5DI9 B;  2J59 M;  4F7G A;  4GZU A;  1Y5O A;  4MK0 A;  4ZRI A;  1DYN A;  2JP2 A;  2D11 A;  1I7A A; 
#chains in the Genus database with same CATH topology
 2DHJ A;  3M1I B;  4EKU A;  3SV1 A;  1SGH A;  2COF A;  4GN1 A;  2RRF A;  1AWE A;  1MAI A;  3ODW A;  2YVC A;  1RRP B;  1UEF A;  4L1R A;  3ML4 A;  2CAY A;  3DXD A;  1XKE A;  2D4Q A;  2KIG A;  5KQ4 A;  4GPT B;  1WGQ A;  2YT1 A;  3PVW A;  5GOW B;  4K17 A;  1MI1 A;  1FGZ A;  1BWN A;  1V89 A;  2N0Y A;  4HB2 B;  1MK7 B;  2RVB B;  1X11 A;  5D27 A;  3TW1 A;  2W2W A;  2BCJ A;  4L6E A;  5LG4 B;  2YT0 A;  2RLO A;  3NWD A;  3AJ4 A;  1BTK A;  4IAP A;  5D3V A;  4DBB A;  3KRW A;  1X1F A;  1KZG A;  5C79 A;  2COA A;  3T06 A;  1ZM0 A;  1U5F A;  4ZRK A;  4A6F A;  1OQN A;  1E5W A;  1V5M A;  1UNP A;  5J3Y A;  2K2U A;  5DIF B;  1LW3 A;  1WJM A;  2LOX A;  3LJU X;  2I1J A;  4WSF A;  3FSS A;  3PSC A;  2RGN B;  5J3Q A;  2AL6 A;  1NI2 A;  2ELB A;  5CLL B;  2L2I A;  4B6H A;  2FJL A;  1XX0 A;  1RJ2 A;  3WYF B;  3HIE A;  5LOP B;  1MK9 B;  2GCJ A;  1W1G A;  5JHG A;  3VIA A;  3F0W A;  4GNK B;  3F5R A;  1V61 A;  4NY0 A;  1EGX A;  2EMT A;  2COD A;  2EJ8 A;  2D9X A;  2DYN A;  3TO1 A;  2VSZ A;  1FHO A;  3O96 A;  4QJ5 B;  1EAZ A;  1NTY A;  2NMB A;  2W2X C;  4TKN A;  5JLJ B;  2NBV A;  3KY9 A;  2UVM A;  1J19 A;  1EVH A;  2COC A;  2N23 A;  1MIZ B;  1XOD A;  2YSZ A;  2LKO A;  2DHK A;  2HTH B;  1UNQ A;  2LUL A;  5I2M A;  3AU4 A;  2I1K A;  1BTN A;  4KAX B;  1DDM A;  3P6A A;  4BBK A;  1FHW A;  2LOZ A;  2DFK A;  3TFM A;  2LG1 A;  1WJ1 A;  2D9Z A;  4Y94 A;  4EJN A;  3ULC A;  2YS5 A;  1MPH A;  1TXD A;  2IYB A;  4PQ0 A;  3P7Z A;  1H4R A;  4KHB B;  4HSI A;  5I2S A;  2K00 A;  1FB8 A;  5EFX A;  2E2X A;  1WG7 A;  2Y7B A;  1P5T A;  1KZ7 A;  2YS3 A;  4KVG B;  3KRX A;  3TCA A;  3X23 A;  4DIX A;  1QC6 A;  1P3R A;  3V5W A;  1V5U A;  2UZS A;  4A5K A;  1X1G A;  2D9V A;  1U29 A;  1Z87 A;  2KR0 A;  1ZVR A;  4MT7 A;  2MWN B;  1XCG A;  1GG3 A;  3UZT A;  2OTX A;  2UZR A;  1U5G A;  2RUK B;  2W2X D;  3HSA A;  4CHJ A;  2HE7 A;  4K2P A;  3D8D A;  5JHH A;  2ADZ A;  3A58 A;  4GXB A;  1FAO A;  4Z2M B;  3ZDT A;  2GJY A;  2QKL A;  3GYO A;  5C5B A;  2VRW B;  4YON A;  1ZC4 B;  2Z59 A;  3GYP A;  1ZYI A;  2J0K A;  2L1C A;  2J0J A;  4D6W A;  2M38 A;  2KCJ A;  2Z13 A;  5D3W A;  1OMW A;  2QKM A;  3G9W A;  3CIK A;  1WI1 A;  2DX5 A;  2D9W