1FB8A

Structure of the pleckstrin homology domain from dapp1/phish
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
106
structure length
106
Chain Sequence
LVPTAPSLGTKEGYLTKQGGLVKTWKTRWFTLHRNELKYFKDQMSPEPIRILDLTECSAVQFDYSQERVNCFCLVFPFRTFYLCAKTGVEADEWIKILRWKLSQIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural basis for discrimination of 3-phosphoinositides by pleckstrin homology domains.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords DUAL ADAPTOR OF PHOSPHOTYROSINE AND 3-PHOSPHOINOSITIDES
total genus 20
structure length 106
sequence length 106
ec nomenclature
pdb deposition date 2000-07-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00169 PH PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1fb8A00
4NY0A 2COCA 2M14A 3F0WA 2RUKB 1AQCA 5DI9B 1MK7B 4Y94A 5D3VA 3HW2B 5D3XA 1KZ7A 1DROA 2K00A 4EKUA 1V61A 4EMOA 4HB4B 1U5FA 2DKQA 1V88A 3CIKA 1TQZA 1MK9B 1P6SA 3D8EA 3PVUA 2L2IA 1OQNA 1MIXA 5D3YA 1WG7A 2D4QA 4P7IA 4WVFB 1P5TA 4GXBA 3D8DA 3P7ZA 3SO6A 3RCPA 1UEFA 2H7DA 1DDVA 1FAOA 1ZVRA 3TFMA 1MIZB 5J3TA 1UPRA 5JHHA 2MFQA 1WGUA 3VOQA 2G35A 2R0DA 4L6EA 4ZRKA 5D3WA 4CHJA 2D11A 2Y7BA 2YT1A 4A6HA 1OY2A 1BWNA 1DDWA 1V89A 4KAXB 3V5WA 3U8ZA 3GYOA 4HAYB 2K2JA 1MKEA 2XQNM 1QQGA 1LB1A 2W2XD 2I5FA 2RSGA 1KI1B 2NZ8B 3X23A 3TVVA 3FSSA 2KGXB 3A8PA 2X18A 3VIAA 2RLOA 2RVBB 4PQ0A 1P3RA 1U5EA 3MPXA 1ZC3B 4GMVA 1ZC4B 2CY5A 5JP4A 1XR0B 2CODA 1TJ6A 3PG7A 5EFXA 2VRWB 1GC6A 3WA0A 2V76A 4A6KA 5DHAB 2EC1A 1X1GA 3ULBA 2KCJA 3LJUX 4F7HA 3SNHA 2EMSA 2FJLA 2LULA 2D9VA 1PFJA 4NSWA 2E2XA 2GS0A 1Y19B 3N7CA 2DYNA 3TW1A 1X11A 2RGNB 1AWEA 2DN6A 1M7RA 2IYBA 1SGHA 3DXEA 2VKIA 1XODA 3ML4A 3ODXA 1IRSA 4GZUA 1W1GA 1FHWA 5JLJB 2YS1A 4ZRJA 3PVWA 1FGYA 4F7UP 3TO1A 2CRFA 1OMWA 4HB0B 2DTCA 5DH9B 2BCJA 1W1DA 3M1IB 3KRWA 4A6FB 2OQBA 3A8QA 2P0FA 1V5MA 2YVCA 5KQ4A 1UNPA 4DXAB 4EJNA 1W1HA 1J19A 4DBBA 1WJ1A 3BJIA 4KVGB 3NSUA 1BTNA 2YF0A 4K17A 4D0NB 2J0JA 1RRPB 2IFSA 5HE1A 2PZ1A 2Y8GA 2AEHA 1J0WA 5HE2A 1XKEA 2YSZA 5KQ1A 3MDBC 2W2XC 3QWMA 2Y8FA 4Z2MB 1V5PA 2MWNB 3DXDA 1WGQA 4BBKA 2YS5A 4MK0A 1BAKA 1EGXA 2YS3A 1H4RA 1X1FA 4TYZA 1XD4A 2DHKA 2GJYA 2EMTA 2Z0QA 4YONA 3A98B 1GC7A 1TXDA 2P8VA 3CXBB 1U2BA 1I2HA 1MAIA 4PNKA 4TKNA 2LYDA 1Q67A 5C5BB 2I1JA 2LOZA 1H10A 1WI1A 1E5WA 4K2PA 1RJ2A 4YL8A 5HE0A 1I7AA 3AU5A 5D27A 2DX5A 2ROZB 5C79A 2AL6A 4HAWB 4GPTB 1MPHA 2YRYA 2HTHB 1Y5OA 4HDOA 2CAYA 4HB2B 5DIFB 4KHAA 2ELAA 2JP2A 2N23A 3IVFA 1NU2A 1DBHA 3OANA 5J3QA 4GMXB 4H8SA 5L81A 1U27A 3SUZA 2DHJA 3PVLA 1FHXA 4IOYX 2MKRA 1NTVA 2HE7A 2H7EA 2COFA 2D10A 2P0DA 3DXCA 3QBVB 1WVHA 4HB3B 4DX8A 1K5GB 1WJMA 4ZRIA 4C0AA 1UNRA 4DX90 2Z0PA 2RNRB 5LONB 3HQCA 3ODWA 1DYNA 4HATB 4A5KA 3D8FA 3KSYA 2D2QA 2Z0OA 2COAA 1NI2A 2GCJA 1X86A 2LG1A 3KY9A 1FGZA 2UZSA 3AU4A 3O96A 2DX1A 1GG3A 4IFSA 5GOWB 1N3HA 1U5DA 5JHGA 2I5CA 3ULCA 1ZSQA 2ADZA 3UZTA 1FHOA 3PSCA 3ZVRA 1XCGA 5C16A 1V5UA 1EVHA 2I1KA 5KCVA 2DA0A 4HAVB 2W2WA 3U7DA 4K81A 3BINA 