1FB8A

Structure of the pleckstrin homology domain from dapp1/phish
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
106
structure length
106
Chain Sequence
b'LVPTAPSLGTKEGYLTKQGGLVKTWKTRWFTLHRNELKYFKDQMSPEPIRILDLTECSAVQFDYSQERVNCFCLVFPFRTFYLCAKTGVEADEWIKILRWKLSQIR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DUAL ADAPTOR OF PHOSPHOTYROSINE AND 3-PHOSPHOINOSITIDES
publication title Structural basis for discrimination of 3-phosphoinositides by pleckstrin homology domains.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 20
structure length 106
sequence length 106
ec nomenclature
pdb deposition date 2000-07-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00169 PH PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1fb8A00
5DIFB 3D8EA 2KCJA 1FB8A 4ZRKA 1LW3A 4KVGB 4YL8A 3A8PA 3ZVRA 1WGQA 2DYQA 1KZGA 1DBHA 1BTNA 1Y5OA 2DX5A 3A98B 2YVCA 1PMSA 4F7GA 2K2JA 1WGUA 1X86A 1GC7A 1M7EA 2W2XD 4K81A 4H8SA 5D27A 1MK9B 2RNRB 4A6FA 5J3YA 2IFSA 2FJLA 1Y19B 2RGNB 2UVMA 4XWXA 1UNQA 1XODA 2HTHB 1J0WA 2MWNB 1XD4A 2EMSA 2ELBA 2L2IA 4Y94A 1UNPA 4MT7A 3SUZA 3M1IB 4ZRIA 5LONB 2Z0QA 1M7RA 3DXDA 2OTXA 4GMVA 1LB1A 1DYNA 4K17A 3ODXA 1E5WA 4KAXB 4DXAB 1NTYA 1UPQA 1WVHA 2OQBA 4HDOA 3T06A 4GXBA 4CHJA 1WJ1A 1X11A 3ODOA 1QQGA 2QKLA 1AQCA 4Z2MB 4GN1A 4CHMA 3FEHA 1WJMA 4HAVB 2COCA 1ISNA 3PSCA 5C5BB 3TO1A 4F7HA 2DHIA 3U8ZA 2M14A 2DTCA 3QIJA 1BTKA 3BJIA 2BCJA 2GS0A 2N0YA 2E2XA 4K2PA 2MFQA 1H4RA 1WG7A 3A8QA 2X18A 3KSYA 4KHAA 3PG7A 2XQNM 1TQZA 1Q67A 5GOWB 2L1CA 2ROZB 1BWNA 1UPRA 1XCGA 2G35A 1FHXA 1TJ6A 1U5DA 4Z2NA 3IVFA 1OQNA 2YSZA 4DX90 5LOPB 2LOXA 3D8DA 1B55A 1UNRA 4HAYB 1K5GB 2DLWA 1K5DB 2Y8FA 4HHVA 1N3HA 2LKOA 4HATB 2VSZA 1J19A 4HAWB 1NTVA 3ULBA 2Z0PA 3KZ1A 3ODWA 5D3XA 3TW1A 1MPHA 3F0WA 2R0DA 3KY9A 2Z0OA 4HAUB 2QKMA 2PZ1A 4WSFA 2KGXB 4HAXB 1EF1A 5HE2A 1V89A 1ZVRA 3QBVB 1U5EA 3GYOA 5CLQB 1AWEA 4HB2B 2YT0A 4EKUA 4GMXB 2GCJA 3AJ4A 2GCLA 2LOZA 3PP2A 2CODA 4EJNA 4KHOA 2UZSA 4B6HA 5JHHA 1FGYA 3SV1A 3SYXA 4WVFB 1U5GA 2D9ZA 2DA0A 1DROA 1X05A 1X1FA 3TVVA 3AU5A 3GYPA 2P0HA 3D8FA 2J0MA 1SGHA 3AU4A 2K00A 2W2WA 1FOEA 1V5MA 3CIKA 1Z87A 2EMTA 5C6RA 5EFXA 1U2BA 4NY0A 1V5PA 2DFKA 1EAZA 1ZC4B 3P6AA 1GG3A 2I1JA 3PVWA 3PVUA 4YONA 3ULCA 4A6HA 4BBKA 5CLLB 2DYNA 2ZPYA 1SHCA 4TYZA 2CRFA 2LG1A 2D9YA 4NSWA 3P7ZA 2Q13A 5HE3A 3MDBC 3QWMA 1FAOA 2Y7BA 2YRYA 3F5RA 4GZUA 2YS1A 4IAPA 5HE1A 4P7IA 2J0JA 5KCVA 1OY2A 3V5WA 1WI1A 4K2OA 4WJ7A 2COAA 1TXDA 1P5TA 4L6EA 1EVHA 2K2UA 4A6FB 4IFSA 1FHOA 3PZDA 2RVBB 5JHGA 2P0DA 2D11A 1FHWA 1V5UA 5DI9B 3KRXA 4C0AA 3BINA 2D9VA 1I2HA 2EC1A 1XX0A 2R09A 1XR0B 2MDXA 4MY6A 2DN6A 3OANA 1QC6A 1ZM0A 2ELAA 2H7EA 5DHFB 2HE7A 1UEFA 2CY5A 3KRWA 1V88A 1W1GA 1DDMA 2D4QA 3G9WA 2N23A 5C5BA 3PVLA 1RRPB 3UZTA 3FM8C 3MPXA 3HK0A 1PFJA 3CXBB 1NU2A 4A6KA 3VOQA 2I5CA 2DHJA 5FI0A 2VRWB 5D3YA 2YS5A 1MAIA 4EMOA 2CAYA 2DHKA 2J0KA 3LJUX 2LULA 4CYEA 3ZDTA 1H10A 4KHBB 5JP4A 5FI1A 3TCAA 2AL6A 2V76A 5KQ4A 