2EC1A

Solution structure of the ranbd1 domain from human nucleoporin 50 kda
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
118
structure length
118
Chain Sequence
EVKEEDAFYSKKCKLFYKKDNEFKEKGIGTLHLKPTANQKTQLLVRADTNLGNILLNVLIPPNMPCTRTGKNNVLIVCVPNPPIDEKNATMPVTMLIRVKTSEDADELHKILLEKKDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nucleoporin 50 kDa
publication title Solution structure of the RanBD1 domain from human Nucleoporin 50 kDa
rcsb
source organism Homo sapiens
molecule tags Transport protein
total genus 17
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2007-02-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2ec1A00
2COFA 1MAIA 3A98B 2KUPA 1GC6A 4KHBB 3PSCA 4MT7A 1XKEA 5C6RA 4ZRIA 1NI2A 2G35A 1U27A 3G9WA 2EJ8A 2I5CA 5CLQB 4TKNA 1ZM0A 2K2JA 5FI0A 1XODA 5LONB 1ISNA 3VIAA 2L2IA 3PVLA 4CYEA 4ZRJA 1XCGA 2VKIA 4HB2B 2NMBA 3WA0A 5J3QA 4A6FB 2W2XC 2RLOA 1P3RA 1ZC4B 4XWXA 2K00A 1TXDA 2DKQA 2YS5A 1ZVRA 4IOYX 2RVBB 3HQCA 3P7ZA 3X23A 1V5UA 5JP4A 3KRWA 2CRFA 4K2PA 1U5FA 2YSZA 1TQZA 1QC6A 2HE7A 4PNKA 2ZPYA 2DTCA 2D9ZA 3FM8C 5EFXA 2YT0A 2CY5A 2UVMA 2XQNM 2NZ8B 1MPHA 5GOWB 5D3YA 5DI9B 2AL6A 1WI1A 2CY4A 2COAA 3D8EA 1SGHA 3ULCA 1Y19B 2QKMA 2D9YA 4HAZB 1BAKA 2AEHA 3HW2B 2UZRA 1FGYA 1W1DA 3RCPA 4WSFA 4H8SA 4IFSA 4MK0A 1ZSQA 2H7DA 3FSSA 2J0MA 2D9VA 2UZSA 3NSUA 1NTYA 5C79A 2ELBA 3BJIA 2DA0A 2DX5A 3HK0A 1MK9B 1BWNA 1I7AA 3PVWA 3VOQA 3A8QA 3BINA 2P0HA 1LB1A 1PMSA 1DDWA 2D9WA 2ROVA 3ZVRA 2I5FA 3D8DA 3UZTA 2EMTA 5L81A 3ODXA 1OQNA 5HE0A 4KHAA 2N0YA 2D2QA 1X11A 1UEFA 1IRSA 2E2XA 3AJ4A 4EJNA 1OMWA 1V5MA 5KCVA 1DDVA 2CAYA 1E5WA 1NU2A 5CLLB 1EF1A 2P8VA 2P0FA 2LKOA 2VSZA 1UNPA 5D3XA 2Y7BA 3MDBC 4WJ7A 2GJYA 4HB0B 2ADZA 1OY2A 4A5KA 3TVVA 2EC1A 4IAPA 3PG7A 2MDXA 1DROA 4TYZA 2FJLA 1Y5OA 5HE3A 1FOEA 1FHOA 1WG7A 4KHOA 2P0DA 1FB8A 2MKRA 2I1KA 1H4RA 1GC7A 2V76A 2M14A 1DYNA 2LOZA 1U5EA 3DXDA 2DHJA 4HAYB 1AWEA 3PZDA 1MK7B 2BCJA 5D3VA 2R09A 4WVFB 1K5DB 1RJ2A 3ULBA 3CIKA 4F7UP 4K81A 1X86A 1WGQA 4DXAB 4PQ0A 2J0JA 4KAXB 3QBVB 2X18A 4Y94A 3SUZA 3ODWA 4GXBA 4YONA 1KZGA 4Z2NA 4HDOA 4A6KA 1UNRA 2Q13A 2YVCA 2I1JA 3DXEA 4BBKA 4HAVB 1QQGA 1TJ6A 2IYBA 5LOPB 4GZUA 2M38A 5D3WA 5D27A 1PFJA 2YS3A 3WYFB 1B55A 4HB4B 4B6HA 1BTKA 2DFKA 4MY6A 3U8ZA 2JP2A 2Z0OA 1X1GA 2R0DA 4F7HA 2EMSA 2W2XD 2YRYA 1W1HA 4ZRKA 5FI1A 4K17A 2Z0PA 1SHCA 2DHKA 2YS1A 2Z0QA 1UPQA 1KI1B 4CHJA 3PP2A 4CHMA 1RRPB 3ODOA 1X1FA 1U5GA 1EGXA 4EKUA 2LULA 2RUKB 4HB3B 2DYNA 4NSWA 4GN1A 2PZ1A 2VRWB 3SYXA 3U7DA 1WGUA 1AQCA 4F7GA 3KY9A 3CXBB 3PVUA 1J0WA 2CODA 5C5BA 2DLWA 1V88A 3QWMA 2IFSA 4KVGB 2OTXA 4P7IA 2KGXB 2RGNB 3DXCA 5DH9B 4HDQA 1UPRA 1PLSA 2LOXA 1P5TA 2QKLA 3TFMA 3O96A 1UNQA 3SV1A 5J3TA 4L6EA 1P6SA 5DHFB 1I2HA 1MIXA 2LG1A 2K2UA 1LW3A 3ZDTA 3T06A 2LYDA 2RNRB 2D9XA 3LJUX 2Y8FA 5JLJB 3MPXA 1KZ7A 4YL8A 3P6AA 1FHWA 3OANA 4HAUB 2DKPA 1J19A 2MWNB 5JHGA 1MIZB 1WJMA 4DX90 2YF0A 5JHHA 2OQBA 2YT1A 1WJ1A 3AU5A 4A6HA 4EMOA 2L1CA 