1FB8A

Structure of the pleckstrin homology domain from dapp1/phish
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
106
structure length
106
Chain Sequence
LVPTAPSLGTKEGYLTKQGGLVKTWKTRWFTLHRNELKYFKDQMSPEPIRILDLTECSAVQFDYSQERVNCFCLVFPFRTFYLCAKTGVEADEWIKILRWKLSQIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Signaling protein
molecule keywords DUAL ADAPTOR OF PHOSPHOTYROSINE AND 3-PHOSPHOINOSITIDES
publication title Structural basis for discrimination of 3-phosphoinositides by pleckstrin homology domains.
pubmed doi rcsb
source organism Homo sapiens
total genus 20
structure length 106
sequence length 106
ec nomenclature
pdb deposition date 2000-07-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00169 PH PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1fb8A00
1UNRA 1X11A 1J0WA 1EF1A 1TJ6A 4MK0A 1GG3A 4XWXA 2NMBA 2RVBB 1H4RA 4GPTB 2VRWB 2UVMA 5C6RA 2YVCA 1Q67A 2MDXA 1UPQA 4HHVA 2P0DA 4ZRJA 1DYNA 5HE3A 1DROA 4B6HA 5JHHA 4WSFA 2DKQA 3D8FA 2AL6A 3WYFB 2LOXA 2LULA 4DX8A 2Z0OA 3DXDA 5C5BB 2D9VA 1P6SA 4HAZB 2UZRA 5EFXA 2XQNM 4HDQA 1WI1A 3KRXA 3PVLA 2MFQA 3SV1A 1XKEA 1BTNA 2LYDA 1MIXA 3KSYA 4Z2MB 4DBBA 4PQ0A 5KQ4A 3MPXA 1AWEA 3A8QA 1I2HA 1SGHA 1TXDA 1U5FA 1XODA 3ODWA 1X86A 2COAA 1MKEA 5D3YA 4KVGB 2N0YA 1UEFA 2ROZB 1X1GA 2KGXB 2VSZA 3TO1A 5D3VA 5J3YA 2P8VA 5C5BA 2R09A 4A6FB 4EJNA 1MAIA 1N3HA 2FJLA 2ZPYA 1V5UA 1NU2A 4C0AA 4K2OA 4A5KA 1LW3A 2L2IA 3X23A 3GYOA 1KZGA 2DLWA 4HB2B 4HB0B 4K81A 1U5DA 4K17A 5DHFB 2COFA 2Z0QA 5JHGA 4GMVA 2KUPA 1IRSA 3PVWA 2GJYA 1MPHA 2V76A 2AEHA 3PVUA 1U2BA 2Q13A 2GCLA 3WA0A 2LOZA 3ULCA 3DXCA 2I5CA 3A98B 2M38A 1ZC4B 3NSUA 1EGXA 1ZVRA 1XR0B 1FHWA 2DKPA 4L6EA 5D27A 3A8PA 1OY2A 1WG7A 3BINA 2M14A 4A6HA 2EJ8A 4D0NB 2I1KA 2GS0A 2Z0PA 3HW2B 2MWNB 2D9XA 1J19A 1EAZA 1ISNA 2ADZA 2DN6A 4KHBB 3QBVB 3TFMA 2LG1A 3G9WA 4EMOA 4P7IA 1MIZB 1M7RA 4TYZA 2EMSA 3D8DA 1TQZA 3CIKA 3LJUX 3P7ZA 5C16A 1K5DB 2D9WA 1NI2A 2KCJA 1DDWA 5HE0A 5CLQB 1GC7A 3SNHA 2X18A 5HE1A 1DDVA 4Z2NA 4BBKA 3ML4A 2CY4A 3UZTA 5DIFB 5KCVA 2YT0A 2R0DA 2W2WA 2J0JA 2QKMA 1ZC3B 4EKUA 2DHJA 4F7HA 1FGYA 4PNKA 1NTYA 2CY5A 3PSCA 1BWNA 2J0MA 2ELBA 1FHXA 1MK7B 2L1CA 2RGNB 1WJ1A 5D3WA 1E5WA 1QQGA 5J3TA 1KI1B 2DHIA 3D8EA 5D3XA 2PZ1A 2H7DA 2DFKA 3SO6A 4IFSA 4H8SA 1B55A 4HB3B 3AU5A 1ZSQA 1WJMA 5LOPB 2YT1A 3P6AA 2UZSA 5L81A 1ZM0A 2YS1A 4HAUB 1DDMA 3SUZA 1UPRA 4A6KA 2K2JA 1RJ2A 1KZ7A 3DXEA 2YRYA 3ULBA 3M1IB 3V5WA 3AU4A 4DXAB 1I7AA 1BTKA 1XX0A 1FHOA 1W1HA 2H7EA 1V5MA 3U8ZA 5DI9B 3KY9A 2Y8FA 4GN1A 2D10A 1U5EA 3VOQA 2OTXA 2I1JA 2YS5A 2MKRA 4HAVB 4GMXB 2D9YA 4K2PA 1V5PA 2DTCA 2DYQA 1EVHA 2COCA 1FGZA 3KRWA 2RUKB 2K2UA 3VIAA 2YF0A 1PFJA 4Y94A 3TVVA 1V89A 1X05A 2N23A 1OQNA 1PLSA 4GZUA 1QC6A 3T06A 4WVFB 2RLOA 1W1GA 1WGUA 1U29A 2BCJA 3O96A 1U27A 4YONA 4HAWB 1BAKA 4GXBA 4NY0A 3AJ4A 2DA0A 4HATB 3HQCA 2D11A 1Y19B 2LKOA 2DHKA 2DX5A 3TCAA 5LONB 4ZRIA 4ZRKA 2ROVA 4KAXB 1X1FA 5FI0A 2EC1A 1XD4A 3QWMA 3KZ1A 4MT7A 3QIJA 