3NSUA

A systematic screen for protein-lipid interactions in saccharomyces cerevisiae
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
117
structure length
109
Chain Sequence
PFTEIKSGFLERRSKFLKSYSKGYYVLTPNFLHEFKTADRKKDLVPVMSLALSECTVTEHSRKNSTSSPNSTGSDAKFVLHAKHNWVFKADSYESMMSWFDNLKILTST
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Phosphatidylinositol 4,5-bisphosphate-binding protein SLM1
publication title A systematic screen for protein-lipid interactions in Saccharomyces cerevisiae.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Signaling protein
total genus 24
structure length 109
sequence length 117
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00169 PH PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 3nsuA00
4ZRJA 1Q67A 5HE1A 5C6RA 3KRXA 1FOEA 1TXDA 3PVWA 4EMOA 1M7RA 2LKOA 4GPTB 2LOZA 2DFKA 1XCGA 2G35A 4Z2MB 3BINA 1I2HA 1KZGA 5LONB 4MT7A 3SNHA 5KQ1A 1ZVRA 2OQBA 3VOQA 2YRYA 2D9WA 1X05A 3D8EA 4F7GA 2I5FA 2YT1A 3DXDA 5D3VA 1RRPB 4DX90 2DLWA 1PLSA 2EJ8A 2LULA 2DHIA 2LYDA 3AU4A 1U2BA 1WJ1A 1NTYA 5HE3A 5EFXA 4H8SA 3O96A 2CAYA 4PNKA 2KCJA 1UNQA 3SUZA 1LW3A 2D10A 2VKIA 2COCA 1AWEA 5J3QA 3PVLA 4A6FA 1DDWA 1U29A 2IFSA 1MAIA 2AEHA 4HAWB 2I1JA 4Z2NA 3X23A 2P0FA 1XX0A 3PSCA 2YT0A 4ZRIA 4A6HA 2E2XA 4IFSA 1OY2A 2J59M 4HAXB 2J0KA 1WGUA 4WVFB 5L81A 3N7CA 2W2XD 4D0NB 2P8VA 3HQCA 1B55A 3P6AA 3NSUA 1WVHA 1M7EA 2D2QA 2D9XA 3WYFB 3DXCA 4HATB 2EMTA 2P0HA 4MK0A 1K5DB 2MKRA 2RLOA 3F5RA 2DX5A 3QBVB 2MFQA 4K17A 2DHKA 1BTNA 1U27A 4TKNA 1J0WA 4A6KA 4GMVA 2Y8FA 2GJYA 3A98B 1U5EA 1OQNA 2KUPA 3U8ZA 2GCLA 2IYBA 2RNRB 3PEGA 2M38A 2D4QA 2BCJA 3TO1A 2LOXA 5GOWB 2J0JA 1BTKA 2K2UA 2CRFA 1MK9B 4IOYX 4HAUB 3GYPA 2W2WA 3ODOA 2HTHB 2YSZA 2V76A 5KCVA 2DN6A 5LOPB 1GG3A 4F7HA 3SO6A 3AJ4A 1U5DA 5JHGA 1EF1A 4K2OA 4C0AA 4A5KA 2Z0OA 2D9VA 2D9YA 2P0DA 1ZC3B 1ISNA 4IAPA 1XODA 4KVGB 1X1GA 2YS5A 2LG1A 1Y5OA 2CY4A 3BJIA 2ELAA 3KSYA 2DTCA 3LJUX 2RVBB 4DBBA 4CYEA 2H7EA 1P5TA 5DHFB 2Z0PA 5C5BB 3U7DA 1V5MA 