1XKEA 1P3RA 2RSGA 4IOYX 2AEHA 2COFA 3VIAA 2D9XA 2P0FA 3TFMA 2CY4A 4DBBA 2LYDA 4HAZB 5JLJB 3ML4A 4ZRJA 2J59M 5D3VA 1ZC3B 4DX8A 1MK7B 2MKRA 2D9WA 2IYBA 1GC6A 5L81A 3DXEA 5C16A 3HW2B 5KQ1A 2JP2A 1W1DA 2P8VA 2RUKB 2ROVA 1DDVA 2I5FA 3N7CA 1EGXA 1U29A 1I7AA 2YT1A 4D0NB 5HE0A 1KZ7A 2YS3A 1U27A 2GJYA 5J3TA 1OMWA 3DXCA 2M38A 2NMBA 5D3WA 3RCPA 3U7DA 3HQCA 4TKNA 5J3QA 1P6SA 3FSSA 1MIXA 2UZRA 1RJ2A 2KUPA 3O96A 5C79A 2Y8GA 4PQ0A 5DH9B 2RLOA 3X23A 1KI1B 2W2XC 2ADZA 1X1GA 4HB3B 1V61A 4HDQA 3PEGA 2DKPA 1W1HA 2DX1A 1IRSA 1MIZB 1ZSQA 1MKEA 1BAKA 3SNHA 1NI2A 3WYFB 1U5FA 2I1KA 4HB4B 1DDWA 2H7DA 2NZ8B 2DKQA 2YF0A 1PLSA 4GPTB 1FGZA 3WA0A 2EJ8A 4A5KA 2D10A 4MK0A 3SO6A 3NSUA 4PNKA 5DHAB 4F7UP 2VKIA 2D2QA 4HB0B
chains in the Genus database with same CATH superfamily
5DIFB 3D8EA 2KCJA 1FB8A 4ZRKA 1LW3A 4KVGB 4YL8A 3A8PA 3ZVRA 1WGQA 2DYQA 1KZGA 1DBHA 1BTNA 2R2YA 1Y5OA 2DX5A 4OT1A 3A98B 2YVCA 1PMSA 4F7GA 2K2JA 1WGUA 1X86A 2FJUB 1GC7A 1M7EA 2W2XD 4K81A 2Z4DA 4H8SA 5D27A 1MK9B 2RNRB 4A6FA 5J3YA 2IFSA 2ZKMX 2FJLA 1Y19B 2RGNB 2UVMA 4XWXA 1UNQA 3B77A 1XODA 2HTHB 4DIXA 3NW8A 1J0WA 2MWNB 1XD4A 2EMSA 2ELBA 2L2IA 4Y94A 1UNPA 4MT7A 3SUZA 3M1IB 4ZRIA 5LONB 2Z0QA 1M7RA 3DXDA 2OTXA 4GMVA 1LB1A 1DYNA 4K17A 3ODXA 1E5WA 4KAXB 4DXAB 1NTYA 1UPQA 1WVHA 2OQBA 4HDOA 4QXAB 3T06A 4GXBA 4CHJA 1WJ1A 1X11A 2KIGA 3ODOA 1QQGA 2QKLA 1AQCA 4Z2MB 2Z13A 4GN1A 4CHMA 3FEHA 1WJMA 4HAVB 2COCA 3U12A 1ISNA 4HSIA 3PSCA 5C5BB 4KHBA 3TO1A 4F7HA 2DHIA 3U8ZA 2M14A 2DTCA 3QIJA 1BTKA 3BJIA 2BCJA 2GS0A 2N0YA 2E2XA 4K2PA 2YT2A 2MFQA 1H4RA 1WG7A 3A8QA 2X18A 3KSYA 4KHAA 3PG7A 2XQNM 1TQZA 1Q67A 5GOWB 2L1CA 2ROZB 1BWNA 1UPRA 1XCGA 2G35A 1FHXA 1TJ6A 1U5DA 4Z2NA 3IVFA 4CSQA 1OQNA 2YSZA 4DX90 5LOPB 4D6WA 2LOXA 3D8DA 1B55A 1UNRA 4HAYB 1K5GB 2DLWA 1K5DB 2Y8FA 5I2SA 4HHVA 1N3HA 2LKOA 4HATB 2VSZA 1J19A 4HAWB 1NTVA 3ULBA 2Z59A 2Z0PA 3KZ1A 3ODWA 5D3XA 3TW1A 1MPHA 3F0WA 2R0DA 3KY9A 2Z0OA 2K49A 4HAUB 2QKMA 2PZ1A 4WSFA 2KGXB 4HAXB 1EF1A 5HE2A 1V89A 1ZVRA 3QBVB 1U5EA 3GYOA 5CLQB 1AWEA 4HB2B 2YT0A 4EKUA 4GMXB 2GCJA 3AJ4A 5M4YB 2GCLA 4QJ4B 2LOZA 3PP2A 2CODA 4EJNA 4KHOA 2UZSA 4B6HA 5JHHA 1FGYA 5IRSA 3SV1A 2KR0A 3SYXA 4WVFB 1U5GA 2D9ZA 2DA0A 1DROA 1X05A 1X1FA 3TVVA 3AU5A 3GYPA 2P0HA 3D8FA 2J0MA 1SGHA 3AU4A 2K00A 2W2WA 1FOEA 1V5MA 3CIKA 1Z87A 2EMTA 5C6RA 5EFXA 1U2BA 4NY0A 1V5PA 2DFKA 1EAZA 1ZC4B 3P6AA 1GG3A 2I1JA 3PVWA 3PVUA 4YONA 3ULCA 4A6HA 4BBKA 4OSNA 5CLLB 2KIEA 4GNKB 2DYNA 2ZPYA 1SHCA 4TYZA 1ZYIA 2CRFA 2LG1A 2D9YA 4NSWA 3P7ZA 2Q13A 5HE3A 3MDBC 3QWMA 1FAOA 2Y7BA 2YRYA 3F5RA 4GZUA 2YS1A 4IAPA 5HE1A 4P7IA 2J0JA 5KCVA 1OY2A 3V5WA 1WI1A 4K2OA 4WJ7A 3NWAA 2COAA 1TXDA 1P5TA 4L6EA 1EVHA 2RRFA 2K2UA 4A6FB 4IFSA 1FHOA 3PZDA 2RVBB 5JHGA 2P0DA 2D11A 1FHWA 1V5UA 5DI9B 3KRXA 4C0AA 3BINA 2D9VA 1I2HA 2EC1A 1XX0A 2R09A 1XR0B 2MDXA 4MY6A 2DN6A 1QC6A 2ELAA 1ZM0A 2H7EA 3OANA 5DHFB 2HE7A 1UEFA 2CY5A 3KRWA 1V88A 1W1GA 1DDMA 2D4QA 3G9WA 2N23A 5C5BA 3FVCA 1RRPB 3PVLA 3UZTA 