1X05A 3SO6A 1XR0B 1XD4A 3KSYA 3AU4A 5DHAB 3SNHA 1N3HA 2HTHB 1EAZA 1V5PA 2D10A 2J0KA 1U5DA 1EVHA 4D0NB 2DX1A 3N7CA 2ROZB 2DYQA 2W2WA 5KQ1A 1FHXA 3FEHA 4Z2MB 5C16A 3TCAA 3M1IB 1U2BA 1GG3A 1MKEA 2D11A 3QIJA 3PEGA 1V61A 5C5BB 1DBHA 3GYOA 1BTNA 1NTVA 3KRXA 4DX8A 2MFQA 1ZC3B 3A8PA 4A6FA 2GCLA 1FAOA 4C0AA 4HATB 2COCA 5DIFB 1DDMA 3V5WA 5HE2A 4DBBA 4GPTB 2RSGA 2KCJA 5HE1A 2GCJA 1M7RA 3GYPA 1K5GB 1V89A 2DN6A 4K2OA 3IVFA 1WVHA 2J59M 2DHIA 1Q67A 1Z87A 4GMVA 4GMXB 2D4QA 2N23A 2GS0A 1XX0A 2H7EA 4HHVA 1M7EA 3KZ1A 2Y8GA 3F5RA 2ELAA 3TO1A 5KQ4A 3D8FA 1W1GA 1H10A 4HAWB 3ML4A 5J3YA 1U29A 1FGZA 3F0WA 4HAXB 4NY0A 3TW1A
chains in the Genus database with same CATH superfamily
2COFA 1MAIA 3A98B 2KUPA 1GC6A 4KHBB 3PSCA 4MT7A 1XKEA 5C6RA 4ZRIA 1NI2A 2G35A 1U27A 3G9WA 2EJ8A 2I5CA 5CLQB 4TKNA 1ZM0A 2K2JA 5FI0A 1XODA 5LONB 1ISNA 3VIAA 2L2IA 3PVLA 4CYEA 4ZRJA 1XCGA 2VKIA 4HB2B 2NMBA 3WA0A 5J3QA 4A6FB 2W2XC 2RLOA 1P3RA 1ZC4B 4XWXA 2K00A 1TXDA 2Z4DA 2DKQA 5IRSA 2ZKMX 2YS5A 1ZVRA 4IOYX 2RVBB 3HQCA 3P7ZA 3X23A 1V5UA 3OHMB 4D6WA 5JP4A 3KRWA 2CRFA 1ZYIA 5I2MA 4K2PA 1U5FA 2YSZA 1TQZA 1QC6A 2HE7A 3A58A 4PNKA 2ZPYA 2DTCA 2D9ZA 3FM8C 5EFXA 2Z14A 2YT0A 2CY5A 2UVMA 2XQNM 2NZ8B 1MPHA 5GOWB 5D3YA 5DI9B 2AL6A 1WI1A 2CY4A 2COAA 3D8EA 1SGHA 3ULCA 1Y19B 2QKMA 2D9YA 4HAZB 1BAKA 2AEHA 3HW2B 2UZRA 1FGYA 1W1DA 3RCPA 3HIEA 4WSFA 4H8SA 4IFSA 4HSIA 4MK0A 1ZSQA 2H7DA 3FSSA 2J0MA 2D9VA 2UZSA 3NSUA 1NTYA 5C79A 2ELBA 3BJIA 2DA0A 2DX5A 3HK0A 1MK9B 1BWNA 1I7AA 4DIXA 3PVWA 3VOQA 3A8QA 3BINA 2P0HA 2Z59A 1LB1A 1PMSA 1DDWA 2D9WA 2ROVA 3ZVRA 2I5FA 3D8DA 3UZTA 2EMTA 5L81A 3ODXA 1OQNA 5HE0A 3DCXA 4KHAA 2N0YA 2D2QA 1X11A 1UEFA 5LG4B 1IRSA 2E2XA 3AJ4A 4EJNA 1OMWA 1V5MA 5KCVA 1DDVA 2CAYA 1E5WA 1NU2A 5CLLB 1EF1A 2P8VA 2P0FA 3FVCA 2LKOA 2VSZA 1UNPA 3U12A 5D3XA 2Y7BA 3MDBC 4WJ7A 2GJYA 4HB0B 2ADZA 1OY2A 4A5KA 3TVVA 2EC1A 4IAPA 3NWAA 3PG7A 2MDXA 1DROA 4TYZA 2FJLA 1Y5OA 5HE3A 1FOEA 1FHOA 1WG7A 4KHOA 2P0DA 4OSNA 1FB8A 2MKRA 2I1KA 4QJ3B 1H4RA 1GC7A 2V76A 1MI1A 2M14A 1DYNA 2LOZA 2K49A 1U5EA 1T77A 3DXDA 2DHJA 4HAYB 5I2SA 1AWEA 3PZDA 1MK7B 2BCJA 5D3VA 2R09A 4WVFB 1K5DB 3B77A 1RJ2A 3ULBA 3CIKA 4F7UP 4K81A 1X86A 1WGQA 4DXAB 4PQ0A 2J0JA 4KAXB 3QBVB 2X18A 4Y94A 3SUZA 3NW8A 3ODWA 4GXBA 4YONA 1KZGA 4Z2NA 4HDOA 4A6KA 1UNRA 2Q13A 2YVCA 2I1JA 3DXEA 4BBKA 4HAVB 2NBVA 1QQGA 4GNKB 1TJ6A 2IYBA 5LOPB 4GZUA 2M38A 5D3WA 5D27A 1PFJA 2YS3A 3WYFB 1B55A 4HB4B 4GOUA 4QJ5B 4B6HA 1BTKA 2DFKA 4MY6A 3U8ZA 2JP2A 2Z0OA 1X1GA 2R0DA 4F7HA 2EMSA 2W2XD 2YRYA 1W1HA 4ZRKA 5FI1A 4K17A 2Z0PA 1SHCA 2DHKA 2YS1A 2Z0QA 1UPQA 1KI1B 4CHJA 3PP2A 4CHMA 1RRPB 3ODOA 1X1FA 1U5GA 1EGXA 4EKUA 2LULA 2RUKB 4HB3B 2DYNA 4NSWA 4CSQA 4GN1A 2PZ1A 2VRWB 3SYXA 3U7DA 1WGUA 1AQCA 4F7GA 3KY9A 3CXBB 3PVUA 1J0WA 2CODA 5C5BA 2DLWA 1V88A 3QWMA 2IFSA 4KVGB 2OTXA 4P7IA 4OT1A 5M4YB 2KGXB 2RGNB 3DXCA 5DH9B 4HDQA 1UPRA 1PLSA 2LOXA 1P5TA 2QKLA 3TFMA 2RRFA 3O96A 1UNQA 3SV1A 5J3TA 4L6EA 1P6SA 5DHFB 