2KUPA 2N0YA 1NTYA 2L1CA 2J59M 5DHFB 2GCLA 4K2OA 1KZGA 3AJ4A 1QC6A 1X05A 5LOPB 1FOEA 1LW3A 2DHIA 1U29A 4IAPA 4WJ7A 5FI0A 2K2UA 2UVMA 2UZRA 3F5RA 3FEHA 2ELBA 3KZ1A 4HAZB 2LOXA 2Q13A 1K5DB 3SV1A 2OTXA 2D9ZA 2J0MA 2P0HA 2ROVA 1BTKA 4Z2NA 2QKLA 4KHBB 4HAUB 2M38A 4KHOA 5C6RA 3PEGA 1XX0A 4HDQA 2DLWA 2DFKA 4HHVA 4GN1A 3KRXA 1SHCA 2ZPYA 2DYQA 2D9YA 4MT7A 1M7EA 3QIJA 2LKOA 3ZDTA 5J3YA 3WYFB 3P6AA 5CLLB 4XWXA 4A6FA 4MY6A 1EF1A 5HE3A 3PP2A 1Z87A 2J0KA 1UNQA 1PMSA 3T06A 5C5BA 3TCAA 4CYEA 1DDMA 2D9XA 3G9WA 1UPQA 1U5GA 2VSZA 1EAZA 2MDXA 2CY4A 2D9WA 3SYXA 4HAXB 2YT0A 1ZM0A 2NMBA 3FM8C 2EJ8A 4B6HA 2R09A 4F7GA 5CLQB 1ISNA 3PZDA 3HK0A 4WSFA 5FI1A 1B55A 3ODOA 4CHMA 1PLSA 2QKMA 3GYPA 2DKPA 1FB8A
chains in the Genus database with same CATH superfamily
4NY0A 2COCA 2Z13A 2M14A 3F0WA 2RUKB 1AQCA 5DI9B 1MK7B 4Y94A 5D3VA 3HW2B 5D3XA 1KZ7A 1DROA 2K00A 4EKUA 1V61A 4EMOA 4HB4B 1U5FA 2YT2A 2DKQA 1V88A 3CIKA 1TQZA 1MK9B 3OHMB 1P6SA 3D8EA 3PVUA 2L2IA 1OQNA 1MIXA 5D3YA 1WG7A 2D4QA 4P7IA 4WVFB 1P5TA 4GXBA 3D8DA 3P7ZA 3SO6A 3RCPA 1UEFA 2H7DA 1DDVA 1FAOA 1ZVRA 3TFMA 1MIZB 5J3TA 1UPRA 5JHHA 2MFQA 1WGUA 3VOQA 2G35A 2R0DA 4L6EA 4ZRKA 5D3WA 4CHJA 2D11A 2Y7BA 2YT1A 4A6HA 1OY2A 1BWNA 1DDWA 1V89A 2RRFA 4KAXB 4OSNA 3V5WA 3U8ZA 3GYOA 4HAYB 2K2JA 1MKEA 2XQNM 1QQGA 1LB1A 2W2XD 2I5FA 2RSGA 1KI1B 2NZ8B 3X23A 3TVVA 3NW8A 3FSSA 2KGXB 3A8PA 2X18A 3VIAA 2RLOA 2RVBB 4PQ0A 1P3RA 1U5EA 3MPXA 1ZC3B 4GMVA 1ZC4B 2CY5A 2KUQA 5JP4A 4QJ5B 1XR0B 2CODA 1TJ6A 3PG7A 4D6WA 2Z59A 5EFXA 2VRWB 1GC6A 3WA0A 2V76A 4A6KA 5DHAB 2EC1A 1X1GA 3ULBA 2KCJA 3LJUX 4F7HA 3SNHA 2EMSA 2FJLA 2LULA 2D9VA 1PFJA 4NSWA 2E2XA 2GS0A 1Y19B 3N7CA 2DYNA 3TW1A 1X11A 2RGNB 1AWEA 2DN6A 1M7RA 2IYBA 1SGHA 3DXEA 2VKIA 1XODA 3ML4A 3ODXA 1IRSA 4GZUA 1W1GA 1FHWA 4CSQA 5JLJB 2YS1A 4ZRJA 3PVWA 1FGYA 4F7UP 3TO1A 2CRFA 1OMWA 4HB0B 2DTCA 5DH9B 2BCJA 1W1DA 3M1IB 3KRWA 4A6FB 2OQBA 3A8QA 2P0FA 1V5MA 2YVCA 5KQ4A 2GUMA 1UNPA 4DXAB 4EJNA 1W1HA 1J19A 4DBBA 1WJ1A 3BJIA 4KVGB 3NSUA 1BTNA 2YF0A 4K17A 4D0NB 2J0JA 1RRPB 2IFSA 5HE1A 2PZ1A 2Y8GA 2AEHA 1J0WA 5HE2A 1XKEA 4QXAB 2YSZA 5KQ1A 3MDBC 2W2XC 3QWMA 2Y8FA 4QJ4B 4Z2MB 1V5PA 2MWNB 3DCXA 3DXDA 1WGQA 4BBKA 2YS5A 4MK0A 1BAKA 4OT1A 1EGXA 2YS3A 1H4RA 1X1FA 4TYZA 1XD4A 2DHKA 2GJYA 2EMTA 2Z0QA 4YONA 3A98B 5IRSA 1GC7A 1TXDA 2P8VA 3CXBB 1U2BA 1I2HA 1MAIA 4PNKA 4TKNA 2LYDA 1Q67A 5C5BB 2I1JA 2LOZA 1H10A 1WI1A 1E5WA 4K2PA 1RJ2A 4YL8A 2KIGA 5HE0A 1I7AA 3AU5A 5D27A 2DX5A 2ROZB 4GOUA 2K49A 5C79A 2AL6A 4KHBA 4HAWB 4GPTB 1MPHA 2YRYA 2HTHB 1Y5OA 4GNKB 4HDOA 2CAYA 4HB2B 5DIFB 4KHAA 2ELAA 3HIEA 2JP2A 2N23A 2KR0A 3NWAA 3FVCA 3IVFA 1NU2A 1DBHA 3OANA 5J3QA 4GMXB 4H8SA 5L81A 1U27A 3SUZA 2DHJA 3PVLA 1FHXA 4IOYX 2K8EA 2MKRA 1NTVA 2HE7A 2H7EA 2COFA 2D10A 2P0DA 3DXCA 3QBVB 1WVHA 4HB3B 4DX8A 1K5GB 1WJMA 4ZRIA 4C0AA 1UNRA 4DX90 1MI1A 2Z0PA 2RNRB 5LONB 3HQCA 3ODWA 1DYNA 4HATB 4A5KA 4HSIA 3D8FA 3KSYA 2D2QA 3A58A 2Z0OA 4L1RA 2COAA 1NI2A 2GCJA 2ZKMX 1X86A 2LG1A 