2L2IA 4NSWA 3ULBA 1K5GB 2I5CA 1KI1B 2EC1A 1EAZA 1NI2A 2XQNM 2RSGA 4YL8A 2YVCA 1ZM0A 4WJ7A 3SV1A 1PFJA 2VSZA 5FI0A 5DIFB 2R09A 1U5GA 2FJLA 2CODA 3MDBC 2KGXB 3CXBB 4GXBA 3WA0A 1GC6A 1Y19B 3OANA 3V5WA 3KRWA 2COFA 2DX1A 3SYXA 1KZ7A 4GMXB 5CLLB 2DHJA 3GYOA 1WJMA 3FM8C 3TVVA 1N3HA 5D3XA 1QQGA 1MPHA 1OMWA 2OTXA 2K2JA 3MPXA 3PG7A 1Z87A 1FGYA 1UNPA 1V5UA 1MIXA 3TFMA 1TJ6A 1NU2A 2ADZA 4HDOA 2Y7BA 4HDQA 3KY9A 3ML4A 2NZ8B 3HK0A 2ELBA 3FEHA 1BAKA 3PVUA 4GN1A 2Y8GA 1MIZB 4HAYB 3A8QA 4NY0A 1FGZA 1XKEA 4XWXA 3A8PA 1UPQA 2JP2A 5C5BA 4HAZB 3VIAA 3HW2B 2D11A 1U5FA 3TW1A 2ROZB 2EMSA 4A6FB 4HAVB 4BBKA 1FB8A 3PZDA 1FAOA 2QKLA 1WI1A 2R0DA 1P6SA 4KHAA 2AL6A 1UEFA 2K00A 4P7IA 5JP4A 2UVMA 5D3YA 1QC6A 1RJ2A 4KAXB 1FHXA 2COAA 4PQ0A 3P7ZA 3TCAA 3ODWA 3PP2A 1I7AA 4L6EA 1MK7B 5FI1A 2UZRA 3RCPA 2YF0A 2H7DA 3D8DA 1XD4A 2PZ1A 4DX8A 1V89A 1X1FA 1PMSA 3IVFA 1GC7A 2DA0A 1NTVA 3AU5A 4HB0B 5HE2A 2ZPYA 1BWNA 4GZUA 2Q13A 1V5PA 4DXAB 2J0MA 2CY5A 4HB2B 1MKEA 3ZDTA 1DYNA 2I1KA 3FSSA 2DYQA 1SHCA 1UPRA 3M1IB 1E5WA 2Z0QA 2X18A 2HE7A 4HB4B 1ZSQA 2YS3A 1W1GA 5JLJB 4KHBB 3DXEA 4HB3B 5CLQB 5D27A 1EGXA 2ROVA 3ZVRA 5C79A 2YS1A 4EKUA 2N23A 1FHWA 1DDMA 1X11A 1P3RA 4CHJA 1XR0B 1DBHA 3UZTA 1H10A 1SGHA 2DYNA 1TQZA 2MDXA 1DDVA 5DH9B 2UZSA 4HHVA 2M14A 1W1HA 3QIJA 2D9ZA 2QKMA 3T06A 5HE0A 3QWMA 3ULCA 5DHAB 3G9WA 1UNRA 1V88A 4KHOA 2N0YA 2DKQA 2NMBA 4K81A 2W2XC 1WG7A 1ZC4B 5DI9B 1AQCA 5JHHA 4ZRKA 4CHMA 1J19A 2MWNB 2GS0A 2L1CA 4B6HA 3D8FA 4YONA 1W1DA 1FHOA 1V61A 1X86A 4TYZA 1DROA 1LB1A 4WSFA 2RUKB 2RGNB 5D3WA 2VRWB 1WGQA 5KQ4A 5C16A 5J3TA 4EJNA 1IRSA 2GCJA 4Y94A 1H4RA 4MY6A 2DKPA 5J3YA 3CIKA 1EVHA 4K2PA 3ODXA 3F0WA 3KZ1A 4F7UP
chains in the Genus database with same CATH superfamily