4L1RA 1I2HA 1MIXA 2LG1A 2R2YA 2K2UA 1LW3A 3ZDTA 3T06A 2KIGA 2LYDA 2RNRB 2D9XA 3LJUX 2Y8FA 5JLJB 3MPXA 1KZ7A 4YL8A 3P6AA 1FHWA 3OANA 4HAUB 2DKPA 1J19A 2MWNB 5JHGA 1MIZB 1WJMA 4DX90 2YF0A 5JHHA 2OQBA 2YT1A 1WJ1A 3AU5A 4A6HA 4EMOA 2L1CA 1X05A 3SO6A 1XR0B 1XD4A 3KSYA 3AU4A 5DHAB 3SNHA 1N3HA 2HTHB 4KHBA 1EAZA 4QXAB 1V5PA 2D10A 2J0KA 1U5DA 1EVHA 4D0NB 2DX1A 2ROZB 3N7CA 2DYQA 2W2WA 5KQ1A 1FHXA 3FEHA 4Z2MB 5C16A 3TCAA 3M1IB 1U2BA 1GG3A 1MKEA 2D11A 3QIJA 3PEGA 1V61A 5C5BB 1DBHA 3HSAA 3GYOA 1BTNA 1NTVA 3KRXA 2GUMA 4DX8A 2KIEA 2MFQA 1ZC3B 3A8PA 4A6FA 2GCLA 1FAOA 4C0AA 4HATB 2K8EA 2KUQA 2KR0A 2Z13A 4QJ4B 2COCA 5DIFB 1DDMA 3V5WA 3NWDA 5HE2A 4DBBA 4GPTB 2RSGA 2KCJA 2FJUB 5HE1A 2GCJA 1M7RA 3GYPA 1K5GB 1V89A 2DN6A 2YT2A 4K2OA 3IVFA 1WVHA 2J59M 2DHIA 1Q67A 1Z87A 4GMVA 4GMXB 2D4QA 2N23A 2GS0A 1XX0A 2H7EA 4HHVA 3NWFA 1M7EA 3KZ1A 2Y8GA 3F5RA 2ELAA 3TO1A 5KQ4A 3D8FA 1W1GA 1H10A 4HAWB 3ML4A 5J3YA 1U29A 1FGZA 3F0WA 4HAXB 4NY0A 3TW1A
chains in the Genus database with same CATH topology
2COFA 1MAIA 3A98B 2KUPA 1GC6A 4KHBB 3PSCA 4MT7A 1XKEA 5C6RA 4ZRIA 1NI2A 2G35A 1U27A 3G9WA 2EJ8A 2I5CA 5CLQB 4TKNA 1ZM0A 2K2JA 5FI0A 1XODA 5LONB 1ISNA 3VIAA 2L2IA 3PVLA 4CYEA 4ZRJA 1XCGA 2VKIA 4HB2B 2NMBA 3WA0A 5J3QA 4A6FB 2W2XC 2RLOA 1P3RA 1ZC4B 4XWXA 2K00A 1TXDA 2DKQA 2YS5A 1ZVRA 4IOYX 2RVBB 3HQCA 3P7ZA 3X23A 1V5UA 5JP4A 3KRWA 2CRFA 4K2PA 1U5FA 2YSZA 1TQZA 1QC6A 2HE7A 4PNKA 2ZPYA 2DTCA 2D9ZA 3FM8C 5EFXA 2YT0A 2CY5A 2UVMA 2XQNM 2NZ8B 1MPHA 5GOWB 5D3YA 5DI9B 2AL6A 1WI1A 2CY4A 2COAA 3D8EA 1SGHA 3ULCA 1Y19B 2QKMA 2D9YA 4HAZB 1BAKA 2AEHA 3HW2B 2UZRA 1FGYA 1W1DA 3RCPA 4WSFA 4H8SA 4IFSA 4MK0A 1ZSQA 2H7DA 3FSSA 2J0MA 2D9VA 2UZSA 3NSUA 1NTYA 5C79A 2ELBA 3BJIA 2DA0A 2DX5A 3HK0A 1MK9B 1BWNA 1I7AA 3PVWA 3VOQA 3A8QA 3BINA 2P0HA 1LB1A 1PMSA 1DDWA 2D9WA 2ROVA 3ZVRA 2I5FA 3D8DA 3UZTA 2EMTA 5L81A 3ODXA 1OQNA 5HE0A 4KHAA 2N0YA 2D2QA 1X11A 1UEFA 1IRSA 2E2XA 3AJ4A 4EJNA 1OMWA 1V5MA 5KCVA 1DDVA 2CAYA 1E5WA 1NU2A 5CLLB 1EF1A 2P8VA 2P0FA 2LKOA 2VSZA 1UNPA 5D3XA 2Y7BA 3MDBC 4WJ7A 2GJYA 4HB0B 2ADZA 1OY2A 4A5KA 3TVVA 2EC1A 4IAPA 3PG7A 2MDXA 1DROA 4TYZA 2FJLA 1Y5OA 5HE3A 1FOEA 1FHOA 1WG7A 4KHOA 2P0DA 1FB8A 2MKRA 2I1KA 1H4RA 1GC7A 2V76A 2M14A 1DYNA 2LOZA 1U5EA 3DXDA 2DHJA 4HAYB 1AWEA 3PZDA 1MK7B 2BCJA 5D3VA 2R09A 4WVFB 1K5DB 1RJ2A 3ULBA 3CIKA 4F7UP 4K81A 1X86A 1WGQA 4DXAB 4PQ0A 2J0JA 4KAXB 3QBVB 2X18A 4Y94A 3SUZA 3ODWA 4GXBA 4YONA 1KZGA 4Z2NA 4HDOA 4A6KA 1UNRA 2Q13A 2YVCA 2I1JA 3DXEA 4BBKA 4HAVB 1QQGA 1TJ6A 2IYBA 5LOPB 4GZUA 2M38A 5D3WA 5D27A 1PFJA 2YS3A 3WYFB 1B55A 4HB4B 4B6HA 1BTKA 2DFKA 4MY6A 3U8ZA 2JP2A 2Z0OA 1X1GA 2R0DA 4F7HA 2EMSA 2W2XD 2YRYA 1W1HA 4ZRKA 5FI1A 4K17A 2Z0PA 1SHCA 2DHKA 2YS1A 2Z0QA 1UPQA 1KI1B 4CHJA 3PP2A 4CHMA 1RRPB 3ODOA 1X1FA 1U5GA 1EGXA 4EKUA 2LULA 2RUKB 4HB3B 2DYNA 4NSWA 4GN1A 2PZ1A 2VRWB 3SYXA 3U7DA 1WGUA 1AQCA 4F7GA 3KY9A 3CXBB 3PVUA 1J0WA 2CODA 5C5BA 2DLWA 1V88A 3QWMA 2IFSA 4KVGB 2OTXA 4P7IA 