2EC1A

Solution structure of the ranbd1 domain from human nucleoporin 50 kda
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
118
structure length
118
Chain Sequence
b'EVKEEDAFYSKKCKLFYKKDNEFKEKGIGTLHLKPTANQKTQLLVRADTNLGNILLNVLIPPNMPCTRTGKNNVLIVCVPNPPIDEKNATMPVTMLIRVKTSEDADELHKILLEKKDA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nucleoporin 50 kDa
publication title Solution structure of the RanBD1 domain from human Nucleoporin 50 kDa
rcsb
source organism Homo sapiens
molecule tags Transport protein
total genus 17
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2007-02-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2ec1A00
2COAA 3HW2B 1E5WA 4IAPA 3FM8C 2YS1A 1X86A 3X23A 3G9WA 3TCAA 4K2OA 1J19A 1SHCA 3QIJA 3BJIA 3ZDTA 4WSFA 2LG1A 1EGXA 3PG7A 2EC1A 3CXBB 4HAUB 2J0JA 4B6HA 2FJLA 2D2QA 2CRFA 2I5CA 5FI1A 1AWEA 1UPQA 2CAYA 3QBVB 2K2JA 3KRWA 3RCPA 2RNRB 1QC6A 2DHIA 1Q67A 4D0NB 2MKRA 2PZ1A 2DN6A 2YVCA 2DKQA 1AQCA 4HB4B 3BINA 1X1GA 5J3QA 1P3RA 3QWMA 2V76A 2LOZA 2D9VA 3VOQA 4HAXB 1OQNA 4HAWB 2RLOA 1LW3A 2YS3A 2BCJA 3PEGA 5JP4A 4A6FB 4YONA 2LYDA 5KCVA 1U29A 3P6AA 4EKUA 2YT1A 5C5BA 2RVBB 4IFSA 1K5DB 1M7RA 4WVFB 1WJ1A 4ZRIA 5HE0A 1FHXA 2COCA 2DLWA 3KSYA 1H4RA 1I2HA 4KHBB 1W1HA 2IFSA 1NTYA 1NU2A 2GCJA 2G35A 1FHWA 2COFA 4DX90 5DHAB 1EAZA 4CHMA 2YSZA 2DTCA 1IRSA 4K81A 1FGYA 1TXDA 1DDVA 2D9YA 2CY4A 2D9ZA 3MPXA 4GXBA 3F0WA 1DDMA 2DHKA 3NSUA 5KQ4A 4KHAA 5JHHA 1K5GB 2K00A 2R0DA 2IYBA 4F7GA 3TO1A 5C79A 1ZVRA 3KY9A 2L1CA 5JHGA 3PVWA 4Z2NA 4WJ7A 1ZSQA 2KGXB 3TVVA 4PNKA 1UNQA 3AJ4A 4GMXB 1PMSA 1GC7A 3U7DA 1OY2A 3CIKA 3ML4A 4BBKA 4GMVA 2CY5A 2H7EA 1XODA 2ROZB 4KVGB 3D8EA 1TJ6A 3PZDA 1NI2A 3HK0A 1KZGA 2W2XD 4HDQA 3FSSA 4HAZB 2HE7A 1U5DA 1W1DA 1DDWA 3ODWA 2YT0A 2DX5A 2H7DA 5D3XA 2P0DA 4H8SA 2ADZA 1U2BA 4Z2MB 1MK9B 2EMTA 2QKMA 1FOEA 1WVHA 1UEFA 1FB8A 5D3WA 4ZRKA 4DBBA 4F7HA 4KAXB 4HHVA 3O96A 5D3VA 3ULBA 5JLJB 3F5RA 2OQBA 1V5PA 4HB0B 1OMWA 1WI1A 2I5FA 5CLQB 2RSGA 3SUZA 3KZ1A 2MWNB 1Y5OA 4XWXA 3OANA 5D3YA 1QQGA 5J3YA 3PVLA 5LONB 4P7IA 3VIAA 2ELBA 1XD4A 1PFJA 3A8PA 1XR0B 4A6FA 4MY6A 2AEHA 1EF1A 3MDBC 1ZC4B 2MDXA 4IOYX 4HAYB 2VSZA 1BTKA 3A98B 3ODOA 3HQCA 4K17A 3V5WA 1DBHA 1PLSA 4HB2B 5DI9B 3SNHA 2I1JA 1V5UA 4HDOA 3KRXA 1KZ7A 1RRPB 5FI0A 2Z0OA 2D11A 2XQNM 1J0WA 2M14A 2UZSA 3PVUA 1ISNA 4F7UP 3A8QA 3DXCA 3PP2A 2GCLA 2P0FA 2P0HA 3P7ZA 3FEHA 3TW1A 2NZ8B 1BAKA 1XCGA 1M7EA 5DIFB 4GZUA 2R09A 1W1GA 4NY0A 3PSCA 5DH9B 4PQ0A 4NSWA 2EJ8A 2YF0A 2LOXA 3U8ZA 3WA0A 1X05A 1FGZA 1MKEA 2DYNA 4K2PA 5KQ1A 1GG3A 1MAIA 4C0AA 2GJYA 4CHJA 1U27A 3AU5A 2UZRA 2YS5A 2J0KA 4EMOA 2MFQA 2D4QA 1V88A 1N3HA 2ZPYA 3UZTA 1U5GA 4A6HA 2ROVA 2CODA 2N23A 1H10A 2J0MA 2DYQA 1ZC3B 1MPHA 1NTVA 1BTNA 2Y8FA 4A5KA 2I1KA 1X1FA 1I7AA 5C6RA 2LULA 2DHJA 4Y94A 1RJ2A 2OTXA 3GYPA 1MK7B 2Y7BA 2Y8GA 4L6EA 4MT7A 2KUPA 2L2IA 3ODXA 2NMBA 4MK0A 5GOWB 4ZRJA 2W2WA 4KHOA 1FHOA 1UNPA 1XX0A 2VRWB 3T06A 1MIZB 4TKNA 4DXAB 1B55A 