2NZ8B 3ODXA 1K5GB 2W2XC 2EMTA 1AQCA 1UNQA 2D2QA 4CHJA 1UNPA 3BJIA 1W1DA 1GC6A 1RRPB 2ELAA 3ODOA 3IVFA 1M7EA 5DH9B 2D9ZA 2G35A 1V61A 1SHCA 4IOYX 3FSSA 3PEGA 4YL8A 2CODA 1DBHA 2Y8GA 3SYXA 1XCGA 1V88A 2DYNA 5J3QA 2IYBA 1P5TA 3PZDA 1H10A 2IFSA 5KQ1A 1Y5OA 3HK0A 2CRFA 2J0KA 2QKLA 1WVHA 5GOWB 2OQBA 4F7UP 3FM8C 1P3RA 1MK9B 2P0HA 2I5FA 3TW1A 3F5RA 4NSWA 4KHOA 4MY6A 3U7DA 4HAXB 3GYPA 5CLLB 4HDOA 1U5GA 4DX90 5C79A 2D4QA 2RNRB 3PG7A 2P0FA 2RSGA 4A6FA 1OMWA 1PMSA 4F7GA 1NTVA 1WGQA 4IAPA 3PP2A 1FOEA 2E2XA 1FB8A 2CAYA 2Y7BA 3CXBB 2YS3A 5JP4A 2DX1A 4HB4B 4WJ7A 3F0WA 3OANA 3FEHA 5DHAB 5JLJB 3ZVRA 2VKIA 4HAYB 2HTHB 3ZDTA 2JP2A 2YSZA 3MDBC 5HE2A 1LB1A 3RCPA 4KHAA 2HE7A 2K00A 2W2XD 4CHMA 1Z87A 1FAOA 4CYEA 4TKNA 2GCJA 3N7CA 2J59M 5FI1A
chains in the Genus database with same CATH superfamily
1UNRA 1X11A 1J0WA 1EF1A 1TJ6A 4MK0A 1GG3A 4XWXA 2NMBA 2RVBB 1H4RA 4GPTB 2VRWB 2UVMA 5C6RA 2YVCA 1Q67A 2MDXA 1UPQA 4HHVA 2P0DA 4ZRJA 1DYNA 5HE3A 3HIEA 1DROA 4B6HA 5JHHA 4WSFA 2DKQA 3D8FA 2AL6A 3WYFB 2LOXA 2LULA 4DX8A 2Z0OA 3DXDA 5C5BB 2D9VA 1P6SA 4HAZB 2UZRA 5EFXA 4QXAB 2XQNM 4HDQA 1WI1A 3KRXA 3PVLA 2MFQA 3SV1A 1XKEA 1BTNA 2LYDA 1MIXA 3KSYA 4Z2MB 4DBBA 4PQ0A 5KQ4A 3MPXA 1AWEA 3A8QA 1I2HA 1SGHA 1TXDA 1U5FA 4KHBA 1XODA 3ODWA 1X86A 2COAA 2RRFA 1MKEA 5D3YA 4KVGB 2N0YA 1UEFA 2ROZB 1X1GA 2KGXB 2VSZA 3TO1A 5D3VA 5J3YA 2P8VA 5C5BA 2R09A 4A6FB 4QJ5B 4EJNA 4L1RA 1MAIA 1N3HA 2FJLA 2ZPYA 1V5UA 1NU2A 5M4YB 4C0AA 4K2OA 4A5KA 1LW3A 4OSNA 2L2IA 3X23A 3GYOA 1KZGA 2DLWA 4HB2B 4HB0B 4K81A 1U5DA 4K17A 5DHFB 2COFA 3HSAA 2Z0QA 5JHGA 4GMVA 2KUPA 5I2SA 1IRSA 3PVWA 2GJYA 1MPHA 2V76A 2AEHA 3PVUA 1U2BA 2Q13A 2Z59A 2GCLA 3NWDA 3WA0A 2LOZA 3ULCA 2Z13A 3DXCA 2I5CA 3U12A 3A98B 2M38A 1ZC4B 3NSUA 1EGXA 1ZVRA 1XR0B 1FHWA 2DKPA 4L6EA 5D27A 3A8PA 1OY2A 1WG7A 3BINA 2M14A 4A6HA 2EJ8A 4D0NB 2I1KA 2GS0A 2Z0PA 3HW2B 2MWNB 2D9XA 1J19A 1EAZA 1ISNA 2ADZA 3FVCA 2DN6A 4KHBB 4CSQA 3QBVB 3TFMA 2LG1A 3G9WA 4EMOA 4P7IA 1MIZB 1M7RA 4TYZA 2EMSA 3D8DA 1TQZA 3CIKA 3LJUX 3P7ZA 4GNKB 5C16A 1K5DB 2D9WA 1NI2A 2KCJA 1DDWA 5HE0A 5CLQB 1GC7A 3SNHA 2X18A 5HE1A 1DDVA 4Z2NA 4BBKA 3ML4A 2CY4A 3UZTA 5DIFB 5KCVA 2YT0A 2R0DA 2W2WA 2J0JA 2QKMA 3B77A 1ZC3B 4EKUA 2DHJA 4F7HA 1FGYA 4PNKA 1NTYA 2CY5A 3NW8A 3PSCA 2K49A 1BWNA 2KIEA 2J0MA 2ELBA 1FHXA 1MK7B 2L1CA 2RGNB 1WJ1A 5D3WA 1E5WA 1QQGA 5J3TA 1KI1B 2DHIA 3D8EA 5D3XA 2PZ1A 2H7DA 5IRSA 2DFKA 3SO6A 4IFSA 4H8SA 1B55A 4HB3B 3AU5A 1ZSQA 1WJMA 5LOPB 2YT1A 3P6AA 2UZSA 5L81A 1ZM0A 2YS1A 4HAUB 1DDMA 3SUZA 1MI1A 1UPRA 4A6KA 2K2JA 1RJ2A 1KZ7A 3DXEA 2YRYA 3ULBA 3M1IB 3V5WA 3AU4A 4DXAB 1I7AA 1BTKA 1XX0A 4QJ3B 1FHOA 1W1HA 2H7EA 1V5MA 3U8ZA 5DI9B 3KY9A 2Y8FA 4GN1A 2D10A 1U5EA 3VOQA 2OTXA 2I1JA 2YS5A 2MKRA 4HAVB 4GMXB 2D9YA 2KIGA 4K2PA 1V5PA 2DTCA 2NBVA 2DYQA 1EVHA 2COCA 1FGZA 3KRWA 2RUKB 2K2UA 4GOUA 3VIAA 2YF0A 1PFJA 4Y94A 3TVVA 1V89A 1X05A 2N23A 1OQNA 1PLSA 4GZUA 1QC6A 3T06A 4WVFB 2FJUB 3DCXA 2RLOA 1W1GA 1WGUA 1U29A 2BCJA 3O96A 1U27A 