4ZRJA 1Q67A 5HE1A 5C6RA 3KRXA 3NWFA 1FOEA 1TXDA 3PVWA 4EMOA 1M7RA 2LKOA 4GPTB 2LOZA 2DFKA 1XCGA 2G35A 4Z2MB 3BINA 1I2HA 1KZGA 5LONB 4MT7A 3SNHA 5KQ1A 1ZVRA 2OQBA 3VOQA 2YRYA 2D9WA 1X05A 3D8EA 4F7GA 2I5FA 2YT1A 3DXDA 5D3VA 1RRPB 4DX90 2DLWA 1PLSA 2EJ8A 2LULA 2DHIA 2LYDA 3AU4A 1U2BA 1WJ1A 1NTYA 5HE3A 5EFXA 4H8SA 3O96A 2CAYA 5LG4B 4PNKA 2KCJA 1UNQA 3SUZA 1LW3A 2D10A 2VKIA 2COCA 1AWEA 5J3QA 3PVLA 4A6FA 1DDWA 1U29A 2IFSA 1MAIA 3HSAA 5I2SA 2AEHA 4HAWB 2I1JA 4Z2NA 3X23A 2P0FA 1XX0A 3PSCA 2YT0A 4ZRIA 4A6HA 2E2XA 4IFSA 1OY2A 2J59M 4HAXB 2J0KA 1WGUA 4WVFB 5L81A 3N7CA 2W2XD 4D0NB 2P8VA 3HQCA 1B55A 3P6AA 3NSUA 1WVHA 1M7EA 3U12A 2D2QA 3NWAA 2D9XA 4GNKB 3WYFB 3DXCA 4HATB 2EMTA 2P0HA 4MK0A 1K5DB 2MKRA 2RLOA 3F5RA 2DX5A 3QBVB 2MFQA 4K17A 2DHKA 1BTNA 1U27A 4TKNA 1J0WA 4A6KA 4GMVA 2Y8FA 4KHBA 2GJYA 3A98B 1U5EA 1OQNA 2KUPA 3U8ZA 2GCLA 2IYBA 2RNRB 3PEGA 2M38A 2D4QA 2BCJA 3TO1A 2LOXA 5GOWB 2J0JA 1BTKA 2K2UA 2CRFA 1MK9B 4IOYX 4OSNA 4HAUB 4OT1A 2KIGA 3GYPA 2W2WA 4GOUA 3ODOA 2HTHB 2YSZA 4QJ4B 2V76A 5KCVA 2DN6A 5LOPB 1GG3A 4F7HA 3SO6A 3AJ4A 3A58A 1U5DA 5JHGA 1EF1A 4K2OA 4C0AA 4A5KA 2Z0OA 2D9VA 2D9YA 2P0DA 1ZC3B 1ISNA 4IAPA 1XODA 4KVGB 1X1GA 2YS5A 2LG1A 1Y5OA 2CY4A 3BJIA 2RRFA 2ELAA 3KSYA 2DTCA 3LJUX 2RVBB 4DBBA 4CYEA 2H7EA 2ZKMX 1P5TA 5DHFB 2Z0PA 5C5BB 3U7DA 1V5MA 2L2IA 4NSWA 3ULBA 1K5GB 2I5CA 1KI1B 2EC1A 1EAZA 1NI2A 2XQNM 2RSGA 4YL8A 2YVCA 1ZM0A 4WJ7A 3SV1A 1PFJA 2VSZA 5FI0A 5DIFB 2R09A 1U5GA 2FJLA 2CODA 3MDBC 2KGXB 3CXBB 4GXBA 3WA0A 1GC6A 1Y19B 3OANA 3V5WA 3KRWA 2COFA 2DX1A 3SYXA 1KZ7A 4GMXB 5CLLB 2DHJA 3GYOA 1WJMA 3FM8C 3TVVA 1N3HA 5D3XA 1QQGA 1MPHA 5I2MA 1OMWA 2OTXA 2K2JA 3MPXA 3FVCA 3PG7A 1Z87A 1FGYA 1UNPA 1V5UA 2K8EA 1MIXA 3TFMA 1TJ6A 2FJUB 1NU2A 2ADZA 4QJ5B 4HDOA 2Y7BA 4HDQA 3KY9A 3NW8A 3ML4A 2NZ8B 3HK0A 2ELBA 2Z14A 3FEHA 1BAKA 3PVUA 4GN1A 2Y8GA 1MIZB 4HAYB 3A8QA 4NY0A 1FGZA 1XKEA 4XWXA 3A8PA 1UPQA 2JP2A 5C5BA 4HAZB 3VIAA 3HW2B 2D11A 1U5FA 3TW1A 2ROZB 2EMSA 4A6FB 2KIEA 4HAVB 4BBKA 3HIEA 1FB8A 3PZDA 1FAOA 2QKLA 2R2YA 1WI1A 2R0DA 1P6SA 4KHAA 2AL6A 1UEFA 2K00A 4P7IA 5JP4A 2UVMA 5D3YA 1QC6A 1RJ2A 3OHMB 4KAXB 1FHXA 3DCXA 2COAA 4PQ0A 2Z59A 3P7ZA 3TCAA 3ODWA 3PP2A 1I7AA 2GUMA 4L6EA 1MK7B 5FI1A 2UZRA 3RCPA 2YF0A 2H7DA 3D8DA 1XD4A 2PZ1A 4DX8A 1V89A 1X1FA 1PMSA 3IVFA 1GC7A 