3KY9A 3NWDA 1FGZA 2UZSA 3AU4A 3O96A 2DX1A 1GG3A 4IFSA 5GOWB 1N3HA 1U5DA 5JHGA 2I5CA 3ULCA 1ZSQA 2ADZA 2KIEA 3UZTA 1FHOA 2Z4DA 3PSCA 5I2SA 3ZVRA 1XCGA 5C16A 1V5UA 1ZYIA 1EVHA 2I1KA 5KCVA 2DA0A 4HAVB 2W2WA 3U7DA 4K81A 3BINA 2KUPA 2N0YA 1NTYA 2L1CA 2J59M 1T77A 5DHFB 2GCLA 4K2OA 1KZGA 3AJ4A 1QC6A 1X05A 3HSAA 5LOPB 2NBVA 1FOEA 1LW3A 2DHIA 1U29A 4IAPA 4WJ7A 5FI0A 2K2UA 2UVMA 4QJ3B 2UZRA 3F5RA 3FEHA 2ELBA 3KZ1A 4HAZB 2LOXA 2Q13A 1K5DB 3SV1A 5M4YB 2OTXA 2Z14A 2D9ZA 2J0MA 2P0HA 2ROVA 1BTKA 4Z2NA 2QKLA 4KHBB 4HAUB 2M38A 4KHOA 5C6RA 3PEGA 1XX0A 4HDQA 2DLWA 2DFKA 4HHVA 4GN1A 3B77A 3KRXA 1SHCA 2ZPYA 2DYQA 2D9YA 4MT7A 1M7EA 3QIJA 2LKOA 3ZDTA 5J3YA 3WYFB 3P6AA 5CLLB 4XWXA 5LG4B 4DIXA 4A6FA 4MY6A 1EF1A 5HE3A 3PP2A 5I2MA 1Z87A 2J0KA 1UNQA 1PMSA 3T06A 5C5BA 3TCAA 4CYEA 1DDMA 2D9XA 3G9WA 3NWFA 1UPQA 2VSZA 1U5GA 2R2YA 1EAZA 2MDXA 2CY4A 2D9WA 3SYXA 4HAXB 3U12A 2YT0A 1ZM0A 2NMBA 3FM8C 2EJ8A 4B6HA 2R09A 4F7GA 2FJUB 5CLQB 1ISNA 3PZDA 3HK0A 4WSFA 5FI1A 1B55A 3ODOA 4CHMA 1PLSA 2QKMA 3GYPA 2DKPA 1FB8A
chains in the Genus database with same CATH topology
4NY0A 2COCA 2M14A 3F0WA 2RUKB 1AQCA 5DI9B 1MK7B 4Y94A 5D3VA 3HW2B 5D3XA 1KZ7A 1DROA 2K00A 4EKUA 1V61A 4EMOA 4HB4B 1U5FA 2DKQA 1V88A 3CIKA 1TQZA 1MK9B 1P6SA 3D8EA 3PVUA 2L2IA 1OQNA 1MIXA 5D3YA 1WG7A 2D4QA 4P7IA 4WVFB 1P5TA 4GXBA 3D8DA 3P7ZA 3SO6A 3RCPA 1UEFA 2H7DA 1DDVA 1FAOA 1ZVRA 3TFMA 1MIZB 5J3TA 1UPRA 5JHHA 2MFQA 1WGUA 3VOQA 2G35A 2R0DA 4L6EA 4ZRKA 5D3WA 4CHJA 2D11A 2Y7BA 2YT1A 4A6HA 1OY2A 1BWNA 1DDWA 1V89A 4KAXB 3V5WA 3U8ZA 3GYOA 4HAYB 2K2JA 1MKEA 2XQNM 1QQGA 1LB1A 2W2XD 2I5FA 2RSGA 1KI1B 2NZ8B 3X23A 3TVVA 3FSSA 2KGXB 3A8PA 2X18A 3VIAA 2RLOA 2RVBB 4PQ0A 1P3RA 1U5EA 3MPXA 1ZC3B 4GMVA 1ZC4B 2CY5A 5JP4A 1XR0B 2CODA 1TJ6A 3PG7A 5EFXA 2VRWB 1GC6A 3WA0A 2V76A 4A6KA 5DHAB 2EC1A 1X1GA 3ULBA 2KCJA 3LJUX 4F7HA 3SNHA 2EMSA 2FJLA 2LULA 2D9VA 1PFJA 4NSWA 2E2XA 2GS0A 1Y19B 3N7CA 2DYNA 3TW1A 1X11A 2RGNB 1AWEA 2DN6A 1M7RA 2IYBA 1SGHA 3DXEA 2VKIA 1XODA 3ML4A 3ODXA 1IRSA 4GZUA 1W1GA 1FHWA 5JLJB 2YS1A 4ZRJA 3PVWA 1FGYA 4F7UP 3TO1A 2CRFA 1OMWA 4HB0B 2DTCA 5DH9B 2BCJA 1W1DA 3M1IB 3KRWA 4A6FB 2OQBA 3A8QA 2P0FA 1V5MA 2YVCA 5KQ4A 1UNPA 4DXAB 4EJNA 1W1HA 1J19A 4DBBA 1WJ1A 3BJIA 4KVGB 3NSUA 1BTNA 2YF0A 4K17A 4D0NB 2J0JA 1RRPB 2IFSA 5HE1A 2PZ1A 2Y8GA 2AEHA 1J0WA 5HE2A 1XKEA 2YSZA 5KQ1A 3MDBC 2W2XC 3QWMA 2Y8FA 4Z2MB 1V5PA 2MWNB 3DXDA 1WGQA 4BBKA 2YS5A 4MK0A 1BAKA 1EGXA 2YS3A 1H4RA 1X1FA 4TYZA 1XD4A 2DHKA 2GJYA 2EMTA 2Z0QA 4YONA 3A98B 1GC7A 1TXDA 2P8VA 3CXBB 1U2BA 1I2HA 1MAIA 4PNKA 4TKNA 2LYDA 1Q67A 5C5BB 2I1JA 2LOZA 1H10A 1WI1A 1E5WA 4K2PA 1RJ2A 4YL8A 5HE0A 1I7AA 3AU5A 5D27A 2DX5A 2ROZB 5C79A 2AL6A 4HAWB 4GPTB 1MPHA 2YRYA 2HTHB 1Y5OA 4HDOA 2CAYA 4HB2B 5DIFB 4KHAA 2ELAA 2JP2A 2N23A 3IVFA 1NU2A 1DBHA 3OANA 5J3QA 4GMXB 4H8SA 5L81A 1U27A 3SUZA 2DHJA 3PVLA 1FHXA 4IOYX 2MKRA 1NTVA 2HE7A 2H7EA 2COFA 2D10A 2P0DA 3DXCA 3QBVB 1WVHA 4HB3B 4DX8A 1K5GB 1WJMA 4ZRIA 4C0AA 