4YONA 4HAWB 1BAKA 2YT2A 4GXBA 4NY0A 3AJ4A 2DA0A 4HATB 3HQCA 2D11A 1Y19B 2LKOA 2DHKA 2DX5A 3TCAA 5LONB 4ZRIA 4ZRKA 2ROVA 4KAXB 1X1FA 2Z14A 5FI0A 2EC1A 1XD4A 3OHMB 3QWMA 3KZ1A 4MT7A 3QIJA 2NZ8B 3ODXA 1K5GB 2W2XC 2EMTA 1AQCA 1ZYIA 1UNQA 2D2QA 4CHJA 4QJ4B 1UNPA 2R2YA 3BJIA 5I2MA 1W1DA 1GC6A 1RRPB 2ELAA 3ODOA 3IVFA 1M7EA 5DH9B 2D9ZA 2G35A 1V61A 1SHCA 4IOYX 4HSIA 2KUQA 3FSSA 5LG4B 3PEGA 4YL8A 2GUMA 2CODA 1DBHA 2Y8GA 3SYXA 1XCGA 1V88A 2DYNA 5J3QA 4OT1A 2IYBA 1P5TA 3PZDA 1H10A 2IFSA 5KQ1A 1Y5OA 3HK0A 2CRFA 2J0KA 2QKLA 1WVHA 5GOWB 2OQBA 4F7UP 1T77A 3FM8C 1P3RA 1MK9B 2P0HA 2I5FA 4DIXA 3TW1A 3F5RA 4NSWA 4KHOA 3A58A 4MY6A 3U7DA 4HAXB 3GYPA 3NWFA 5CLLB 4HDOA 1U5GA 4DX90 5C79A 2D4QA 2RNRB 3PG7A 2P0FA 2RSGA 4A6FA 1OMWA 1PMSA 4F7GA 1NTVA 1WGQA 4IAPA 3PP2A 1FOEA 2E2XA 1FB8A 2CAYA 2Y7BA 3CXBB 2YS3A 5JP4A 2DX1A 4HB4B 4WJ7A 3F0WA 3OANA 3FEHA 5DHAB 5JLJB 3ZVRA 2VKIA 4HAYB 2HTHB 3ZDTA 2Z4DA 3NWAA 2JP2A 2YSZA 3MDBC 5HE2A 2KR0A 1LB1A 2ZKMX 3RCPA 4KHAA 2HE7A 2K00A 2K8EA 2W2XD 4D6WA 4CHMA 1Z87A 1FAOA 4CYEA 4TKNA 2GCJA 3N7CA 2J59M 5FI1A
chains in the Genus database with same CATH topology
1UNRA 1X11A 1J0WA 1EF1A 1TJ6A 4MK0A 1GG3A 4XWXA 2NMBA 2RVBB 1H4RA 4GPTB 2VRWB 2UVMA 5C6RA 2YVCA 1Q67A 2MDXA 1UPQA 4HHVA 2P0DA 4ZRJA 1DYNA 5HE3A 1DROA 4B6HA 5JHHA 4WSFA 2DKQA 3D8FA 2AL6A 3WYFB 2LOXA 2LULA 4DX8A 2Z0OA 3DXDA 5C5BB 2D9VA 1P6SA 4HAZB 2UZRA 5EFXA 2XQNM 4HDQA 1WI1A 3KRXA 3PVLA 2MFQA 3SV1A 1XKEA 1BTNA 2LYDA 1MIXA 3KSYA 4Z2MB 4DBBA 4PQ0A 5KQ4A 3MPXA 1AWEA 3A8QA 1I2HA 1SGHA 1TXDA 1U5FA 1XODA 3ODWA 1X86A 2COAA 1MKEA 5D3YA 4KVGB 2N0YA 1UEFA 2ROZB 1X1GA 2KGXB 2VSZA 3TO1A 5D3VA 5J3YA 2P8VA 5C5BA 2R09A 4A6FB 4EJNA 1MAIA 1N3HA 2FJLA 2ZPYA 1V5UA 1NU2A 4C0AA 4K2OA 4A5KA 1LW3A 2L2IA 3X23A 3GYOA 1KZGA 2DLWA 4HB2B 4HB0B 4K81A 1U5DA 4K17A 5DHFB 2COFA 2Z0QA 5JHGA 4GMVA 2KUPA 1IRSA 3PVWA 2GJYA 1MPHA 2V76A 2AEHA 3PVUA 1U2BA 2Q13A 2GCLA 3WA0A 2LOZA 3ULCA 3DXCA 2I5CA 3A98B 2M38A 1ZC4B 3NSUA 1EGXA 1ZVRA 1XR0B 1FHWA 2DKPA 4L6EA 5D27A 3A8PA 1OY2A 1WG7A 3BINA 2M14A 4A6HA 2EJ8A 4D0NB 2I1KA 2GS0A 2Z0PA 3HW2B 2MWNB 2D9XA 1J19A 1EAZA 1ISNA 2ADZA 2DN6A 4KHBB 3QBVB 3TFMA 2LG1A 3G9WA 4EMOA 4P7IA 1MIZB 1M7RA 4TYZA 2EMSA 3D8DA 1TQZA 3CIKA 3LJUX 3P7ZA 5C16A 1K5DB 2D9WA 1NI2A 2KCJA 1DDWA 5HE0A 5CLQB 1GC7A 3SNHA 2X18A 5HE1A 1DDVA 4Z2NA 4BBKA 3ML4A 2CY4A 3UZTA 5DIFB 5KCVA 2YT0A 2R0DA 2W2WA 2J0JA 2QKMA 1ZC3B 4EKUA 2DHJA 4F7HA 1FGYA 4PNKA 1NTYA 2CY5A 3PSCA 1BWNA 2J0MA 2ELBA 1FHXA 1MK7B 2L1CA 2RGNB 1WJ1A 5D3WA 1E5WA 1QQGA 5J3TA 1KI1B 2DHIA 3D8EA 5D3XA 2PZ1A 2H7DA 2DFKA 3SO6A 4IFSA 4H8SA 1B55A 4HB3B 3AU5A 1ZSQA 1WJMA 5LOPB 2YT1A 3P6AA 2UZSA 5L81A 1ZM0A 2YS1A 4HAUB 1DDMA 3SUZA 1UPRA 4A6KA 2K2JA 1RJ2A 1KZ7A 3DXEA 2YRYA 3ULBA 3M1IB 3V5WA 3AU4A 4DXAB 1I7AA 1BTKA 1XX0A 1FHOA 1W1HA 2H7EA 1V5MA 3U8ZA 5DI9B 3KY9A 2Y8FA 4GN1A 2D10A 1U5EA 3VOQA 2OTXA 2I1JA 2YS5A 2MKRA 4HAVB 4GMXB 2D9YA 4K2PA 1V5PA 2DTCA 2DYQA 1EVHA 2COCA 1FGZA 3KRWA 2RUKB 2K2UA 