2DA0A 1NTVA 3AU5A 4HB0B 5HE2A 2ZPYA 1BWNA 4GZUA 2Q13A 1V5PA 4DXAB 2J0MA 2CY5A 4HSIA 2Z13A 4HB2B 3NWDA 1MKEA 3ZDTA 1DYNA 2I1KA 3FSSA 2DYQA 1SHCA 1UPRA 3M1IB 1E5WA 2Z0QA 2X18A 2HE7A 4HB4B 1ZSQA 2YS3A 1W1GA 5JLJB 4KHBB 3DXEA 4HB3B 5CLQB 5D27A 1EGXA 2ROVA 3ZVRA 5C79A 2YS1A 4EKUA 2N23A 1FHWA 1DDMA 1X11A 2YT2A 1P3RA 4CHJA 1XR0B 1DBHA 2KR0A 3UZTA 1H10A 1SGHA 2DYNA 1TQZA 2MDXA 1DDVA 5M4YB 5DH9B 2UZSA 4HHVA 2M14A 1W1HA 3QIJA 2D9ZA 2KUQA 2QKMA 3T06A 5HE0A 3QWMA 2NBVA 3ULCA 5DHAB 3G9WA 1UNRA 1V88A 4KHOA 2N0YA 2DKQA 2NMBA 4K81A 4CSQA 2W2XC 1WG7A 1ZC4B 5DI9B 2Z4DA 1AQCA 5JHHA 4ZRKA 4CHMA 1J19A 2MWNB 2GS0A 2L1CA 4B6HA 3D8FA 4YONA 1W1DA 3B77A 1V61A 4QXAB 1FHOA 1X86A 4TYZA 1DROA 1LB1A 4WSFA 2RUKB 2RGNB 4QJ3B 5D3WA 2VRWB 1WGQA 1ZYIA 5KQ4A 1T77A 5C16A 5J3TA 1MI1A 4EJNA 1IRSA 2K49A 2GCJA 4Y94A 4DIXA 1H4RA 4MY6A 2DKPA 5J3YA 3CIKA 5IRSA 1EVHA 4K2PA 3ODXA 4D6WA 3F0WA 3KZ1A 4F7UP 4L1RA
chains in the Genus database with same CATH topology
4ZRJA 1Q67A 5HE1A 5C6RA 3KRXA 1FOEA 1TXDA 3PVWA 4EMOA 1M7RA 2LKOA 4GPTB 2LOZA 2DFKA 1XCGA 2G35A 4Z2MB 3BINA 1I2HA 1KZGA 5LONB 4MT7A 3SNHA 5KQ1A 1ZVRA 2OQBA 3VOQA 2YRYA 2D9WA 1X05A 3D8EA 4F7GA 2I5FA 2YT1A 3DXDA 5D3VA 1RRPB 4DX90 2DLWA 1PLSA 2EJ8A 2LULA 2DHIA 2LYDA 3AU4A 1U2BA 1WJ1A 1NTYA 5HE3A 5EFXA 4H8SA 3O96A 2CAYA 4PNKA 2KCJA 1UNQA 3SUZA 1LW3A 2D10A 2VKIA 2COCA 1AWEA 5J3QA 3PVLA 4A6FA 1DDWA 1U29A 2IFSA 1MAIA 2AEHA 4HAWB 2I1JA 4Z2NA 3X23A 2P0FA 1XX0A 3PSCA 2YT0A 4ZRIA 4A6HA 2E2XA 4IFSA 1OY2A 2J59M 4HAXB 2J0KA 1WGUA 4WVFB 5L81A 3N7CA 2W2XD 4D0NB 2P8VA 3HQCA 1B55A 3P6AA 3NSUA 1WVHA 1M7EA 2D2QA 2D9XA 3WYFB 3DXCA 4HATB 2EMTA 2P0HA 4MK0A 1K5DB 2MKRA 2RLOA 3F5RA 2DX5A 3QBVB 2MFQA 4K17A 2DHKA 1BTNA 1U27A 4TKNA 1J0WA 4A6KA 4GMVA 2Y8FA 2GJYA 3A98B 1U5EA 1OQNA 2KUPA 3U8ZA 2GCLA 2IYBA 2RNRB 3PEGA 2M38A 2D4QA 2BCJA 3TO1A 2LOXA 5GOWB 2J0JA 1BTKA 2K2UA 2CRFA 1MK9B 4IOYX 4HAUB 3GYPA 2W2WA 3ODOA 2HTHB 2YSZA 2V76A 5KCVA 2DN6A 5LOPB 1GG3A 4F7HA 3SO6A 3AJ4A 1U5DA 5JHGA 1EF1A 4K2OA 4C0AA 