1FB8A

Structure of the pleckstrin homology domain from dapp1/phish
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
106
structure length
106
Chain Sequence
LVPTAPSLGTKEGYLTKQGGLVKTWKTRWFTLHRNELKYFKDQMSPEPIRILDLTECSAVQFDYSQERVNCFCLVFPFRTFYLCAKTGVEADEWIKILRWKLSQIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DUAL ADAPTOR OF PHOSPHOTYROSINE AND 3-PHOSPHOINOSITIDES
publication title Structural basis for discrimination of 3-phosphoinositides by pleckstrin homology domains.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 20
structure length 106
sequence length 106
ec nomenclature
pdb deposition date 2000-07-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00169 PH PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1fb8A00
3PZDA 4ZRJA 5J3TA 2CY4A 2FJLA 3D8DA 3PEGA 4GXBA 1H4RA 1W1HA 4NY0A 1XODA 4K17A 5HE0A 3ZDTA 5FI1A 3SO6A 1RJ2A 1NTYA 2H7DA 1FHWA 1WG7A 4IOYX 2BCJA 1UNRA 4HHVA 5FI0A 4KHBB 2HE7A 2COAA 2UZRA 4HDQA 1NTVA 3A8PA 2J0KA 1WJMA 3GYOA 1FAOA 3X23A 4GMXB 4HB2B 2CY5A 4WJ7A 1MPHA 5D3YA 3M1IB 5HE2A 2PZ1A 4KAXB 2YRYA 1FHXA 1TXDA 1Y5OA 2YS3A 2VKIA 4F7GA 4DBBA 1K5DB 2D9ZA 2K2UA 2Y7BA 1EVHA 1KZ7A 3U8ZA 3V5WA 1FGZA 5L81A 4F7UP 2DHIA 5C5BA 1KZGA 2W2XD 1XX0A 4K2OA 1W1GA 4KVGB 3VOQA 3PVWA 2RVBB 4A6HA 3FM8C 2D2QA 2ROVA 2GCJA 1MK7B 2LOZA 4HAYB 3DXCA 1XD4A 2OQBA 2P0DA 2MWNB 3KY9A 2K2JA 4HATB 2YS1A 4D0NB 4XWXA 2J59M 1MK9B 1ZC3B 4TKNA 5LONB 1BAKA 1DDVA 5JHGA 5GOWB 1IRSA 2P0HA 1V61A 1DYNA 2I1JA 1EF1A 4A5KA 1U5GA 2D4QA 2D9WA 1X11A 2UZSA 1K5GB 3DXEA 5EFXA 1DROA 5DIFB 4GN1A 2RNRB 1WI1A 1U5EA 3DXDA 2L2IA 5C79A 3QIJA 1MIZB 1ISNA 1LB1A 3TCAA 4PNKA 2MDXA 4HAVB 4HAWB 4MK0A 4DX90 1Q67A 1B55A 2J0JA 2XQNM 2ZPYA 1OMWA 1TQZA 4IAPA 2JP2A 2DHJA 1U27A 1DDMA 3PSCA 1X1GA 3T06A 1N3HA 5C16A 1PMSA 1I2HA 1V88A 2L1CA 2CODA 3FSSA 2Y8GA 1GG3A 2AEHA 3ODWA 2D9XA 1FGYA 2VSZA 2DTCA 4HB0B 2Y8FA 2Q13A 3KSYA 1OY2A 4TYZA 3VIAA 2DX1A 1U5FA 3MDBC 2DA0A 1V5UA 1MAIA 4ZRKA 3CXBB 2YS5A 2NMBA 3BJIA 3ZVRA 5JLJB 1PLSA 3U7DA 2EMTA 3QBVB 2EJ8A 5D27A 3NSUA 5KQ1A 4PQ0A 3BINA 2LOXA 3IVFA 2DYNA 2M14A 3TO1A 5D3XA 1PFJA 3F5RA 1WGUA 1UNQA 2KUPA 1ZSQA 3ODOA 5KQ4A 1I7AA 5DI9B 2DKQA 1X05A 2Z0OA 4KHAA 4A6FB 1DDWA 2YT0A 4Y94A 1NI2A 3A8QA 3O96A 2QKLA 3KRWA 3PVLA 2COCA 1W1DA 3AJ4A 2YT1A 2HTHB 1SGHA 2RGNB 3F0WA 1X1FA 2CAYA 1ZM0A 3KZ1A 5D3VA 5C6RA 4HB4B 2P8VA 2OTXA 3GYPA 3CIKA 3MPXA 2ADZA 2MKRA 1EAZA 4EKUA 2DN6A 4YL8A 4Z2MB 5HE1A 2KCJA 4L6EA 1P3RA 4IFSA 3QWMA 2D9YA 1ZVRA 4A6KA 1X86A 2X18A 4DXAB 4C0AA 4EMOA 2CRFA 2N0YA 1UPRA 2D11A 1E5WA 2P0FA 3D8FA 1P6SA 4NSWA 5HE3A 2VRWB 2H7EA 1FB8A 2DKPA 1AQCA 2LULA 1Z87A 1RRPB 4K81A 1U5DA 1V5MA 2N23A 3A98B 2YF0A 1KI1B 1P5TA 1J19A 2ROZB 1J0WA 2UVMA 2DFKA 4MT7A 1H10A 1EGXA 1BTNA 1FOEA 1V5PA 2W2XC 2DYQA 3HK0A 4CHJA 1WJ1A 2DLWA 5D3WA 1DBHA 4HB3B 2DHKA 1QQGA 2LG1A 2NZ8B 3TVVA 5DHFB 2RUKB 2YSZA 1GC7A 1LW3A 2I1KA 3FEHA 2YVCA 2E2XA 3OANA 4HAUB 3PVUA 4GMVA 4YONA 1WGQA 2K00A 2R09A 4A6FA 1BWNA 