2KGXB 2RGNB 3DXCA 5DH9B 4HDQA 1UPRA 1PLSA 2LOXA 1P5TA 2QKLA 3TFMA 3O96A 1UNQA 3SV1A 5J3TA 4L6EA 1P6SA 5DHFB 1I2HA 1MIXA 2LG1A 2K2UA 1LW3A 3ZDTA 3T06A 2LYDA 2RNRB 2D9XA 3LJUX 2Y8FA 5JLJB 3MPXA 1KZ7A 4YL8A 3P6AA 1FHWA 3OANA 4HAUB 2DKPA 1J19A 2MWNB 5JHGA 1MIZB 1WJMA 4DX90 2YF0A 5JHHA 2OQBA 2YT1A 1WJ1A 3AU5A 4A6HA 4EMOA 2L1CA 1X05A 3SO6A 1XR0B 1XD4A 3KSYA 3AU4A 5DHAB 3SNHA 1N3HA 2HTHB 1EAZA 1V5PA 2D10A 2J0KA 1U5DA 1EVHA 4D0NB 2DX1A 3N7CA 2ROZB 2DYQA 2W2WA 5KQ1A 1FHXA 3FEHA 4Z2MB 5C16A 3TCAA 3M1IB 1U2BA 1GG3A 1MKEA 2D11A 3QIJA 3PEGA 1V61A 5C5BB 1DBHA 3GYOA 1BTNA 1NTVA 3KRXA 4DX8A 2MFQA 1ZC3B 3A8PA 4A6FA 2GCLA 1FAOA 4C0AA 4HATB 2COCA 5DIFB 1DDMA 3V5WA 5HE2A 4DBBA 4GPTB 2RSGA 2KCJA 5HE1A 2GCJA 1M7RA 3GYPA 1K5GB 1V89A 2DN6A 4K2OA 3IVFA 1WVHA 2J59M 2DHIA 1Q67A 1Z87A 4GMVA 4GMXB 2D4QA 2N23A 2GS0A 1XX0A 2H7EA 4HHVA 1M7EA 3KZ1A 2Y8GA 3F5RA 2ELAA 3TO1A 5KQ4A 3D8FA 1W1GA 1H10A 4HAWB 3ML4A 5J3YA 1U29A 1FGZA 3F0WA 4HAXB 4NY0A 3TW1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2COF A;  1MAI A;  3A98 B;  2KUP A;  1GC6 A;  4KHB B;  3PSC A;  4MT7 A;  1XKE A;  5C6R A;  4ZRI A;  1NI2 A;  2G35 A;  1U27 A;  3G9W A;  2EJ8 A;  2I5C A;  5CLQ B;  4TKN A;  1ZM0 A;  2K2J A;  5FI0 A;  1XOD A;  5LON B;  1ISN A;  3VIA A;  2L2I A;  3PVL A;  4CYE A;  4ZRJ A;  1XCG A;  2VKI A;  4HB2 B;  2NMB A;  3WA0 A;  5J3Q A;  4A6F B;  2W2X C;  2RLO A;  1P3R A;  1ZC4 B;  4XWX A;  2K00 A;  1TXD A;  2DKQ A;  2YS5 A;  1ZVR A;  4IOY X;  2RVB B;  3HQC A;  3P7Z A;  3X23 A;  1V5U A;  5JP4 A;  3KRW A;  2CRF A;  4K2P A;  1U5F A;  2YSZ A;  1TQZ A;  1QC6 A;  2HE7 A;  4PNK A;  2ZPY A;  2DTC A;  2D9Z A;  3FM8 C;  5EFX A;  2YT0 A;  2CY5 A;  2UVM A;  2XQN M;  2NZ8 B;  1MPH A;  5GOW B;  5D3Y A;  5DI9 B;  2AL6 A;  1WI1 A;  2CY4 A;  2COA A;  3D8E A;  1SGH A;  3ULC A;  1Y19 B;  2QKM A;  2D9Y A;  4HAZ B;  1BAK A;  2AEH A;  3HW2 B;  2UZR A;  1FGY A;  1W1D A;  3RCP A;  4WSF A;  4H8S A;  4IFS A;  4MK0 A;  1ZSQ A;  2H7D A;  3FSS A;  2J0M A;  2D9V A;  2UZS A;  3NSU A;  1NTY A;  5C79 A;  2ELB A;  3BJI A;  2DA0 A;  2DX5 A;  3HK0 A;  1MK9 B;  1BWN A;  1I7A A;  3PVW A;  3VOQ A;  3A8Q A;  3BIN A;  2P0H A;  1LB1 A;  1PMS A;  1DDW A;  2D9W A;  2ROV A;  3ZVR A;  2I5F A;  3D8D A;  3UZT A;  2EMT A;  5L81 A;  3ODX A;  1OQN A;  5HE0 A;  4KHA A;  2N0Y A;  2D2Q A;  1X11 A;  1UEF A;  1IRS A;  2E2X A;  3AJ4 A;  4EJN A;  1OMW A;  1V5M A;  5KCV A;  1DDV A;  2CAY A;  1E5W A;  1NU2 A;  5CLL B;  1EF1 A;  2P8V A;  2P0F A;  2LKO A;  2VSZ A;  1UNP A;  5D3X A;  2Y7B A;  3MDB C;  4WJ7 A;  2GJY A;  4HB0 B;  2ADZ A;  1OY2 A;  4A5K A;  3TVV A;  2EC1 A;  4IAP A;  3PG7 A;  2MDX A;  1DRO A;  4TYZ A;  2FJL A;  1Y5O A;  5HE3 A;  1FOE A;  1FHO A;  1WG7 A;  4KHO A;  2P0D A;  1FB8 A;  2MKR A;  2I1K A;  1H4R A;  1GC7 A;  2V76 A;  2M14 A;  1DYN A;  2LOZ A;  1U5E A;  3DXD A;  2DHJ A;  4HAY B;  1AWE A;  3PZD A;  1MK7 B;  2BCJ A;  5D3V A;  2R09 A;  4WVF B;  