2EC1A

Solution structure of the ranbd1 domain from human nucleoporin 50 kda
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
118
structure length
118
Chain Sequence
EVKEEDAFYSKKCKLFYKKDNEFKEKGIGTLHLKPTANQKTQLLVRADTNLGNILLNVLIPPNMPCTRTGKNNVLIVCVPNPPIDEKNATMPVTMLIRVKTSEDADELHKILLEKKDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords Nucleoporin 50 kDa
publication title Solution structure of the RanBD1 domain from human Nucleoporin 50 kDa
rcsb
source organism Homo sapiens
total genus 17
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2007-02-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2ec1A00
2COCA 1DBHA 4Y94A 1M7RA 2RNRB 3P7ZA 4CYEA 1DDVA 2P0FA 3ODWA 2D11A 1AWEA 4KAXB 3UZTA 4C0AA 5HE0A 2MKRA 5GOWB 2GCJA 5EFXA 5HE3A 3HQCA 1EF1A 5D3VA 2YS3A 2I1KA 3N7CA 1UNPA 2D2QA 1ZVRA 1TQZA 1H10A 1U29A 1K5GB 4Z2MB 2DFKA 3TO1A 5CLLB 3ODXA 1P5TA 2L1CA 2R09A 2M14A 2DTCA 2P0DA 4IAPA 4HDQA 3PZDA 3U8ZA 2NMBA 1WJ1A 2OQBA 2KGXB 3ZVRA 2D9YA 2QKLA 1DDWA 4K2OA 1ZC4B 3FEHA 4F7GA 1B55A 3PVUA 4WVFB 3PSCA 3CIKA 2Z0OA 4HB4B 2J0MA 1P3RA 2HTHB 1E5WA 3PP2A 2KCJA 4HHVA 4Z2NA 2DHJA 2LG1A 4PNKA 5JHHA 3DXDA 1PMSA 4HAVB 4XWXA 5KCVA 1IRSA 1KZGA 2DHKA 1BTKA 2DN6A 4L6EA 1BTNA 1NI2A 1WJMA 3ZDTA 3T06A 2ELBA 2RGNB 1W1HA 1OQNA 4DBBA 2J0KA 5D3XA 3PG7A 1MAIA 1K5DB 2MFQA 3VOQA 1SHCA 4WSFA 2D9WA 4A6FB 2EMSA 3KSYA 4HB3B 4KVGB 5C16A 1LB1A 1V5PA 2I1JA 2VSZA 4GPTB 5C79A 2Y8FA 1MK9B 2RVBB 1FHOA 5FI0A 1FB8A 3ULCA 1H4RA 2V76A 2YRYA 4A6FA 4GXBA 1QC6A 5JLJB 2D9XA 5CLQB 1SGHA 3SO6A 1NTYA 2YT0A 2VKIA 2Z0QA 2KUPA 3RCPA 3KRWA 1I7AA 3SYXA 1RRPB 4K81A 2N0YA 1U5GA 4EKUA 2LOXA 2P0HA 1I2HA 4GN1A 4DX8A 2K00A 3A8PA 2ADZA 2Q13A 2ROZB 4F7HA 2IYBA 1UPRA 4ZRJA 4EMOA 2COFA 4A6KA 1U27A 3MPXA 3FM8C 4NY0A 3FSSA 4IFSA 1WG7A 1V5MA 4TKNA 1PFJA 2ELAA 2RUKB 3WYFB 1Q67A 2DYNA 2FJLA 1EGXA 1X86A 5DI9B 4K2PA 3O96A 4A5KA 3D8DA 1MPHA 1NTVA 3DXEA 3MDBC 3P6AA 3QBVB 2Z0PA 5JHGA 5DHFB 2L2IA 2LKOA 4NSWA 4GZUA 5KQ1A 3A98B 3TW1A 1XKEA 1M7EA 2XQNM 2GJYA 1MIXA 3V5WA 2DKQA 1BWNA 3PEGA 1KI1B 1XR0B 3D8EA 3QWMA 1PLSA 2D10A 2PZ1A 1U5FA 1TXDA 2X18A 1MKEA 4DX90 1WGQA 1N3HA 5D27A 2UVMA 5C5BA 1W1DA 1OY2A 2LULA 2I5FA 4PQ0A 3X23A 1W1GA 3GYPA 3KRXA 4KHOA 1FAOA 2RSGA 2P8VA 1Y5OA 1MK7B 1AQCA 1U5DA 3M1IB 2CY5A 4P7IA 3F5RA 1KZ7A 3LJUX 4HB2B 1ZC3B 2DX1A 2DKPA 2LOZA 5HE1A 2EMTA 2J0JA 1Y19B 4MT7A 4H8SA 1WGUA 2J59M 2W2XC 2RLOA 2QKMA 4ZRKA 1FGZA 2MWNB 3BINA 4HAUB 3G9WA 3AJ4A 3CXBB 4HB0B 1MIZB 2YT1A 2YS1A 4HAXB 4D0NB 3A8QA 2YS5A 2ZPYA 1XX0A 3AU4A 1X1GA 5LONB 4EJNA 4CHMA 1QQGA 1X11A 2BCJA 5JP4A 2DA0A 5J3TA 1NU2A 3VIAA 2DHIA 5KQ4A 4GMVA 1XODA 4KHAA 1J19A 1X1FA 3ML4A 3IVFA 1ZSQA 4KHBB 1U2BA 2I5CA 4K17A 3GYOA 3HW2B 2W2XD 5DIFB 3TVVA 1LW3A 2H7DA 5FI1A 4MK0A 4B6HA 4CHJA 2HE7A 4ZRIA 1FGYA 1V61A 1ISNA 2CRFA 3PVWA 4MY6A 3SNHA 2N23A 2R0DA 1GC7A 2UZRA 3SUZA 4F7UP 2DYQA 2Y7BA 4WJ7A 5DH9B 1FHWA 2NZ8B 3ODOA 5L81A 2ROVA 2YVCA 3KZ1A 1WI1A 5C5BB 1FOEA 2M38A 