3VIAA 2YF0A 1PFJA 4Y94A 3TVVA 1V89A 1X05A 2N23A 1OQNA 1PLSA 4GZUA 1QC6A 3T06A 4WVFB 2RLOA 1W1GA 1WGUA 1U29A 2BCJA 3O96A 1U27A 4YONA 4HAWB 1BAKA 4GXBA 4NY0A 3AJ4A 2DA0A 4HATB 3HQCA 2D11A 1Y19B 2LKOA 2DHKA 2DX5A 3TCAA 5LONB 4ZRIA 4ZRKA 2ROVA 4KAXB 1X1FA 5FI0A 2EC1A 1XD4A 3QWMA 3KZ1A 4MT7A 3QIJA 2NZ8B 3ODXA 1K5GB 2W2XC 2EMTA 1AQCA 1UNQA 2D2QA 4CHJA 1UNPA 3BJIA 1W1DA 1GC6A 1RRPB 2ELAA 3ODOA 3IVFA 1M7EA 5DH9B 2D9ZA 2G35A 1V61A 1SHCA 4IOYX 3FSSA 3PEGA 4YL8A 2CODA 1DBHA 2Y8GA 3SYXA 1XCGA 1V88A 2DYNA 5J3QA 2IYBA 1P5TA 3PZDA 1H10A 2IFSA 5KQ1A 1Y5OA 3HK0A 2CRFA 2J0KA 2QKLA 1WVHA 5GOWB 2OQBA 4F7UP 3FM8C 1P3RA 1MK9B 2P0HA 2I5FA 3TW1A 3F5RA 4NSWA 4KHOA 4MY6A 3U7DA 4HAXB 3GYPA 5CLLB 4HDOA 1U5GA 4DX90 5C79A 2D4QA 2RNRB 3PG7A 2P0FA 2RSGA 4A6FA 1OMWA 1PMSA 4F7GA 1NTVA 1WGQA 4IAPA 3PP2A 1FOEA 2E2XA 1FB8A 2CAYA 2Y7BA 3CXBB 2YS3A 5JP4A 2DX1A 4HB4B 4WJ7A 3F0WA 3OANA 3FEHA 5DHAB 5JLJB 3ZVRA 2VKIA 4HAYB 2HTHB 3ZDTA 2JP2A 2YSZA 3MDBC 5HE2A 1LB1A 3RCPA 4KHAA 2HE7A 2K00A 2W2XD 4CHMA 1Z87A 1FAOA 4CYEA 4TKNA 2GCJA 3N7CA 2J59M 5FI1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UNR A;  1X11 A;  1J0W A;  1EF1 A;  1TJ6 A;  4MK0 A;  1GG3 A;  4XWX A;  2NMB A;  2RVB B;  1H4R A;  4GPT B;  2VRW B;  2UVM A;  5C6R A;  2YVC A;  1Q67 A;  2MDX A;  1UPQ A;  4HHV A;  2P0D A;  4ZRJ A;  1DYN A;  5HE3 A;  1DRO A;  4B6H A;  5JHH A;  4WSF A;  2DKQ A;  3D8F A;  2AL6 A;  3WYF B;  2LOX A;  2LUL A;  4DX8 A;  2Z0O A;  3DXD A;  5C5B B;  2D9V A;  1P6S A;  4HAZ B;  2UZR A;  5EFX A;  2XQN M;  4HDQ A;  1WI1 A;  3KRX A;  3PVL A;  2MFQ A;  3SV1 A;  1XKE A;  1BTN A;  2LYD A;  1MIX A;  3KSY A;  4Z2M B;  4DBB A;  4PQ0 A;  5KQ4 A;  3MPX A;  1AWE A;  3A8Q A;  1I2H A;  1SGH A;  1TXD A;  1U5F A;  1XOD A;  3ODW A;  1X86 A;  2COA A;  1MKE A;  5D3Y A;  4KVG B;  2N0Y A;  1UEF A;  2ROZ B;  1X1G A;  2KGX B;  2VSZ A;  3TO1 A;  5D3V A;  5J3Y A;  2P8V A;  5C5B A;  2R09 A;  4A6F B;  4EJN A;  1MAI A;  1N3H A;  2FJL A;  2ZPY A;  1V5U A;  1NU2 A;  4C0A A;  4K2O A;  4A5K A;  1LW3 A;  2L2I A;  3X23 A;  3GYO A;  1KZG A;  2DLW A;  4HB2 B;  4HB0 B;  4K81 A;  1U5D A;  4K17 A;  5DHF B;  2COF A;  2Z0Q A;  5JHG A;  4GMV A;  2KUP A;  1IRS A;  3PVW A;  2GJY A;  1MPH A;  2V76 A;  2AEH A;  3PVU A;  1U2B A;  2Q13 A;  2GCL A;  3WA0 A;  2LOZ A;  3ULC A;  3DXC A;  2I5C A;  3A98 B;  2M38 A;  1ZC4 B;  3NSU A;  1EGX A;  1ZVR A;  1XR0 B;  1FHW A;  2DKP A;  4L6E A;  5D27 A;  3A8P A;  1OY2 A;  1WG7 A;  3BIN A;  2M14 A;  4A6H A;  2EJ8 A;  4D0N B;  2I1K A;  2GS0 A;  2Z0P A;  3HW2 B;  2MWN B;  2D9X A;  1J19 A;  1EAZ A;  1ISN A;  2ADZ A;  2DN6 A;  4KHB B;  3QBV B;  3TFM A;  2LG1 A;  3G9W A;  4EMO A;  4P7I A;  1MIZ B;  1M7R A;  4TYZ A;  2EMS A;  3D8D A;  1TQZ A;  3CIK A;  3LJU X;  3P7Z A;  5C16 A;  1K5D B;  2D9W A;  1NI2 A;  2KCJ A;  1DDW A;  5HE0 A;  5CLQ B;  1GC7 A;  3SNH A;  2X18 A;  5HE1 A;  1DDV A;  4Z2N A;  4BBK A;  3ML4 A;  2CY4 A;  3UZT A;  5DIF B;  5KCV A;  