4A5KA 2Z0OA 2D9VA 2D9YA 2P0DA 1ZC3B 1ISNA 4IAPA 1XODA 4KVGB 1X1GA 2YS5A 2LG1A 1Y5OA 2CY4A 3BJIA 2ELAA 3KSYA 2DTCA 3LJUX 2RVBB 4DBBA 4CYEA 2H7EA 1P5TA 5DHFB 2Z0PA 5C5BB 3U7DA 1V5MA 2L2IA 4NSWA 3ULBA 1K5GB 2I5CA 1KI1B 2EC1A 1EAZA 1NI2A 2XQNM 2RSGA 4YL8A 2YVCA 1ZM0A 4WJ7A 3SV1A 1PFJA 2VSZA 5FI0A 5DIFB 2R09A 1U5GA 2FJLA 2CODA 3MDBC 2KGXB 3CXBB 4GXBA 3WA0A 1GC6A 1Y19B 3OANA 3V5WA 3KRWA 2COFA 2DX1A 3SYXA 1KZ7A 4GMXB 5CLLB 2DHJA 3GYOA 1WJMA 3FM8C 3TVVA 1N3HA 5D3XA 1QQGA 1MPHA 1OMWA 2OTXA 2K2JA 3MPXA 3PG7A 1Z87A 1FGYA 1UNPA 1V5UA 1MIXA 3TFMA 1TJ6A 1NU2A 2ADZA 4HDOA 2Y7BA 4HDQA 3KY9A 3ML4A 2NZ8B 3HK0A 2ELBA 3FEHA 1BAKA 3PVUA 4GN1A 2Y8GA 1MIZB 4HAYB 3A8QA 4NY0A 1FGZA 1XKEA 4XWXA 3A8PA 1UPQA 2JP2A 5C5BA 4HAZB 3VIAA 3HW2B 2D11A 1U5FA 3TW1A 2ROZB 2EMSA 4A6FB 4HAVB 4BBKA 1FB8A 3PZDA 1FAOA 2QKLA 1WI1A 2R0DA 1P6SA 4KHAA 2AL6A 1UEFA 2K00A 4P7IA 5JP4A 2UVMA 5D3YA 1QC6A 1RJ2A 4KAXB 1FHXA 2COAA 4PQ0A 3P7ZA 3TCAA 3ODWA 3PP2A 1I7AA 4L6EA 1MK7B 5FI1A 2UZRA 3RCPA 2YF0A 2H7DA 3D8DA 1XD4A 2PZ1A 4DX8A 1V89A 1X1FA 1PMSA 3IVFA 1GC7A 2DA0A 1NTVA 3AU5A 4HB0B 5HE2A 2ZPYA 1BWNA 4GZUA 2Q13A 1V5PA 4DXAB 2J0MA 2CY5A 4HB2B 1MKEA 3ZDTA 1DYNA 2I1KA 3FSSA 2DYQA 1SHCA 1UPRA 3M1IB 1E5WA 2Z0QA 2X18A 2HE7A 4HB4B 1ZSQA 2YS3A 1W1GA 5JLJB 4KHBB 3DXEA 4HB3B 5CLQB 5D27A 1EGXA 2ROVA 3ZVRA 5C79A 2YS1A 4EKUA 2N23A 1FHWA 1DDMA 1X11A 1P3RA 4CHJA 1XR0B 1DBHA 3UZTA 1H10A 1SGHA 2DYNA 1TQZA 2MDXA 1DDVA 5DH9B 2UZSA 4HHVA 2M14A 1W1HA 3QIJA 2D9ZA 2QKMA 3T06A 5HE0A 3QWMA 3ULCA 5DHAB 3G9WA 1UNRA 1V88A 4KHOA 2N0YA 2DKQA 2NMBA 4K81A 2W2XC 1WG7A 1ZC4B 5DI9B 1AQCA 5JHHA 4ZRKA 4CHMA 1J19A 2MWNB 2GS0A 2L1CA 4B6HA 3D8FA 4YONA 1W1DA 1FHOA 1V61A 1X86A 4TYZA 1DROA 1LB1A 4WSFA 2RUKB 2RGNB 5D3WA 2VRWB 1WGQA 5KQ4A 5C16A 5J3TA 4EJNA 1IRSA 2GCJA 4Y94A 1H4RA 4MY6A 2DKPA 5J3YA 3CIKA 1EVHA 4K2PA 3ODXA 3F0WA 3KZ1A 4F7UP
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ZRJ A;  1Q67 A;  5HE1 A;  5C6R A;  3KRX A;  1FOE A;  1TXD A;  3PVW A;  4EMO A;  1M7R A;  2LKO A;  4GPT B;  2LOZ A;  2DFK A;  1XCG A;  2G35 A;  4Z2M B;  3BIN A;  1I2H A;  1KZG A;  5LON B;  4MT7 A;  3SNH A;  5KQ1 A;  1ZVR A;  2OQB A;  3VOQ A;  2YRY A;  2D9W A;  1X05 A;  3D8E A;  4F7G A;  2I5F A;  2YT1 A;  3DXD A;  5D3V A;  1RRP B;  4DX9 0;  2DLW A;  1PLS A;  2EJ8 A;  2LUL A;  2DHI A;  2LYD A;  3AU4 A;  1U2B A;  1WJ1 A;  1NTY A;  5HE3 A;  5EFX A;  4H8S A;  3O96 A;  2CAY A;  4PNK A;  2KCJ A;  1UNQ A;  3SUZ A;  1LW3 A;  2D10 A;  2VKI A;  2COC A;  1AWE A;  5J3Q A;  3PVL A;  4A6F A;  1DDW A;  1U29 A;  2IFS A;  1MAI A;  2AEH A;  4HAW B;  2I1J A;  4Z2N A;  3X23 A;  2P0F A;  1XX0 A;  3PSC A;  2YT0 A;  4ZRI A;  4A6H A;  2E2X A;  4IFS A;  1OY2 A;  2J59 M;  4HAX B;  2J0K A;  1WGU A;  4WVF B;  5L81 A;  3N7C A;  2W2X D;  4D0N B;  2P8V A;  3HQC A;  1B55 A;  3P6A A;  3NSU A;  1WVH A;  1M7E A;  2D2Q A;  2D9X A;  3WYF B;  3DXC A;  4HAT B;  2EMT A;  2P0H A;  4MK0 A;  1K5D B;  2MKR A;  2RLO A;  3F5R A;  2DX5 A;  3QBV B;  2MFQ A;  4K17 A;  2DHK A;  1BTN A;  1U27 A;  4TKN A;  1J0W A;  4A6K A;  4GMV A;  2Y8F A;  2GJY A;  3A98 B;  1U5E A;  1OQN A;  2KUP A;  3U8Z A;  2GCL A;  2IYB A;  2RNR B;  3PEG A;  2M38 A;  2D4Q A;  2BCJ A;  3TO1 A;  2LOX A;  5GOW B;  2J0J A;  1BTK A;  2K2U A;  2CRF A;  1MK9 B;  4IOY X;  4HAU B;  3GYP A;  2W2W A;  3ODO A;  2HTH B;  2YSZ A;  2V76 A;  5KCV A;  2DN6 A;  5LOP B;  1GG3 A;  4F7H A;  3SO6 A;  3AJ4 A;  1U5D A;  5JHG A;  1EF1 A;  4K2O A;  4C0A A;  4A5K A;  2Z0O A;  2D9V A;  2D9Y A;  2P0D A;  1ZC3 B;  1ISN A;  4IAP A;  1XOD A;  4KVG B;  1X1G A;  2YS5 A;  2LG1 A;  1Y5O A;  2CY4 A;  3BJI A;  2ELA A;  3KSY A;  2DTC A;  3LJU X;  2RVB B;  4DBB A;  4CYE A;  2H7E A;  1P5T A;  5DHF B;  2Z0P A;  5C5B B;  3U7D A;  1V5M A;  2L2I A;  4NSW A;  3ULB A;  1K5G B;  2I5C A;  1KI1 B;  2EC1 A;  1EAZ A;  1NI2 A;  2XQN M;  2RSG A;  4YL8 A;  2YVC A;  1ZM0 A;  4WJ7 A;  3SV1 A;  1PFJ A;  2VSZ A;  5FI0 A;  5DIF B;  2R09 A;  1U5G A;  2FJL A;  2COD A;  3MDB C;  2KGX B;  3CXB B;  4GXB A;  3WA0 A;  