3N7CA 1WG7A 3IVFA 1U5FA 1WJMA 1SGHA 3DXEA 2QKLA 5J3TA 1WGUA 3M1IB 1V61A 1KI1B 4DX8A 4GN1A 2HTHB 4CYEA 2RGNB 2LKOA 2UVMA 5C5BB 2W2XC 4HATB 2DFKA 1UPRA 1U5EA 4HB3B 5CLLB 2K2UA 1P6SA 3SYXA 2ELAA 1DYNA 3ULCA 2DA0A 2YRYA 2JP2A 2E2XA 3WYFB 4HAVB 1UNRA 2EMSA 1X11A 2Z0PA 1BWNA 3DXDA 1Z87A 1TQZA 2Z0QA 5HE1A 1WGQA 5C16A 2DKPA 1GC6A 2KCJA 5LOPB 5EFXA 2D9WA 4YL8A 2D10A 3D8DA 3AU4A 3ZVRA 2J59M 1ZM0A 1FAOA 2N0YA 5DHFB 3SV1A 1LB1A 3TFMA 2X18A 1XKEA 2AL6A 3SO6A 2RUKB 3GYOA 5HE3A 1EVHA 5D27A 2M38A 1V89A 3LJUX 4GPTB 1V5MA 1P5TA 1MIXA 2GS0A 5HE2A 4TYZA 4EJNA 1DROA 4A6KA 1Y19B 2Q13A 3D8FA 2P8VA 2D9XA 5L81A 2VKIA 2DX1A
chains in the Genus database with same CATH superfamily
2KR0A 2ZKMX 2COAA 3HW2B 3NWFA 1E5WA 4IAPA 3FM8C 2YS1A 1X86A 3X23A 3G9WA 3TCAA 4K2OA 1J19A 1SHCA 3QIJA 3BJIA 3ZDTA 4WSFA 4CSQA 2LG1A 1EGXA 3NW8A 3NWDA 3PG7A 2EC1A 3CXBB 4HAUB 4OSNA 2J0JA 4B6HA 2FJLA 2D2QA 2CRFA 2I5CA 5FI1A 1AWEA 1UPQA 5I2MA 2CAYA 3QBVB 2K2JA 3KRWA 3RCPA 2RNRB 1QC6A 2DHIA 1Q67A 4D0NB 2MKRA 2PZ1A 2DN6A 2FJUB 2YVCA 2DKQA 1AQCA 4HB4B 3BINA 1X1GA 5J3QA 1P3RA 3QWMA 2V76A 3A58A 2LOZA 2D9VA 3VOQA 4HAXB 1OQNA 4HAWB 2RLOA 1LW3A 2YS3A 2BCJA 3PEGA 5JP4A 4A6FB 4YONA 2LYDA 5KCVA 1U29A 3P6AA 4EKUA 2YT1A 5C5BA 2RVBB 4IFSA 1K5DB 1M7RA 4QJ5B 4WVFB 1WJ1A 4ZRIA 5HE0A 1FHXA 2COCA 2DLWA 3KSYA 3FVCA 1H4RA 1I2HA 4KHBB 1W1HA 2IFSA 2KIEA 1NTYA 1NU2A 2GCJA 2G35A 1FHWA 2COFA 4DX90 3NWAA 5DHAB 1EAZA 4CHMA 2YSZA 2DTCA 1IRSA 3DCXA 4K81A 1FGYA 1TXDA 1DDVA 2D9YA 2CY4A 2D9ZA 2DX1A 3MPXA 4GXBA 3F0WA 1DDMA 2DHKA 3NSUA 5KQ4A 4KHAA 5JHHA 1K5GB 2K00A 2R0DA 2IYBA 4F7GA 3TO1A 5C79A 1ZVRA 3KY9A 2L1CA 5JHGA 3PVWA 4Z2NA 4WJ7A 1ZSQA 2KGXB 3TVVA 4PNKA 1UNQA 3AJ4A 4GMXB 1PMSA 1GC7A 3U7DA 1OY2A 3CIKA 3ML4A 4BBKA 4GMVA 2CY5A 2H7EA 1XODA 2ROZB 4KVGB 3D8EA 1TJ6A 3PZDA 1NI2A 3HK0A 1KZGA 2W2XD 4HDQA 3FSSA 4HAZB 2HE7A 1U5DA 1W1DA 1DDWA 3ODWA 2YT0A 2DX5A 2H7DA 5D3XA 2P0DA 4H8SA 2ADZA 1U2BA 4Z2MB 1MK9B 1ZYIA 2EMTA 2QKMA 1FOEA 1WVHA 1UEFA 1FB8A 5D3WA 4ZRKA 4DBBA 4F7HA 4KAXB 4HHVA 3O96A 5D3VA 3ULBA 4HSIA 5M4YB 5JLJB 3F5RA 5I2SA 3B77A 2OQBA 1V5PA 4HB0B 2RRFA 1OMWA 1WI1A 2I5FA 5CLQB 2RSGA 3SUZA 3KZ1A 2MWNB 1Y5OA 4XWXA 3OANA 5D3YA 1QQGA 5J3YA 3PVLA 5LONB 4P7IA 3VIAA 2ELBA 1XD4A 1PFJA 3A8PA 1XR0B 4A6FA 4MY6A 2AEHA 1EF1A 2GUMA 3MDBC 1ZC4B 2MDXA 4IOYX 4HAYB 2VSZA 1BTKA 3A98B 3ODOA 3HQCA 4K17A 3V5WA 1DBHA 4GOUA 1PLSA 4HB2B 5DI9B 4KHBA 3SNHA 2I1JA 1V5UA 4HDOA 3KRXA 1KZ7A 1RRPB 5FI0A 2Z0OA 2D11A 2XQNM 1J0WA 2M14A 5IRSA 2UZSA 3PVUA 1ISNA 4F7UP 3A8QA 3DXCA 3PP2A 2GCLA 2P0FA 2P0HA 3P7ZA 3FEHA 3TW1A 2NZ8B 1BAKA 1XCGA 1M7EA 5DIFB 4GZUA 2R09A 1W1GA 4NY0A 3PSCA 5DH9B 4PQ0A 4NSWA 2EJ8A 2YF0A 2LOXA 3U8ZA 3WA0A 1X05A 1FGZA 1MKEA 2DYNA 3OHMB 4K2PA 2R2YA 5KQ1A 1GG3A 1MAIA 4C0AA 2GJYA 4CHJA 1U27A 3AU5A 2UZRA 2YS5A 2J0KA 4EMOA 2MFQA 2D4QA 1V88A 1N3HA 2ZPYA 3UZTA 1U5GA 4A6HA 2ROVA 2CODA 2N23A 1H10A 2J0MA 2DYQA 1ZC3B 1MPHA 1NTVA 3U12A 1BTNA 2K49A 2NBVA 2Y8FA 4A5KA 