2GJYA 1Y19B 2GCLA 1XKEA 1U29A 1ZC4B 2IFSA 5JHHA 2ELBA 2M38A 4WVFB 1M7RA 2RSGA 1AWEA 3SYXA 1FHOA 1WVHA 2EC1A 3AU5A 4B6HA 1UEFA 2D9VA 3D8EA 1UPQA 3P6AA 3ML4A 1TJ6A 4HDOA 5J3QA 2Z0PA 3G9WA 4F7HA 3SUZA 2ELAA 3N7CA 1V89A 5DH9B 2COFA 3PG7A 2EMSA 3ULBA 2DX5A 1XCGA 2LKOA 3ODXA 3TW1A 1MKEA 5CLQB 5J3YA 4Z2NA 2Z0QA 1QC6A 3TFMA 1OQNA 3P7ZA 2I5CA 1M7EA 1XR0B 2W2WA 4K2PA 5LOPB 3WYFB 2V76A 4HAXB 4KHOA 4DX8A 4CYEA 4EJNA 1MIXA 3SV1A 2IYBA 3UZTA 4MY6A 3WA0A 4GZUA 2MFQA 5CLLB 3HQCA 1BTKA 2I5FA 2D10A 1U2BA 3PP2A 4P7IA 2QKMA 4BBKA 5C5BB 2GS0A 2G35A 3KRXA 5KCVA 1SHCA 5DHAB 5JP4A 3HW2B 4HAZB 2KGXB 4WSFA 2J0MA 2RLOA 1NU2A 3LJUX 3RCPA 4CHMA 2LYDA 4GPTB 1GC6A 2AL6A 2R0DA 4H8SA 3AU4A 4ZRIA 3ULCA 3SNHA 1UNPA
chains in the Genus database with same CATH superfamily
3PZDA 4CSQA 4ZRJA 5J3TA 2CY4A 2FJLA 3D8DA 5M4YB 3PEGA 4GXBA 1H4RA 5I2SA 1W1HA 2R2YA 4NY0A 1XODA 4K17A 4QXAB 5HE0A 3ZDTA 5FI1A 3SO6A 1RJ2A 1NTYA 2H7DA 1FHWA 1WG7A 4IOYX 2BCJA 1UNRA 4HHVA 5FI0A 4KHBB 2HE7A 2COAA 3NWDA 2UZRA 4HDQA 1NTVA 3A8PA 2J0KA 1WJMA 3GYOA 1FAOA 3X23A 4GMXB 4HB2B 2CY5A 4WJ7A 1MPHA 5D3YA 3M1IB 5HE2A 2PZ1A 4KAXB 2YRYA 5LG4B 1FHXA 1TXDA 1Y5OA 2YS3A 2VKIA 2Z4DA 4F7GA 4DBBA 1K5DB 2D9ZA 2K2UA 2Y7BA 1EVHA 1KZ7A 3U8ZA 3V5WA 1FGZA 5L81A 4F7UP 2DHIA 5C5BA 1KZGA 2W2XD 1XX0A 4K2OA 1W1GA 4KVGB 3VOQA 3PVWA 2RVBB 4A6HA 3FM8C 2D2QA 2ROVA 2GCJA 3A58A 1MK7B 2LOZA 4HAYB 3DXCA 1XD4A 2OQBA 2P0DA 3DCXA 2MWNB 3KY9A 2K2JA 4HATB 2Z14A 2YS1A 2ZKMX 4D0NB 4XWXA 2J59M 1MK9B 1ZC3B 3NWFA 4TKNA 5LONB 1BAKA 1DDVA 5JHGA 5GOWB 1IRSA 3U12A 2P0HA 2FJUB 1V61A 1DYNA 2I1JA 1EF1A 4A5KA 1U5GA 2D4QA 2D9WA 1X11A 2UZSA 1K5GB 3DXEA 5EFXA 1DROA 5DIFB 4GN1A 2RNRB 1WI1A 1U5EA 3DXDA 2L2IA 5C79A 3QIJA 1MIZB 1ISNA 1LB1A 3TCAA 4PNKA 2MDXA 4KHBA 4HAVB 4HAWB 4MK0A 4DX90 1Q67A 1B55A 4GOUA 2J0JA 3NWAA 2XQNM 2ZPYA 1OMWA 1TQZA 4IAPA 2JP2A 5IRSA 2DHJA 1U27A 1DDMA 3PSCA 1X1GA 3T06A 1N3HA 5C16A 1PMSA 2KIGA 1I2HA 1V88A 2GUMA 2L1CA 2CODA 3FSSA 2Y8GA 1GG3A 2AEHA 4L1RA 3ODWA 2D9XA 1FGYA 2VSZA 2DTCA 4HB0B 2Y8FA 2Q13A 3KSYA 1OY2A 4TYZA 3VIAA 2DX1A 1U5FA 3MDBC 2DA0A 1V5UA 1MAIA 4ZRKA 3CXBB 2YS5A 2NMBA 3BJIA 4GNKB 3ZVRA 5JLJB 1PLSA 2KR0A 3U7DA 2EMTA 3HSAA 3QBVB 2EJ8A 5D27A 3NSUA 5KQ1A 4PQ0A 3BINA 2LOXA 3IVFA 2DYNA 2K49A 2M14A 3TO1A 5D3XA 1PFJA 3F5RA 1WGUA 1UNQA 2KUPA 1ZSQA 3ODOA 5KQ4A 1I7AA 5DI9B 2DKQA 1X05A 2Z0OA 4KHAA 4A6FB 1DDWA 2YT0A 4Y94A 1NI2A 3A8QA 3O96A 2QKLA 3KRWA 3PVLA 4DIXA 2COCA 1W1DA 2K8EA 3AJ4A 2YT1A 2HTHB 1SGHA 4QJ4B 2RGNB 3F0WA 1X1FA 2CAYA 1ZM0A 3KZ1A 5D3VA 5C6RA 4HB4B 2P8VA 2OTXA 3GYPA 3CIKA 3MPXA 2ADZA 2MKRA 1EAZA 4EKUA 2DN6A 2KUQA 4YL8A 4Z2MB 5HE1A 2KCJA 4L6EA 3NW8A 1P3RA 4IFSA 3QWMA 2D9YA 1ZVRA 4A6KA 1X86A 2X18A 4DXAB 4C0AA 4EMOA 2CRFA 2N0YA 1UPRA 2D11A 1E5WA 2P0FA 3D8FA 1P6SA 4NSWA 4D6WA 5HE3A 2VRWB 2H7EA 1MI1A 1FB8A 2DKPA 1AQCA 2LULA 1Z87A 1RRPB 4K81A 1U5DA 1V5MA 2N23A 3A98B 2YF0A 2KIEA 1KI1B 1P5TA 1J19A 2ROZB 1J0WA 2UVMA 2DFKA 4MT7A 1H10A 1EGXA 1BTNA 1FOEA 