5J3QA 1DROA 1OMWA 3PVLA 5J3YA 1XD4A 2K2UA 3SV1A 1V89A 3U7DA 2EJ8A 1XCGA 1GC6A 1ZM0A 5DHAB 2DX5A 2YF0A 1EAZA 2YSZA 2LYDA 4IOYX 3HK0A 2IFSA 4BBKA 2D4QA 2GCLA 5D3WA 2UZSA 1Z87A 2JP2A 3KY9A 2CY4A 1X05A 1UNQA 3BJIA 3TCAA 2D9ZA 3WA0A 5D3YA 2EC1A 2E2XA 4HAWB 3OANA 1U5EA 2VRWB 1J0WA 4A6HA 5LOPB 4GMXB 3QIJA 4DXAB 3D8FA 2D9VA 5HE2A 4YL8A 1DDMA 2W2WA 2H7EA 1RJ2A 1TJ6A 3NSUA 4HATB 5C6RA 1UNRA 1DYNA 4HAZB 2GS0A 1UEFA 2MDXA 1FHXA 2OTXA 3F0WA 1UPQA 2AEHA 2CODA 4HAYB 1V5UA 4HDOA 2G35A 2AL6A 3AU5A 1V88A 2Y8GA 2CAYA 2COAA 2K2JA 1GG3A 1EVHA 4TYZA 2DLWA 3DXCA 4YONA 1BAKA 1P6SA 3TFMA 3ULBA 1WVHA
chains in the Genus database with same CATH superfamily
2COCA 1DBHA 4Y94A 1M7RA 2RNRB 3P7ZA 4CYEA 1DDVA 2P0FA 3HIEA 3ODWA 2D11A 1AWEA 4KAXB 2Z59A 3UZTA 4C0AA 3NWFA 5HE0A 2MKRA 5GOWB 2GCJA 5EFXA 5HE3A 5I2MA 3HQCA 1EF1A 5D3VA 2YS3A 2I1KA 3N7CA 1UNPA 2D2QA 1ZVRA 1TQZA 1H10A 1U29A 1K5GB 4Z2MB 2DFKA 3TO1A 5CLLB 3ODXA 1P5TA 2L1CA 2R09A 2M14A 4HSIA 2DTCA 2P0DA 4QJ5B 4IAPA 4HDQA 3PZDA 3U8ZA 2NMBA 1WJ1A 2OQBA 2KGXB 3ZVRA 2D9YA 2QKLA 1DDWA 4K2OA 1ZC4B 3FEHA 4F7GA 1B55A 4D6WA 3PVUA 4WVFB 3PSCA 5M4YB 3CIKA 2Z0OA 4HB4B 2J0MA 1P3RA 2HTHB 1E5WA 3PP2A 2Z13A 2KCJA 4HHVA 4Z2NA 2DHJA 2LG1A 4PNKA 5JHHA 3DXDA 1PMSA 4HAVB 5LG4B 3FVCA 4XWXA 5KCVA 1IRSA 1KZGA 2DHKA 1BTKA 2DN6A 2Z4DA 4L6EA 1BTNA 1NI2A 1WJMA 3ZDTA 4QJ3B 3T06A 3B77A 2ELBA 2RGNB 1W1HA 3U12A 1OQNA 2YT2A 4DBBA 2J0KA 5D3XA 2Z14A 3PG7A 1MAIA 1K5DB 2MFQA 3VOQA 1SHCA 4WSFA 2D9WA 4A6FB 3NW8A 2EMSA 3KSYA 2KUQA 2NBVA 4HB3B 4KVGB 5C16A 1LB1A 2R2YA 1V5PA 2I1JA 2VSZA 4GPTB 5C79A 2Y8FA 1MK9B 2RVBB 1FHOA 5FI0A 1FB8A 1ZYIA 3ULCA 1H4RA 2V76A 2YRYA 4A6FA 4L1RA 4GXBA 1QC6A 5JLJB 2D9XA 5CLQB 1SGHA 3SO6A 1NTYA 2YT0A 2VKIA 2Z0QA 2KUPA 3RCPA 3A58A 3KRWA 1I7AA 3SYXA 4DIXA 1RRPB 4K81A 2N0YA 1U5GA 4OT1A 4EKUA 3HSAA 2LOXA 2P0HA 1I2HA 4GN1A 4DX8A 2K00A 3A8PA 2ADZA 2Q13A 2ROZB 4OSNA 4F7HA 2IYBA 1UPRA 4ZRJA 4EMOA 2COFA 4GNKB 4A6KA 1U27A 3MPXA 3FM8C 4NY0A 3FSSA 4IFSA 1WG7A 1V5MA 4TKNA 1PFJA 2ELAA 2RUKB 3WYFB 1Q67A 2DYNA 2FJLA 1EGXA 1X86A 5DI9B 4K2PA 3O96A 4A5KA 3D8DA 1MPHA 1NTVA 3DXEA 2KR0A 3MDBC 3P6AA 3QBVB 2Z0PA 5JHGA 5DHFB 2L2IA 2LKOA 4NSWA 4GZUA 5IRSA 3DCXA 5KQ1A 3A98B 3TW1A 1XKEA 1M7EA 2XQNM 2GJYA 1MIXA 3V5WA 2DKQA 1BWNA 3PEGA 1KI1B 1XR0B 3D8EA 3QWMA 3NWDA 1PLSA 2D10A 2PZ1A 1U5FA 1TXDA 2X18A 1MKEA 4DX90 1WGQA 1N3HA 1T77A 5D27A 2UVMA 2K8EA 5C5BA 1W1DA 1OY2A 2LULA 2I5FA 4PQ0A 3X23A 1W1GA 3GYPA 3OHMB 3KRXA 4KHOA 1FAOA 2RSGA 2P8VA 1Y5OA 1MK7B 1AQCA 1U5DA 3M1IB 2CY5A 4P7IA 3F5RA 1KZ7A 3LJUX 4HB2B 4GOUA 1ZC3B 2DX1A 2DKPA 2LOZA 5HE1A 2EMTA 2J0JA 2ZKMX 1Y19B 4MT7A 4QJ4B 4H8SA 1WGUA 2FJUB 2J59M 2W2XC 2RLOA 2QKMA 4ZRKA 1FGZA 2MWNB 2RRFA 3BINA 4HAUB 3G9WA 3AJ4A 3CXBB 4HB0B 4CSQA 1MIZB 2YT1A 2YS1A 4HAXB 4D0NB 3A8QA 2YS5A 2ZPYA 1XX0A 3AU4A 1X1GA 5LONB 4EJNA 4CHMA 1QQGA 1X11A 2BCJA 5JP4A 2DA0A 5J3TA 1NU2A 3VIAA 2DHIA 5KQ4A 4GMVA 3NWAA 1XODA 4KHAA 1J19A 1X1FA 3ML4A 3IVFA 1ZSQA 