2I1KA 1X1FA 1I7AA 5C6RA 5LG4B 2LULA 2DHJA 4Y94A 1RJ2A 2OTXA 3GYPA 1MK7B 2Y7BA 2Y8GA 4L6EA 4MT7A 2KUPA 2L2IA 3ODXA 2NMBA 4MK0A 5GOWB 4ZRJA 2W2WA 4KHOA 1FHOA 1UNPA 1XX0A 2VRWB 3T06A 1MIZB 4TKNA 4DXAB 1B55A 3N7CA 2KIGA 1WG7A 3IVFA 1U5FA 1WJMA 1SGHA 3DXEA 2QKLA 4OT1A 5J3TA 1WGUA 3M1IB 1V61A 1KI1B 4DX8A 2KUQA 4GN1A 2HTHB 4CYEA 2RGNB 2LKOA 2UVMA 5C5BB 2W2XC 4HATB 2DFKA 1UPRA 1U5EA 4HB3B 5CLLB 2K2UA 1P6SA 3SYXA 2Z59A 4L1RA 3HIEA 2Z13A 2ELAA 1DYNA 3ULCA 2Z14A 2DA0A 2YT2A 2YRYA 2JP2A 2E2XA 3WYFB 4HAVB 1UNRA 2EMSA 1X11A 2Z0PA 1BWNA 3DXDA 1Z87A 1TQZA 2Z0QA 5HE1A 1WGQA 5C16A 2DKPA 1GC6A 2KCJA 1T77A 5LOPB 5EFXA 2D9WA 4YL8A 2D10A 3HSAA 3D8DA 3AU4A 3ZVRA 2J59M 4GNKB 1ZM0A 1FAOA 2N0YA 5DHFB 4QJ3B 3SV1A 1LB1A 3TFMA 4DIXA 2X18A 1XKEA 2AL6A 3SO6A 2RUKB 3GYOA 5HE3A 1EVHA 4QXAB 5D27A 2M38A 1V89A 3LJUX 4QJ4B 2Z4DA 4GPTB 1V5MA 1P5TA 1MIXA 2GS0A 4D6WA 1MI1A 5HE2A 4TYZA 4EJNA 1DROA 4A6KA 1Y19B 2Q13A 3D8FA 2P8VA 2D9XA 5L81A 2VKIA 2K8EA
chains in the Genus database with same CATH topology
2COAA 3HW2B 1E5WA 4IAPA 3FM8C 2YS1A 1X86A 3X23A 3G9WA 3TCAA 4K2OA 1J19A 1SHCA 3QIJA 3BJIA 3ZDTA 4WSFA 2LG1A 1EGXA 3PG7A 2EC1A 3CXBB 4HAUB 2J0JA 4B6HA 2FJLA 2D2QA 2CRFA 2I5CA 5FI1A 1AWEA 1UPQA 2CAYA 3QBVB 2K2JA 3KRWA 3RCPA 2RNRB 1QC6A 2DHIA 1Q67A 4D0NB 2MKRA 2PZ1A 2DN6A 2YVCA 2DKQA 1AQCA 4HB4B 3BINA 1X1GA 5J3QA 1P3RA 3QWMA 2V76A 2LOZA 2D9VA 3VOQA 4HAXB 1OQNA 4HAWB 2RLOA 1LW3A 2YS3A 2BCJA 3PEGA 5JP4A 4A6FB 4YONA 2LYDA 5KCVA 1U29A 3P6AA 4EKUA 2YT1A 5C5BA 2RVBB 4IFSA 1K5DB 1M7RA 4WVFB 1WJ1A 4ZRIA 5HE0A 1FHXA 2COCA 2DLWA 3KSYA 1H4RA 1I2HA 4KHBB 1W1HA 2IFSA 1NTYA 1NU2A 2GCJA 2G35A 1FHWA 2COFA 4DX90 5DHAB 1EAZA 4CHMA 2YSZA 2DTCA 1IRSA 4K81A 1FGYA 1TXDA 1DDVA 2D9YA 2CY4A 2D9ZA 3MPXA 4GXBA 3F0WA 1DDMA 2DHKA 3NSUA 5KQ4A 4KHAA 5JHHA 1K5GB 2K00A 2R0DA 2IYBA 4F7GA 3TO1A 5C79A 1ZVRA 3KY9A 2L1CA 5JHGA 3PVWA 4Z2NA 4WJ7A 1ZSQA 2KGXB 3TVVA 4PNKA 1UNQA 3AJ4A 4GMXB 1PMSA 1GC7A 3U7DA 1OY2A 3CIKA 3ML4A 4BBKA 4GMVA 2CY5A 2H7EA 1XODA 2ROZB 4KVGB 3D8EA 1TJ6A 3PZDA 1NI2A 3HK0A 1KZGA 2W2XD 4HDQA 3FSSA 4HAZB 2HE7A 1U5DA 1W1DA 1DDWA 3ODWA 2YT0A 2DX5A 2H7DA 5D3XA 2P0DA 4H8SA 2ADZA 1U2BA 4Z2MB 1MK9B 2EMTA 2QKMA 1FOEA 1WVHA 1UEFA 1FB8A 5D3WA 4ZRKA 4DBBA 4F7HA 4KAXB 4HHVA 3O96A 5D3VA 3ULBA 5JLJB 3F5RA 2OQBA 1V5PA 4HB0B 1OMWA 1WI1A 2I5FA 5CLQB 2RSGA 3SUZA 3KZ1A 2MWNB 1Y5OA 4XWXA 3OANA 5D3YA 1QQGA 5J3YA 3PVLA 5LONB 4P7IA 3VIAA 2ELBA 1XD4A 1PFJA 3A8PA 1XR0B 4A6FA 4MY6A 2AEHA 1EF1A 3MDBC 1ZC4B 2MDXA 4IOYX 4HAYB 2VSZA 1BTKA 3A98B 3ODOA 3HQCA 4K17A 3V5WA 1DBHA 1PLSA 4HB2B 5DI9B 3SNHA 2I1JA 1V5UA 4HDOA 3KRXA 1KZ7A 1RRPB 5FI0A 2Z0OA 2D11A 2XQNM 1J0WA 2M14A 2UZSA 3PVUA 1ISNA 4F7UP 3A8QA 3DXCA 3PP2A 2GCLA 2P0FA 2P0HA 3P7ZA 3FEHA 3TW1A 2NZ8B 1BAKA 1XCGA 1M7EA 5DIFB 4GZUA 2R09A 1W1GA 4NY0A 3PSCA 5DH9B 4PQ0A 4NSWA 2EJ8A 2YF0A 2LOXA 3U8ZA 3WA0A 1X05A 1FGZA 1MKEA 2DYNA 4K2PA 5KQ1A 1GG3A 1MAIA 4C0AA 2GJYA 4CHJA 1U27A 3AU5A 2UZRA 2YS5A 2J0KA 