1V5PA 2W2XC 2DYQA 3HK0A 4CHJA 4QJ5B 3FVCA 1WJ1A 2DLWA 5D3WA 1DBHA 4HB3B 2DHKA 1QQGA 2LG1A 2NZ8B 3TVVA 5DHFB 2RUKB 2YSZA 1GC7A 1LW3A 2I1KA 3OHMB 3FEHA 2YVCA 2E2XA 5I2MA 3OANA 4HAUB 3PVUA 4GMVA 4YONA 1WGQA 2K00A 2R09A 4A6FA 1BWNA 2GJYA 1Y19B 2GCLA 1XKEA 1U29A 1ZC4B 2IFSA 5JHHA 2ELBA 2M38A 4WVFB 1M7RA 2RSGA 1AWEA 3SYXA 1FHOA 1WVHA 2EC1A 3AU5A 4B6HA 1UEFA 2D9VA 3D8EA 1UPQA 3P6AA 3HIEA 3ML4A 1TJ6A 4HDOA 5J3QA 2Z0PA 3G9WA 4OT1A 4F7HA 3SUZA 2ELAA 3N7CA 1V89A 5DH9B 2COFA 3PG7A 2EMSA 3ULBA 2RRFA 2DX5A 1XCGA 2NBVA 2LKOA 3ODXA 3TW1A 1MKEA 5CLQB 5J3YA 4Z2NA 2Z0QA 1QC6A 1T77A 2YT2A 3TFMA 1OQNA 4OSNA 3P7ZA 2I5CA 1M7EA 1XR0B 2W2WA 4K2PA 5LOPB 3WYFB 2V76A 4HAXB 4KHOA 4DX8A 4CYEA 4EJNA 1MIXA 3SV1A 1ZYIA 2IYBA 3UZTA 4MY6A 3WA0A 4GZUA 2MFQA 5CLLB 3HQCA 1BTKA 2I5FA 2D10A 4HSIA 1U2BA 3PP2A 4P7IA 2QKMA 2Z59A 4BBKA 5C5BB 2GS0A 2G35A 3KRXA 5KCVA 1SHCA 3B77A 5DHAB 5JP4A 3HW2B 4HAZB 2KGXB 4WSFA 2J0MA 2RLOA 1NU2A 2Z13A 3LJUX 3RCPA 4CHMA 2LYDA 4GPTB 1GC6A 2AL6A 2R0DA 4H8SA 3AU4A 4ZRIA 3ULCA 4QJ3B 3SNHA 1UNPA
chains in the Genus database with same CATH topology
3PZDA 4ZRJA 5J3TA 2CY4A 2FJLA 3D8DA 3PEGA 4GXBA 1H4RA 1W1HA 4NY0A 1XODA 4K17A 5HE0A 3ZDTA 5FI1A 3SO6A 1RJ2A 1NTYA 2H7DA 1FHWA 1WG7A 4IOYX 2BCJA 1UNRA 4HHVA 5FI0A 4KHBB 2HE7A 2COAA 2UZRA 4HDQA 1NTVA 3A8PA 2J0KA 1WJMA 3GYOA 1FAOA 3X23A 4GMXB 4HB2B 2CY5A 4WJ7A 1MPHA 5D3YA 3M1IB 5HE2A 2PZ1A 4KAXB 2YRYA 1FHXA 1TXDA 1Y5OA 2YS3A 2VKIA 4F7GA 4DBBA 1K5DB 2D9ZA 2K2UA 2Y7BA 1EVHA 1KZ7A 3U8ZA 3V5WA 1FGZA 5L81A 4F7UP 2DHIA 5C5BA 1KZGA 2W2XD 1XX0A 4K2OA 1W1GA 4KVGB 3VOQA 3PVWA 2RVBB 4A6HA 3FM8C 2D2QA 2ROVA 2GCJA 1MK7B 2LOZA 4HAYB 3DXCA 1XD4A 2OQBA 2P0DA 2MWNB 3KY9A 2K2JA 4HATB 2YS1A 4D0NB 4XWXA 2J59M 1MK9B 1ZC3B 4TKNA 5LONB 1BAKA 1DDVA 5JHGA 5GOWB 1IRSA 2P0HA 1V61A 1DYNA 2I1JA 1EF1A 4A5KA 1U5GA 2D4QA 2D9WA 1X11A 2UZSA 1K5GB 3DXEA 5EFXA 1DROA 5DIFB 4GN1A 2RNRB 1WI1A 1U5EA 3DXDA 2L2IA 5C79A 3QIJA 1MIZB 1ISNA 1LB1A 3TCAA 4PNKA 2MDXA 4HAVB 4HAWB 4MK0A 4DX90 1Q67A 1B55A 2J0JA 2XQNM 2ZPYA 1OMWA 1TQZA 4IAPA 2JP2A 2DHJA 1U27A 1DDMA 3PSCA 1X1GA 3T06A 1N3HA 5C16A 1PMSA 1I2HA 1V88A 2L1CA 2CODA 3FSSA 2Y8GA 1GG3A 2AEHA 3ODWA 2D9XA 1FGYA 2VSZA 2DTCA 4HB0B 2Y8FA 2Q13A 3KSYA 1OY2A 4TYZA 3VIAA 2DX1A 1U5FA 3MDBC 2DA0A 1V5UA 1MAIA 4ZRKA 3CXBB 2YS5A 2NMBA 3BJIA 3ZVRA 5JLJB 1PLSA 3U7DA 2EMTA 3QBVB 2EJ8A 5D27A 3NSUA 5KQ1A 4PQ0A 3BINA 2LOXA 3IVFA 2DYNA 2M14A 3TO1A 5D3XA 1PFJA 3F5RA 1WGUA 1UNQA 2KUPA 1ZSQA 3ODOA 5KQ4A 1I7AA 5DI9B 2DKQA 1X05A 2Z0OA 4KHAA 4A6FB 1DDWA 2YT0A 4Y94A 1NI2A 3A8QA 3O96A 2QKLA 3KRWA 3PVLA 2COCA 1W1DA 3AJ4A 2YT1A 2HTHB 1SGHA 2RGNB 3F0WA 1X1FA 2CAYA 1ZM0A 3KZ1A 5D3VA 5C6RA 4HB4B 2P8VA 2OTXA 3GYPA 3CIKA 3MPXA 2ADZA 2MKRA 1EAZA 4EKUA 2DN6A 4YL8A 4Z2MB 5HE1A 2KCJA 4L6EA 1P3RA 4IFSA 3QWMA 2D9YA 1ZVRA 4A6KA 1X86A 2X18A 4DXAB 4C0AA 4EMOA 2CRFA 2N0YA 1UPRA 2D11A 1E5WA 2P0FA 3D8FA 1P6SA 4NSWA 5HE3A 2VRWB 2H7EA 1FB8A 2DKPA 1AQCA 2LULA 1Z87A 1RRPB 4K81A 