4KHBB 1U2BA 2I5CA 4K17A 3GYOA 3HW2B 2W2XD 5DIFB 3TVVA 1LW3A 2KIGA 2H7DA 5FI1A 4MK0A 4B6HA 4CHJA 2HE7A 4ZRIA 1FGYA 1V61A 1ISNA 2CRFA 4KHBA 3PVWA 4MY6A 4QXAB 2N23A 2R0DA 1GC7A 2UZRA 3SNHA 3SUZA 4F7UP 2DYQA 2Y7BA 4WJ7A 5DH9B 1FHWA 2NZ8B 3ODOA 5L81A 2ROVA 2YVCA 3KZ1A 1WI1A 5C5BB 1FOEA 2M38A 5J3QA 1DROA 1OMWA 3PVLA 1MI1A 2K49A 5J3YA 1XD4A 2K2UA 3SV1A 1V89A 3U7DA 2EJ8A 1XCGA 1GC6A 1ZM0A 5DHAB 2DX5A 5I2SA 2YF0A 1EAZA 2YSZA 2LYDA 4IOYX 3HK0A 2IFSA 4BBKA 2D4QA 2GCLA 5D3WA 2UZSA 1Z87A 2JP2A 3KY9A 2CY4A 1X05A 1UNQA 3BJIA 3TCAA 2D9ZA 3WA0A 5D3YA 2EC1A 2E2XA 4HAWB 3OANA 1U5EA 2VRWB 1J0WA 4A6HA 5LOPB 4GMXB 3QIJA 4DXAB 3D8FA 2D9VA 2GUMA 5HE2A 4YL8A 2KIEA 1DDMA 2W2WA 2H7EA 1RJ2A 1TJ6A 3NSUA 4HATB 5C6RA 1UNRA 1DYNA 4HAZB 2GS0A 1UEFA 2MDXA 1FHXA 2OTXA 3F0WA 1UPQA 2AEHA 2CODA 4HAYB 1V5UA 4HDOA 2G35A 2AL6A 3AU5A 1V88A 2Y8GA 2CAYA 2COAA 2K2JA 1GG3A 1EVHA 4TYZA 2DLWA 3DXCA 4YONA 1BAKA 1P6SA 3TFMA 3ULBA 1WVHA
chains in the Genus database with same CATH topology
2COCA 1DBHA 4Y94A 1M7RA 2RNRB 3P7ZA 4CYEA 1DDVA 2P0FA 3ODWA 2D11A 1AWEA 4KAXB 3UZTA 4C0AA 5HE0A 2MKRA 5GOWB 2GCJA 5EFXA 5HE3A 3HQCA 1EF1A 5D3VA 2YS3A 2I1KA 3N7CA 1UNPA 2D2QA 1ZVRA 1TQZA 1H10A 1U29A 1K5GB 4Z2MB 2DFKA 3TO1A 5CLLB 3ODXA 1P5TA 2L1CA 2R09A 2M14A 2DTCA 2P0DA 4IAPA 4HDQA 3PZDA 3U8ZA 2NMBA 1WJ1A 2OQBA 2KGXB 3ZVRA 2D9YA 2QKLA 1DDWA 4K2OA 1ZC4B 3FEHA 4F7GA 1B55A 3PVUA 4WVFB 3PSCA 3CIKA 2Z0OA 4HB4B 2J0MA 1P3RA 2HTHB 1E5WA 3PP2A 2KCJA 4HHVA 4Z2NA 2DHJA 2LG1A 4PNKA 5JHHA 3DXDA 1PMSA 4HAVB 4XWXA 5KCVA 1IRSA 1KZGA 2DHKA 1BTKA 2DN6A 4L6EA 1BTNA 1NI2A 1WJMA 3ZDTA 3T06A 2ELBA 2RGNB 1W1HA 1OQNA 4DBBA 2J0KA 5D3XA 3PG7A 1MAIA 1K5DB 2MFQA 3VOQA 1SHCA 4WSFA 2D9WA 4A6FB 2EMSA 3KSYA 4HB3B 4KVGB 5C16A 1LB1A 1V5PA 2I1JA 2VSZA 4GPTB 5C79A 2Y8FA 1MK9B 2RVBB 1FHOA 5FI0A 1FB8A 3ULCA 1H4RA 2V76A 2YRYA 4A6FA 4GXBA 1QC6A 5JLJB 2D9XA 5CLQB 1SGHA 3SO6A 1NTYA 2YT0A 2VKIA 2Z0QA 2KUPA 3RCPA 3KRWA 1I7AA 3SYXA 1RRPB 4K81A 2N0YA 1U5GA 4EKUA 2LOXA 2P0HA 1I2HA 4GN1A 4DX8A 2K00A 3A8PA 2ADZA 2Q13A 2ROZB 4F7HA 2IYBA 1UPRA 4ZRJA 4EMOA 2COFA 4A6KA 1U27A 3MPXA 3FM8C 4NY0A 3FSSA 4IFSA 1WG7A 1V5MA 4TKNA 1PFJA 2ELAA 2RUKB 3WYFB 1Q67A 2DYNA 2FJLA 1EGXA 1X86A 5DI9B 4K2PA 3O96A 4A5KA 3D8DA 1MPHA 1NTVA 3DXEA 3MDBC 3P6AA 3QBVB 2Z0PA 5JHGA 5DHFB 2L2IA 2LKOA 4NSWA 4GZUA 5KQ1A 3A98B 3TW1A 1XKEA 1M7EA 2XQNM 2GJYA 1MIXA 3V5WA 2DKQA 1BWNA 3PEGA 1KI1B 1XR0B 3D8EA 3QWMA 1PLSA 2D10A 2PZ1A 1U5FA 1TXDA 2X18A 1MKEA 4DX90 1WGQA 1N3HA 5D27A 2UVMA 5C5BA 1W1DA 1OY2A 2LULA 2I5FA 4PQ0A 3X23A 1W1GA 3GYPA 3KRXA 4KHOA 1FAOA 2RSGA 2P8VA 1Y5OA 1MK7B 1AQCA 1U5DA 3M1IB 2CY5A 4P7IA 3F5RA 1KZ7A 3LJUX 4HB2B 1ZC3B 2DX1A 2DKPA 2LOZA 5HE1A 2EMTA 2J0JA 1Y19B 4MT7A 4H8SA 1WGUA 2J59M 2W2XC 2RLOA 2QKMA 4ZRKA 1FGZA 2MWNB 3BINA 4HAUB 3G9WA 3AJ4A 3CXBB 4HB0B 1MIZB 2YT1A 2YS1A 4HAXB 4D0NB 3A8QA 2YS5A 2ZPYA 1XX0A 3AU4A 1X1GA 5LONB 4EJNA 4CHMA 1QQGA 1X11A 2BCJA 5JP4A 2DA0A 5J3TA 1NU2A 3VIAA 