4EMOA 2MFQA 2D4QA 1V88A 1N3HA 2ZPYA 3UZTA 1U5GA 4A6HA 2ROVA 2CODA 2N23A 1H10A 2J0MA 2DYQA 1ZC3B 1MPHA 1NTVA 1BTNA 2Y8FA 4A5KA 2I1KA 1X1FA 1I7AA 5C6RA 2LULA 2DHJA 4Y94A 1RJ2A 2OTXA 3GYPA 1MK7B 2Y7BA 2Y8GA 4L6EA 4MT7A 2KUPA 2L2IA 3ODXA 2NMBA 4MK0A 5GOWB 4ZRJA 2W2WA 4KHOA 1FHOA 1UNPA 1XX0A 2VRWB 3T06A 1MIZB 4TKNA 4DXAB 1B55A 3N7CA 1WG7A 3IVFA 1U5FA 1WJMA 1SGHA 3DXEA 2QKLA 5J3TA 1WGUA 3M1IB 1V61A 1KI1B 4DX8A 4GN1A 2HTHB 4CYEA 2RGNB 2LKOA 2UVMA 5C5BB 2W2XC 4HATB 2DFKA 1UPRA 1U5EA 4HB3B 5CLLB 2K2UA 1P6SA 3SYXA 2ELAA 1DYNA 3ULCA 2DA0A 2YRYA 2JP2A 2E2XA 3WYFB 4HAVB 1UNRA 2EMSA 1X11A 2Z0PA 1BWNA 3DXDA 1Z87A 1TQZA 2Z0QA 5HE1A 1WGQA 5C16A 2DKPA 1GC6A 2KCJA 5LOPB 5EFXA 2D9WA 4YL8A 2D10A 3D8DA 3AU4A 3ZVRA 2J59M 1ZM0A 1FAOA 2N0YA 5DHFB 3SV1A 1LB1A 3TFMA 2X18A 1XKEA 2AL6A 3SO6A 2RUKB 3GYOA 5HE3A 1EVHA 5D27A 2M38A 1V89A 3LJUX 4GPTB 1V5MA 1P5TA 1MIXA 2GS0A 5HE2A 4TYZA 4EJNA 1DROA 4A6KA 1Y19B 2Q13A 3D8FA 2P8VA 2D9XA 5L81A 2VKIA 2DX1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2COA A;  3HW2 B;  1E5W A;  4IAP A;  3FM8 C;  2YS1 A;  1X86 A;  3X23 A;  3G9W A;  3TCA A;  4K2O A;  1J19 A;  1SHC A;  3QIJ A;  3BJI A;  3ZDT A;  4WSF A;  2LG1 A;  1EGX A;  3PG7 A;  2EC1 A;  3CXB B;  4HAU B;  2J0J A;  4B6H A;  2FJL A;  2D2Q A;  2CRF A;  2I5C A;  5FI1 A;  1AWE A;  1UPQ A;  2CAY A;  3QBV B;  2K2J A;  3KRW A;  3RCP A;  2RNR B;  1QC6 A;  2DHI A;  1Q67 A;  4D0N B;  2MKR A;  2PZ1 A;  2DN6 A;  2YVC A;  2DKQ A;  1AQC A;  4HB4 B;  3BIN A;  1X1G A;  5J3Q A;  1P3R A;  3QWM A;  2V76 A;  2LOZ A;  2D9V A;  3VOQ A;  4HAX B;  1OQN A;  4HAW B;  2RLO A;  1LW3 A;  2YS3 A;  2BCJ A;  3PEG A;  5JP4 A;  4A6F B;  4YON A;  2LYD A;  5KCV A;  1U29 A;  3P6A A;  4EKU A;  2YT1 A;  5C5B A;  2RVB B;  4IFS A;  1K5D B;  1M7R A;  4WVF B;  1WJ1 A;  4ZRI A;  5HE0 A;  1FHX A;  2COC A;  2DLW A;  3KSY A;  1H4R A;  1I2H A;  4KHB B;  1W1H A;  2IFS A;  1NTY A;  1NU2 A;  2GCJ A;  2G35 A;  1FHW A;  2COF A;  4DX9 0;  5DHA B;  1EAZ A;  4CHM A;  2YSZ A;  2DTC A;  1IRS A;  4K81 A;  1FGY A;  1TXD A;  1DDV A;  2D9Y A;  2CY4 A;  2D9Z A;  3MPX A;  4GXB A;  3F0W A;  1DDM A;  2DHK A;  3NSU A;  5KQ4 A;  4KHA A;  5JHH A;  1K5G B;  2K00 A;  2R0D A;  2IYB A;  4F7G A;  3TO1 A;  5C79 A;  1ZVR A;  3KY9 A;  2L1C A;  5JHG A;  3PVW A;  4Z2N A;  4WJ7 A;  1ZSQ A;  2KGX B;  3TVV A;  4PNK A;  1UNQ A;  3AJ4 A;  4GMX B;  1PMS A;  1GC7 A;  3U7D A;  1OY2 A;  3CIK A;  3ML4 A;  4BBK A;  4GMV A;  2CY5 A;  2H7E A;  1XOD A;  2ROZ B;  4KVG B;  3D8E A;  1TJ6 A;  3PZD A;  1NI2 A;  3HK0 A;  1KZG A;  2W2X D;  4HDQ A;  3FSS A;  4HAZ B;  2HE7 A;  1U5D A;  1W1D A;  1DDW A;  3ODW A;  2YT0 A;  2DX5 A;  2H7D A;  5D3X A;  2P0D A;  4H8S A;  2ADZ A;  1U2B A;  4Z2M B;  1MK9 B;  2EMT A;  2QKM A;  1FOE A;  1WVH A;  1UEF A;  1FB8 A;  5D3W A;  4ZRK A;  4DBB A;  4F7H A;  4KAX B;  4HHV A;  3O96 A;  5D3V A;  3ULB A;  5JLJ B;  3F5R A;  2OQB A;  1V5P A;  4HB0 B;  1OMW