1K5D B;  1RJ2 A;  3ULB A;  3CIK A;  4F7U P;  4K81 A;  1X86 A;  1WGQ A;  4DXA B;  4PQ0 A;  2J0J A;  4KAX B;  3QBV B;  2X18 A;  4Y94 A;  3SUZ A;  3ODW A;  4GXB A;  4YON A;  1KZG A;  4Z2N A;  4HDO A;  4A6K A;  1UNR A;  2Q13 A;  2YVC A;  2I1J A;  3DXE A;  4BBK A;  4HAV B;  1QQG A;  1TJ6 A;  2IYB A;  5LOP B;  4GZU A;  2M38 A;  5D3W A;  5D27 A;  1PFJ A;  2YS3 A;  3WYF B;  1B55 A;  4HB4 B;  4B6H A;  1BTK A;  2DFK A;  4MY6 A;  3U8Z A;  2JP2 A;  2Z0O A;  1X1G A;  2R0D A;  4F7H A;  2EMS A;  2W2X D;  2YRY A;  1W1H A;  4ZRK A;  5FI1 A;  4K17 A;  2Z0P A;  1SHC A;  2DHK A;  2YS1 A;  2Z0Q A;  1UPQ A;  1KI1 B;  4CHJ A;  3PP2 A;  4CHM A;  1RRP B;  3ODO A;  1X1F A;  1U5G A;  1EGX A;  4EKU A;  2LUL A;  2RUK B;  4HB3 B;  2DYN A;  4NSW A;  4GN1 A;  2PZ1 A;  2VRW B;  3SYX A;  3U7D A;  1WGU A;  1AQC A;  4F7G A;  3KY9 A;  3CXB B;  3PVU A;  1J0W A;  2COD A;  5C5B A;  2DLW A;  1V88 A;  3QWM A;  2IFS A;  4KVG B;  2OTX A;  4P7I A;  2KGX B;  2RGN B;  3DXC A;  5DH9 B;  4HDQ A;  1UPR A;  1PLS A;  2LOX A;  1P5T A;  2QKL A;  3TFM A;  3O96 A;  1UNQ A;  3SV1 A;  5J3T A;  4L6E A;  1P6S A;  5DHF B;  1I2H A;  1MIX A;  2LG1 A;  2K2U A;  1LW3 A;  3ZDT A;  3T06 A;  2LYD A;  2RNR B;  2D9X A;  3LJU X;  2Y8F A;  5JLJ B;  3MPX A;  1KZ7 A;  4YL8 A;  3P6A A;  1FHW A;  3OAN A;  4HAU B;  2DKP A;  1J19 A;  2MWN B;  5JHG A;  1MIZ B;  1WJM A;  4DX9 0;  2YF0 A;  5JHH A;  2OQB A;  2YT1 A;  1WJ1 A;  3AU5 A;  4A6H A;  4EMO A;  2L1C A;  1X05 A;  3SO6 A;  1XR0 B;  1XD4 A;  3KSY A;  3AU4 A;  5DHA B;  3SNH A;  1N3H A;  2HTH B;  1EAZ A;  1V5P A;  2D10 A;  2J0K A;  1U5D A;  1EVH A;  4D0N B;  2DX1 A;  3N7C A;  2ROZ B;  2DYQ A;  2W2W A;  5KQ1 A;  1FHX A;  3FEH A;  4Z2M B;  5C16 A;  3TCA A;  3M1I B;  1U2B A;  1GG3 A;  1MKE A;  2D11 A;  3QIJ A;  3PEG A;  1V61 A;  5C5B B;  1DBH A;  3GYO A;  1BTN A;  1NTV A;  3KRX A;  4DX8 A;  2MFQ A;  1ZC3 B;  3A8P A;  4A6F A;  2GCL A;  1FAO A;  4C0A A;  4HAT B;  2COC A;  5DIF B;  1DDM A;  3V5W A;  5HE2 A;  4DBB A;  4GPT B;  2RSG A;  2KCJ A;  5HE1 A;  2GCJ A;  1M7R A;  3GYP A;  1K5G B;  1V89 A;  2DN6 A;  4K2O A;  3IVF A;  1WVH A;  2J59 M;  2DHI A;  1Q67 A;  1Z87 A;  4GMV A;  4GMX B;  2D4Q A;  2N23 A;  2GS0 A;  1XX0 A;  2H7E A;  4HHV A;  1M7E A;  3KZ1 A;  2Y8G A;  3F5R A;  2ELA A;  3TO1 A;  5KQ4 A;  3D8F A;  1W1G A;  1H10 A;  4HAW B;  3ML4 A;  5J3Y A;  1U29 A;  1FGZ A;  3F0W A;  4HAX B;  4NY0 A;  3TW1 A; 
#chains in the Genus database with same CATH topology
 2COF A;  1MAI A;  3A98 B;  2KUP A;  1GC6 A;  4KHB B;  3PSC A;  4MT7 A;  1XKE A;  5C6R A;  4ZRI A;  1NI2 A;  2G35 A;  1U27 A;  3G9W A;  2EJ8 A;  2I5C A;  5CLQ B;  4TKN A;  1ZM0 A;  2K2J A;  5FI0 A;  1XOD A;  5LON B;  1ISN A;  3VIA A;  2L2I A;  3PVL A;  4CYE A;  4ZRJ A;  1XCG A;  2VKI A;  4HB2 B;  2NMB A;  3WA0 A;  5J3Q A;  4A6F B;  2W2X C;  2RLO A;  1P3R A;  1ZC4 B;  4XWX A;  2K00 A;  1TXD A;  2Z4D A;  2DKQ A;  5IRS A;  2ZKM