3FM8C 3HSAA 3MPXA 3HK0A 1PFJA 2KUQA 3DCXA 3CXBB 1NU2A 4A6KA 3VOQA 3HIEA 2I5CA 1T77A 2DHJA 5FI0A 2VRWB 5D3YA 2YS5A 1MAIA 4EMOA 2CAYA 2DHKA 2J0KA 3LJUX 2LULA 4CYEA 3ZDTA 3A58A 1H10A 4KHBB 5JP4A 5FI1A 3TCAA 2AL6A 2V76A 2GUMA 5KQ4A 3NWDA 1XKEA 1P3RA 2RSGA 4IOYX 2AEHA 2COFA 3VIAA 2D9XA 2P0FA 3TFMA 2CY4A 5I2MA 4DBBA 2LYDA 4HAZB 5JLJB 2K8EA 3ML4A 4ZRJA 2J59M 5D3VA 1ZC3B 4DX8A 1MK7B 2MKRA 2D9WA 2IYBA 1GC6A 5L81A 3DXEA 5C16A 3HW2B 5KQ1A 2JP2A 3OHMB 1W1DA 2P8VA 2RUKB 2NBVA 2ROVA 1DDVA 2I5FA 3N7CA 1EGXA 1U29A 1I7AA 2YT1A 4D0NB 5LG4B 5HE0A 1KZ7A 2YS3A 4L1RA 1U27A 2GJYA 5J3TA 1OMWA 3DXCA 2M38A 2NMBA 5D3WA 3RCPA 3U7DA 1MI1A 3HQCA 4TKNA 5J3QA 4QJ5B 1P6SA 3FSSA 1MIXA 2UZRA 1RJ2A 2KUPA 3O96A 5C79A 2Y8GA 4PQ0A 4QJ3B 5DH9B 2RLOA 3X23A 1KI1B 2W2XC 2ADZA 1X1GA 4HB3B 1V61A 4HDQA 3PEGA 2DKPA 1W1HA 2DX1A 1IRSA 1MIZB 1ZSQA 1MKEA 1BAKA 3SNHA 1NI2A 3WYFB 1U5FA 2I1KA 4HB4B 1DDWA 2H7DA 2NZ8B 2DKQA 2YF0A 2Z14A 1PLSA 4GPTB 1FGZA 3WA0A 2EJ8A 4A5KA 3NWFA 2D10A 4MK0A 3SO6A 3NSUA 4GOUA 4PNKA 5DHAB 4F7UP 2VKIA 2D2QA 4HB0B
chains in the Genus database with same CATH topology
5DIFB 3D8EA 2KCJA 1FB8A 4ZRKA 1LW3A 4KVGB 4YL8A 3A8PA 3ZVRA 1WGQA 2DYQA 1KZGA 1DBHA 1BTNA 1Y5OA 2DX5A 3A98B 2YVCA 1PMSA 4F7GA 2K2JA 1WGUA 1X86A 1GC7A 1M7EA 2W2XD 4K81A 4H8SA 5D27A 1MK9B 2RNRB 4A6FA 5J3YA 2IFSA 2FJLA 1Y19B 2RGNB 2UVMA 4XWXA 1UNQA 1XODA 2HTHB 1J0WA 2MWNB 1XD4A 2EMSA 2ELBA 2L2IA 4Y94A 1UNPA 4MT7A 3SUZA 3M1IB 4ZRIA 5LONB 2Z0QA 1M7RA 3DXDA 2OTXA 4GMVA 1LB1A 1DYNA 4K17A 3ODXA 1E5WA 4KAXB 4DXAB 1NTYA 1UPQA 1WVHA 2OQBA 4HDOA 3T06A 4GXBA 4CHJA 1WJ1A 1X11A 3ODOA 1QQGA 2QKLA 1AQCA 4Z2MB 4GN1A 4CHMA 3FEHA 1WJMA 4HAVB 2COCA 1ISNA 3PSCA 5C5BB 3TO1A 4F7HA 2DHIA 3U8ZA 2M14A 2DTCA 3QIJA 1BTKA 3BJIA 2BCJA 2GS0A 2N0YA 2E2XA 4K2PA 2MFQA 1H4RA 1WG7A 3A8QA 2X18A 3KSYA 4KHAA 3PG7A 2XQNM 1TQZA 1Q67A 5GOWB 2L1CA 2ROZB 1BWNA 1UPRA 1XCGA 2G35A 1FHXA 1TJ6A 1U5DA 4Z2NA 3IVFA 1OQNA 2YSZA 4DX90 5LOPB 2LOXA 3D8DA 1B55A 1UNRA 4HAYB 1K5GB 2DLWA 1K5DB 2Y8FA 4HHVA 1N3HA 2LKOA 4HATB 2VSZA 1J19A 4HAWB 1NTVA 3ULBA 2Z0PA 3KZ1A 3ODWA 5D3XA 3TW1A 1MPHA 3F0WA 2R0DA 3KY9A 2Z0OA 4HAUB 2QKMA 2PZ1A 4WSFA 2KGXB 4HAXB 1EF1A 5HE2A 1V89A 1ZVRA 3QBVB 1U5EA 3GYOA 5CLQB 1AWEA 4HB2B 2YT0A 4EKUA 4GMXB 2GCJA 3AJ4A 2GCLA 2LOZA 3PP2A 2CODA 4EJNA 4KHOA 2UZSA 4B6HA 5JHHA 1FGYA 3SV1A 3SYXA 4WVFB 1U5GA 2D9ZA 2DA0A 1DROA 1X05A 1X1FA 3TVVA 3AU5A 3GYPA 2P0HA 3D8FA 2J0MA 1SGHA 3AU4A 2K00A 2W2WA 1FOEA 1V5MA 3CIKA 1Z87A 2EMTA 5C6RA 5EFXA 1U2BA 4NY0A 1V5PA 2DFKA 1EAZA 1ZC4B 3P6AA 1GG3A 2I1JA 3PVWA 3PVUA 4YONA 3ULCA 4A6HA 4BBKA 5CLLB 2DYNA 2ZPYA 1SHCA 4TYZA 2CRFA 2LG1A 2D9YA 4NSWA 3P7ZA 2Q13A 5HE3A 3MDBC 3QWMA 1FAOA 2Y7BA 2YRYA 3F5RA 4GZUA 2YS1A 4IAPA 5HE1A 4P7IA 2J0JA 5KCVA 1OY2A 3V5WA 1WI1A 4K2OA 4WJ7A 2COAA 1TXDA 1P5TA 4L6EA 1EVHA 2K2UA 4A6FB 4IFSA 1FHOA 3PZDA 2RVBB 5JHGA 2P0DA 2D11A 1FHWA 1V5UA 5DI9B 3KRXA 4C0AA 3BINA 2D9VA 1I2HA 2EC1A 1XX0A 2R09A 1XR0B 2MDXA 4MY6A 2DN6A 3OANA 