1UNRA 4DX90 2Z0PA 2RNRB 5LONB 3HQCA 3ODWA 1DYNA 4HATB 4A5KA 3D8FA 3KSYA 2D2QA 2Z0OA 2COAA 1NI2A 2GCJA 1X86A 2LG1A 3KY9A 1FGZA 2UZSA 3AU4A 3O96A 2DX1A 1GG3A 4IFSA 5GOWB 1N3HA 1U5DA 5JHGA 2I5CA 3ULCA 1ZSQA 2ADZA 3UZTA 1FHOA 3PSCA 3ZVRA 1XCGA 5C16A 1V5UA 1EVHA 2I1KA 5KCVA 2DA0A 4HAVB 2W2WA 3U7DA 4K81A 3BINA 2KUPA 2N0YA 1NTYA 2L1CA 2J59M 5DHFB 2GCLA 4K2OA 1KZGA 3AJ4A 1QC6A 1X05A 5LOPB 1FOEA 1LW3A 2DHIA 1U29A 4IAPA 4WJ7A 5FI0A 2K2UA 2UVMA 2UZRA 3F5RA 3FEHA 2ELBA 3KZ1A 4HAZB 2LOXA 2Q13A 1K5DB 3SV1A 2OTXA 2D9ZA 2J0MA 2P0HA 2ROVA 1BTKA 4Z2NA 2QKLA 4KHBB 4HAUB 2M38A 4KHOA 5C6RA 3PEGA 1XX0A 4HDQA 2DLWA 2DFKA 4HHVA 4GN1A 3KRXA 1SHCA 2ZPYA 2DYQA 2D9YA 4MT7A 1M7EA 3QIJA 2LKOA 3ZDTA 5J3YA 3WYFB 3P6AA 5CLLB 4XWXA 4A6FA 4MY6A 1EF1A 5HE3A 3PP2A 1Z87A 2J0KA 1UNQA 1PMSA 3T06A 5C5BA 3TCAA 4CYEA 1DDMA 2D9XA 3G9WA 1UPQA 1U5GA 2VSZA 1EAZA 2MDXA 2CY4A 2D9WA 3SYXA 4HAXB 2YT0A 1ZM0A 2NMBA 3FM8C 2EJ8A 4B6HA 2R09A 4F7GA 5CLQB 1ISNA 3PZDA 3HK0A 4WSFA 5FI1A 1B55A 3ODOA 4CHMA 1PLSA 2QKMA 3GYPA 2DKPA 1FB8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NY0 A;  2COC A;  2M14 A;  3F0W A;  2RUK B;  1AQC A;  5DI9 B;  1MK7 B;  4Y94 A;  5D3V A;  3HW2 B;  5D3X A;  1KZ7 A;  1DRO A;  2K00 A;  4EKU A;  1V61 A;  4EMO A;  4HB4 B;  1U5F A;  2DKQ A;  1V88 A;  3CIK A;  1TQZ A;  1MK9 B;  1P6S A;  3D8E A;  3PVU A;  2L2I A;  1OQN A;  1MIX A;  5D3Y A;  1WG7 A;  2D4Q A;  4P7I A;  4WVF B;  1P5T A;  4GXB A;  3D8D A;  3P7Z A;  3SO6 A;  3RCP A;  1UEF A;  2H7D A;  1DDV A;  1FAO A;  1ZVR A;  3TFM A;  1MIZ B;  5J3T A;  1UPR A;  5JHH A;  2MFQ A;  1WGU A;  3VOQ A;  2G35 A;  2R0D A;  4L6E A;  4ZRK A;  5D3W A;  4CHJ A;  2D11 A;  2Y7B A;  2YT1 A;  4A6H A;  1OY2 A;  1BWN A;  1DDW A;  1V89 A;  4KAX B;  3V5W A;  3U8Z A;  3GYO A;  4HAY B;  2K2J A;  1MKE A;  2XQN M;  1QQG A;  1LB1 A;  2W2X D;  2I5F A;  2RSG A;  1KI1 B;  2NZ8 B;  3X23 A;  3TVV A;  3FSS A;  2KGX B;  3A8P A;  2X18 A;  3VIA A;  2RLO A;  2RVB B;  4PQ0 A;  1P3R A;  1U5E A;  3MPX A;  1ZC3 B;  4GMV A;  1ZC4 B;  2CY5 A;  5JP4 A;  1XR0 B;  2COD A;  1TJ6 A;  3PG7 A;  5EFX A;  2VRW B;  1GC6 A;  3WA0 A;  2V76 A;  4A6K A;  5DHA B;  2EC1 A;  1X1G A;  3ULB A;  2KCJ A;  3LJU X;  4F7H A;  3SNH A;  2EMS A;  2FJL A;  2LUL A;  2D9V A;  1PFJ A;  4NSW A;  2E2X A;  2GS0 A;  1Y19 B;  3N7C A;  2DYN A;  3TW1 A;  1X11 A;  2RGN B;  1AWE A;  2DN6 A;  1M7R A;  2IYB A;  1SGH A;  3DXE A;  2VKI A;  1XOD A;  3ML4 A;  3ODX A;  1IRS A;  4GZU A;  1W1G A;  1FHW A;  5JLJ B;  2YS1 A;  4ZRJ A;  3PVW A;  1FGY A;  4F7U P;  3TO1 A;  2CRF A;  1OMW A;  4HB0 B;  2DTC A;  5DH9 B;  2BCJ A;  1W1D A;  3M1I B;  3KRW A;  4A6F B;  2OQB A;  3A8Q A;  2P0F A;  1V5M A;  2YVC A;  5KQ4 A;  1UNP A;  4DXA B;  4EJN A;  1W1H A;  1J19 A;  4DBB A;  1WJ1 A;  3BJI A;  4KVG B;  3NSU A;  1BTN A;  2YF0 A;  4K17 A;  4D0N B;  2J0J A;  1RRP B;  2IFS A;  5HE1 A;  2PZ1 A;  2Y8G A;  2AEH A;  1J0W A;  5HE2 A;  1XKE A;  2YSZ A;  5KQ1 A;  