X;  2YS5 A;  1ZVR A;  4IOY X;  2RVB B;  3HQC A;  3P7Z A;  3X23 A;  1V5U A;  3OHM B;  4D6W A;  5JP4 A;  3KRW A;  2CRF A;  1ZYI A;  5I2M A;  4K2P A;  1U5F A;  2YSZ A;  1TQZ A;  1QC6 A;  2HE7 A;  3A58 A;  4PNK A;  2ZPY A;  2DTC A;  2D9Z A;  3FM8 C;  5EFX A;  2Z14 A;  2YT0 A;  2CY5 A;  2UVM A;  2XQN M;  2NZ8 B;  1MPH A;  5GOW B;  5D3Y A;  5DI9 B;  2AL6 A;  1WI1 A;  2CY4 A;  2COA A;  3D8E A;  1SGH A;  3ULC A;  1Y19 B;  2QKM A;  2D9Y A;  4HAZ B;  1BAK A;  2AEH A;  3HW2 B;  2UZR A;  1FGY A;  1W1D A;  3RCP A;  3HIE A;  4WSF A;  4H8S A;  4IFS A;  4HSI A;  4MK0 A;  1ZSQ A;  2H7D A;  3FSS A;  2J0M A;  2D9V A;  2UZS A;  3NSU A;  1NTY A;  5C79 A;  2ELB A;  3BJI A;  2DA0 A;  2DX5 A;  3HK0 A;  1MK9 B;  1BWN A;  1I7A A;  4DIX A;  3PVW A;  3VOQ A;  3A8Q A;  3BIN A;  2P0H A;  2Z59 A;  1LB1 A;  1PMS A;  1DDW A;  2D9W A;  2ROV A;  3ZVR A;  2I5F A;  3D8D A;  3UZT A;  2EMT A;  5L81 A;  3ODX A;  1OQN A;  5HE0 A;  3DCX A;  4KHA A;  2N0Y A;  2D2Q A;  1X11 A;  1UEF A;  5LG4 B;  1IRS A;  2E2X A;  3AJ4 A;  4EJN A;  1OMW A;  1V5M A;  5KCV A;  1DDV A;  2CAY A;  1E5W A;  1NU2 A;  5CLL B;  1EF1 A;  2P8V A;  2P0F A;  3FVC A;  2LKO A;  2VSZ A;  1UNP A;  3U12 A;  5D3X A;  2Y7B A;  3MDB C;  4WJ7 A;  2GJY A;  4HB0 B;  2ADZ A;  1OY2 A;  4A5K A;  3TVV A;  2EC1 A;  4IAP A;  3NWA A;  3PG7 A;  2MDX A;  1DRO A;  4TYZ A;  2FJL A;  1Y5O A;  5HE3 A;  1FOE A;  1FHO A;  1WG7 A;  4KHO A;  2P0D A;  4OSN A;  1FB8 A;  2MKR A;  2I1K A;  4QJ3 B;  1H4R A;  1GC7 A;  2V76 A;  1MI1 A;  2M14 A;  1DYN A;  2LOZ A;  2K49 A;  1U5E A;  1T77 A;  3DXD A;  2DHJ A;  4HAY B;  5I2S A;  1AWE A;  3PZD A;  1MK7 B;  2BCJ A;  5D3V A;  2R09 A;  4WVF B;  1K5D B;  3B77 A;  1RJ2 A;  3ULB A;  3CIK A;  4F7U P;  4K81 A;  1X86 A;  1WGQ A;  4DXA B;  4PQ0 A;  2J0J A;  4KAX B;  3QBV B;  2X18 A;  4Y94 A;  3SUZ A;  3NW8 A;  3ODW A;  4GXB A;  4YON A;  1KZG A;  4Z2N A;  4HDO A;  4A6K A;  1UNR A;  2Q13 A;  2YVC A;  2I1J A;  3DXE A;  4BBK A;  4HAV B;  2NBV A;  1QQG A;  4GNK B;  1TJ6 A;  2IYB A;  5LOP B;  4GZU A;  2M38 A;  5D3W A;  5D27 A;  1PFJ A;  2YS3 A;  3WYF B;  1B55 A;  4HB4 B;  4GOU A;  4QJ5 B;  4B6H A;  1BTK A;  2DFK A;  4MY6 A;  3U8Z A;  2JP2 A;  2Z0O A;  1X1G A;  2R0D A;  4F7H A;  2EMS A;  2W2X D;  2YRY A;  1W1H A;  4ZRK A;  5FI1 A;  4K17 A;  2Z0P A;  1SHC A;  2DHK A;  2YS1 A;  2Z0Q A;  1UPQ A;  1KI1 B;  4CHJ A;  3PP2 A;  4CHM A;  1RRP B;  3ODO A;  1X1F A;  1U5G A;  1EGX A;  4EKU A;  2LUL A;  2RUK B;  4HB3 B;  2DYN A;  4NSW A;  4CSQ A;  4GN1 A;  2PZ1 A;  2VRW B;  3SYX A;  3U7D A;  1WGU A;  1AQC A;  4F7G A;  3KY9 A;  3CXB B;  3PVU A;  1J0W A;  2COD A;  5C5B A;  2DLW A;  1V88 A;  3QWM A;  2IFS A;  4KVG B;  2OTX A;  4P7I A;  4OT1 A;  5M4Y B;  2KGX B;  2RGN B;  3DXC A;  5DH9 B;  4HDQ A;  1UPR A;  1PLS A;  2LOX A;  1P5T A;  2QKL A;  3TFM A;  2RRF A;  3O96 A;  1UNQ A;  3SV1 A;  5J3T A;  4L6E A;  1P6S A;  5DHF B;  4L1R A;  1I2H A;  1MIX