1QC6A 1ZM0A 2ELAA 2H7EA 5DHFB 2HE7A 1UEFA 2CY5A 3KRWA 1V88A 1W1GA 1DDMA 2D4QA 3G9WA 2N23A 5C5BA 3PVLA 1RRPB 3UZTA 3FM8C 3MPXA 3HK0A 1PFJA 3CXBB 1NU2A 4A6KA 3VOQA 2I5CA 2DHJA 5FI0A 2VRWB 5D3YA 2YS5A 1MAIA 4EMOA 2CAYA 2DHKA 2J0KA 3LJUX 2LULA 4CYEA 3ZDTA 1H10A 4KHBB 5JP4A 5FI1A 3TCAA 2AL6A 2V76A 5KQ4A 1XKEA 1P3RA 2RSGA 4IOYX 2AEHA 2COFA 3VIAA 2D9XA 2P0FA 3TFMA 2CY4A 4DBBA 2LYDA 4HAZB 5JLJB 3ML4A 4ZRJA 2J59M 5D3VA 1ZC3B 4DX8A 1MK7B 2MKRA 2D9WA 2IYBA 1GC6A 5L81A 3DXEA 5C16A 3HW2B 5KQ1A 2JP2A 1W1DA 2P8VA 2RUKB 2ROVA 1DDVA 2I5FA 3N7CA 1EGXA 1U29A 1I7AA 2YT1A 4D0NB 5HE0A 1KZ7A 2YS3A 1U27A 2GJYA 5J3TA 1OMWA 3DXCA 2M38A 2NMBA 5D3WA 3RCPA 3U7DA 3HQCA 4TKNA 5J3QA 1P6SA 3FSSA 1MIXA 2UZRA 1RJ2A 2KUPA 3O96A 5C79A 2Y8GA 4PQ0A 5DH9B 2RLOA 3X23A 1KI1B 2W2XC 2ADZA 1X1GA 4HB3B 1V61A 4HDQA 3PEGA 2DKPA 1W1HA 2DX1A 1IRSA 1MIZB 1ZSQA 1MKEA 1BAKA 3SNHA 1NI2A 3WYFB 1U5FA 2I1KA 4HB4B 1DDWA 2H7DA 2NZ8B 2DKQA 2YF0A 1PLSA 4GPTB 1FGZA 3WA0A 2EJ8A 4A5KA 2D10A 4MK0A 3SO6A 3NSUA 4PNKA 5DHAB 4F7UP 2VKIA 2D2QA 4HB0B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5DIF B;  3D8E A;  2KCJ A;  1FB8 A;  4ZRK A;  1LW3 A;  4KVG B;  4YL8 A;  3A8P A;  3ZVR A;  1WGQ A;  2DYQ A;  1KZG A;  1DBH A;  1BTN A;  1Y5O A;  2DX5 A;  3A98 B;  2YVC A;  1PMS A;  4F7G A;  2K2J A;  1WGU A;  1X86 A;  1GC7 A;  1M7E A;  2W2X D;  4K81 A;  4H8S A;  5D27 A;  1MK9 B;  2RNR B;  4A6F A;  5J3Y A;  2IFS A;  2FJL A;  1Y19 B;  2RGN B;  2UVM A;  4XWX A;  1UNQ A;  1XOD A;  2HTH B;  1J0W A;  2MWN B;  1XD4 A;  2EMS A;  2ELB A;  2L2I A;  4Y94 A;  1UNP A;  4MT7 A;  3SUZ A;  3M1I B;  4ZRI A;  5LON B;  2Z0Q A;  1M7R A;  3DXD A;  2OTX A;  4GMV A;  1LB1 A;  1DYN A;  4K17 A;  3ODX A;  1E5W A;  4KAX B;  4DXA B;  1NTY A;  1UPQ A;  1WVH A;  2OQB A;  4HDO A;  3T06 A;  4GXB A;  4CHJ A;  1WJ1 A;  1X11 A;  3ODO A;  1QQG A;  2QKL A;  1AQC A;  4Z2M B;  4GN1 A;  4CHM A;  3FEH A;  1WJM A;  4HAV B;  2COC A;  1ISN A;  3PSC A;  5C5B B;  3TO1 A;  4F7H A;  2DHI A;  3U8Z A;  2M14 A;  2DTC A;  3QIJ A;  1BTK A;  3BJI A;  2BCJ A;  2GS0 A;  2N0Y A;  2E2X A;  4K2P A;  2MFQ A;  1H4R A;  1WG7 A;  3A8Q A;  2X18 A;  3KSY A;  4KHA A;  3PG7 A;  2XQN M;  1TQZ A;  1Q67 A;  5GOW B;  2L1C A;  2ROZ B;  1BWN A;  1UPR A;  1XCG A;  2G35 A;  1FHX A;  1TJ6 A;  1U5D A;  4Z2N A;  3IVF A;  1OQN A;  2YSZ A;  4DX9 0;  5LOP B;  2LOX A;  3D8D A;  1B55 A;  1UNR A;  4HAY B;  1K5G B;  2DLW A;  1K5D B;  2Y8F A;  4HHV A;  1N3H A;  2LKO A;  4HAT B;  2VSZ A;  1J19 A;  4HAW B;  1NTV A;  3ULB A;  2Z0P A;  3KZ1 A;  3ODW A;  5D3X A;  3TW1 A;  1MPH A;  3F0W A;  2R0D A;  3KY9 A;  2Z0O A;  4HAU B;  2QKM A;  2PZ1 A;  4WSF A;  2KGX B;  4HAX B;  1EF1 A;  5HE2 A;  1V89 A;  1ZVR A;  3QBV B;  1U5E A;  3GYO A;  5CLQ B;  1AWE A;  4HB2 B;  2YT0 A;  4EKU A;  4GMX B;  2GCJ A;  3AJ4 A;  2GCL A;  2LOZ A;  3PP2 A;  2COD A;  4EJN A;  4KHO A;  2UZS A;  4B6H A;  5JHH A;  1FGY A;  3SV1 A;  3SYX A;  4WVF B;  1U5G A;  