2DHIA 5KQ4A 4GMVA 1XODA 4KHAA 1J19A 1X1FA 3ML4A 3IVFA 1ZSQA 4KHBB 1U2BA 2I5CA 4K17A 3GYOA 3HW2B 2W2XD 5DIFB 3TVVA 1LW3A 2H7DA 5FI1A 4MK0A 4B6HA 4CHJA 2HE7A 4ZRIA 1FGYA 1V61A 1ISNA 2CRFA 3PVWA 4MY6A 3SNHA 2N23A 2R0DA 1GC7A 2UZRA 3SUZA 4F7UP 2DYQA 2Y7BA 4WJ7A 5DH9B 1FHWA 2NZ8B 3ODOA 5L81A 2ROVA 2YVCA 3KZ1A 1WI1A 5C5BB 1FOEA 2M38A 5J3QA 1DROA 1OMWA 3PVLA 5J3YA 1XD4A 2K2UA 3SV1A 1V89A 3U7DA 2EJ8A 1XCGA 1GC6A 1ZM0A 5DHAB 2DX5A 2YF0A 1EAZA 2YSZA 2LYDA 4IOYX 3HK0A 2IFSA 4BBKA 2D4QA 2GCLA 5D3WA 2UZSA 1Z87A 2JP2A 3KY9A 2CY4A 1X05A 1UNQA 3BJIA 3TCAA 2D9ZA 3WA0A 5D3YA 2EC1A 2E2XA 4HAWB 3OANA 1U5EA 2VRWB 1J0WA 4A6HA 5LOPB 4GMXB 3QIJA 4DXAB 3D8FA 2D9VA 5HE2A 4YL8A 1DDMA 2W2WA 2H7EA 1RJ2A 1TJ6A 3NSUA 4HATB 5C6RA 1UNRA 1DYNA 4HAZB 2GS0A 1UEFA 2MDXA 1FHXA 2OTXA 3F0WA 1UPQA 2AEHA 2CODA 4HAYB 1V5UA 4HDOA 2G35A 2AL6A 3AU5A 1V88A 2Y8GA 2CAYA 2COAA 2K2JA 1GG3A 1EVHA 4TYZA 2DLWA 3DXCA 4YONA 1BAKA 1P6SA 3TFMA 3ULBA 1WVHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2COC A;  1DBH A;  4Y94 A;  1M7R A;  2RNR B;  3P7Z A;  4CYE A;  1DDV A;  2P0F A;  3ODW A;  2D11 A;  1AWE A;  4KAX B;  3UZT A;  4C0A A;  5HE0 A;  2MKR A;  5GOW B;  2GCJ A;  5EFX A;  5HE3 A;  3HQC A;  1EF1 A;  5D3V A;  2YS3 A;  2I1K A;  3N7C A;  1UNP A;  2D2Q A;  1ZVR A;  1TQZ A;  1H10 A;  1U29 A;  1K5G B;  4Z2M B;  2DFK A;  3TO1 A;  5CLL B;  3ODX A;  1P5T A;  2L1C A;  2R09 A;  2M14 A;  2DTC A;  2P0D A;  4IAP A;  4HDQ A;  3PZD A;  3U8Z A;  2NMB A;  1WJ1 A;  2OQB A;  2KGX B;  3ZVR A;  2D9Y A;  2QKL A;  1DDW A;  4K2O A;  1ZC4 B;  3FEH A;  4F7G A;  1B55 A;  3PVU A;  4WVF B;  3PSC A;  3CIK A;  2Z0O A;  4HB4 B;  2J0M A;  1P3R A;  2HTH B;  1E5W A;  3PP2 A;  2KCJ A;  4HHV A;  4Z2N A;  2DHJ A;  2LG1 A;  4PNK A;  5JHH A;  3DXD A;  1PMS A;  4HAV B;  4XWX A;  5KCV A;  1IRS A;  1KZG A;  2DHK A;  1BTK A;  2DN6 A;  4L6E A;  1BTN A;  1NI2 A;  1WJM A;  3ZDT A;  3T06 A;  2ELB A;  2RGN B;  1W1H A;  1OQN A;  4DBB A;  2J0K A;  5D3X A;  3PG7 A;  1MAI A;  1K5D B;  2MFQ A;  3VOQ A;  1SHC A;  4WSF A;  2D9W A;  4A6F B;  2EMS A;  3KSY A;  4HB3 B;  4KVG B;  5C16 A;  1LB1 A;  1V5P A;  2I1J A;  2VSZ A;  4GPT B;  5C79 A;  2Y8F A;  1MK9 B;  2RVB B;  1FHO A;  5FI0 A;  1FB8 A;  3ULC A;  1H4R A;  2V76 A;  2YRY A;  4A6F A;  4GXB A;  1QC6 A;  5JLJ B;  2D9X A;  5CLQ B;  1SGH A;  3SO6 A;  1NTY A;  2YT0 A;  2VKI A;  2Z0Q A;  2KUP A;  3RCP A;  3KRW A;  1I7A A;  3SYX A;  1RRP B;  4K81 A;  2N0Y A;  1U5G A;  4EKU A;  2LOX A;  2P0H A;  1I2H A;  4GN1 A;  4DX8 A;  2K00 A;  3A8P A;  2ADZ A;  2Q13 A;  2ROZ B;  4F7H A;  2IYB A;  1UPR A;  4ZRJ A;  4EMO A;  2COF A;  4A6K A;  1U27 A;  3MPX A;  3FM8 C;  4NY0 A;  3FSS A;  4IFS A;  1WG7 A;  1V5M A;  4TKN A;  1PFJ A;  2ELA A;  2RUK B;  3WYF B;  1Q67 A;  2DYN A;  2FJL A;  1EGX A;  1X86 A;  5DI9 B;  4K2P A;  3O96 A;  4A5K A;  3D8D A;  1MPH A;  1NTV A;  3DXE A;  3MDB C;  3P6A A;  3QBV B;  2Z0P A;  5JHG A;  5DHF