1U5DA 1V5MA 2N23A 3A98B 2YF0A 1KI1B 1P5TA 1J19A 2ROZB 1J0WA 2UVMA 2DFKA 4MT7A 1H10A 1EGXA 1BTNA 1FOEA 1V5PA 2W2XC 2DYQA 3HK0A 4CHJA 1WJ1A 2DLWA 5D3WA 1DBHA 4HB3B 2DHKA 1QQGA 2LG1A 2NZ8B 3TVVA 5DHFB 2RUKB 2YSZA 1GC7A 1LW3A 2I1KA 3FEHA 2YVCA 2E2XA 3OANA 4HAUB 3PVUA 4GMVA 4YONA 1WGQA 2K00A 2R09A 4A6FA 1BWNA 2GJYA 1Y19B 2GCLA 1XKEA 1U29A 1ZC4B 2IFSA 5JHHA 2ELBA 2M38A 4WVFB 1M7RA 2RSGA 1AWEA 3SYXA 1FHOA 1WVHA 2EC1A 3AU5A 4B6HA 1UEFA 2D9VA 3D8EA 1UPQA 3P6AA 3ML4A 1TJ6A 4HDOA 5J3QA 2Z0PA 3G9WA 4F7HA 3SUZA 2ELAA 3N7CA 1V89A 5DH9B 2COFA 3PG7A 2EMSA 3ULBA 2DX5A 1XCGA 2LKOA 3ODXA 3TW1A 1MKEA 5CLQB 5J3YA 4Z2NA 2Z0QA 1QC6A 3TFMA 1OQNA 3P7ZA 2I5CA 1M7EA 1XR0B 2W2WA 4K2PA 5LOPB 3WYFB 2V76A 4HAXB 4KHOA 4DX8A 4CYEA 4EJNA 1MIXA 3SV1A 2IYBA 3UZTA 4MY6A 3WA0A 4GZUA 2MFQA 5CLLB 3HQCA 1BTKA 2I5FA 2D10A 1U2BA 3PP2A 4P7IA 2QKMA 4BBKA 5C5BB 2GS0A 2G35A 3KRXA 5KCVA 1SHCA 5DHAB 5JP4A 3HW2B 4HAZB 2KGXB 4WSFA 2J0MA 2RLOA 1NU2A 3LJUX 3RCPA 4CHMA 2LYDA 4GPTB 1GC6A 2AL6A 2R0DA 4H8SA 3AU4A 4ZRIA 3ULCA 3SNHA 1UNPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PZD A;  4ZRJ A;  5J3T A;  2CY4 A;  2FJL A;  3D8D A;  3PEG A;  4GXB A;  1H4R A;  1W1H A;  4NY0 A;  1XOD A;  4K17 A;  5HE0 A;  3ZDT A;  5FI1 A;  3SO6 A;  1RJ2 A;  1NTY A;  2H7D A;  1FHW A;  1WG7 A;  4IOY X;  2BCJ A;  1UNR A;  4HHV A;  5FI0 A;  4KHB B;  2HE7 A;  2COA A;  2UZR A;  4HDQ A;  1NTV A;  3A8P A;  2J0K A;  1WJM A;  3GYO A;  1FAO A;  3X23 A;  4GMX B;  4HB2 B;  2CY5 A;  4WJ7 A;  1MPH A;  5D3Y A;  3M1I B;  5HE2 A;  2PZ1 A;  4KAX B;  2YRY A;  1FHX A;  1TXD A;  1Y5O A;  2YS3 A;  2VKI A;  4F7G A;  4DBB A;  1K5D B;  2D9Z A;  2K2U A;  2Y7B A;  1EVH A;  1KZ7 A;  3U8Z A;  3V5W A;  1FGZ A;  5L81 A;  4F7U P;  2DHI A;  5C5B A;  1KZG A;  2W2X D;  1XX0 A;  4K2O A;  1W1G A;  4KVG B;  3VOQ A;  3PVW A;  2RVB B;  4A6H A;  3FM8 C;  2D2Q A;  2ROV A;  2GCJ A;  1MK7 B;  2LOZ A;  4HAY B;  3DXC A;  1XD4 A;  2OQB A;  2P0D A;  2MWN B;  3KY9 A;  2K2J A;  4HAT B;  2YS1 A;  4D0N B;  4XWX A;  2J59 M;  1MK9 B;  1ZC3 B;  4TKN A;  5LON B;  1BAK A;  1DDV A;  5JHG A;  5GOW B;  1IRS A;  2P0H A;  1V61 A;  1DYN A;  2I1J A;  1EF1 A;  4A5K A;  1U5G A;  2D4Q A;  2D9W A;  1X11 A;  2UZS A;  1K5G B;  3DXE A;  5EFX A;  1DRO A;  5DIF B;  4GN1 A;  2RNR B;  1WI1 A;  1U5E A;  3DXD A;  2L2I A;  5C79 A;  3QIJ A;  1MIZ B;  1ISN A;  1LB1 A;  3TCA A;  4PNK A;  2MDX A;  4HAV B;  4HAW B;  4MK0 A;  4DX9 0;  1Q67 A;  1B55 A;  2J0J A;  2XQN M;  2ZPY A;  1OMW A;  1TQZ A;  4IAP A;  2JP2 A;  2DHJ A;  1U27 A;  1DDM A;  3PSC A;  1X1G A;  3T06 A;  1N3H A;  5C16 A;  1PMS A;  1I2H A;  1V88 A;  2L1C A;  2COD A;  3FSS A;  2Y8G A;  1GG3 A;  2AEH A;  3ODW A;  2D9X A;  1FGY A;  2VSZ A;  2DTC A;  4HB0 B;  2Y8F A;  2Q13 A;  3KSY A;  1OY2 A;  4TYZ A;  3VIA A;  2DX1 A;  1U5F A;  3MDB C;  2DA0 A;  1V5U A;  1MAI A;  4ZRK A;  3CXB B;  2YS5 A;  2NMB A;  3BJI A;  3ZVR A;  5JLJ B;  1PLS A;  3U7D A;  2EMT A;  3QBV