A;  1WI1 A;  2I5F A;  5CLQ B;  2RSG A;  3SUZ A;  3KZ1 A;  2MWN B;  1Y5O A;  4XWX A;  3OAN A;  5D3Y A;  1QQG A;  5J3Y A;  3PVL A;  5LON B;  4P7I A;  3VIA A;  2ELB A;  1XD4 A;  1PFJ A;  3A8P A;  1XR0 B;  4A6F A;  4MY6 A;  2AEH A;  1EF1 A;  3MDB C;  1ZC4 B;  2MDX A;  4IOY X;  4HAY B;  2VSZ A;  1BTK A;  3A98 B;  3ODO A;  3HQC A;  4K17 A;  3V5W A;  1DBH A;  1PLS A;  4HB2 B;  5DI9 B;  3SNH A;  2I1J A;  1V5U A;  4HDO A;  3KRX A;  1KZ7 A;  1RRP B;  5FI0 A;  2Z0O A;  2D11 A;  2XQN M;  1J0W A;  2M14 A;  2UZS A;  3PVU A;  1ISN A;  4F7U P;  3A8Q A;  3DXC A;  3PP2 A;  2GCL A;  2P0F A;  2P0H A;  3P7Z A;  3FEH A;  3TW1 A;  2NZ8 B;  1BAK A;  1XCG A;  1M7E A;  5DIF B;  4GZU A;  2R09 A;  1W1G A;  4NY0 A;  3PSC A;  5DH9 B;  4PQ0 A;  4NSW A;  2EJ8 A;  2YF0 A;  2LOX A;  3U8Z A;  3WA0 A;  1X05 A;  1FGZ A;  1MKE A;  2DYN A;  4K2P A;  5KQ1 A;  1GG3 A;  1MAI A;  4C0A A;  2GJY A;  4CHJ A;  1U27 A;  3AU5 A;  2UZR A;  2YS5 A;  2J0K A;  4EMO A;  2MFQ A;  2D4Q A;  1V88 A;  1N3H A;  2ZPY A;  3UZT A;  1U5G A;  4A6H A;  2ROV A;  2COD A;  2N23 A;  1H10 A;  2J0M A;  2DYQ A;  1ZC3 B;  1MPH A;  1NTV A;  1BTN A;  2Y8F A;  4A5K A;  2I1K A;  1X1F A;  1I7A A;  5C6R A;  2LUL A;  2DHJ A;  4Y94 A;  1RJ2 A;  2OTX A;  3GYP A;  1MK7 B;  2Y7B A;  2Y8G A;  4L6E A;  4MT7 A;  2KUP A;  2L2I A;  3ODX A;  2NMB A;  4MK0 A;  5GOW B;  4ZRJ A;  2W2W A;  4KHO A;  1FHO A;  1UNP A;  1XX0 A;  2VRW B;  3T06 A;  1MIZ B;  4TKN A;  4DXA B;  1B55 A;  3N7C A;  1WG7 A;  3IVF A;  1U5F A;  1WJM A;  1SGH A;  3DXE A;  2QKL A;  5J3T A;  1WGU A;  3M1I B;  1V61 A;  1KI1 B;  4DX8 A;  4GN1 A;  2HTH B;  4CYE A;  2RGN B;  2LKO A;  2UVM A;  5C5B B;  2W2X C;  4HAT B;  2DFK A;  1UPR A;  1U5E A;  4HB3 B;  5CLL B;  2K2U A;  1P6S A;  3SYX A;  2ELA A;  1DYN A;  3ULC A;  2DA0 A;  2YRY A;  2JP2 A;  2E2X A;  3WYF B;  4HAV B;  1UNR A;  2EMS A;  1X11 A;  2Z0P A;  1BWN A;  3DXD A;  1Z87 A;  1TQZ A;  2Z0Q A;  5HE1 A;  1WGQ A;  5C16 A;  2DKP A;  1GC6 A;  2KCJ A;  5LOP B;  5EFX A;  2D9W A;  4YL8 A;  2D10 A;  3D8D A;  3AU4 A;  3ZVR A;  2J59 M;  1ZM0 A;  1FAO A;  2N0Y A;  5DHF B;  3SV1 A;  1LB1 A;  3TFM A;  2X18 A;  1XKE A;  2AL6 A;  3SO6 A;  2RUK B;  3GYO A;  5HE3 A;  1EVH A;  5D27 A;  2M38 A;  1V89 A;  3LJU X;  4GPT B;  1V5M A;  1P5T A;  1MIX A;  2GS0 A;  5HE2 A;  4TYZ A;  4EJN A;  1DRO A;  4A6K A;  1Y19 B;  2Q13 A;  3D8F A;  2P8V A;  2D9X A;  5L81 A;  2VKI A;  2DX1 A; 
#chains in the Genus database with same CATH topology
 2KR0 A;  2ZKM X;  2COA A;  3HW2 B;  3NWF A;  1E5W A;  4IAP A;  3FM8 C;  2YS1 A;  1X86 A;  3X23 A;  3G9W A;  3TCA A;  4K2O A;  1J19 A;  1SHC A;  3QIJ A;  3BJI A;  3ZDT A;  4WSF A;  4CSQ A;  2LG1 A;  1EGX A;  3NW8 A;  3NWD A;  3PG7 A;  2EC1 A;  3CXB B;  4HAU B;  4OSN A;  2J0J A;  4B6H A;  2FJL A;  2D2Q A;  2CRF A;  2I5C A;  5FI1 A;  1AWE A;  1UPQ A;  5I2M A;  2CAY A;  3QBV B;  2K2J A;  3KRW A;  3RCP A;  2RNR B;  1QC6 A;  2DHI