3MDB C;  2W2X C;  3QWM A;  2Y8F A;  4Z2M B;  1V5P A;  2MWN B;  3DXD A;  1WGQ A;  4BBK A;  2YS5 A;  4MK0 A;  1BAK A;  1EGX A;  2YS3 A;  1H4R A;  1X1F A;  4TYZ A;  1XD4 A;  2DHK A;  2GJY A;  2EMT A;  2Z0Q A;  4YON A;  3A98 B;  1GC7 A;  1TXD A;  2P8V A;  3CXB B;  1U2B A;  1I2H A;  1MAI A;  4PNK A;  4TKN A;  2LYD A;  1Q67 A;  5C5B B;  2I1J A;  2LOZ A;  1H10 A;  1WI1 A;  1E5W A;  4K2P A;  1RJ2 A;  4YL8 A;  5HE0 A;  1I7A A;  3AU5 A;  5D27 A;  2DX5 A;  2ROZ B;  5C79 A;  2AL6 A;  4HAW B;  4GPT B;  1MPH A;  2YRY A;  2HTH B;  1Y5O A;  4HDO A;  2CAY A;  4HB2 B;  5DIF B;  4KHA A;  2ELA A;  2JP2 A;  2N23 A;  3IVF A;  1NU2 A;  1DBH A;  3OAN A;  5J3Q A;  4GMX B;  4H8S A;  5L81 A;  1U27 A;  3SUZ A;  2DHJ A;  3PVL A;  1FHX A;  4IOY X;  2MKR A;  1NTV A;  2HE7 A;  2H7E A;  2COF A;  2D10 A;  2P0D A;  3DXC A;  3QBV B;  1WVH A;  4HB3 B;  4DX8 A;  1K5G B;  1WJM A;  4ZRI A;  4C0A A;  1UNR A;  4DX9 0;  2Z0P A;  2RNR B;  5LON B;  3HQC A;  3ODW A;  1DYN A;  4HAT B;  4A5K A;  3D8F A;  3KSY A;  2D2Q A;  2Z0O A;  2COA A;  1NI2 A;  2GCJ A;  1X86 A;  2LG1 A;  3KY9 A;  1FGZ A;  2UZS A;  3AU4 A;  3O96 A;  2DX1 A;  1GG3 A;  4IFS A;  5GOW B;  1N3H A;  1U5D A;  5JHG A;  2I5C A;  3ULC A;  1ZSQ A;  2ADZ A;  3UZT A;  1FHO A;  3PSC A;  3ZVR A;  1XCG A;  5C16 A;  1V5U A;  1EVH A;  2I1K A;  5KCV A;  2DA0 A;  4HAV B;  2W2W A;  3U7D A;  4K81 A;  3BIN A;  2KUP A;  2N0Y A;  1NTY A;  2L1C A;  2J59 M;  5DHF B;  2GCL A;  4K2O A;  1KZG A;  3AJ4 A;  1QC6 A;  1X05 A;  5LOP B;  1FOE A;  1LW3 A;  2DHI A;  1U29 A;  4IAP A;  4WJ7 A;  5FI0 A;  2K2U A;  2UVM A;  2UZR A;  3F5R A;  3FEH A;  2ELB A;  3KZ1 A;  4HAZ B;  2LOX A;  2Q13 A;  1K5D B;  3SV1 A;  2OTX A;  2D9Z A;  2J0M A;  2P0H A;  2ROV A;  1BTK A;  4Z2N A;  2QKL A;  4KHB B;  4HAU B;  2M38 A;  4KHO A;  5C6R A;  3PEG A;  1XX0 A;  4HDQ A;  2DLW A;  2DFK A;  4HHV A;  4GN1 A;  3KRX A;  1SHC A;  2ZPY A;  2DYQ A;  2D9Y A;  4MT7 A;  1M7E A;  3QIJ A;  2LKO A;  3ZDT A;  5J3Y A;  3WYF B;  3P6A A;  5CLL B;  4XWX A;  4A6F A;  4MY6 A;  1EF1 A;  5HE3 A;  3PP2 A;  1Z87 A;  2J0K A;  1UNQ A;  1PMS A;  3T06 A;  5C5B A;  3TCA A;  4CYE A;  1DDM A;  2D9X A;  3G9W A;  1UPQ A;  1U5G A;  2VSZ A;  1EAZ A;  2MDX A;  2CY4 A;  2D9W A;  3SYX A;  4HAX B;  2YT0 A;  1ZM0 A;  2NMB A;  3FM8 C;  2EJ8 A;  4B6H A;  2R09 A;  4F7G A;  5CLQ B;  1ISN A;  3PZD A;  3HK0 A;  4WSF A;  5FI1 A;  1B55 A;  3ODO A;  4CHM A;  1PLS A;  2QKM A;  3GYP A;  2DKP A;  1FB8 A; 
#chains in the Genus database with same CATH topology