A;  2LG1 A;  2R2Y A;  2K2U A;  1LW3 A;  3ZDT A;  3T06 A;  2KIG A;  2LYD A;  2RNR B;  2D9X A;  3LJU X;  2Y8F A;  5JLJ B;  3MPX A;  1KZ7 A;  4YL8 A;  3P6A A;  1FHW A;  3OAN A;  4HAU B;  2DKP A;  1J19 A;  2MWN B;  5JHG A;  1MIZ B;  1WJM A;  4DX9 0;  2YF0 A;  5JHH A;  2OQB A;  2YT1 A;  1WJ1 A;  3AU5 A;  4A6H A;  4EMO A;  2L1C A;  1X05 A;  3SO6 A;  1XR0 B;  1XD4 A;  3KSY A;  3AU4 A;  5DHA B;  3SNH A;  1N3H A;  2HTH B;  4KHB A;  1EAZ A;  4QXA B;  1V5P A;  2D10 A;  2J0K A;  1U5D A;  1EVH A;  4D0N B;  2DX1 A;  2ROZ B;  3N7C A;  2DYQ A;  2W2W A;  5KQ1 A;  1FHX A;  3FEH A;  4Z2M B;  5C16 A;  3TCA A;  3M1I B;  1U2B A;  1GG3 A;  1MKE A;  2D11 A;  3QIJ A;  3PEG A;  1V61 A;  5C5B B;  1DBH A;  3HSA A;  3GYO A;  1BTN A;  1NTV A;  3KRX A;  2GUM A;  4DX8 A;  2KIE A;  2MFQ A;  1ZC3 B;  3A8P A;  4A6F A;  2GCL A;  1FAO A;  4C0A A;  4HAT B;  2K8E A;  2KUQ A;  2KR0 A;  2Z13 A;  4QJ4 B;  2COC A;  5DIF B;  1DDM A;  3V5W A;  3NWD A;  5HE2 A;  4DBB A;  4GPT B;  2RSG A;  2KCJ A;  2FJU B;  5HE1 A;  2GCJ A;  1M7R A;  3GYP A;  1K5G B;  1V89 A;  2DN6 A;  2YT2 A;  4K2O A;  3IVF A;  1WVH A;  2J59 M;  2DHI A;  1Q67 A;  1Z87 A;  4GMV A;  4GMX B;  2D4Q A;  2N23 A;  2GS0 A;  1XX0 A;  2H7E A;  4HHV A;  3NWF A;  1M7E A;  3KZ1 A;  2Y8G A;  3F5R A;  2ELA A;  3TO1 A;  5KQ4 A;  3D8F A;  1W1G A;  1H10 A;  4HAW B;  3ML4 A;  5J3Y A;  1U29 A;  1FGZ A;  3F0W A;  4HAX B;  4NY0 A;  3TW1 A; 
#chains in the Genus database with same CATH homology
 2COF A;  1MAI A;  3A98 B;  2KUP A;  1GC6 A;  4KHB B;  3PSC A;  4MT7 A;  1XKE A;  5C6R A;  4ZRI A;  1NI2 A;  2G35 A;  1U27 A;  3G9W A;  2EJ8 A;  2I5C A;  5CLQ B;  4TKN A;  1ZM0 A;  2K2J A;  5FI0 A;  1XOD A;  5LON B;  1ISN A;  3VIA A;  2L2I A;  3PVL A;  4CYE A;  4ZRJ A;  1XCG A;  2VKI A;  4HB2 B;  2NMB A;  3WA0 A;  5J3Q A;  4A6F B;  2W2X C;  2RLO A;  1P3R A;  1ZC4 B;  4XWX A;  2K00 A;  1TXD A;  2DKQ A;  2YS5 A;  1ZVR A;  4IOY X;  2RVB B;  3HQC A;  3P7Z A;  3X23 A;  1V5U A;  5JP4 A;  3KRW A;  2CRF A;  4K2P A;  1U5F A;  2YSZ A;  1TQZ A;  1QC6 A;  2HE7 A;  4PNK A;  2ZPY A;  2DTC A;  2D9Z A;  3FM8 C;  5EFX A;  2YT0 A;  2CY5 A;  2UVM A;  2XQN M;  2NZ8 B;  1MPH A;  5GOW B;  5D3Y A;  5DI9 B;  2AL6 A;  1WI1 A;  2CY4 A;  2COA A;  3D8E A;  1SGH A;  3ULC A;  1Y19 B;  2QKM A;  2D9Y A;  4HAZ B;  1BAK A;  2AEH A;  3HW2 B;  2UZR A;  1FGY A;  1W1D A;  3RCP A;  4WSF A;  4H8S A;  4IFS A;  4MK0 A;  1ZSQ A;  2H7D A;  3FSS A;  2J0M A;  2D9V A;  2UZS A;  3NSU A;  1NTY A;  5C79 A;  2ELB A;  3BJI A;  2DA0 A;  2DX5 A;  3HK0 A;  1MK9 B;  1BWN A;  1I7A A;  3PVW A;  3VOQ A;  3A8Q A;  3BIN A;  2P0H A;  1LB1 A;  1PMS A;  1DDW A;  2D9W A;  2ROV A;  3ZVR A;  2I5F A;  3D8D A;  3UZT A;  2EMT A;  5L81 A;  3ODX A;  1OQN A;  5HE0 A;  4KHA A;  2N0Y A;  2D2Q A;  1X11 A;  1UEF A;  1IRS A;  2E2X A;  3AJ4 A;  4EJN A;  1OMW A;  1V5M A;  5KCV A;  1DDV A;  2CAY A;  1E5W A;  1NU2 A;  5CLL B;  1EF1 A;  2P8V