A;  1Q67 A;  4D0N B;  2MKR A;  2PZ1 A;  2DN6 A;  2FJU B;  2YVC A;  2DKQ A;  1AQC A;  4HB4 B;  3BIN A;  1X1G A;  5J3Q A;  1P3R A;  3QWM A;  2V76 A;  3A58 A;  2LOZ A;  2D9V A;  3VOQ A;  4HAX B;  1OQN A;  4HAW B;  2RLO A;  1LW3 A;  2YS3 A;  2BCJ A;  3PEG A;  5JP4 A;  4A6F B;  4YON A;  2LYD A;  5KCV A;  1U29 A;  3P6A A;  4EKU A;  2YT1 A;  5C5B A;  2RVB B;  4IFS A;  1K5D B;  1M7R A;  4QJ5 B;  4WVF B;  1WJ1 A;  4ZRI A;  5HE0 A;  1FHX A;  2COC A;  2DLW A;  3KSY A;  3FVC A;  1H4R A;  1I2H A;  4KHB B;  1W1H A;  2IFS A;  2KIE A;  1NTY A;  1NU2 A;  2GCJ A;  2G35 A;  1FHW A;  2COF A;  4DX9 0;  3NWA A;  5DHA B;  1EAZ A;  4CHM A;  2YSZ A;  2DTC A;  1IRS A;  3DCX A;  4K81 A;  1FGY A;  1TXD A;  1DDV A;  2D9Y A;  2CY4 A;  2D9Z A;  2DX1 A;  3MPX A;  4GXB A;  3F0W A;  1DDM A;  2DHK A;  3NSU A;  5KQ4 A;  4KHA A;  5JHH A;  1K5G B;  2K00 A;  2R0D A;  2IYB A;  4F7G A;  3TO1 A;  5C79 A;  1ZVR A;  3KY9 A;  2L1C A;  5JHG A;  3PVW A;  4Z2N A;  4WJ7 A;  1ZSQ A;  2KGX B;  3TVV A;  4PNK A;  1UNQ A;  3AJ4 A;  4GMX B;  1PMS A;  1GC7 A;  3U7D A;  1OY2 A;  3CIK A;  3ML4 A;  4BBK A;  4GMV A;  2CY5 A;  2H7E A;  1XOD A;  2ROZ B;  4KVG B;  3D8E A;  1TJ6 A;  3PZD A;  1NI2 A;  3HK0 A;  1KZG A;  2W2X D;  4HDQ A;  3FSS A;  4HAZ B;  2HE7 A;  1U5D A;  1W1D A;  1DDW A;  3ODW A;  2YT0 A;  2DX5 A;  2H7D A;  5D3X A;  2P0D A;  4H8S A;  2ADZ A;  1U2B A;  4Z2M B;  1MK9 B;  1ZYI A;  2EMT A;  2QKM A;  1FOE A;  1WVH A;  1UEF A;  1FB8 A;  5D3W A;  4ZRK A;  4DBB A;  4F7H A;  4KAX B;  4HHV A;  3O96 A;  5D3V A;  3ULB A;  4HSI A;  5M4Y B;  5JLJ B;  3F5R A;  5I2S A;  3B77 A;  2OQB A;  1V5P A;  4HB0 B;  2RRF A;  1OMW A;  1WI1 A;  2I5F A;  5CLQ B;  2RSG A;  3SUZ A;  3KZ1 A;  2MWN B;  1Y5O A;  4XWX A;  3OAN A;  5D3Y A;  1QQG A;  5J3Y A;  3PVL A;  5LON B;  4P7I A;  3VIA A;  2ELB A;  1XD4 A;  1PFJ A;  3A8P A;  1XR0 B;  4A6F A;  4MY6 A;  2AEH A;  1EF1 A;  2GUM A;  3MDB C;  1ZC4 B;  2MDX A;  4IOY X;  4HAY B;  2VSZ A;  1BTK A;  3A98 B;  3ODO A;  3HQC A;  4K17 A;  3V5W A;  1DBH A;  4GOU A;  1PLS A;  4HB2 B;  5DI9 B;  4KHB A;  3SNH A;  2I1J A;  1V5U A;  4HDO A;  3KRX A;  1KZ7 A;  1RRP B;  5FI0 A;  2Z0O A;  2D11 A;  2XQN M;  1J0W A;  2M14 A;  5IRS A;  2UZS A;  3PVU A;  1ISN A;  4F7U P;  3A8Q A;  3DXC A;  3PP2 A;  2GCL A;  2P0F A;  2P0H A;  3P7Z A;  3FEH A;  3TW1 A;  2NZ8 B;  1BAK A;  1XCG A;  1M7E A;  5DIF B;  4GZU A;  2R09 A;  1W1G A;  4NY0 A;  3PSC A;  5DH9 B;  4PQ0 A;  4NSW A;  2EJ8 A;  2YF0 A;  2LOX A;  3U8Z A;  3WA0 A;  1X05 A;  1FGZ A;  1MKE A;  2DYN A;  3OHM B;  4K2P A;  2R2Y A;  5KQ1 A;  1GG3 A;  1MAI A;  4C0A A;  2GJY A;  4CHJ A;  1U27 A;  3AU5 A;  2UZR A;  2YS5 A;  2J0K A;  4EMO A;  2MFQ A;  2D4Q A;  1V88 A;  1N3H A;  2ZPY A;  3UZT A;  1U5G A;  4A6H A;  2ROV A;  2COD A;  2N23 A;  1H10 A;  2J0M A;  2DYQ A;  1ZC3 B;  1MPH A;  1NTV A;  3U12 A;  1BTN A;  2K49 A;  2NBV A;  2Y8F A;  4A5K A;  2I1K A;  1X1F A;  1I7A