2YT0 A;  2R0D A;  2W2W A;  2J0J A;  2QKM A;  1ZC3 B;  4EKU A;  2DHJ A;  4F7H A;  1FGY A;  4PNK A;  1NTY A;  2CY5 A;  3PSC A;  1BWN A;  2J0M A;  2ELB A;  1FHX A;  1MK7 B;  2L1C A;  2RGN B;  1WJ1 A;  5D3W A;  1E5W A;  1QQG A;  5J3T A;  1KI1 B;  2DHI A;  3D8E A;  5D3X A;  2PZ1 A;  2H7D A;  2DFK A;  3SO6 A;  4IFS A;  4H8S A;  1B55 A;  4HB3 B;  3AU5 A;  1ZSQ A;  1WJM A;  5LOP B;  2YT1 A;  3P6A A;  2UZS A;  5L81 A;  1ZM0 A;  2YS1 A;  4HAU B;  1DDM A;  3SUZ A;  1UPR A;  4A6K A;  2K2J A;  1RJ2 A;  1KZ7 A;  3DXE A;  2YRY A;  3ULB A;  3M1I B;  3V5W A;  3AU4 A;  4DXA B;  1I7A A;  1BTK A;  1XX0 A;  1FHO A;  1W1H A;  2H7E A;  1V5M A;  3U8Z A;  5DI9 B;  3KY9 A;  2Y8F A;  4GN1 A;  2D10 A;  1U5E A;  3VOQ A;  2OTX A;  2I1J A;  2YS5 A;  2MKR A;  4HAV B;  4GMX B;  2D9Y A;  4K2P A;  1V5P A;  2DTC A;  2DYQ A;  1EVH A;  2COC A;  1FGZ A;  3KRW A;  2RUK B;  2K2U A;  3VIA A;  2YF0 A;  1PFJ A;  4Y94 A;  3TVV A;  1V89 A;  1X05 A;  2N23 A;  1OQN A;  1PLS A;  4GZU A;  1QC6 A;  3T06 A;  4WVF B;  2RLO A;  1W1G A;  1WGU A;  1U29 A;  2BCJ A;  3O96 A;  1U27 A;  4YON A;  4HAW B;  1BAK A;  4GXB A;  4NY0 A;  3AJ4 A;  2DA0 A;  4HAT B;  3HQC A;  2D11 A;  1Y19 B;  2LKO A;  2DHK A;  2DX5 A;  3TCA A;  5LON B;  4ZRI A;  4ZRK A;  2ROV A;  4KAX B;  1X1F A;  5FI0 A;  2EC1 A;  1XD4 A;  3QWM A;  3KZ1 A;  4MT7 A;  3QIJ A;  2NZ8 B;  3ODX A;  1K5G B;  2W2X C;  2EMT A;  1AQC A;  1UNQ A;  2D2Q A;  4CHJ A;  1UNP A;  3BJI A;  1W1D A;  1GC6 A;  1RRP B;  2ELA A;  3ODO A;  3IVF A;  1M7E A;  5DH9 B;  2D9Z A;  2G35 A;  1V61 A;  1SHC A;  4IOY X;  3FSS A;  3PEG A;  4YL8 A;  2COD A;  1DBH A;  2Y8G A;  3SYX A;  1XCG A;  1V88 A;  2DYN A;  5J3Q A;  2IYB A;  1P5T A;  3PZD A;  1H10 A;  2IFS A;  5KQ1 A;  1Y5O A;  3HK0 A;  2CRF A;  2J0K A;  2QKL A;  1WVH A;  5GOW B;  2OQB A;  4F7U P;  3FM8 C;  1P3R A;  1MK9 B;  2P0H A;  2I5F A;  3TW1 A;  3F5R A;  4NSW A;  4KHO A;  4MY6 A;  3U7D A;  4HAX B;  3GYP A;  5CLL B;  4HDO A;  1U5G A;  4DX9 0;  5C79 A;  2D4Q A;  2RNR B;  3PG7 A;  2P0F A;  2RSG A;  4A6F A;  1OMW A;  1PMS A;  4F7G A;  1NTV A;  1WGQ A;  4IAP A;  3PP2 A;  1FOE A;  2E2X A;  1FB8 A;  2CAY A;  2Y7B A;  3CXB B;  2YS3 A;  5JP4 A;  2DX1 A;  4HB4 B;  4WJ7 A;  3F0W A;  3OAN A;  3FEH A;  5DHA B;  5JLJ B;  3ZVR A;  2VKI A;  4HAY B;  2HTH B;  3ZDT A;  2JP2 A;  2YSZ A;  3MDB C;  5HE2 A;  1LB1 A;  3RCP A;  4KHA A;  2HE7 A;  2K00 A;  2W2X D;  4CHM A;  1Z87 A;  1FAO A;  4CYE A;  4TKN A;  2GCJ A;  3N7C A;  2J59 M;  5FI1 A; 
#chains in the Genus database with same CATH topology