B;  2L2I A;  2LKO A;  4NSW A;  4GZU A;  5KQ1 A;  3A98 B;  3TW1 A;  1XKE A;  1M7E A;  2XQN M;  2GJY A;  1MIX A;  3V5W A;  2DKQ A;  1BWN A;  3PEG A;  1KI1 B;  1XR0 B;  3D8E A;  3QWM A;  1PLS A;  2D10 A;  2PZ1 A;  1U5F A;  1TXD A;  2X18 A;  1MKE A;  4DX9 0;  1WGQ A;  1N3H A;  5D27 A;  2UVM A;  5C5B A;  1W1D A;  1OY2 A;  2LUL A;  2I5F A;  4PQ0 A;  3X23 A;  1W1G A;  3GYP A;  3KRX A;  4KHO A;  1FAO A;  2RSG A;  2P8V A;  1Y5O A;  1MK7 B;  1AQC A;  1U5D A;  3M1I B;  2CY5 A;  4P7I A;  3F5R A;  1KZ7 A;  3LJU X;  4HB2 B;  1ZC3 B;  2DX1 A;  2DKP A;  2LOZ A;  5HE1 A;  2EMT A;  2J0J A;  1Y19 B;  4MT7 A;  4H8S A;  1WGU A;  2J59 M;  2W2X C;  2RLO A;  2QKM A;  4ZRK A;  1FGZ A;  2MWN B;  3BIN A;  4HAU B;  3G9W A;  3AJ4 A;  3CXB B;  4HB0 B;  1MIZ B;  2YT1 A;  2YS1 A;  4HAX B;  4D0N B;  3A8Q A;  2YS5 A;  2ZPY A;  1XX0 A;  3AU4 A;  1X1G A;  5LON B;  4EJN A;  4CHM A;  1QQG A;  1X11 A;  2BCJ A;  5JP4 A;  2DA0 A;  5J3T A;  1NU2 A;  3VIA A;  2DHI A;  5KQ4 A;  4GMV A;  1XOD A;  4KHA A;  1J19 A;  1X1F A;  3ML4 A;  3IVF A;  1ZSQ A;  4KHB B;  1U2B A;  2I5C A;  4K17 A;  3GYO A;  3HW2 B;  2W2X D;  5DIF B;  3TVV A;  1LW3 A;  2H7D A;  5FI1 A;  4MK0 A;  4B6H A;  4CHJ A;  2HE7 A;  4ZRI A;  1FGY A;  1V61 A;  1ISN A;  2CRF A;  3PVW A;  4MY6 A;  3SNH A;  2N23 A;  2R0D A;  1GC7 A;  2UZR A;  3SUZ A;  4F7U P;  2DYQ A;  2Y7B A;  4WJ7 A;  5DH9 B;  1FHW A;  2NZ8 B;  3ODO A;  5L81 A;  2ROV A;  2YVC A;  3KZ1 A;  1WI1 A;  5C5B B;  1FOE A;  2M38 A;  5J3Q A;  1DRO A;  1OMW A;  3PVL A;  5J3Y A;  1XD4 A;  2K2U A;  3SV1 A;  1V89 A;  3U7D A;  2EJ8 A;  1XCG A;  1GC6 A;  1ZM0 A;  5DHA B;  2DX5 A;  2YF0 A;  1EAZ A;  2YSZ A;  2LYD A;  4IOY X;  3HK0 A;  2IFS A;  4BBK A;  2D4Q A;  2GCL A;  5D3W A;  2UZS A;  1Z87 A;  2JP2 A;  3KY9 A;  2CY4 A;  1X05 A;  1UNQ A;  3BJI A;  3TCA A;  2D9Z A;  3WA0 A;  5D3Y A;  2EC1 A;  2E2X A;  4HAW B;  3OAN A;  1U5E A;  2VRW B;  1J0W A;  4A6H A;  5LOP B;  4GMX B;  3QIJ A;  4DXA B;  3D8F A;  2D9V A;  5HE2 A;  4YL8 A;  1DDM A;  2W2W A;  2H7E A;  1RJ2 A;  1TJ6 A;  3NSU A;  4HAT B;  5C6R A;  1UNR A;  1DYN A;  4HAZ B;  2GS0 A;  1UEF A;  2MDX A;  1FHX A;  2OTX A;  3F0W A;  1UPQ A;  2AEH A;  2COD A;  4HAY B;  1V5U A;  4HDO A;  2G35 A;  2AL6 A;  3AU5 A;  1V88 A;  2Y8G A;  2CAY A;  2COA A;  2K2J A;  1GG3 A;  1EVH A;  4TYZ A;  2DLW A;  3DXC A;  4YON A;  1BAK A;  1P6S A;  3TFM A;  3ULB A;  1WVH A; 
#chains in the Genus database with same CATH topology
 2COC A;  1DBH A;  4Y94 A;  1M7R A;  2RNR B;  3P7Z A;  4CYE A;  1DDV A;  2P0F A;  3HIE A;  3ODW A;  2D11 A;  1AWE A;  4KAX B;  2Z59 A;  3UZT A;  4C0A A;  3NWF A;  5HE0 A;  2MKR A;  5GOW B;  2GCJ A;  5EFX A;  5HE3 A;  5I2M A;  3HQC A;  1EF1 A;  5D3V A;  2YS3 A;  2I1K A;  3N7C A;  1UNP A;  2D2Q A;  1ZVR A;  1TQZ A;  1H10 A;  1U29 A;  1K5G B;  4Z2M B;  2DFK A;  3TO1 A;  5CLL B;  3ODX A;  1P5T A;  2L1C A;  2R09 A;  2M14 A;  4HSI A;  2DTC A;  