A;  5C6R A;  5LG4 B;  2LUL A;  2DHJ A;  4Y94 A;  1RJ2 A;  2OTX A;  3GYP A;  1MK7 B;  2Y7B A;  2Y8G A;  4L6E A;  4MT7 A;  2KUP A;  2L2I A;  3ODX A;  2NMB A;  4MK0 A;  5GOW B;  4ZRJ A;  2W2W A;  4KHO A;  1FHO A;  1UNP A;  1XX0 A;  2VRW B;  3T06 A;  1MIZ B;  4TKN A;  4DXA B;  1B55 A;  3N7C A;  2KIG A;  1WG7 A;  3IVF A;  1U5F A;  1WJM A;  1SGH A;  3DXE A;  2QKL A;  4OT1 A;  5J3T A;  1WGU A;  3M1I B;  1V61 A;  1KI1 B;  4DX8 A;  2KUQ A;  4GN1 A;  2HTH B;  4CYE A;  2RGN B;  2LKO A;  2UVM A;  5C5B B;  2W2X C;  4HAT B;  2DFK A;  1UPR A;  1U5E A;  4HB3 B;  5CLL B;  2K2U A;  1P6S A;  3SYX A;  2Z59 A;  4L1R A;  3HIE A;  2Z13 A;  2ELA A;  1DYN A;  3ULC A;  2Z14 A;  2DA0 A;  2YT2 A;  2YRY A;  2JP2 A;  2E2X A;  3WYF B;  4HAV B;  1UNR A;  2EMS A;  1X11 A;  2Z0P A;  1BWN A;  3DXD A;  1Z87 A;  1TQZ A;  2Z0Q A;  5HE1 A;  1WGQ A;  5C16 A;  2DKP A;  1GC6 A;  2KCJ A;  1T77 A;  5LOP B;  5EFX A;  2D9W A;  4YL8 A;  2D10 A;  3HSA A;  3D8D A;  3AU4 A;  3ZVR A;  2J59 M;  4GNK B;  1ZM0 A;  1FAO A;  2N0Y A;  5DHF B;  4QJ3 B;  3SV1 A;  1LB1 A;  3TFM A;  4DIX A;  2X18 A;  1XKE A;  2AL6 A;  3SO6 A;  2RUK B;  3GYO A;  5HE3 A;  1EVH A;  4QXA B;  5D27 A;  2M38 A;  1V89 A;  3LJU X;  4QJ4 B;  2Z4D A;  4GPT B;  1V5M A;  1P5T A;  1MIX A;  2GS0 A;  4D6W A;  1MI1 A;  5HE2 A;  4TYZ A;  4EJN A;  1DRO A;  4A6K A;  1Y19 B;  2Q13 A;  3D8F A;  2P8V A;  2D9X A;  5L81 A;  2VKI A;  2K8E A; 
#chains in the Genus database with same CATH homology
 2COA A;  3HW2 B;  1E5W A;  4IAP A;  3FM8 C;  2YS1 A;  1X86 A;  3X23 A;  3G9W A;  3TCA A;  4K2O A;  1J19 A;  1SHC A;  3QIJ A;  3BJI A;  3ZDT A;  4WSF A;  2LG1 A;  1EGX A;  3PG7 A;  2EC1 A;  3CXB B;  4HAU B;  2J0J A;  4B6H A;  2FJL A;  2D2Q A;  2CRF A;  2I5C A;  5FI1 A;  1AWE A;  1UPQ A;  2CAY A;  3QBV B;  2K2J A;  3KRW A;  3RCP A;  2RNR B;  1QC6 A;  2DHI A;  1Q67 A;  4D0N B;  2MKR A;  2PZ1 A;  2DN6 A;  2YVC A;  2DKQ A;  1AQC A;  4HB4 B;  3BIN A;  1X1G A;  5J3Q A;  1P3R A;  3QWM A;  2V76 A;  2LOZ A;  2D9V A;  3VOQ A;  4HAX B;  1OQN A;  4HAW B;  2RLO A;  1LW3 A;  2YS3 A;  2BCJ A;  3PEG A;  5JP4 A;  4A6F B;  4YON A;  2LYD A;  5KCV A;  1U29 A;  3P6A A;  4EKU A;  2YT1 A;  5C5B A;  2RVB B;  4IFS A;  1K5D B;  1M7R A;  4WVF B;  1WJ1 A;  4ZRI A;  5HE0 A;  1FHX A;  2COC A;  2DLW A;  3KSY A;  1H4R A;  1I2H A;  4KHB B;  1W1H A;  2IFS A;  1NTY A;  1NU2 A;  2GCJ A;  2G35 A;  1FHW A;  2COF A;  4DX9 0;  5DHA B;  1EAZ A;  4CHM A;  2YSZ A;  2DTC A;  1IRS A;  4K81 A;  1FGY A;  1TXD A;  1DDV A;  2D9Y A;  2CY4 A;  2D9Z A;  3MPX A;  4GXB A;  3F0W A;  1DDM A;  2DHK A;  3NSU A;  5KQ4 A;  4KHA A;  5JHH A;  1K5G B;  2K00 A;  2R0D A;  2IYB A;  4F7G A;  3TO1 A;  5C79 A;  1ZVR A;  3KY9 A;  2L1C A;  5JHG A;  3PVW A;  4Z2N A;  4WJ7 A;  1ZSQ A;  2KGX B;  3TVV A;  4PNK A;  1UNQ A;  3AJ4 A;  4GMX B;  1PMS A;  1GC7 A;  3U7D A;  1OY2 A;  3CIK A;  3ML4 A;  4BBK A;  4GMV A;  2CY5 A;  2H7E A;  1XOD