2D9Z A;  2DA0 A;  1DRO A;  1X05 A;  1X1F A;  3TVV A;  3AU5 A;  3GYP A;  2P0H A;  3D8F A;  2J0M A;  1SGH A;  3AU4 A;  2K00 A;  2W2W A;  1FOE A;  1V5M A;  3CIK A;  1Z87 A;  2EMT A;  5C6R A;  5EFX A;  1U2B A;  4NY0 A;  1V5P A;  2DFK A;  1EAZ A;  1ZC4 B;  3P6A A;  1GG3 A;  2I1J A;  3PVW A;  3PVU A;  4YON A;  3ULC A;  4A6H A;  4BBK A;  5CLL B;  2DYN A;  2ZPY A;  1SHC A;  4TYZ A;  2CRF A;  2LG1 A;  2D9Y A;  4NSW A;  3P7Z A;  2Q13 A;  5HE3 A;  3MDB C;  3QWM A;  1FAO A;  2Y7B A;  2YRY A;  3F5R A;  4GZU A;  2YS1 A;  4IAP A;  5HE1 A;  4P7I A;  2J0J A;  5KCV A;  1OY2 A;  3V5W A;  1WI1 A;  4K2O A;  4WJ7 A;  2COA A;  1TXD A;  1P5T A;  4L6E A;  1EVH A;  2K2U A;  4A6F B;  4IFS A;  1FHO A;  3PZD A;  2RVB B;  5JHG A;  2P0D A;  2D11 A;  1FHW A;  1V5U A;  5DI9 B;  3KRX A;  4C0A A;  3BIN A;  2D9V A;  1I2H A;  2EC1 A;  1XX0 A;  2R09 A;  1XR0 B;  2MDX A;  4MY6 A;  2DN6 A;  3OAN A;  1QC6 A;  1ZM0 A;  2ELA A;  2H7E A;  5DHF B;  2HE7 A;  1UEF A;  2CY5 A;  3KRW A;  1V88 A;  1W1G A;  1DDM A;  2D4Q A;  3G9W A;  2N23 A;  5C5B A;  3PVL A;  1RRP B;  3UZT A;  3FM8 C;  3MPX A;  3HK0 A;  1PFJ A;  3CXB B;  1NU2 A;  4A6K A;  3VOQ A;  2I5C A;  2DHJ A;  5FI0 A;  2VRW B;  5D3Y A;  2YS5 A;  1MAI A;  4EMO A;  2CAY A;  2DHK A;  2J0K A;  3LJU X;  2LUL A;  4CYE A;  3ZDT A;  1H10 A;  4KHB B;  5JP4 A;  5FI1 A;  3TCA A;  2AL6 A;  2V76 A;  5KQ4 A;  1XKE A;  1P3R A;  2RSG A;  4IOY X;  2AEH A;  2COF A;  3VIA A;  2D9X A;  2P0F A;  3TFM A;  2CY4 A;  4DBB A;  2LYD A;  4HAZ B;  5JLJ B;  3ML4 A;  4ZRJ A;  2J59 M;  5D3V A;  1ZC3 B;  4DX8 A;  1MK7 B;  2MKR A;  2D9W A;  2IYB A;  1GC6 A;  5L81 A;  3DXE A;  5C16 A;  3HW2 B;  5KQ1 A;  2JP2 A;  1W1D A;  2P8V A;  2RUK B;  2ROV A;  1DDV A;  2I5F A;  3N7C A;  1EGX A;  1U29 A;  1I7A A;  2YT1 A;  4D0N B;  5HE0 A;  1KZ7 A;  2YS3 A;  1U27 A;  2GJY A;  5J3T A;  1OMW A;  3DXC A;  2M38 A;  2NMB A;  5D3W A;  3RCP A;  3U7D A;  3HQC A;  4TKN A;  5J3Q A;  1P6S A;  3FSS A;  1MIX A;  2UZR A;  1RJ2 A;  2KUP A;  3O96 A;  5C79 A;  2Y8G A;  4PQ0 A;  5DH9 B;  2RLO A;  3X23 A;  1KI1 B;  2W2X C;  2ADZ A;  1X1G A;  4HB3 B;  1V61 A;  4HDQ A;  3PEG A;  2DKP A;  1W1H A;  2DX1 A;  1IRS A;  1MIZ B;  1ZSQ A;  1MKE A;  1BAK A;  3SNH A;  1NI2 A;  3WYF B;  1U5F A;  2I1K A;  4HB4 B;  1DDW A;  2H7D A;  2NZ8 B;  2DKQ A;  2YF0 A;  1PLS A;  4GPT B;  1FGZ A;  3WA0 A;  2EJ8 A;  4A5K A;  2D10 A;  4MK0 A;  3SO6 A;  3NSU A;  4PNK A;  5DHA B;  4F7U P;  2VKI A;  2D2Q A;  4HB0 B; 
#chains in the Genus database with same CATH topology