 4NY0 A;  2COC A;  2Z13 A;  2M14 A;  3F0W A;  2RUK B;  1AQC A;  5DI9 B;  1MK7 B;  4Y94 A;  5D3V A;  3HW2 B;  5D3X A;  1KZ7 A;  1DRO A;  2K00 A;  4EKU A;  1V61 A;  4EMO A;  4HB4 B;  1U5F A;  2YT2 A;  2DKQ A;  1V88 A;  3CIK A;  1TQZ A;  1MK9 B;  3OHM B;  1P6S A;  3D8E A;  3PVU A;  2L2I A;  1OQN A;  1MIX A;  5D3Y A;  1WG7 A;  2D4Q A;  4P7I A;  4WVF B;  1P5T A;  4GXB A;  3D8D A;  3P7Z A;  3SO6 A;  3RCP A;  1UEF A;  2H7D A;  1DDV A;  1FAO A;  1ZVR A;  3TFM A;  1MIZ B;  5J3T A;  1UPR A;  5JHH A;  2MFQ A;  1WGU A;  3VOQ A;  2G35 A;  2R0D A;  4L6E A;  4ZRK A;  5D3W A;  4CHJ A;  2D11 A;  2Y7B A;  2YT1 A;  4A6H A;  1OY2 A;  1BWN A;  1DDW A;  1V89 A;  2RRF A;  4KAX B;  4OSN A;  3V5W A;  3U8Z A;  3GYO A;  4HAY B;  2K2J A;  1MKE A;  2XQN M;  1QQG A;  1LB1 A;  2W2X D;  2I5F A;  2RSG A;  1KI1 B;  2NZ8 B;  3X23 A;  3TVV A;  3NW8 A;  3FSS A;  2KGX B;  3A8P A;  2X18 A;  3VIA A;  2RLO A;  2RVB B;  4PQ0 A;  1P3R A;  1U5E A;  3MPX A;  1ZC3 B;  4GMV A;  1ZC4 B;  2CY5 A;  2KUQ A;  5JP4 A;  4QJ5 B;  1XR0 B;  2COD A;  1TJ6 A;  3PG7 A;  4D6W A;  2Z59 A;  5EFX A;  2VRW B;  1GC6 A;  3WA0 A;  2V76 A;  4A6K A;  5DHA B;  2EC1 A;  1X1G A;  3ULB A;  2KCJ A;  3LJU X;  4F7H A;  3SNH A;  2EMS A;  2FJL A;  2LUL A;  2D9V A;  1PFJ A;  4NSW A;  2E2X A;  2GS0 A;  1Y19 B;  3N7C A;  2DYN A;  3TW1 A;  1X11 A;  2RGN B;  1AWE A;  2DN6 A;  1M7R A;  2IYB A;  1SGH A;  3DXE A;  2VKI A;  1XOD A;  3ML4 A;  3ODX A;  1IRS A;  4GZU A;  1W1G A;  1FHW A;  4CSQ A;  5JLJ B;  2YS1 A;  4ZRJ A;  3PVW A;  1FGY A;  4F7U P;  3TO1 A;  2CRF A;  1OMW A;  4HB0 B;  2DTC A;  5DH9 B;  2BCJ A;  1W1D A;  3M1I B;  3KRW A;  4A6F B;  2OQB A;  3A8Q A;  2P0F A;  1V5M A;  2YVC A;  5KQ4 A;  2GUM A;  1UNP A;  4DXA B;  4EJN A;  1W1H A;  1J19 A;  4DBB A;  1WJ1 A;  3BJI A;  4KVG B;  3NSU A;  1BTN A;  2YF0 A;  4K17 A;  4D0N B;  2J0J A;  1RRP B;  2IFS A;  5HE1 A;  2PZ1 A;  2Y8G A;  2AEH A;  1J0W A;  5HE2 A;  1XKE A;  4QXA B;  2YSZ A;  5KQ1 A;  3MDB C;  2W2X C;  3QWM A;  2Y8F A;  4QJ4 B;  4Z2M B;  1V5P A;  2MWN B;  3DCX A;  3DXD A;  1WGQ A;  4BBK A;  2YS5 A;  4MK0 A;  1BAK A;  4OT1 A;  1EGX A;  2YS3 A;  1H4R A;  1X1F A;  4TYZ A;  1XD4 A;  2DHK A;  2GJY A;  2EMT A;  2Z0Q A;  4YON A;  3A98 B;  5IRS A;  1GC7 A;  1TXD A;  2P8V A;  3CXB B;  1U2B A;  1I2H A;  1MAI A;  4PNK A;  4TKN A;  2LYD A;  1Q67 A;  5C5B B;  2I1J A;  2LOZ A;  1H10 A;  1WI1 A;  1E5W A;  4K2P A;  1RJ2 A;  4YL8 A;  2KIG A;  5HE0 A;  1I7A A;  3AU5 A;  5D27 A;  2DX5 A;  2ROZ B;  4GOU A;  2K49 A;  5C79 A;  2AL6 A;  4KHB A;  4HAW B;  4GPT B;  1MPH A;  2YRY A;  2HTH B;  1Y5O A;  4GNK B;  4HDO A;  2CAY A;  4HB2 B;  5DIF B;  4KHA A;  2ELA A;  3HIE A;  2JP2 A;  2N23 A;  2KR0 A;  3NWA A;  3FVC A;  3IVF A;  1NU2 A;  1DBH A;  3OAN A;  5J3Q A;  4GMX B;  4H8S A;  5L81 A;  1U27 A;  3SUZ A;  2DHJ A;  3PVL A;  1FHX A;  4IOY X;  2K8E A;  2MKR A;  1NTV A;  2HE7 A;  2H7E A;  2COF A;  2D10 A;  2P0D A;  3DXC A;  3QBV B;  1WVH A;  4HB3 B;  4DX8 A;  1K5G B;  1WJM A;  4ZRI A;  4C0A A;  1UNR A;  4DX9 0;  1MI1 A;  2Z0P A;  2RNR B;  5LON B;  3HQC A;  3ODW A;  1DYN A;  4HAT B;  4A5K A;  4HSI A;  3D8F A;  3KSY A;  2D2Q A;  3A58 A;  2Z0O A;  4L1R A;  2COA A;  1NI2 A;  2GCJ A;  2ZKM X;  1X86 A;  2LG1 A;  3KY9 A;  3NWD A;  1FGZ A;  2UZS A;  3AU4 A;  3O96 A;  2DX1 A;  1GG3 A;  4IFS A;  5GOW B;  1N3H A;  