B;  2EJ8 A;  5D27 A;  3NSU A;  5KQ1 A;  4PQ0 A;  3BIN A;  2LOX A;  3IVF A;  2DYN A;  2M14 A;  3TO1 A;  5D3X A;  1PFJ A;  3F5R A;  1WGU A;  1UNQ A;  2KUP A;  1ZSQ A;  3ODO A;  5KQ4 A;  1I7A A;  5DI9 B;  2DKQ A;  1X05 A;  2Z0O A;  4KHA A;  4A6F B;  1DDW A;  2YT0 A;  4Y94 A;  1NI2 A;  3A8Q A;  3O96 A;  2QKL A;  3KRW A;  3PVL A;  2COC A;  1W1D A;  3AJ4 A;  2YT1 A;  2HTH B;  1SGH A;  2RGN B;  3F0W A;  1X1F A;  2CAY A;  1ZM0 A;  3KZ1 A;  5D3V A;  5C6R A;  4HB4 B;  2P8V A;  2OTX A;  3GYP A;  3CIK A;  3MPX A;  2ADZ A;  2MKR A;  1EAZ A;  4EKU A;  2DN6 A;  4YL8 A;  4Z2M B;  5HE1 A;  2KCJ A;  4L6E A;  1P3R A;  4IFS A;  3QWM A;  2D9Y A;  1ZVR A;  4A6K A;  1X86 A;  2X18 A;  4DXA B;  4C0A A;  4EMO A;  2CRF A;  2N0Y A;  1UPR A;  2D11 A;  1E5W A;  2P0F A;  3D8F A;  1P6S A;  4NSW A;  5HE3 A;  2VRW B;  2H7E A;  1FB8 A;  2DKP A;  1AQC A;  2LUL A;  1Z87 A;  1RRP B;  4K81 A;  1U5D A;  1V5M A;  2N23 A;  3A98 B;  2YF0 A;  1KI1 B;  1P5T A;  1J19 A;  2ROZ B;  1J0W A;  2UVM A;  2DFK A;  4MT7 A;  1H10 A;  1EGX A;  1BTN A;  1FOE A;  1V5P A;  2W2X C;  2DYQ A;  3HK0 A;  4CHJ A;  1WJ1 A;  2DLW A;  5D3W A;  1DBH A;  4HB3 B;  2DHK A;  1QQG A;  2LG1 A;  2NZ8 B;  3TVV A;  5DHF B;  2RUK B;  2YSZ A;  1GC7 A;  1LW3 A;  2I1K A;  3FEH A;  2YVC A;  2E2X A;  3OAN A;  4HAU B;  3PVU A;  4GMV A;  4YON A;  1WGQ A;  2K00 A;  2R09 A;  4A6F A;  1BWN A;  2GJY A;  1Y19 B;  2GCL A;  1XKE A;  1U29 A;  1ZC4 B;  2IFS A;  5JHH A;  2ELB A;  2M38 A;  4WVF B;  1M7R A;  2RSG A;  1AWE A;  3SYX A;  1FHO A;  1WVH A;  2EC1 A;  3AU5 A;  4B6H A;  1UEF A;  2D9V A;  3D8E A;  1UPQ A;  3P6A A;  3ML4 A;  1TJ6 A;  4HDO A;  5J3Q A;  2Z0P A;  3G9W A;  4F7H A;  3SUZ A;  2ELA A;  3N7C A;  1V89 A;  5DH9 B;  2COF A;  3PG7 A;  2EMS A;  3ULB A;  2DX5 A;  1XCG A;  2LKO A;  3ODX A;  3TW1 A;  1MKE A;  5CLQ B;  5J3Y A;  4Z2N A;  2Z0Q A;  1QC6 A;  3TFM A;  1OQN A;  3P7Z A;  2I5C A;  1M7E A;  1XR0 B;  2W2W A;  4K2P A;  5LOP B;  3WYF B;  2V76 A;  4HAX B;  4KHO A;  4DX8 A;  4CYE A;  4EJN A;  1MIX A;  3SV1 A;  2IYB A;  3UZT A;  4MY6 A;  3WA0 A;  4GZU A;  2MFQ A;  5CLL B;  3HQC A;  1BTK A;  2I5F A;  2D10 A;  1U2B A;  3PP2 A;  4P7I A;  2QKM A;  4BBK A;  5C5B B;  2GS0 A;  2G35 A;  3KRX A;  5KCV A;  1SHC A;  5DHA B;  5JP4 A;  3HW2 B;  4HAZ B;  2KGX B;  4WSF A;  2J0M A;  2RLO A;  1NU2 A;  3LJU X;  3RCP A;  4CHM A;  2LYD A;  4GPT B;  1GC6 A;  2AL6 A;  2R0D A;  4H8S A;  3AU4 A;  4ZRI A;  3ULC A;  3SNH A;  1UNP A; 
#chains in the Genus database with same CATH topology