 5DIF B;  3D8E A;  2KCJ A;  1FB8 A;  4ZRK A;  1LW3 A;  4KVG B;  4YL8 A;  3A8P A;  3ZVR A;  1WGQ A;  2DYQ A;  1KZG A;  1DBH A;  1BTN A;  2R2Y A;  1Y5O A;  2DX5 A;  4OT1 A;  3A98 B;  2YVC A;  1PMS A;  4F7G A;  2K2J A;  1WGU A;  1X86 A;  2FJU B;  1GC7 A;  1M7E A;  2W2X D;  4K81 A;  2Z4D A;  4H8S A;  5D27 A;  1MK9 B;  2RNR B;  4A6F A;  5J3Y A;  2IFS A;  2ZKM X;  2FJL A;  1Y19 B;  2RGN B;  2UVM A;  4XWX A;  1UNQ A;  3B77 A;  1XOD A;  2HTH B;  4DIX A;  3NW8 A;  1J0W A;  2MWN B;  1XD4 A;  2EMS A;  2ELB A;  2L2I A;  4Y94 A;  1UNP A;  4MT7 A;  3SUZ A;  3M1I B;  4ZRI A;  5LON B;  2Z0Q A;  1M7R A;  3DXD A;  2OTX A;  4GMV A;  1LB1 A;  1DYN A;  4K17 A;  3ODX A;  1E5W A;  4KAX B;  4DXA B;  1NTY A;  1UPQ A;  1WVH A;  2OQB A;  4HDO A;  4QXA B;  3T06 A;  4GXB A;  4CHJ A;  1WJ1 A;  1X11 A;  2KIG A;  3ODO A;  1QQG A;  2QKL A;  1AQC A;  4Z2M B;  2Z13 A;  4GN1 A;  4CHM A;  3FEH A;  1WJM A;  4HAV B;  2COC A;  3U12 A;  1ISN A;  4HSI A;  3PSC A;  5C5B B;  4KHB A;  3TO1 A;  4F7H A;  2DHI A;  3U8Z A;  2M14 A;  2DTC A;  3QIJ A;  1BTK A;  3BJI A;  2BCJ A;  2GS0 A;  2N0Y A;  2E2X A;  4K2P A;  2YT2 A;  2MFQ A;  1H4R A;  1WG7 A;  3A8Q A;  2X18 A;  3KSY A;  4KHA A;  3PG7 A;  2XQN M;  1TQZ A;  1Q67 A;  5GOW B;  2L1C A;  2ROZ B;  1BWN A;  1UPR A;  1XCG A;  2G35 A;  1FHX A;  1TJ6 A;  1U5D A;  4Z2N A;  3IVF A;  4CSQ A;  1OQN A;  2YSZ A;  4DX9 0;  5LOP B;  4D6W A;  2LOX A;  3D8D A;  1B55 A;  1UNR A;  4HAY B;  1K5G B;  2DLW A;  1K5D B;  2Y8F A;  5I2S A;  4HHV A;  1N3H A;  2LKO A;  4HAT B;  2VSZ A;  1J19 A;  4HAW B;  1NTV A;  3ULB A;  2Z59 A;  2Z0P A;  3KZ1 A;  3ODW A;  5D3X A;  3TW1 A;  1MPH A;  3F0W A;  2R0D A;  3KY9 A;  2Z0O A;  2K49 A;  4HAU B;  2QKM A;  2PZ1 A;  4WSF A;  2KGX B;  4HAX B;  1EF1 A;  5HE2 A;  1V89 A;  1ZVR A;  3QBV B;  1U5E A;  3GYO A;  5CLQ B;  1AWE A;  4HB2 B;  2YT0 A;  4EKU A;  4GMX B;  2GCJ A;  3AJ4 A;  5M4Y B;  2GCL A;  4QJ4 B;  2LOZ A;  3PP2 A;  2COD A;  4EJN A;  4KHO A;  2UZS A;  4B6H A;  5JHH A;  1FGY A;  5IRS A;  3SV1 A;  2KR0 A;  3SYX A;  4WVF B;  1U5G A;  2D9Z A;  2DA0 A;  1DRO A;  1X05 A;  1X1F A;  3TVV A;  3AU5 A;  3GYP A;  2P0H A;  3D8F A;  2J0M A;  1SGH A;  3AU4 A;  2K00 A;  2W2W A;  1FOE A;  1V5M A;  3CIK A;  1Z87 A;  2EMT A;  5C6R A;  5EFX A;  1U2B A;  4NY0 A;  1V5P A;  2DFK A;  1EAZ A;  1ZC4 B;  3P6A A;  1GG3 A;  2I1J A;  3PVW A;  3PVU A;  4YON A;  3ULC A;  4A6H A;  4BBK A;  4OSN A;  5CLL B;  2KIE A;  4GNK B;  2DYN A;  2ZPY A;  1SHC A;  4TYZ A;  1ZYI A;  2CRF A;  2LG1 A;  2D9Y A;  4NSW A;  3P7Z A;  2Q13 A;  5HE3 A;  3MDB C;  3QWM A;  1FAO A;  2Y7B A;  2YRY A;  3F5R A;  4GZU A;  2YS1 A;  4IAP A;  5HE1 A;  4P7I A;  2J0J A;  5KCV A;  1OY2 A;  3V5W A;  1WI1 A;  4K2O A;  4WJ7 A;  3NWA A;  2COA A;  1TXD A;  1P5T A;  4L6E A;  1EVH A;  2RRF A;  2K2U A;  4A6F B;  4IFS A;  1FHO A;  3PZD A;  2RVB B;  5JHG A;  2P0D A;  2D11 A;  1FHW A;  1V5U A;  5DI9 B;  3KRX A;  4C0A A;  3BIN A;  2D9V A;  1I2H A;  2EC1 A;  1XX0 A;  2R09 A;  1XR0 B;  2MDX A;  4MY6 A;  2DN6 A;  1QC6 A;  2ELA A;  1ZM0 A;  2H7E A;  3OAN A;  5DHF B;  2HE7 A;  1UEF A;  2CY5 A;  3KRW A;  1V88 A;  1W1G A;  1DDM A;  2D4Q A;  3G9W A;  2N23 A;  5C5B A;  3FVC A;  1RRP B;  3PVL A;  3UZT A;  3FM8 C;  3HSA A;  3MPX A;  3HK0 A;  1PFJ A;  2KUQ A;  3DCX A;  3CXB B;  1NU2 A;  4A6K A;  3VOQ A;  3HIE A;  2I5C A;  