1U5D A;  5JHG A;  2I5C A;  3ULC A;  1ZSQ A;  2ADZ A;  2KIE A;  3UZT A;  1FHO A;  2Z4D A;  3PSC A;  5I2S A;  3ZVR A;  1XCG A;  5C16 A;  1V5U A;  1ZYI A;  1EVH A;  2I1K A;  5KCV A;  2DA0 A;  4HAV B;  2W2W A;  3U7D A;  4K81 A;  3BIN A;  2KUP A;  2N0Y A;  1NTY A;  2L1C A;  2J59 M;  1T77 A;  5DHF B;  2GCL A;  4K2O A;  1KZG A;  3AJ4 A;  1QC6 A;  1X05 A;  3HSA A;  5LOP B;  2NBV A;  1FOE A;  1LW3 A;  2DHI A;  1U29 A;  4IAP A;  4WJ7 A;  5FI0 A;  2K2U A;  2UVM A;  4QJ3 B;  2UZR A;  3F5R A;  3FEH A;  2ELB A;  3KZ1 A;  4HAZ B;  2LOX A;  2Q13 A;  1K5D B;  3SV1 A;  5M4Y B;  2OTX A;  2Z14 A;  2D9Z A;  2J0M A;  2P0H A;  2ROV A;  1BTK A;  4Z2N A;  2QKL A;  4KHB B;  4HAU B;  2M38 A;  4KHO A;  5C6R A;  3PEG A;  1XX0 A;  4HDQ A;  2DLW A;  2DFK A;  4HHV A;  4GN1 A;  3B77 A;  3KRX A;  1SHC A;  2ZPY A;  2DYQ A;  2D9Y A;  4MT7 A;  1M7E A;  3QIJ A;  2LKO A;  3ZDT A;  5J3Y A;  3WYF B;  3P6A A;  5CLL B;  4XWX A;  5LG4 B;  4DIX A;  4A6F A;  4MY6 A;  1EF1 A;  5HE3 A;  3PP2 A;  5I2M A;  1Z87 A;  2J0K A;  1UNQ A;  1PMS A;  3T06 A;  5C5B A;  3TCA A;  4CYE A;  1DDM A;  2D9X A;  3G9W A;  3NWF A;  1UPQ A;  2VSZ A;  1U5G A;  2R2Y A;  1EAZ A;  2MDX A;  2CY4 A;  2D9W A;  3SYX A;  4HAX B;  3U12 A;  2YT0 A;  1ZM0 A;  2NMB A;  3FM8 C;  2EJ8 A;  4B6H A;  2R09 A;  4F7G A;  2FJU B;  5CLQ B;  1ISN A;  3PZD A;  3HK0 A;  4WSF A;  5FI1 A;  1B55 A;  3ODO A;  4CHM A;  1PLS A;  2QKM A;  3GYP A;  2DKP A;  1FB8 A; 
#chains in the Genus database with same CATH homology
 4NY0 A;  2COC A;  2M14 A;  3F0W A;  2RUK B;  1AQC A;  5DI9 B;  1MK7 B;  4Y94 A;  5D3V A;  3HW2 B;  5D3X A;  1KZ7 A;  1DRO A;  2K00 A;  4EKU A;  1V61 A;  4EMO A;  4HB4 B;  1U5F A;  2DKQ A;  1V88 A;  3CIK A;  1TQZ A;  1MK9 B;  1P6S A;  3D8E A;  3PVU A;  2L2I A;  1OQN A;  1MIX A;  5D3Y A;  1WG7 A;  2D4Q A;  4P7I A;  4WVF B;  1P5T A;  4GXB A;  3D8D A;  3P7Z A;  3SO6 A;  3RCP A;  1UEF A;  2H7D A;  1DDV A;  1FAO A;  1ZVR A;  3TFM A;  1MIZ B;  5J3T A;  1UPR A;  5JHH A;  2MFQ A;  1WGU A;  3VOQ A;  2G35 A;  2R0D A;  4L6E A;  4ZRK A;  5D3W A;  4CHJ A;  2D11 A;  2Y7B A;  2YT1 A;  4A6H A;  1OY2 A;  1BWN A;  1DDW A;  1V89 A;  4KAX B;  3V5W A;  3U8Z A;  3GYO A;  4HAY B;  2K2J A;  1MKE A;  2XQN M;  1QQG A;  1LB1 A;  2W2X D;  2I5F A;  2RSG A;  1KI1 B;  2NZ8 B;  3X23 A;  3TVV A;  3FSS A;  2KGX B;  3A8P A;  2X18 A;  3VIA A;  2RLO A;  2RVB B;  4PQ0 A;  1P3R A;  1U5E A;  3MPX A;  1ZC3 B;  4GMV A;  1ZC4 B;  2CY5 A;  5JP4 A;  1XR0 B;  2COD A;  1TJ6 A;  3PG7 A;  5EFX A;  2VRW B;  1GC6 A;  3WA0 A;  2V76 A;  4A6K A;  5DHA B;  2EC1 A;  1X1G A;  3ULB A;  2KCJ A;  3LJU X;  4F7H A;  3SNH A;  2EMS A;  2FJL A;  2LUL A;  2D9V A;  1PFJ A;  4NSW A;  2E2X A;  2GS0 A;  1Y19 B;  3N7C A;  2DYN A;  3TW1 A;  1X11 A;  2RGN B;  1AWE A;  2DN6 A;  1M7R A;  2IYB A;  1SGH A;  3DXE A;  2VKI A;  1XOD A;  3ML4 A;  3ODX A;  1IRS A;  4GZU A;  1W1G A;  1FHW A;  5JLJ B;  2YS1 A;  4ZRJ A;  3PVW A;  1FGY