A;  2ROZ B;  4KVG B;  3D8E A;  1TJ6 A;  3PZD A;  1NI2 A;  3HK0 A;  1KZG A;  2W2X D;  4HDQ A;  3FSS A;  4HAZ B;  2HE7 A;  1U5D A;  1W1D A;  1DDW A;  3ODW A;  2YT0 A;  2DX5 A;  2H7D A;  5D3X A;  2P0D A;  4H8S A;  2ADZ A;  1U2B A;  4Z2M B;  1MK9 B;  2EMT A;  2QKM A;  1FOE A;  1WVH A;  1UEF A;  1FB8 A;  5D3W A;  4ZRK A;  4DBB A;  4F7H A;  4KAX B;  4HHV A;  3O96 A;  5D3V A;  3ULB A;  5JLJ B;  3F5R A;  2OQB A;  1V5P A;  4HB0 B;  1OMW A;  1WI1 A;  2I5F A;  5CLQ B;  2RSG A;  3SUZ A;  3KZ1 A;  2MWN B;  1Y5O A;  4XWX A;  3OAN A;  5D3Y A;  1QQG A;  5J3Y A;  3PVL A;  5LON B;  4P7I A;  3VIA A;  2ELB A;  1XD4 A;  1PFJ A;  3A8P A;  1XR0 B;  4A6F A;  4MY6 A;  2AEH A;  1EF1 A;  3MDB C;  1ZC4 B;  2MDX A;  4IOY X;  4HAY B;  2VSZ A;  1BTK A;  3A98 B;  3ODO A;  3HQC A;  4K17 A;  3V5W A;  1DBH A;  1PLS A;  4HB2 B;  5DI9 B;  3SNH A;  2I1J A;  1V5U A;  4HDO A;  3KRX A;  1KZ7 A;  1RRP B;  5FI0 A;  2Z0O A;  2D11 A;  2XQN M;  1J0W A;  2M14 A;  2UZS A;  3PVU A;  1ISN A;  4F7U P;  3A8Q A;  3DXC A;  3PP2 A;  2GCL A;  2P0F A;  2P0H A;  3P7Z A;  3FEH A;  3TW1 A;  2NZ8 B;  1BAK A;  1XCG A;  1M7E A;  5DIF B;  4GZU A;  2R09 A;  1W1G A;  4NY0 A;  3PSC A;  5DH9 B;  4PQ0 A;  4NSW A;  2EJ8 A;  2YF0 A;  2LOX A;  3U8Z A;  3WA0 A;  1X05 A;  1FGZ A;  1MKE A;  2DYN A;  4K2P A;  5KQ1 A;  1GG3 A;  1MAI A;  4C0A A;  2GJY A;  4CHJ A;  1U27 A;  3AU5 A;  2UZR A;  2YS5 A;  2J0K A;  4EMO A;  2MFQ A;  2D4Q A;  1V88 A;  1N3H A;  2ZPY A;  3UZT A;  1U5G A;  4A6H A;  2ROV A;  2COD A;  2N23 A;  1H10 A;  2J0M A;  2DYQ A;  1ZC3 B;  1MPH A;  1NTV A;  1BTN A;  2Y8F A;  4A5K A;  2I1K A;  1X1F A;  1I7A A;  5C6R A;  2LUL A;  2DHJ A;  4Y94 A;  1RJ2 A;  2OTX A;  3GYP A;  1MK7 B;  2Y7B A;  2Y8G A;  4L6E A;  4MT7 A;  2KUP A;  2L2I A;  3ODX A;  2NMB A;  4MK0 A;  5GOW B;  4ZRJ A;  2W2W A;  4KHO A;  1FHO A;  1UNP A;  1XX0 A;  2VRW B;  3T06 A;  1MIZ B;  4TKN A;  4DXA B;  1B55 A;  3N7C A;  1WG7 A;  3IVF A;  1U5F A;  1WJM A;  1SGH A;  3DXE A;  2QKL A;  5J3T A;  1WGU A;  3M1I B;  1V61 A;  1KI1 B;  4DX8 A;  4GN1 A;  2HTH B;  4CYE A;  2RGN B;  2LKO A;  2UVM A;  5C5B B;  2W2X C;  4HAT B;  2DFK A;  1UPR A;  1U5E A;  4HB3 B;  5CLL B;  2K2U A;  1P6S A;  3SYX A;  2ELA A;  1DYN A;  3ULC A;  2DA0 A;  2YRY A;  2JP2 A;  2E2X A;  3WYF B;  4HAV B;  1UNR A;  2EMS A;  1X11 A;  2Z0P A;  1BWN A;  3DXD A;  1Z87 A;  1TQZ A;  2Z0Q A;  5HE1 A;  1WGQ A;  5C16 A;  2DKP A;  1GC6 A;  2KCJ A;  5LOP B;  5EFX A;  2D9W A;  4YL8 A;  2D10 A;  3D8D A;  3AU4 A;  3ZVR A;  2J59 M;  1ZM0 A;  1FAO A;  2N0Y A;  5DHF B;  3SV1 A;  1LB1 A;  3TFM A;  2X18 A;  1XKE A;  2AL6 A;  3SO6 A;  2RUK B;  3GYO A;  5HE3 A;  1EVH A;  5D27 A;  2M38 A;  1V89 A;  3LJU X;  4GPT B;  1V5M A;  1P5T A;  1MIX A;  2GS0 A;  5HE2 A;  4TYZ A;  4EJN A;  1DRO A;  4A6K A;  1Y19 B;  2Q13 A;  3D8F A;  2P8V A;  2D9X A;  5L81 A;  2VKI A;  2DX1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...