2P0D A;  4QJ5 B;  4IAP A;  4HDQ A;  3PZD A;  3U8Z A;  2NMB A;  1WJ1 A;  2OQB A;  2KGX B;  3ZVR A;  2D9Y A;  2QKL A;  1DDW A;  4K2O A;  1ZC4 B;  3FEH A;  4F7G A;  1B55 A;  4D6W A;  3PVU A;  4WVF B;  3PSC A;  5M4Y B;  3CIK A;  2Z0O A;  4HB4 B;  2J0M A;  1P3R A;  2HTH B;  1E5W A;  3PP2 A;  2Z13 A;  2KCJ A;  4HHV A;  4Z2N A;  2DHJ A;  2LG1 A;  4PNK A;  5JHH A;  3DXD A;  1PMS A;  4HAV B;  5LG4 B;  3FVC A;  4XWX A;  5KCV A;  1IRS A;  1KZG A;  2DHK A;  1BTK A;  2DN6 A;  2Z4D A;  4L6E A;  1BTN A;  1NI2 A;  1WJM A;  3ZDT A;  4QJ3 B;  3T06 A;  3B77 A;  2ELB A;  2RGN B;  1W1H A;  3U12 A;  1OQN A;  2YT2 A;  4DBB A;  2J0K A;  5D3X A;  2Z14 A;  3PG7 A;  1MAI A;  1K5D B;  2MFQ A;  3VOQ A;  1SHC A;  4WSF A;  2D9W A;  4A6F B;  3NW8 A;  2EMS A;  3KSY A;  2KUQ A;  2NBV A;  4HB3 B;  4KVG B;  5C16 A;  1LB1 A;  2R2Y A;  1V5P A;  2I1J A;  2VSZ A;  4GPT B;  5C79 A;  2Y8F A;  1MK9 B;  2RVB B;  1FHO A;  5FI0 A;  1FB8 A;  1ZYI A;  3ULC A;  1H4R A;  2V76 A;  2YRY A;  4A6F A;  4L1R A;  4GXB A;  1QC6 A;  5JLJ B;  2D9X A;  5CLQ B;  1SGH A;  3SO6 A;  1NTY A;  2YT0 A;  2VKI A;  2Z0Q A;  2KUP A;  3RCP A;  3A58 A;  3KRW A;  1I7A A;  3SYX A;  4DIX A;  1RRP B;  4K81 A;  2N0Y A;  1U5G A;  4OT1 A;  4EKU A;  3HSA A;  2LOX A;  2P0H A;  1I2H A;  4GN1 A;  4DX8 A;  2K00 A;  3A8P A;  2ADZ A;  2Q13 A;  2ROZ B;  4OSN A;  4F7H A;  2IYB A;  1UPR A;  4ZRJ A;  4EMO A;  2COF A;  4GNK B;  4A6K A;  1U27 A;  3MPX A;  3FM8 C;  4NY0 A;  3FSS A;  4IFS A;  1WG7 A;  1V5M A;  4TKN A;  1PFJ A;  2ELA A;  2RUK B;  3WYF B;  1Q67 A;  2DYN A;  2FJL A;  1EGX A;  1X86 A;  5DI9 B;  4K2P A;  3O96 A;  4A5K A;  3D8D A;  1MPH A;  1NTV A;  3DXE A;  2KR0 A;  3MDB C;  3P6A A;  3QBV B;  2Z0P A;  5JHG A;  5DHF B;  2L2I A;  2LKO A;  4NSW A;  4GZU A;  5IRS A;  3DCX A;  5KQ1 A;  3A98 B;  3TW1 A;  1XKE A;  1M7E A;  2XQN M;  2GJY A;  1MIX A;  3V5W A;  2DKQ A;  1BWN A;  3PEG A;  1KI1 B;  1XR0 B;  3D8E A;  3QWM A;  3NWD A;  1PLS A;  2D10 A;  2PZ1 A;  1U5F A;  1TXD A;  2X18 A;  1MKE A;  4DX9 0;  1WGQ A;  1N3H A;  1T77 A;  5D27 A;  2UVM A;  2K8E A;  5C5B A;  1W1D A;  1OY2 A;  2LUL A;  2I5F A;  4PQ0 A;  3X23 A;  1W1G A;  3GYP A;  3OHM B;  3KRX A;  4KHO A;  1FAO A;  2RSG A;  2P8V A;  1Y5O A;  1MK7 B;  1AQC A;  1U5D A;  3M1I B;  2CY5 A;  4P7I A;  3F5R A;  1KZ7 A;  3LJU X;  4HB2 B;  4GOU A;  1ZC3 B;  2DX1 A;  2DKP A;  2LOZ A;  5HE1 A;  2EMT A;  2J0J A;  2ZKM X;  1Y19 B;  4MT7 A;  4QJ4 B;  4H8S A;  1WGU A;  2FJU B;  2J59 M;  2W2X C;  2RLO A;  2QKM A;  4ZRK A;  1FGZ A;  2MWN B;  2RRF A;  3BIN A;  4HAU B;  3G9W A;  3AJ4 A;  3CXB B;  4HB0 B;  4CSQ A;  1MIZ B;  2YT1 A;  2YS1 A;  4HAX B;  4D0N B;  3A8Q A;  2YS5 A;  2ZPY A;  1XX0 A;  3AU4 A;  1X1G A;  5LON B;  4EJN A;  4CHM A;  1QQG A;  1X11 A;  2BCJ A;  5JP4 A;  2DA0 A;  5J3T A;  1NU2 A;  3VIA A;  2DHI A;  5KQ4 A;  4GMV A;  3NWA A;  1XOD A;  4KHA A;  1J19 A;  1X1F A;  3ML4 A;  3IVF A;  1ZSQ A;  4KHB B;  1U2B A;  2I5C A;  4K17 A;  3GYO A;  3HW2 B;  2W2X D;  5DIF B;  3TVV A;  1LW3 A;  2KIG A;  2H7D A;  5FI1 A;  4MK0 A;  4B6H A;  4CHJ A;  2HE7 A;  4ZRI A;  1FGY A;  1V61 A;  1ISN A;  2CRF A;  4KHB A;  3PVW A;  4MY6 A;  4QXA B;  2N23 A;  2R0D A;  1GC7 A;  2UZR A;  3SNH A;  3SUZ A;  4F7U P;  2DYQ A;  2Y7B A;  4WJ7 A;  5DH9 B;  1FHW A;  2NZ8 B;  3ODO A;  5L81 A;  2ROV A;  2YVC A;  3KZ1 A;  1WI1 A;  5C5B B;  1FOE A;  2M38 A;  5J3Q A;  1DRO A;  1OMW A;  3PVL A;  1MI1 A;  2K49 A;  5J3Y A;  1XD4 A;  2K2U A;  3SV1 A;  1V89 A;  3U7D A;  2EJ8 A;  1XCG A;  1GC6 A;  1ZM0 A;  5DHA B;  2DX5 A;  5I2S A;  2YF0 A;  1EAZ A;  2YSZ A;  2LYD A;  4IOY X;  3HK0 A;  2IFS A;  4BBK A;  2D4Q A;  2GCL A;  5D3W A;  2UZS A;  1Z87 A;  2JP2 A;  3KY9 A;  2CY4 A;  1X05 A;  1UNQ A;  3BJI A;  3TCA A;  2D9Z A;  3WA0 A;  5D3Y A;  2EC1 A;  2E2X A;  4HAW B;  3OAN A;  1U5E A;  2VRW B;  1J0W A;  4A6H A;  5LOP B;  4GMX B;  3QIJ A;  4DXA B;  3D8F A;  2D9V A;  2GUM A;  5HE2 A;  4YL8 A;  2KIE A;  1DDM A;  2W2W A;  2H7E A;  1RJ2 A;  1TJ6 A;  3NSU A;  4HAT B;  5C6R A;  1UNR A;  1DYN A;  4HAZ B;  2GS0 A;  1UEF A;  2MDX A;  1FHX A;  2OTX A;  3F0W A;  1UPQ A;  2AEH A;  2COD A;  4HAY B;  1V5U A;  4HDO A;  2G35 A;  2AL6 A;  3AU5 A;  1V88 A;  2Y8G A;  2CAY A;  2COA A;  2K2J A;  1GG3 A;  1EVH A;  4TYZ A;  2DLW A;  3DXC A;  4YON A;  1BAK A;  1P6S A;  3TFM A;  3ULB A;  1WVH A; 
#chains in the Genus database with same CATH homology
 2COC A;  1DBH A;  4Y94 A;  1M7R A;  2RNR B;  3P7Z A;  4CYE A;  1DDV A;  2P0F A;  3ODW A;  2D11 A;  1AWE A;  4KAX B;  3UZT A;  4C0A A;  5HE0 A;  2MKR A;  5GOW B;  2GCJ A;  5EFX A;  5HE3 A;  3HQC A;  1EF1 A;  5D3V A;  2YS3 A;  2I1K A;  3N7C A;  1UNP A;  2D2Q A;  1ZVR A;  1TQZ A;  1H10 A;  1U29 A;  1K5G B;  4Z2M B;  2DFK A;  3TO1 A;  5CLL B;  3ODX A;  1P5T A;  2L1C A;  2R09 A;  2M14 A;  2DTC A;  2P0D A;  4IAP A;  4HDQ A;  3PZD A;  3U8Z A;  2NMB A;  1WJ1 A;  2OQB A;  2KGX B;  3ZVR A;  2D9Y A;  2QKL A;  1DDW A;  4K2O A;  1ZC4 B;  3FEH A;  4F7G A;  1B55 A;  3PVU A;  4WVF B;  3PSC A;  3CIK A;  2Z0O A;  4HB4 B;  2J0M A;  1P3R A;  2HTH B;  1E5W A;  3PP2 A;  2KCJ A;  4HHV A;  4Z2N A;  2DHJ A;  2LG1 A;  4PNK A;  5JHH A;  3DXD A;  1PMS A;  4HAV B;  4XWX A;  5KCV A;  1IRS A;  1KZG A;  2DHK A;  1BTK A;  2DN6 A;  4L6E A;  1BTN A;  1NI2 A;  1WJM A;  3ZDT A;  3T06 A;  2ELB A;  2RGN B;  1W1H A;  1OQN A;  4DBB A;  2J0K A;  5D3X A;  3PG7 A;  1MAI A;  1K5D B;  2MFQ A;  3VOQ A;  1SHC A;  4WSF A;  2D9W A;  4A6F B;  2EMS A;  3KSY A;  4HB3 B;  4KVG B;  5C16 A;  1LB1 A;  1V5P A;  2I1J A;  2VSZ A;  4GPT B;  5C79 A;  2Y8F A;  1MK9 B;  2RVB B;  1FHO A;  5FI0 A;  1FB8 A;  3ULC A;  1H4R A;  2V76 A;  2YRY A;  4A6F A;  4GXB A;  1QC6 A;  5JLJ B;  2D9X A;  5CLQ B;  1SGH A;  3SO6 A;  1NTY A;  2YT0 A;  2VKI A;  2Z0Q A;  2KUP A;  3RCP A;  3KRW A;  1I7A A;  3SYX A;  1RRP B;  4K81 A;  2N0Y A;  1U5G A;  