A;  4CYE A;  1TQZ A;  4WVF B;  2ELA A;  3HW2 B;  2R09 A;  4QXA B;  3PVU A;  4KHB A;  2DYQ A;  2CRF A;  3DXC A;  5M4Y B;  4HAX B;  4HAU B;  2R0D A;  2Y8F A;  3HQC A;  4HAV B;  4DXA B;  3AU5 A;  4TYZ A;  2YT2 A;  2YF0 A;  2FJU B;  4K81 A;  2IFS A;  5C6R A;  4D0N B;  4GMX B;  1B55 A;  5D3X A;  1U5D A;  2KIE A;  2Z0O A;  2K8E A;  3A98 B;  2KUQ A;  4PNK A;  1J0W A;  4HB4 B;  2I5F A;  3SYX A;  1Q67 A;  4K2O A;  2ROV A;  1FOE A;  1M7E A;  1TJ6 A;  3A8P A;  2DTC A;  3FEH A;  2EC1 A;  2D2Q A;  4OT1 A;  5DHF B;  5HE3 A;  3VOQ A;  3PG7 A;  4F7U P;  2YRY A;  1V88 A;  2ZKM X;  4HAZ B;  5D3Y A;  2OQB A;  1ZSQ A;  3D8E A;  3FM8 C;  3U12 A;  5LON B;  1DDW A;  4Z2N A;  1FGY A;  1GC7 A;  3IVF A;  4CHM A;  5HE0 A;  3ODO A;  4XWX A;  3DXE A;  3QIJ A;  4HDO A;  1ISN A;  2CY5 A;  2GS0 A;  2NZ8 B;  2K2J A;  5HE1 A;  3OHM B;  2LYD A;  3HK0 A;  3N7C A;  5JP4 A;  1U5E A;  1I2H A;  3KSY A;  2MFQ A;  4HHV A;  1DRO A;  1W1D A;  4ZRJ A;  2EMS A;  5C5B B;  4A6H A;  2DX1 A;  3OAN A;  3SNH A;  3ULB A;  5DH9 B;  1BAK A;  4HB0 B;  5L81 A;  5CLQ B;  4F7H A;  2Z14 A;  3SUZ A;  1NU2 A;  2MKR A;  2Q13 A;  4HAT B;  3WA0 A;  4HDQ A;  3CXB B;  1M7R A;  2KUP A;  4KHA A;  3D8F A;  1MIX A;  1GC6 A;  2DA0 A;  1K5G B;  5FI1 A;  3DCX A;  2DN6 A;  1Y19 B;  1IRS A;  5J3T A;  2PZ1 A;  4GMV A;  2GUM A;  3NWF A;  2I5C A;  2P8V A;  3BJI A;  3BIN A;  1NTV A;  2P0H A;  4NSW A;  4WJ7 A;  2K49 A;  5IRS A;  1T77 A;  2CY4 A;  2GCL A;  5KCV A;  2J0M A;  5FI0 A;  1K5D B;  3TVV A;  4H8S A;  3ODX A;  5HE2 A;  1UNR A;  4P7I A;  2M14 A;  1DBH A;  3PZD A;  1X05 A;  4A6F B;  2XQN M;  4HB3 B;  4MY6 A;  3QBV B;  2D9Y A;  3NW8 A;  1V5P A;  2X18 A;  1U2B A;  2V76 A;  1XR0 B;  4IFS A;  2H7E A;  2RSG A;  3FVC A;  1H10 A;  2DKP A;  3QWM A;  3PEG A;  1X86 A;  2DHI A;  2RNR B;  1W1H A;  3RCP A;  1WGU A;  2G35 A;  4QJ3 B;  2Z4D A;  3PP2 A;  1PFJ A;  4DX8 A;  4C0A A;  3A8Q A;  4YL8 A;  4OSN A;  4HAY B;  1DDV A;  2Z0Q A;  1UPR A;  1PMS A;  2DLW A;  3MPX A;  1SHC A;  1WVH A;  3U7D A;  1PLS A;  1UPQ A;  1LB1 A;  3NSU A;  1U27 A;  2P0D A;  5DHA B;  5C16 A;  3NWA A;  4DX9 0;  1FHX A;  4GOU A;  1ZC3 B;  1OY2 A;  1N3H A;  1MKE A;  2AEH A;  3U8Z A;  2Y8G A;  2DKQ A;  3MDB C;  3PVL A;  1EF1 A;  2VKI A;  4CSQ A;  3KZ1 A;  1QQG A;  2MDX A;  2ZPY A;  4KHO A;  2ROZ B;  2Z0P A;  1XD4 A;  2H7D A;  4IOY X;  2KGX B;  4HAW B;  4A6K A;  2P0F A;  4EMO A;  2D10 A;  3ZVR A;  3SO6 A;  1AQC A;  2YS1 A;  1P6S A;  5KQ1 A;  4QJ4 B;  1KI1 B;  3B77 A;  5DI9 B;  2J59 M;  4F7G A;  4GZU A;  1Y5O A;  2R2Y A;  4MK0 A;  4ZRI A;  1DYN A;  2JP2 A;  2D11 A;  1I7A A; 