 3PZD A;  4CSQ A;  4ZRJ A;  5J3T A;  2CY4 A;  2FJL A;  3D8D A;  5M4Y B;  3PEG A;  4GXB A;  1H4R A;  5I2S A;  1W1H A;  2R2Y A;  4NY0 A;  1XOD A;  4K17 A;  4QXA B;  5HE0 A;  3ZDT A;  5FI1 A;  3SO6 A;  1RJ2 A;  1NTY A;  2H7D A;  1FHW A;  1WG7 A;  4IOY X;  2BCJ A;  1UNR A;  4HHV A;  5FI0 A;  4KHB B;  2HE7 A;  2COA A;  3NWD A;  2UZR A;  4HDQ A;  1NTV A;  3A8P A;  2J0K A;  1WJM A;  3GYO A;  1FAO A;  3X23 A;  4GMX B;  4HB2 B;  2CY5 A;  4WJ7 A;  1MPH A;  5D3Y A;  3M1I B;  5HE2 A;  2PZ1 A;  4KAX B;  2YRY A;  5LG4 B;  1FHX A;  1TXD A;  1Y5O A;  2YS3 A;  2VKI A;  2Z4D A;  4F7G A;  4DBB A;  1K5D B;  2D9Z A;  2K2U A;  2Y7B A;  1EVH A;  1KZ7 A;  3U8Z A;  3V5W A;  1FGZ A;  5L81 A;  4F7U P;  2DHI A;  5C5B A;  1KZG A;  2W2X D;  1XX0 A;  4K2O A;  1W1G A;  4KVG B;  3VOQ A;  3PVW A;  2RVB B;  4A6H A;  3FM8 C;  2D2Q A;  2ROV A;  2GCJ A;  3A58 A;  1MK7 B;  2LOZ A;  4HAY B;  3DXC A;  1XD4 A;  2OQB A;  2P0D A;  3DCX A;  2MWN B;  3KY9 A;  2K2J A;  4HAT B;  2Z14 A;  2YS1 A;  2ZKM X;  4D0N B;  4XWX A;  2J59 M;  1MK9 B;  1ZC3 B;  3NWF A;  4TKN A;  5LON B;  1BAK A;  1DDV A;  5JHG A;  5GOW B;  1IRS A;  3U12 A;  2P0H A;  2FJU B;  1V61 A;  1DYN A;  2I1J A;  1EF1 A;  4A5K A;  1U5G A;  2D4Q A;  2D9W A;  1X11 A;  2UZS A;  1K5G B;  3DXE A;  5EFX A;  1DRO A;  5DIF B;  4GN1 A;  2RNR B;  1WI1 A;  1U5E A;  3DXD A;  2L2I A;  5C79 A;  3QIJ A;  1MIZ B;  1ISN A;  1LB1 A;  3TCA A;  4PNK A;  2MDX A;  4KHB A;  4HAV B;  4HAW B;  4MK0 A;  4DX9 0;  1Q67 A;  1B55 A;  4GOU A;  2J0J A;  3NWA A;  2XQN M;  2ZPY A;  1OMW A;  1TQZ A;  4IAP A;  2JP2 A;  5IRS A;  2DHJ A;  1U27 A;  1DDM A;  3PSC A;  1X1G A;  3T06 A;  1N3H A;  5C16 A;  1PMS A;  2KIG A;  1I2H A;  1V88 A;  2GUM A;  2L1C A;  2COD A;  3FSS A;  2Y8G A;  1GG3 A;  2AEH A;  4L1R A;  3ODW A;  2D9X A;  1FGY A;  2VSZ A;  2DTC A;  4HB0 B;  2Y8F A;  2Q13 A;  3KSY A;  1OY2 A;  4TYZ A;  3VIA A;  2DX1 A;  1U5F A;  3MDB C;  2DA0 A;  1V5U A;  1MAI A;  4ZRK A;  3CXB B;  2YS5 A;  2NMB A;  3BJI A;  4GNK B;  3ZVR A;  5JLJ B;  1PLS A;  2KR0 A;  3U7D A;  2EMT A;  3HSA A;  3QBV B;  2EJ8 A;  5D27 A;  3NSU A;  5KQ1 A;  4PQ0 A;  3BIN A;  2LOX A;  3IVF A;  2DYN A;  2K49 A;  2M14 A;  3TO1 A;  5D3X A;  1PFJ A;  3F5R A;  1WGU A;  1UNQ A;  2KUP A;  1ZSQ A;  3ODO A;  5KQ4 A;  1I7A A;  5DI9 B;  2DKQ A;  1X05 A;  2Z0O A;  4KHA A;  4A6F B;  1DDW A;  2YT0 A;  4Y94 A;  1NI2 A;  3A8Q A;  3O96 A;  2QKL A;  3KRW A;  3PVL A;  4DIX A;  2COC A;  1W1D A;  2K8E A;  3AJ4 A;  2YT1 A;  2HTH B;  1SGH A;  4QJ4 B;  2RGN B;  3F0W A;  1X1F A;  2CAY A;  1ZM0 A;  3KZ1 A;  5D3V A;  5C6R A;  4HB4 B;  2P8V A;  2OTX A;  3GYP A;  3CIK A;  3MPX A;  2ADZ A;  2MKR A;  1EAZ A;  4EKU A;  2DN6 A;  2KUQ A;  4YL8 A;  4Z2M B;  5HE1 A;  2KCJ A;  4L6E A;  3NW8 A;  1P3R A;  4IFS A;  3QWM A;  2D9Y A;  1ZVR A;  4A6K A;  1X86 A;  2X18 A;  4DXA B;  4C0A A;  4EMO A;  2CRF A;  2N0Y A;  1UPR A;  2D11 A;  1E5W A;  2P0F A;  3D8F A;  1P6S A;  4NSW A;  4D6W A;  5HE3 A;  2VRW B;  2H7E A;  1MI1 A;  1FB8 A;  2DKP A;  1AQC A;  2LUL A;  1Z87 A;  1RRP B;  4K81 A;  1U5D A;  1V5M A;  2N23 A;  3A98 B;  2YF0 A;  2KIE A;  1KI1 B;  1P5T A;  1J19 A;  2ROZ B;  1J0W A;  2UVM A;  2DFK A;  4MT7 A;  1H10 A;  1EGX A;  1BTN A;  1FOE A;  1V5P A;  2W2X C;  2DYQ A;  3HK0 A;  4CHJ A;  4QJ5 B;  3FVC A;  1WJ1 A;  2DLW A;  5D3W A;  1DBH A;  4HB3 B;  