A;  2P0F A;  2LKO A;  2VSZ A;  1UNP A;  5D3X A;  2Y7B A;  3MDB C;  4WJ7 A;  2GJY A;  4HB0 B;  2ADZ A;  1OY2 A;  4A5K A;  3TVV A;  2EC1 A;  4IAP A;  3PG7 A;  2MDX A;  1DRO A;  4TYZ A;  2FJL A;  1Y5O A;  5HE3 A;  1FOE A;  1FHO A;  1WG7 A;  4KHO A;  2P0D A;  1FB8 A;  2MKR A;  2I1K A;  1H4R A;  1GC7 A;  2V76 A;  2M14 A;  1DYN A;  2LOZ A;  1U5E A;  3DXD A;  2DHJ A;  4HAY B;  1AWE A;  3PZD A;  1MK7 B;  2BCJ A;  5D3V A;  2R09 A;  4WVF B;  1K5D B;  1RJ2 A;  3ULB A;  3CIK A;  4F7U P;  4K81 A;  1X86 A;  1WGQ A;  4DXA B;  4PQ0 A;  2J0J A;  4KAX B;  3QBV B;  2X18 A;  4Y94 A;  3SUZ A;  3ODW A;  4GXB A;  4YON A;  1KZG A;  4Z2N A;  4HDO A;  4A6K A;  1UNR A;  2Q13 A;  2YVC A;  2I1J A;  3DXE A;  4BBK A;  4HAV B;  1QQG A;  1TJ6 A;  2IYB A;  5LOP B;  4GZU A;  2M38 A;  5D3W A;  5D27 A;  1PFJ A;  2YS3 A;  3WYF B;  1B55 A;  4HB4 B;  4B6H A;  1BTK A;  2DFK A;  4MY6 A;  3U8Z A;  2JP2 A;  2Z0O A;  1X1G A;  2R0D A;  4F7H A;  2EMS A;  2W2X D;  2YRY A;  1W1H A;  4ZRK A;  5FI1 A;  4K17 A;  2Z0P A;  1SHC A;  2DHK A;  2YS1 A;  2Z0Q A;  1UPQ A;  1KI1 B;  4CHJ A;  3PP2 A;  4CHM A;  1RRP B;  3ODO A;  1X1F A;  1U5G A;  1EGX A;  4EKU A;  2LUL A;  2RUK B;  4HB3 B;  2DYN A;  4NSW A;  4GN1 A;  2PZ1 A;  2VRW B;  3SYX A;  3U7D A;  1WGU A;  1AQC A;  4F7G A;  3KY9 A;  3CXB B;  3PVU A;  1J0W A;  2COD A;  5C5B A;  2DLW A;  1V88 A;  3QWM A;  2IFS A;  4KVG B;  2OTX A;  4P7I A;  2KGX B;  2RGN B;  3DXC A;  5DH9 B;  4HDQ A;  1UPR A;  1PLS A;  2LOX A;  1P5T A;  2QKL A;  3TFM A;  3O96 A;  1UNQ A;  3SV1 A;  5J3T A;  4L6E A;  1P6S A;  5DHF B;  1I2H A;  1MIX A;  2LG1 A;  2K2U A;  1LW3 A;  3ZDT A;  3T06 A;  2LYD A;  2RNR B;  2D9X A;  3LJU X;  2Y8F A;  5JLJ B;  3MPX A;  1KZ7 A;  4YL8 A;  3P6A A;  1FHW A;  3OAN A;  4HAU B;  2DKP A;  1J19 A;  2MWN B;  5JHG A;  1MIZ B;  1WJM A;  4DX9 0;  2YF0 A;  5JHH A;  2OQB A;  2YT1 A;  1WJ1 A;  3AU5 A;  4A6H A;  4EMO A;  2L1C A;  1X05 A;  3SO6 A;  1XR0 B;  1XD4 A;  3KSY A;  3AU4 A;  5DHA B;  3SNH A;  1N3H A;  2HTH B;  1EAZ A;  1V5P A;  2D10 A;  2J0K A;  1U5D A;  1EVH A;  4D0N B;  2DX1 A;  3N7C A;  2ROZ B;  2DYQ A;  2W2W A;  5KQ1 A;  1FHX A;  3FEH A;  4Z2M B;  5C16 A;  3TCA A;  3M1I B;  1U2B A;  1GG3 A;  1MKE A;  2D11 A;  3QIJ A;  3PEG A;  1V61 A;  5C5B B;  1DBH A;  3GYO A;  1BTN A;  1NTV A;  3KRX A;  4DX8 A;  2MFQ A;  1ZC3 B;  3A8P A;  4A6F A;  2GCL A;  1FAO A;  4C0A A;  4HAT B;  2COC A;  5DIF B;  1DDM A;  3V5W A;  5HE2 A;  4DBB A;  4GPT B;  2RSG A;  2KCJ A;  5HE1 A;  2GCJ A;  1M7R A;  3GYP A;  1K5G B;  1V89 A;  2DN6 A;  4K2O A;  3IVF A;  1WVH A;  2J59 M;  2DHI A;  1Q67 A;  1Z87 A;  4GMV A;  4GMX B;  2D4Q A;  2N23 A;  2GS0 A;  1XX0 A;  2H7E A;  4HHV A;  1M7E A;  3KZ1 A;  2Y8G A;  3F5R A;  2ELA A;  3TO1 A;  5KQ4 A;  3D8F A;  1W1G A;  1H10 A;  4HAW B;  3ML4 A;  5J3Y A;  1U29 A;  1FGZ A;  3F0W A;  4HAX B;  4NY0 A;  3TW1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...