#chains in the Genus database with same CATH homology
 2DHJ A;  3M1I B;  4EKU A;  3SV1 A;  1SGH A;  2COF A;  4GN1 A;  1AWE A;  1MAI A;  3ODW A;  2YVC A;  1RRP B;  1UEF A;  3ML4 A;  2CAY A;  3DXD A;  1XKE A;  2D4Q A;  5KQ4 A;  4GPT B;  1WGQ A;  2YT1 A;  3PVW A;  5GOW B;  4K17 A;  1FGZ A;  1BWN A;  1V89 A;  2N0Y A;  4HB2 B;  1MK7 B;  2RVB B;  1X11 A;  5D27 A;  3TW1 A;  2W2W A;  2BCJ A;  4L6E A;  2YT0 A;  2RLO A;  3AJ4 A;  1BTK A;  4IAP A;  5D3V A;  4DBB A;  3KRW A;  1X1F A;  1KZG A;  5C79 A;  2COA A;  3T06 A;  1ZM0 A;  1U5F A;  4ZRK A;  4A6F A;  1OQN A;  1E5W A;  1V5M A;  1UNP A;  5J3Y A;  2K2U A;  5DIF B;  1LW3 A;  1WJM A;  2LOX A;  3LJU X;  2I1J A;  4WSF A;  3FSS A;  3PSC A;  2RGN B;  5J3Q A;  2AL6 A;  1NI2 A;  2ELB A;  5CLL B;  2L2I A;  4B6H A;  2FJL A;  1XX0 A;  1RJ2 A;  3WYF B;  5LOP B;  1MK9 B;  2GCJ A;  1W1G A;  5JHG A;  3VIA A;  3F0W A;  3F5R A;  1V61 A;  4NY0 A;  1EGX A;  2EMT A;  2COD A;  2EJ8 A;  2D9X A;  2DYN A;  3TO1 A;  2VSZ A;  1FHO A;  3O96 A;  1EAZ A;  1NTY A;  2NMB A;  2W2X C;  4TKN A;  5JLJ B;  3KY9 A;  2UVM A;  1J19 A;  1EVH A;  2COC A;  2N23 A;  1MIZ B;  1XOD A;  2YSZ A;  2LKO A;  2DHK A;  2HTH B;  1UNQ A;  2LUL A;  3AU4 A;  2I1K A;  1BTN A;  4KAX B;  1DDM A;  3P6A A;  4BBK A;  1FHW A;  2LOZ A;  2DFK A;  3TFM A;  2LG1 A;  1WJ1 A;  2D9Z A;  4Y94 A;  4EJN A;  3ULC A;  2YS5 A;  1MPH A;  1TXD A;  2IYB A;  4PQ0 A;  3P7Z A;  1H4R A;  4KHB B;  2K00 A;  1FB8 A;  5EFX A;  2E2X A;  1WG7 A;  2Y7B A;  1P5T A;  1KZ7 A;  2YS3 A;  4KVG B;  3KRX A;  3TCA A;  3X23 A;  1QC6 A;  1P3R A;  3V5W A;  1V5U A;  2UZS A;  4A5K A;  1X1G A;  2D9V A;  1U29 A;  1Z87 A;  1ZVR A;  4MT7 A;  2MWN B;  1XCG A;  1GG3 A;  3UZT A;  2OTX A;  2UZR A;  1U5G A;  2RUK B;  2W2X D;  4CHJ A;  2HE7 A;  4K2P A;  3D8D A;  5JHH A;  2ADZ A;  4GXB A;  1FAO A;  4Z2M B;  3ZDT A;  2GJY A;  2QKL A;  3GYO A;  5C5B A;  2VRW B;  4YON A;  1ZC4 B;  3GYP A;  2J0K A;  2L1C A;  2J0J A;  2M38 A;  2KCJ A;  5D3W A;  1OMW A;  2QKM A;  3G9W A;  3CIK A;  1WI1 A;  2DX5 A;  2D9W A;  4CYE A;  1TQZ A;  4WVF B;  