 1UNR A;  1X11 A;  1J0W A;  1EF1 A;  1TJ6 A;  4MK0 A;  1GG3 A;  4XWX A;  2NMB A;  2RVB B;  1H4R A;  4GPT B;  2VRW B;  2UVM A;  5C6R A;  2YVC A;  1Q67 A;  2MDX A;  1UPQ A;  4HHV A;  2P0D A;  4ZRJ A;  1DYN A;  5HE3 A;  3HIE A;  1DRO A;  4B6H A;  5JHH A;  4WSF A;  2DKQ A;  3D8F A;  2AL6 A;  3WYF B;  2LOX A;  2LUL A;  4DX8 A;  2Z0O A;  3DXD A;  5C5B B;  2D9V A;  1P6S A;  4HAZ B;  2UZR A;  5EFX A;  4QXA B;  2XQN M;  4HDQ A;  1WI1 A;  3KRX A;  3PVL A;  2MFQ A;  3SV1 A;  1XKE A;  1BTN A;  2LYD A;  1MIX A;  3KSY A;  4Z2M B;  4DBB A;  4PQ0 A;  5KQ4 A;  3MPX A;  1AWE A;  3A8Q A;  1I2H A;  1SGH A;  1TXD A;  1U5F A;  4KHB A;  1XOD A;  3ODW A;  1X86 A;  2COA A;  2RRF A;  1MKE A;  5D3Y A;  4KVG B;  2N0Y A;  1UEF A;  2ROZ B;  1X1G A;  2KGX B;  2VSZ A;  3TO1 A;  5D3V A;  5J3Y A;  2P8V A;  5C5B A;  2R09 A;  4A6F B;  4QJ5 B;  4EJN A;  4L1R A;  1MAI A;  1N3H A;  2FJL A;  2ZPY A;  1V5U A;  1NU2 A;  5M4Y B;  4C0A A;  4K2O A;  4A5K A;  1LW3 A;  4OSN A;  2L2I A;  3X23 A;  3GYO A;  1KZG A;  2DLW A;  4HB2 B;  4HB0 B;  4K81 A;  1U5D A;  4K17 A;  5DHF B;  2COF A;  3HSA A;  2Z0Q A;  5JHG A;  4GMV A;  2KUP A;  5I2S A;  1IRS A;  3PVW A;  2GJY A;  1MPH A;  2V76 A;  2AEH A;  3PVU A;  1U2B A;  2Q13 A;  2Z59 A;  2GCL A;  3NWD A;  3WA0 A;  2LOZ A;  3ULC A;  2Z13 A;  3DXC A;  2I5C A;  3U12 A;  3A98 B;  2M38 A;  1ZC4 B;  3NSU A;  1EGX A;  1ZVR A;  1XR0 B;  1FHW A;  2DKP A;  4L6E A;  5D27 A;  3A8P A;  1OY2 A;  1WG7 A;  3BIN A;  2M14 A;  4A6H A;  2EJ8 A;  4D0N B;  2I1K A;  2GS0 A;  2Z0P A;  3HW2 B;  2MWN B;  2D9X A;  1J19 A;  1EAZ A;  1ISN A;  2ADZ A;  3FVC A;  2DN6 A;  4KHB B;  4CSQ A;  3QBV B;  3TFM A;  2LG1 A;  3G9W A;  4EMO A;  4P7I A;  1MIZ B;  1M7R A;  4TYZ A;  2EMS A;  3D8D A;  1TQZ A;  3CIK A;  3LJU X;  3P7Z A;  4GNK B;  5C16 A;  1K5D B;  2D9W A;  1NI2 A;  2KCJ A;  1DDW A;  5HE0 A;  5CLQ B;  1GC7 A;  3SNH A;  2X18 A;  5HE1 A;  1DDV A;  4Z2N A;  4BBK A;  3ML4 A;  2CY4 A;  3UZT A;  5DIF B;  5KCV A;  2YT0 A;  2R0D A;  2W2W A;  2J0J A;  2QKM A;  3B77 A;  1ZC3 B;  4EKU A;  2DHJ A;  4F7H A;  1FGY A;  4PNK A;  1NTY A;  2CY5 A;  3NW8 A;  3PSC A;  2K49 A;  1BWN A;  2KIE A;  2J0M A;  2ELB A;  1FHX A;  1MK7 B;  2L1C A;  2RGN B;  1WJ1 A;  5D3W A;  1E5W A;  1QQG A;  5J3T A;  1KI1 B;  2DHI A;  3D8E A;  5D3X A;  2PZ1 A;  2H7D A;  5IRS A;  2DFK A;  3SO6 A;  4IFS A;  4H8S A;  1B55 A;  4HB3 B;  3AU5 A;  1ZSQ A;  1WJM A;  5LOP B;  2YT1 A;  3P6A A;  2UZS A;  5L81 A;  1ZM0 A;  2YS1 A;  4HAU B;  1DDM A;  3SUZ A;  1MI1 A;  1UPR A;  4A6K A;  2K2J A;  1RJ2 A;  1KZ7 A;  3DXE A;  2YRY A;  3ULB A;  3M1I B;  3V5W A;  3AU4 A;  4DXA B;  1I7A A;  1BTK A;  1XX0 A;  4QJ3 B;  1FHO A;  1W1H A;  2H7E A;  1V5M A;  3U8Z A;  5DI9 B;  3KY9 A;  2Y8F A;  4GN1 A;  2D10 A;  1U5E A;  3VOQ A;  2OTX A;  2I1J A;  2YS5 A;  2MKR A;  4HAV B;  4GMX B;  2D9Y A;  2KIG A;  4K2P A;  1V5P A;  2DTC A;  2NBV A;  2DYQ A;  1EVH A;  2COC A;  1FGZ A;  3KRW A;  2RUK B;  2K2U A;  4GOU A;  3VIA A;  2YF0 A;  1PFJ A;  4Y94 A;  3TVV A;  1V89 A;  1X05 A;  2N23 A;  1OQN A;  1PLS A;  4GZU A;  1QC6 A;  3T06 A;  4WVF B;  2FJU B;  3DCX A;  2RLO A;  1W1G A;  1WGU A;  1U29 A;  2BCJ A;  3O96 A;  1U27 A;  4YON A;  4HAW B;  1BAK A;  2YT2 A;  4GXB A;  4NY0 A;  3AJ4 A;  2DA0 A;  4HAT B;  3HQC A;  2D11 A;  1Y19 B;  2LKO A;  2DHK A;  2DX5 A;  3TCA A;  