2DHK A;  1QQG A;  2LG1 A;  2NZ8 B;  3TVV A;  5DHF B;  2RUK B;  2YSZ A;  1GC7 A;  1LW3 A;  2I1K A;  3OHM B;  3FEH A;  2YVC A;  2E2X A;  5I2M A;  3OAN A;  4HAU B;  3PVU A;  4GMV A;  4YON A;  1WGQ A;  2K00 A;  2R09 A;  4A6F A;  1BWN A;  2GJY A;  1Y19 B;  2GCL A;  1XKE A;  1U29 A;  1ZC4 B;  2IFS A;  5JHH A;  2ELB A;  2M38 A;  4WVF B;  1M7R A;  2RSG A;  1AWE A;  3SYX A;  1FHO A;  1WVH A;  2EC1 A;  3AU5 A;  4B6H A;  1UEF A;  2D9V A;  3D8E A;  1UPQ A;  3P6A A;  3HIE A;  3ML4 A;  1TJ6 A;  4HDO A;  5J3Q A;  2Z0P A;  3G9W A;  4OT1 A;  4F7H A;  3SUZ A;  2ELA A;  3N7C A;  1V89 A;  5DH9 B;  2COF A;  3PG7 A;  2EMS A;  3ULB A;  2RRF A;  2DX5 A;  1XCG A;  2NBV A;  2LKO A;  3ODX A;  3TW1 A;  1MKE A;  5CLQ B;  5J3Y A;  4Z2N A;  2Z0Q A;  1QC6 A;  1T77 A;  2YT2 A;  3TFM A;  1OQN A;  4OSN A;  3P7Z A;  2I5C A;  1M7E A;  1XR0 B;  2W2W A;  4K2P A;  5LOP B;  3WYF B;  2V76 A;  4HAX B;  4KHO A;  4DX8 A;  4CYE A;  4EJN A;  1MIX A;  3SV1 A;  1ZYI A;  2IYB A;  3UZT A;  4MY6 A;  3WA0 A;  4GZU A;  2MFQ A;  5CLL B;  3HQC A;  1BTK A;  2I5F A;  2D10 A;  4HSI A;  1U2B A;  3PP2 A;  4P7I A;  2QKM A;  2Z59 A;  4BBK A;  5C5B B;  2GS0 A;  2G35 A;  3KRX A;  5KCV A;  1SHC A;  3B77 A;  5DHA B;  5JP4 A;  3HW2 B;  4HAZ B;  2KGX B;  4WSF A;  2J0M A;  2RLO A;  1NU2 A;  2Z13 A;  3LJU X;  3RCP A;  4CHM A;  2LYD A;  4GPT B;  1GC6 A;  2AL6 A;  2R0D A;  4H8S A;  3AU4 A;  4ZRI A;  3ULC A;  4QJ3 B;  3SNH A;  1UNP A; 
#chains in the Genus database with same CATH homology
 3PZD A;  4ZRJ A;  5J3T A;  2CY4 A;  2FJL A;  3D8D A;  3PEG A;  4GXB A;  1H4R A;  1W1H A;  4NY0 A;  1XOD A;  4K17 A;  5HE0 A;  3ZDT A;  5FI1 A;  3SO6 A;  1RJ2 A;  1NTY A;  2H7D A;  1FHW A;  1WG7 A;  4IOY X;  2BCJ A;  1UNR A;  4HHV A;  5FI0 A;  4KHB B;  2HE7 A;  2COA A;  2UZR A;  4HDQ A;  1NTV A;  3A8P A;  2J0K A;  1WJM A;  3GYO A;  1FAO A;  3X23 A;  4GMX B;  4HB2 B;  2CY5 A;  4WJ7 A;  1MPH A;  5D3Y A;  3M1I B;  5HE2 A;  2PZ1 A;  4KAX B;  2YRY A;  1FHX A;  1TXD A;  1Y5O A;  2YS3 A;  2VKI A;  4F7G A;  4DBB A;  1K5D B;  2D9Z A;  2K2U A;  2Y7B A;  1EVH A;  1KZ7 A;  3U8Z A;  3V5W A;  1FGZ A;  5L81 A;  4F7U P;  2DHI A;  5C5B A;  1KZG A;  2W2X D;  1XX0 A;  4K2O A;  1W1G A;  4KVG B;  3VOQ A;  3PVW A;  2RVB B;  4A6H A;  3FM8 C;  2D2Q A;  2ROV A;  2GCJ A;  1MK7 B;  2LOZ A;  4HAY B;  3DXC A;  1XD4 A;  2OQB A;  2P0D A;  2MWN B;  3KY9 A;  2K2J A;  4HAT B;  2YS1 A;  4D0N B;  4XWX A;  2J59 M;  1MK9 B;  1ZC3 B;  4TKN A;  5LON B;  1BAK A;  1DDV A;  5JHG A;  5GOW B;  1IRS A;  2P0H A;  1V61 A;  1DYN A;  2I1J A;  1EF1 A;  4A5K A;  1U5G A;  2D4Q A;  2D9W A;  1X11 A;  2UZS A;  1K5G B;  3DXE A;  5EFX A;  1DRO A;  5DIF B;  4GN1 A;  2RNR B;  1WI1 A;  1U5E A;  3DXD A;  2L2I A;  5C79 A;  3QIJ A;  1MIZ B;  1ISN A;  1LB1 A;  3TCA A;  4PNK A;  2MDX A;  4HAV B;  4HAW B;  4MK0 A;  4DX9 0;  1Q67 A;  1B55 A;  2J0J A;  2XQN M;  2ZPY A;  1OMW A;  1TQZ A;  4IAP A;  2JP2 A;  2DHJ A;  1U27 