2ELA A;  3HW2 B;  2R09 A;  3PVU A;  2DYQ A;  2CRF A;  3DXC A;  4HAX B;  4HAU B;  2R0D A;  2Y8F A;  3HQC A;  4HAV B;  4DXA B;  3AU5 A;  4TYZ A;  2YF0 A;  4K81 A;  2IFS A;  5C6R A;  4D0N B;  4GMX B;  1B55 A;  5D3X A;  1U5D A;  2Z0O A;  3A98 B;  4PNK A;  1J0W A;  4HB4 B;  2I5F A;  3SYX A;  1Q67 A;  4K2O A;  2ROV A;  1FOE A;  1M7E A;  1TJ6 A;  3A8P A;  2DTC A;  3FEH A;  2EC1 A;  2D2Q A;  5DHF B;  5HE3 A;  3VOQ A;  3PG7 A;  4F7U P;  2YRY A;  1V88 A;  4HAZ B;  5D3Y A;  2OQB A;  1ZSQ A;  3D8E A;  3FM8 C;  5LON B;  1DDW A;  4Z2N A;  1FGY A;  1GC7 A;  3IVF A;  4CHM A;  5HE0 A;  3ODO A;  4XWX A;  3DXE A;  3QIJ A;  4HDO A;  1ISN A;  2CY5 A;  2GS0 A;  2NZ8 B;  2K2J A;  5HE1 A;  2LYD A;  3HK0 A;  3N7C A;  5JP4 A;  1U5E A;  1I2H A;  3KSY A;  2MFQ A;  4HHV A;  1DRO A;  1W1D A;  4ZRJ A;  2EMS A;  5C5B B;  4A6H A;  2DX1 A;  3OAN A;  3SNH A;  3ULB A;  5DH9 B;  1BAK A;  4HB0 B;  5L81 A;  5CLQ B;  4F7H A;  3SUZ A;  1NU2 A;  2MKR A;  2Q13 A;  4HAT B;  3WA0 A;  4HDQ A;  3CXB B;  1M7R A;  2KUP A;  4KHA A;  3D8F A;  1MIX A;  1GC6 A;  2DA0 A;  1K5G B;  5FI1 A;  2DN6 A;  1Y19 B;  1IRS A;  5J3T A;  2PZ1 A;  4GMV A;  2I5C A;  2P8V A;  3BJI A;  3BIN A;  1NTV A;  2P0H A;  4NSW A;  4WJ7 A;  2CY4 A;  2GCL A;  5KCV A;  2J0M A;  5FI0 A;  1K5D B;  3TVV A;  4H8S A;  3ODX A;  5HE2 A;  1UNR A;  4P7I A;  2M14 A;  1DBH A;  3PZD A;  1X05 A;  4A6F B;  2XQN M;  4HB3 B;  4MY6 A;  3QBV B;  2D9Y A;  1V5P A;  2X18 A;  1U2B A;  2V76 A;  1XR0 B;  4IFS A;  2H7E A;  2RSG A;  1H10 A;  2DKP A;  3QWM A;  3PEG A;  1X86 A;  2DHI A;  2RNR B;  1W1H A;  3RCP A;  1WGU A;  2G35 A;  3PP2 A;  1PFJ A;  4DX8 A;  4C0A A;  3A8Q A;  4YL8 A;  4HAY B;  1DDV A;  2Z0Q A;  1UPR A;  1PMS A;  2DLW A;  3MPX A;  1SHC A;  1WVH A;  3U7D A;  1PLS A;  1UPQ A;  1LB1 A;  3NSU A;  1U27 A;  2P0D A;  5DHA B;  5C16 A;  4DX9 0;  1FHX A;  1ZC3 B;  1OY2 A;  1N3H A;  1MKE A;  2AEH A;  3U8Z A;  2Y8G A;  2DKQ A;  3MDB C;  3PVL A;  1EF1 A;  2VKI A;  3KZ1 A;  1QQG A;  2MDX A;  2ZPY A;  4KHO A;  2ROZ B;  2Z0P A;  1XD4 A;  2H7D A;  4IOY X;  2KGX B;  4HAW B;  4A6K A;  2P0F A;  4EMO A;  2D10 A;  3ZVR A;  3SO6 A;  1AQC A;  2YS1 A;  1P6S A;  5KQ1 A;  1KI1 B;  5DI9 B;  2J59 M;  4F7G A;  4GZU A;  1Y5O A;  4MK0 A;  4ZRI A;  1DYN A;  2JP2 A;  2D11 A;  1I7A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...