1T77 A;  2DHJ A;  5FI0 A;  2VRW B;  5D3Y A;  2YS5 A;  1MAI A;  4EMO A;  2CAY A;  2DHK A;  2J0K A;  3LJU X;  2LUL A;  4CYE A;  3ZDT A;  3A58 A;  1H10 A;  4KHB B;  5JP4 A;  5FI1 A;  3TCA A;  2AL6 A;  2V76 A;  2GUM A;  5KQ4 A;  3NWD A;  1XKE A;  1P3R A;  2RSG A;  4IOY X;  2AEH A;  2COF A;  3VIA A;  2D9X A;  2P0F A;  3TFM A;  2CY4 A;  5I2M A;  4DBB A;  2LYD A;  4HAZ B;  5JLJ B;  2K8E A;  3ML4 A;  4ZRJ A;  2J59 M;  5D3V A;  1ZC3 B;  4DX8 A;  1MK7 B;  2MKR A;  2D9W A;  2IYB A;  1GC6 A;  5L81 A;  3DXE A;  5C16 A;  3HW2 B;  5KQ1 A;  2JP2 A;  3OHM B;  1W1D A;  2P8V A;  2RUK B;  2NBV A;  2ROV A;  1DDV A;  2I5F A;  3N7C A;  1EGX A;  1U29 A;  1I7A A;  2YT1 A;  4D0N B;  5LG4 B;  5HE0 A;  1KZ7 A;  2YS3 A;  4L1R A;  1U27 A;  2GJY A;  5J3T A;  1OMW A;  3DXC A;  2M38 A;  2NMB A;  5D3W A;  3RCP A;  3U7D A;  1MI1 A;  3HQC A;  4TKN A;  5J3Q A;  4QJ5 B;  1P6S A;  3FSS A;  1MIX A;  2UZR A;  1RJ2 A;  2KUP A;  3O96 A;  5C79 A;  2Y8G A;  4PQ0 A;  4QJ3 B;  5DH9 B;  2RLO A;  3X23 A;  1KI1 B;  2W2X C;  2ADZ A;  1X1G A;  4HB3 B;  1V61 A;  4HDQ A;  3PEG A;  2DKP A;  1W1H A;  2DX1 A;  1IRS A;  1MIZ B;  1ZSQ A;  1MKE A;  1BAK A;  3SNH A;  1NI2 A;  3WYF B;  1U5F A;  2I1K A;  4HB4 B;  1DDW A;  2H7D A;  2NZ8 B;  2DKQ A;  2YF0 A;  2Z14 A;  1PLS A;  4GPT B;  1FGZ A;  3WA0 A;  2EJ8 A;  4A5K A;  3NWF A;  2D10 A;  4MK0 A;  3SO6 A;  3NSU A;  4GOU A;  4PNK A;  5DHA B;  4F7U P;  2VKI A;  2D2Q A;  4HB0 B; 
#chains in the Genus database with same CATH homology
 5DIF B;  3D8E A;  2KCJ A;  1FB8 A;  4ZRK A;  1LW3 A;  4KVG B;  4YL8 A;  3A8P A;  3ZVR A;  1WGQ A;  2DYQ A;  1KZG A;  1DBH A;  1BTN A;  1Y5O A;  2DX5 A;  3A98 B;  2YVC A;  1PMS A;  4F7G A;  2K2J A;  1WGU A;  1X86 A;  1GC7 A;  1M7E A;  2W2X D;  4K81 A;  4H8S A;  5D27 A;  1MK9 B;  2RNR B;  4A6F A;  5J3Y A;  2IFS A;  2FJL A;  1Y19 B;  2RGN B;  2UVM A;  4XWX A;  1UNQ A;  1XOD A;  2HTH B;  1J0W A;  2MWN B;  1XD4 A;  2EMS A;  2ELB A;  2L2I A;  4Y94 A;  1UNP A;  4MT7 A;  3SUZ A;  3M1I B;  4ZRI A;  5LON B;  2Z0Q A;  1M7R A;  3DXD A;  2OTX A;  4GMV A;  1LB1 A;  1DYN A;  4K17 A;  3ODX A;  1E5W A;  4KAX B;  4DXA B;  1NTY A;  1UPQ A;  1WVH A;  2OQB A;  4HDO A;  3T06 A;  4GXB A;  4CHJ A;  1WJ1 A;  1X11 A;  3ODO A;  1QQG A;  2QKL A;  1AQC A;  4Z2M B;  4GN1 A;  4CHM A;  3FEH A;  1WJM A;  4HAV B;  2COC A;  1ISN A;  3PSC A;  5C5B B;  3TO1 A;  4F7H A;  2DHI A;  3U8Z A;  2M14 A;  2DTC A;  3QIJ A;  1BTK A;  3BJI A;  2BCJ A;  2GS0 A;  2N0Y A;  2E2X A;  4K2P A;  2MFQ A;  1H4R A;  1WG7 A;  3A8Q A;  2X18 A;  3KSY A;  4KHA A;  3PG7 A;  2XQN M;  1TQZ A;  1Q67 A;  5GOW B;  2L1C A;  2ROZ B;  1BWN A;  1UPR A;  1XCG A;  2G35 A;  1FHX A;  1TJ6 A;  1U5D A;  4Z2N A;  3IVF A;  1OQN A;  2YSZ A;  4DX9 0;  5LOP B;  2LOX A;  3D8D A;  1B55 A;  1UNR A;  4HAY B;  1K5G B;  2DLW A;  1K5D B;  2Y8F A;  4HHV A;  1N3H A;  2LKO A;  4HAT B;  2VSZ A;  1J19 A;  4HAW B;  1NTV A;  3ULB A;  2Z0P A;  3KZ1 