5LON B;  4ZRI A;  4ZRK A;  2ROV A;  4KAX B;  1X1F A;  2Z14 A;  5FI0 A;  2EC1 A;  1XD4 A;  3OHM B;  3QWM A;  3KZ1 A;  4MT7 A;  3QIJ A;  2NZ8 B;  3ODX A;  1K5G B;  2W2X C;  2EMT A;  1AQC A;  1ZYI A;  1UNQ A;  2D2Q A;  4CHJ A;  4QJ4 B;  1UNP A;  2R2Y A;  3BJI A;  5I2M A;  1W1D A;  1GC6 A;  1RRP B;  2ELA A;  3ODO A;  3IVF A;  1M7E A;  5DH9 B;  2D9Z A;  2G35 A;  1V61 A;  1SHC A;  4IOY X;  4HSI A;  2KUQ A;  3FSS A;  5LG4 B;  3PEG A;  4YL8 A;  2GUM A;  2COD A;  1DBH A;  2Y8G A;  3SYX A;  1XCG A;  1V88 A;  2DYN A;  5J3Q A;  4OT1 A;  2IYB A;  1P5T A;  3PZD A;  1H10 A;  2IFS A;  5KQ1 A;  1Y5O A;  3HK0 A;  2CRF A;  2J0K A;  2QKL A;  1WVH A;  5GOW B;  2OQB A;  4F7U P;  1T77 A;  3FM8 C;  1P3R A;  1MK9 B;  2P0H A;  2I5F A;  4DIX A;  3TW1 A;  3F5R A;  4NSW A;  4KHO A;  3A58 A;  4MY6 A;  3U7D A;  4HAX B;  3GYP A;  3NWF A;  5CLL B;  4HDO A;  1U5G A;  4DX9 0;  5C79 A;  2D4Q A;  2RNR B;  3PG7 A;  2P0F A;  2RSG A;  4A6F A;  1OMW A;  1PMS A;  4F7G A;  1NTV A;  1WGQ A;  4IAP A;  3PP2 A;  1FOE A;  2E2X A;  1FB8 A;  2CAY A;  2Y7B A;  3CXB B;  2YS3 A;  5JP4 A;  2DX1 A;  4HB4 B;  4WJ7 A;  3F0W A;  3OAN A;  3FEH A;  5DHA B;  5JLJ B;  3ZVR A;  2VKI A;  4HAY B;  2HTH B;  3ZDT A;  2Z4D A;  3NWA A;  2JP2 A;  2YSZ A;  3MDB C;  5HE2 A;  2KR0 A;  1LB1 A;  2ZKM X;  3RCP A;  4KHA A;  2HE7 A;  2K00 A;  2K8E A;  2W2X D;  4D6W A;  4CHM A;  1Z87 A;  1FAO A;  4CYE A;  4TKN A;  2GCJ A;  3N7C A;  2J59 M;  5FI1 A; 
#chains in the Genus database with same CATH homology
 1UNR A;  1X11 A;  1J0W A;  1EF1 A;  1TJ6 A;  4MK0 A;  1GG3 A;  4XWX A;  2NMB A;  2RVB B;  1H4R A;  4GPT B;  2VRW B;  2UVM A;  5C6R A;  2YVC A;  1Q67 A;  2MDX A;  1UPQ A;  4HHV A;  2P0D A;  4ZRJ A;  1DYN A;  5HE3 A;  1DRO A;  4B6H A;  5JHH A;  4WSF A;  2DKQ A;  3D8F A;  2AL6 A;  3WYF B;  2LOX A;  2LUL A;  4DX8 A;  2Z0O A;  3DXD A;  5C5B B;  2D9V A;  1P6S A;  4HAZ B;  2UZR A;  5EFX A;  2XQN M;  4HDQ A;  1WI1 A;  3KRX A;  3PVL A;  2MFQ A;  3SV1 A;  1XKE A;  1BTN A;  2LYD A;  1MIX A;  3KSY A;  4Z2M B;  4DBB A;  4PQ0 A;  5KQ4 A;  3MPX A;  1AWE A;  3A8Q A;  1I2H A;  1SGH A;  1TXD A;  1U5F A;  1XOD A;  3ODW A;  1X86 A;  2COA A;  1MKE A;  5D3Y A;  4KVG B;  2N0Y A;  1UEF A;  2ROZ B;  1X1G A;  2KGX B;  2VSZ A;  3TO1 A;  5D3V A;  5J3Y A;  2P8V A;  5C5B A;  2R09 A;  4A6F B;  4EJN A;  1MAI A;  1N3H A;  2FJL A;  2ZPY A;  1V5U A;  1NU2 A;  4C0A A;  4K2O A;  4A5K A;  1LW3 A;  2L2I A;  3X23 A;  3GYO A;  1KZG A;  2DLW A;  4HB2 B;  4HB0 B;  4K81 A;  1U5D A;  4K17 A;  5DHF B;  2COF A;  2Z0Q A;  5JHG A;  4GMV A;  2KUP A;  1IRS A;  3PVW A;  2GJY A;  1MPH A;  2V76 A;  2AEH A;  3PVU A;  1U2B A;  2Q13 A;  2GCL A;  3WA0 A;  2LOZ A;  3ULC A;  3DXC A;  2I5C A;  3A98 B;  2M38 A;  1ZC4 B;  3NSU A;  1EGX A;  1ZVR A;  1XR0 B;  1FHW A;  2DKP A;  4L6E A;  5D27 A;  3A8P A;  1OY2 A;  1WG7 A;  3BIN A;  2M14 A;  4A6H A;  2EJ8 A;  4D0N B;  2I1K A;  2GS0 A;  2Z0P A;  3HW2 B;  2MWN