A;  4F7U P;  3TO1 A;  2CRF A;  1OMW A;  4HB0 B;  2DTC A;  5DH9 B;  2BCJ A;  1W1D A;  3M1I B;  3KRW A;  4A6F B;  2OQB A;  3A8Q A;  2P0F A;  1V5M A;  2YVC A;  5KQ4 A;  1UNP A;  4DXA B;  4EJN A;  1W1H A;  1J19 A;  4DBB A;  1WJ1 A;  3BJI A;  4KVG B;  3NSU A;  1BTN A;  2YF0 A;  4K17 A;  4D0N B;  2J0J A;  1RRP B;  2IFS A;  5HE1 A;  2PZ1 A;  2Y8G A;  2AEH A;  1J0W A;  5HE2 A;  1XKE A;  2YSZ A;  5KQ1 A;  3MDB C;  2W2X C;  3QWM A;  2Y8F A;  4Z2M B;  1V5P A;  2MWN B;  3DXD A;  1WGQ A;  4BBK A;  2YS5 A;  4MK0 A;  1BAK A;  1EGX A;  2YS3 A;  1H4R A;  1X1F A;  4TYZ A;  1XD4 A;  2DHK A;  2GJY A;  2EMT A;  2Z0Q A;  4YON A;  3A98 B;  1GC7 A;  1TXD A;  2P8V A;  3CXB B;  1U2B A;  1I2H A;  1MAI A;  4PNK A;  4TKN A;  2LYD A;  1Q67 A;  5C5B B;  2I1J A;  2LOZ A;  1H10 A;  1WI1 A;  1E5W A;  4K2P A;  1RJ2 A;  4YL8 A;  5HE0 A;  1I7A A;  3AU5 A;  5D27 A;  2DX5 A;  2ROZ B;  5C79 A;  2AL6 A;  4HAW B;  4GPT B;  1MPH A;  2YRY A;  2HTH B;  1Y5O A;  4HDO A;  2CAY A;  4HB2 B;  5DIF B;  4KHA A;  2ELA A;  2JP2 A;  2N23 A;  3IVF A;  1NU2 A;  1DBH A;  3OAN A;  5J3Q A;  4GMX B;  4H8S A;  5L81 A;  1U27 A;  3SUZ A;  2DHJ A;  3PVL A;  1FHX A;  4IOY X;  2MKR A;  1NTV A;  2HE7 A;  2H7E A;  2COF A;  2D10 A;  2P0D A;  3DXC A;  3QBV B;  1WVH A;  4HB3 B;  4DX8 A;  1K5G B;  1WJM A;  4ZRI A;  4C0A A;  1UNR A;  4DX9 0;  2Z0P A;  2RNR B;  5LON B;  3HQC A;  3ODW A;  1DYN A;  4HAT B;  4A5K A;  3D8F A;  3KSY A;  2D2Q A;  2Z0O A;  2COA A;  1NI2 A;  2GCJ A;  1X86 A;  2LG1 A;  3KY9 A;  1FGZ A;  2UZS A;  3AU4 A;  3O96 A;  2DX1 A;  1GG3 A;  4IFS A;  5GOW B;  1N3H A;  1U5D A;  5JHG A;  2I5C A;  3ULC A;  1ZSQ A;  2ADZ A;  3UZT A;  1FHO A;  3PSC A;  3ZVR A;  1XCG A;  5C16 A;  1V5U A;  1EVH A;  2I1K A;  5KCV A;  2DA0 A;  4HAV B;  2W2W A;  3U7D A;  4K81 A;  3BIN A;  2KUP A;  2N0Y A;  1NTY A;  2L1C A;  2J59 M;  5DHF B;  2GCL A;  4K2O A;  1KZG A;  3AJ4 A;  1QC6 A;  1X05 A;  5LOP B;  1FOE A;  1LW3 A;  2DHI A;  1U29 A;  4IAP A;  4WJ7 A;  5FI0 A;  2K2U A;  2UVM A;  2UZR A;  3F5R A;  3FEH A;  2ELB A;  3KZ1 A;  4HAZ B;  2LOX A;  2Q13 A;  1K5D B;  3SV1 A;  2OTX A;  2D9Z A;  2J0M A;  2P0H A;  2ROV A;  1BTK A;  4Z2N A;  2QKL A;  4KHB B;  4HAU B;  2M38 A;  4KHO A;  5C6R A;  3PEG A;  1XX0 A;  4HDQ A;  2DLW A;  2DFK A;  4HHV A;  4GN1 A;  3KRX A;  1SHC A;  2ZPY A;  2DYQ A;  2D9Y A;  4MT7 A;  1M7E A;  3QIJ A;  2LKO A;  3ZDT A;  5J3Y A;  3WYF B;  3P6A A;  5CLL B;  4XWX A;  4A6F A;  4MY6 A;  1EF1 A;  5HE3 A;  3PP2 A;  1Z87 A;  2J0K A;  1UNQ A;  1PMS A;  3T06 A;  5C5B A;  3TCA A;  4CYE A;  1DDM A;  2D9X A;  3G9W A;  1UPQ A;  1U5G A;  2VSZ A;  1EAZ A;  2MDX A;  2CY4 A;  2D9W A;  3SYX A;  4HAX B;  2YT0 A;  1ZM0 A;  2NMB A;  3FM8 C;  2EJ8 A;  4B6H A;  2R09 A;  4F7G A;  5CLQ B;  1ISN A;  3PZD A;  3HK0 A;  4WSF A;  5FI1 A;  1B55 A;  3ODO A;  4CHM A;  1PLS A;  2QKM A;  3GYP A;  2DKP A;  1FB8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...