A;  3ODW A;  5D3X A;  3TW1 A;  1MPH A;  3F0W A;  2R0D A;  3KY9 A;  2Z0O A;  4HAU B;  2QKM A;  2PZ1 A;  4WSF A;  2KGX B;  4HAX B;  1EF1 A;  5HE2 A;  1V89 A;  1ZVR A;  3QBV B;  1U5E A;  3GYO A;  5CLQ B;  1AWE A;  4HB2 B;  2YT0 A;  4EKU A;  4GMX B;  2GCJ A;  3AJ4 A;  2GCL A;  2LOZ A;  3PP2 A;  2COD A;  4EJN A;  4KHO A;  2UZS A;  4B6H A;  5JHH A;  1FGY A;  3SV1 A;  3SYX A;  4WVF B;  1U5G A;  2D9Z A;  2DA0 A;  1DRO A;  1X05 A;  1X1F A;  3TVV A;  3AU5 A;  3GYP A;  2P0H A;  3D8F A;  2J0M A;  1SGH A;  3AU4 A;  2K00 A;  2W2W A;  1FOE A;  1V5M A;  3CIK A;  1Z87 A;  2EMT A;  5C6R A;  5EFX A;  1U2B A;  4NY0 A;  1V5P A;  2DFK A;  1EAZ A;  1ZC4 B;  3P6A A;  1GG3 A;  2I1J A;  3PVW A;  3PVU A;  4YON A;  3ULC A;  4A6H A;  4BBK A;  5CLL B;  2DYN A;  2ZPY A;  1SHC A;  4TYZ A;  2CRF A;  2LG1 A;  2D9Y A;  4NSW A;  3P7Z A;  2Q13 A;  5HE3 A;  3MDB C;  3QWM A;  1FAO A;  2Y7B A;  2YRY A;  3F5R A;  4GZU A;  2YS1 A;  4IAP A;  5HE1 A;  4P7I A;  2J0J A;  5KCV A;  1OY2 A;  3V5W A;  1WI1 A;  4K2O A;  4WJ7 A;  2COA A;  1TXD A;  1P5T A;  4L6E A;  1EVH A;  2K2U A;  4A6F B;  4IFS A;  1FHO A;  3PZD A;  2RVB B;  5JHG A;  2P0D A;  2D11 A;  1FHW A;  1V5U A;  5DI9 B;  3KRX A;  4C0A A;  3BIN A;  2D9V A;  1I2H A;  2EC1 A;  1XX0 A;  2R09 A;  1XR0 B;  2MDX A;  4MY6 A;  2DN6 A;  3OAN A;  1QC6 A;  1ZM0 A;  2ELA A;  2H7E A;  5DHF B;  2HE7 A;  1UEF A;  2CY5 A;  3KRW A;  1V88 A;  1W1G A;  1DDM A;  2D4Q A;  3G9W A;  2N23 A;  5C5B A;  3PVL A;  1RRP B;  3UZT A;  3FM8 C;  3MPX A;  3HK0 A;  1PFJ A;  3CXB B;  1NU2 A;  4A6K A;  3VOQ A;  2I5C A;  2DHJ A;  5FI0 A;  2VRW B;  5D3Y A;  2YS5 A;  1MAI A;  4EMO A;  2CAY A;  2DHK A;  2J0K A;  3LJU X;  2LUL A;  4CYE A;  3ZDT A;  1H10 A;  4KHB B;  5JP4 A;  5FI1 A;  3TCA A;  2AL6 A;  2V76 A;  5KQ4 A;  1XKE A;  1P3R A;  2RSG A;  4IOY X;  2AEH A;  2COF A;  3VIA A;  2D9X A;  2P0F A;  3TFM A;  2CY4 A;  4DBB A;  2LYD A;  4HAZ B;  5JLJ B;  3ML4 A;  4ZRJ A;  2J59 M;  5D3V A;  1ZC3 B;  4DX8 A;  1MK7 B;  2MKR A;  2D9W A;  2IYB A;  1GC6 A;  5L81 A;  3DXE A;  5C16 A;  3HW2 B;  5KQ1 A;  2JP2 A;  1W1D A;  2P8V A;  2RUK B;  2ROV A;  1DDV A;  2I5F A;  3N7C A;  1EGX A;  1U29 A;  1I7A A;  2YT1 A;  4D0N B;  5HE0 A;  1KZ7 A;  2YS3 A;  1U27 A;  2GJY A;  5J3T A;  1OMW A;  3DXC A;  2M38 A;  2NMB A;  5D3W A;  3RCP A;  3U7D A;  3HQC A;  4TKN A;  5J3Q A;  1P6S A;  3FSS A;  1MIX A;  2UZR A;  1RJ2 A;  2KUP A;  3O96 A;  5C79 A;  2Y8G A;  4PQ0 A;  5DH9 B;  2RLO A;  3X23 A;  1KI1 B;  2W2X C;  2ADZ A;  1X1G A;  4HB3 B;  1V61 A;  4HDQ A;  3PEG A;  2DKP A;  1W1H A;  2DX1 A;  1IRS A;  1MIZ B;  1ZSQ A;  1MKE A;  1BAK A;  3SNH A;  1NI2 A;  3WYF B;  1U5F A;  2I1K A;  4HB4 B;  1DDW A;  2H7D A;  2NZ8 B;  2DKQ A;  2YF0 A;  1PLS A;  4GPT B;  1FGZ A;  3WA0 A;  2EJ8 A;  4A5K A;  2D10 A;  4MK0 A;  3SO6 A;  3NSU A;  4PNK A;  5DHA B;  4F7U P;  2VKI A;  2D2Q A;  4HB0 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...