A;  1DDM A;  3PSC A;  1X1G A;  3T06 A;  1N3H A;  5C16 A;  1PMS A;  1I2H A;  1V88 A;  2L1C A;  2COD A;  3FSS A;  2Y8G A;  1GG3 A;  2AEH A;  3ODW A;  2D9X A;  1FGY A;  2VSZ A;  2DTC A;  4HB0 B;  2Y8F A;  2Q13 A;  3KSY A;  1OY2 A;  4TYZ A;  3VIA A;  2DX1 A;  1U5F A;  3MDB C;  2DA0 A;  1V5U A;  1MAI A;  4ZRK A;  3CXB B;  2YS5 A;  2NMB A;  3BJI A;  3ZVR A;  5JLJ B;  1PLS A;  3U7D A;  2EMT A;  3QBV B;  2EJ8 A;  5D27 A;  3NSU A;  5KQ1 A;  4PQ0 A;  3BIN A;  2LOX A;  3IVF A;  2DYN A;  2M14 A;  3TO1 A;  5D3X A;  1PFJ A;  3F5R A;  1WGU A;  1UNQ A;  2KUP A;  1ZSQ A;  3ODO A;  5KQ4 A;  1I7A A;  5DI9 B;  2DKQ A;  1X05 A;  2Z0O A;  4KHA A;  4A6F B;  1DDW A;  2YT0 A;  4Y94 A;  1NI2 A;  3A8Q A;  3O96 A;  2QKL A;  3KRW A;  3PVL A;  2COC A;  1W1D A;  3AJ4 A;  2YT1 A;  2HTH B;  1SGH A;  2RGN B;  3F0W A;  1X1F A;  2CAY A;  1ZM0 A;  3KZ1 A;  5D3V A;  5C6R A;  4HB4 B;  2P8V A;  2OTX A;  3GYP A;  3CIK A;  3MPX A;  2ADZ A;  2MKR A;  1EAZ A;  4EKU A;  2DN6 A;  4YL8 A;  4Z2M B;  5HE1 A;  2KCJ A;  4L6E A;  1P3R A;  4IFS A;  3QWM A;  2D9Y A;  1ZVR A;  4A6K A;  1X86 A;  2X18 A;  4DXA B;  4C0A A;  4EMO A;  2CRF A;  2N0Y A;  1UPR A;  2D11 A;  1E5W A;  2P0F A;  3D8F A;  1P6S A;  4NSW A;  5HE3 A;  2VRW B;  2H7E A;  1FB8 A;  2DKP A;  1AQC A;  2LUL A;  1Z87 A;  1RRP B;  4K81 A;  1U5D A;  1V5M A;  2N23 A;  3A98 B;  2YF0 A;  1KI1 B;  1P5T A;  1J19 A;  2ROZ B;  1J0W A;  2UVM A;  2DFK A;  4MT7 A;  1H10 A;  1EGX A;  1BTN A;  1FOE A;  1V5P A;  2W2X C;  2DYQ A;  3HK0 A;  4CHJ A;  1WJ1 A;  2DLW A;  5D3W A;  1DBH A;  4HB3 B;  2DHK A;  1QQG A;  2LG1 A;  2NZ8 B;  3TVV A;  5DHF B;  2RUK B;  2YSZ A;  1GC7 A;  1LW3 A;  2I1K A;  3FEH A;  2YVC A;  2E2X A;  3OAN A;  4HAU B;  3PVU A;  4GMV A;  4YON A;  1WGQ A;  2K00 A;  2R09 A;  4A6F A;  1BWN A;  2GJY A;  1Y19 B;  2GCL A;  1XKE A;  1U29 A;  1ZC4 B;  2IFS A;  5JHH A;  2ELB A;  2M38 A;  4WVF B;  1M7R A;  2RSG A;  1AWE A;  3SYX A;  1FHO A;  1WVH A;  2EC1 A;  3AU5 A;  4B6H A;  1UEF A;  2D9V A;  3D8E A;  1UPQ A;  3P6A A;  3ML4 A;  1TJ6 A;  4HDO A;  5J3Q A;  2Z0P A;  3G9W A;  4F7H A;  3SUZ A;  2ELA A;  3N7C A;  1V89 A;  5DH9 B;  2COF A;  3PG7 A;  2EMS A;  3ULB A;  2DX5 A;  1XCG A;  2LKO A;  3ODX A;  3TW1 A;  1MKE A;  5CLQ B;  5J3Y A;  4Z2N A;  2Z0Q A;  1QC6 A;  3TFM A;  1OQN A;  3P7Z A;  2I5C A;  1M7E A;  1XR0 B;  2W2W A;  4K2P A;  5LOP B;  3WYF B;  2V76 A;  4HAX B;  4KHO A;  4DX8 A;  4CYE A;  4EJN A;  1MIX A;  3SV1 A;  2IYB A;  3UZT A;  4MY6 A;  3WA0 A;  4GZU A;  2MFQ A;  5CLL B;  3HQC A;  1BTK A;  2I5F A;  2D10 A;  1U2B A;  3PP2 A;  4P7I A;  2QKM A;  4BBK A;  5C5B B;  2GS0 A;  2G35 A;  3KRX A;  5KCV A;  1SHC A;  5DHA B;  5JP4 A;  3HW2 B;  4HAZ B;  2KGX B;  4WSF A;  2J0M A;  2RLO A;  1NU2 A;  3LJU X;  3RCP A;  4CHM A;  2LYD A;  4GPT B;  1GC6 A;  2AL6 A;  2R0D A;  4H8S A;  3AU4 A;  4ZRI A;  3ULC A;  3SNH A;  1UNP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...