4EKU A;  2LOX A;  2P0H A;  1I2H A;  4GN1 A;  4DX8 A;  2K00 A;  3A8P A;  2ADZ A;  2Q13 A;  2ROZ B;  4F7H A;  2IYB A;  1UPR A;  4ZRJ A;  4EMO A;  2COF A;  4A6K A;  1U27 A;  3MPX A;  3FM8 C;  4NY0 A;  3FSS A;  4IFS A;  1WG7 A;  1V5M A;  4TKN A;  1PFJ A;  2ELA A;  2RUK B;  3WYF B;  1Q67 A;  2DYN A;  2FJL A;  1EGX A;  1X86 A;  5DI9 B;  4K2P A;  3O96 A;  4A5K A;  3D8D A;  1MPH A;  1NTV A;  3DXE A;  3MDB C;  3P6A A;  3QBV B;  2Z0P A;  5JHG A;  5DHF B;  2L2I A;  2LKO A;  4NSW A;  4GZU A;  5KQ1 A;  3A98 B;  3TW1 A;  1XKE A;  1M7E A;  2XQN M;  2GJY A;  1MIX A;  3V5W A;  2DKQ A;  1BWN A;  3PEG A;  1KI1 B;  1XR0 B;  3D8E A;  3QWM A;  1PLS A;  2D10 A;  2PZ1 A;  1U5F A;  1TXD A;  2X18 A;  1MKE A;  4DX9 0;  1WGQ A;  1N3H A;  5D27 A;  2UVM A;  5C5B A;  1W1D A;  1OY2 A;  2LUL A;  2I5F A;  4PQ0 A;  3X23 A;  1W1G A;  3GYP A;  3KRX A;  4KHO A;  1FAO A;  2RSG A;  2P8V A;  1Y5O A;  1MK7 B;  1AQC A;  1U5D A;  3M1I B;  2CY5 A;  4P7I A;  3F5R A;  1KZ7 A;  3LJU X;  4HB2 B;  1ZC3 B;  2DX1 A;  2DKP A;  2LOZ A;  5HE1 A;  2EMT A;  2J0J A;  1Y19 B;  4MT7 A;  4H8S A;  1WGU A;  2J59 M;  2W2X C;  2RLO A;  2QKM A;  4ZRK A;  1FGZ A;  2MWN B;  3BIN A;  4HAU B;  3G9W A;  3AJ4 A;  3CXB B;  4HB0 B;  1MIZ B;  2YT1 A;  2YS1 A;  4HAX B;  4D0N B;  3A8Q A;  2YS5 A;  2ZPY A;  1XX0 A;  3AU4 A;  1X1G A;  5LON B;  4EJN A;  4CHM A;  1QQG A;  1X11 A;  2BCJ A;  5JP4 A;  2DA0 A;  5J3T A;  1NU2 A;  3VIA A;  2DHI A;  5KQ4 A;  4GMV A;  1XOD A;  4KHA A;  1J19 A;  1X1F A;  3ML4 A;  3IVF A;  1ZSQ A;  4KHB B;  1U2B A;  2I5C A;  4K17 A;  3GYO A;  3HW2 B;  2W2X D;  5DIF B;  3TVV A;  1LW3 A;  2H7D A;  5FI1 A;  4MK0 A;  4B6H A;  4CHJ A;  2HE7 A;  4ZRI A;  1FGY A;  1V61 A;  1ISN A;  2CRF A;  3PVW A;  4MY6 A;  3SNH A;  2N23 A;  2R0D A;  1GC7 A;  2UZR A;  3SUZ A;  4F7U P;  2DYQ A;  2Y7B A;  4WJ7 A;  5DH9 B;  1FHW A;  2NZ8 B;  3ODO A;  5L81 A;  2ROV A;  2YVC A;  3KZ1 A;  1WI1 A;  5C5B B;  1FOE A;  2M38 A;  5J3Q A;  1DRO A;  1OMW A;  3PVL A;  5J3Y A;  1XD4 A;  2K2U A;  3SV1 A;  1V89 A;  3U7D A;  2EJ8 A;  1XCG A;  1GC6 A;  1ZM0 A;  5DHA B;  2DX5 A;  2YF0 A;  1EAZ A;  2YSZ A;  2LYD A;  4IOY X;  3HK0 A;  2IFS A;  4BBK A;  2D4Q A;  2GCL A;  5D3W A;  2UZS A;  1Z87 A;  2JP2 A;  3KY9 A;  2CY4 A;  1X05 A;  1UNQ A;  3BJI A;  3TCA A;  2D9Z A;  3WA0 A;  5D3Y A;  2EC1 A;  2E2X A;  4HAW B;  3OAN A;  1U5E A;  2VRW B;  1J0W A;  4A6H A;  5LOP B;  4GMX B;  3QIJ A;  4DXA B;  3D8F A;  2D9V A;  5HE2 A;  4YL8 A;  1DDM A;  2W2W A;  2H7E A;  1RJ2 A;  1TJ6 A;  3NSU A;  4HAT B;  5C6R A;  1UNR A;  1DYN A;  4HAZ B;  2GS0 A;  1UEF A;  2MDX A;  1FHX A;  2OTX A;  3F0W A;  1UPQ A;  2AEH A;  2COD A;  4HAY B;  1V5U A;  4HDO A;  2G35 A;  2AL6 A;  3AU5 A;  1V88 A;  2Y8G A;  2CAY A;  2COA A;  2K2J A;  1GG3 A;  1EVH A;  4TYZ A;  2DLW A;  3DXC A;  4YON A;  1BAK A;  1P6S A;  3TFM A;  3ULB A;  1WVH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...