B;  2D9X A;  1J19 A;  1EAZ A;  1ISN A;  2ADZ A;  2DN6 A;  4KHB B;  3QBV B;  3TFM A;  2LG1 A;  3G9W A;  4EMO A;  4P7I A;  1MIZ B;  1M7R A;  4TYZ A;  2EMS A;  3D8D A;  1TQZ A;  3CIK A;  3LJU X;  3P7Z A;  5C16 A;  1K5D B;  2D9W A;  1NI2 A;  2KCJ A;  1DDW A;  5HE0 A;  5CLQ B;  1GC7 A;  3SNH A;  2X18 A;  5HE1 A;  1DDV A;  4Z2N A;  4BBK A;  3ML4 A;  2CY4 A;  3UZT A;  5DIF B;  5KCV A;  2YT0 A;  2R0D A;  2W2W A;  2J0J A;  2QKM A;  1ZC3 B;  4EKU A;  2DHJ A;  4F7H A;  1FGY A;  4PNK A;  1NTY A;  2CY5 A;  3PSC A;  1BWN A;  2J0M A;  2ELB A;  1FHX A;  1MK7 B;  2L1C A;  2RGN B;  1WJ1 A;  5D3W A;  1E5W A;  1QQG A;  5J3T A;  1KI1 B;  2DHI A;  3D8E A;  5D3X A;  2PZ1 A;  2H7D A;  2DFK A;  3SO6 A;  4IFS A;  4H8S A;  1B55 A;  4HB3 B;  3AU5 A;  1ZSQ A;  1WJM A;  5LOP B;  2YT1 A;  3P6A A;  2UZS A;  5L81 A;  1ZM0 A;  2YS1 A;  4HAU B;  1DDM A;  3SUZ A;  1UPR A;  4A6K A;  2K2J A;  1RJ2 A;  1KZ7 A;  3DXE A;  2YRY A;  3ULB A;  3M1I B;  3V5W A;  3AU4 A;  4DXA B;  1I7A A;  1BTK A;  1XX0 A;  1FHO A;  1W1H A;  2H7E A;  1V5M A;  3U8Z A;  5DI9 B;  3KY9 A;  2Y8F A;  4GN1 A;  2D10 A;  1U5E A;  3VOQ A;  2OTX A;  2I1J A;  2YS5 A;  2MKR A;  4HAV B;  4GMX B;  2D9Y A;  4K2P A;  1V5P A;  2DTC A;  2DYQ A;  1EVH A;  2COC A;  1FGZ A;  3KRW A;  2RUK B;  2K2U A;  3VIA A;  2YF0 A;  1PFJ A;  4Y94 A;  3TVV A;  1V89 A;  1X05 A;  2N23 A;  1OQN A;  1PLS A;  4GZU A;  1QC6 A;  3T06 A;  4WVF B;  2RLO A;  1W1G A;  1WGU A;  1U29 A;  2BCJ A;  3O96 A;  1U27 A;  4YON A;  4HAW B;  1BAK A;  4GXB A;  4NY0 A;  3AJ4 A;  2DA0 A;  4HAT B;  3HQC A;  2D11 A;  1Y19 B;  2LKO A;  2DHK A;  2DX5 A;  3TCA A;  5LON B;  4ZRI A;  4ZRK A;  2ROV A;  4KAX B;  1X1F A;  5FI0 A;  2EC1 A;  1XD4 A;  3QWM A;  3KZ1 A;  4MT7 A;  3QIJ A;  2NZ8 B;  3ODX A;  1K5G B;  2W2X C;  2EMT A;  1AQC A;  1UNQ A;  2D2Q A;  4CHJ A;  1UNP A;  3BJI A;  1W1D A;  1GC6 A;  1RRP B;  2ELA A;  3ODO A;  3IVF A;  1M7E A;  5DH9 B;  2D9Z A;  2G35 A;  1V61 A;  1SHC A;  4IOY X;  3FSS A;  3PEG A;  4YL8 A;  2COD A;  1DBH A;  2Y8G A;  3SYX A;  1XCG A;  1V88 A;  2DYN A;  5J3Q A;  2IYB A;  1P5T A;  3PZD A;  1H10 A;  2IFS A;  5KQ1 A;  1Y5O A;  3HK0 A;  2CRF A;  2J0K A;  2QKL A;  1WVH A;  5GOW B;  2OQB A;  4F7U P;  3FM8 C;  1P3R A;  1MK9 B;  2P0H A;  2I5F A;  3TW1 A;  3F5R A;  4NSW A;  4KHO A;  4MY6 A;  3U7D A;  4HAX B;  3GYP A;  5CLL B;  4HDO A;  1U5G A;  4DX9 0;  5C79 A;  2D4Q A;  2RNR B;  3PG7 A;  2P0F A;  2RSG A;  4A6F A;  1OMW A;  1PMS A;  4F7G A;  1NTV A;  1WGQ A;  4IAP A;  3PP2 A;  1FOE A;  2E2X A;  1FB8 A;  2CAY A;  2Y7B A;  3CXB B;  2YS3 A;  5JP4 A;  2DX1 A;  4HB4 B;  4WJ7 A;  3F0W A;  3OAN A;  3FEH A;  5DHA B;  5JLJ B;  3ZVR A;  2VKI A;  4HAY B;  2HTH B;  3ZDT A;  2JP2 A;  2YSZ A;  3MDB C;  5HE2 A;  1LB1 A;  3RCP A;  4KHA A;  2HE7 A;  2K00 A;  2W2X D;  4CHM A;  1Z87 A;  1FAO A;  4CYE A;  4TKN A;  2GCJ A;  3N7C A;  2J59 M;  5FI1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...