1GC6 A;  1Y19 B;  3OAN A;  3V5W A;  3KRW A;  2COF A;  2DX1 A;  3SYX A;  1KZ7 A;  4GMX B;  5CLL B;  2DHJ A;  3GYO A;  1WJM A;  3FM8 C;  3TVV A;  1N3H A;  5D3X A;  1QQG A;  1MPH A;  1OMW A;  2OTX A;  2K2J A;  3MPX A;  3PG7 A;  1Z87 A;  1FGY A;  1UNP A;  1V5U A;  1MIX A;  3TFM A;  1TJ6 A;  1NU2 A;  2ADZ A;  4HDO A;  2Y7B A;  4HDQ A;  3KY9 A;  3ML4 A;  2NZ8 B;  3HK0 A;  2ELB A;  3FEH A;  1BAK A;  3PVU A;  4GN1 A;  2Y8G A;  1MIZ B;  4HAY B;  3A8Q A;  4NY0 A;  1FGZ A;  1XKE A;  4XWX A;  3A8P A;  1UPQ A;  2JP2 A;  5C5B A;  4HAZ B;  3VIA A;  3HW2 B;  2D11 A;  1U5F A;  3TW1 A;  2ROZ B;  2EMS A;  4A6F B;  4HAV B;  4BBK A;  1FB8 A;  3PZD A;  1FAO A;  2QKL A;  1WI1 A;  2R0D A;  1P6S A;  4KHA A;  2AL6 A;  1UEF A;  2K00 A;  4P7I A;  5JP4 A;  2UVM A;  5D3Y A;  1QC6 A;  1RJ2 A;  4KAX B;  1FHX A;  2COA A;  4PQ0 A;  3P7Z A;  3TCA A;  3ODW A;  3PP2 A;  1I7A A;  4L6E A;  1MK7 B;  5FI1 A;  2UZR A;  3RCP A;  2YF0 A;  2H7D A;  3D8D A;  1XD4 A;  2PZ1 A;  4DX8 A;  1V89 A;  1X1F A;  1PMS A;  3IVF A;  1GC7 A;  2DA0 A;  1NTV A;  3AU5 A;  4HB0 B;  5HE2 A;  2ZPY A;  1BWN A;  4GZU A;  2Q13 A;  1V5P A;  4DXA B;  2J0M A;  2CY5 A;  4HB2 B;  1MKE A;  3ZDT A;  1DYN A;  2I1K A;  3FSS A;  2DYQ A;  1SHC A;  1UPR A;  3M1I B;  1E5W A;  2Z0Q A;  2X18 A;  2HE7 A;  4HB4 B;  1ZSQ A;  2YS3 A;  1W1G A;  5JLJ B;  4KHB B;  3DXE A;  4HB3 B;  5CLQ B;  5D27 A;  1EGX A;  2ROV A;  3ZVR A;  5C79 A;  2YS1 A;  4EKU A;  2N23 A;  1FHW A;  1DDM A;  1X11 A;  1P3R A;  4CHJ A;  1XR0 B;  1DBH A;  3UZT A;  1H10 A;  1SGH A;  2DYN A;  1TQZ A;  2MDX A;  1DDV A;  5DH9 B;  2UZS A;  4HHV A;  2M14 A;  1W1H A;  3QIJ A;  2D9Z A;  2QKM A;  3T06 A;  5HE0 A;  3QWM A;  3ULC A;  5DHA B;  3G9W A;  1UNR A;  1V88 A;  4KHO A;  2N0Y A;  2DKQ A;  2NMB A;  4K81 A;  2W2X C;  1WG7 A;  1ZC4 B;  5DI9 B;  1AQC A;  5JHH A;  4ZRK A;  4CHM A;  1J19 A;  2MWN B;  2GS0 A;  2L1C A;  4B6H A;  3D8F A;  4YON A;  1W1D A;  1FHO A;  1V61 A;  1X86 A;  4TYZ A;  1DRO A;  1LB1 A;  4WSF A;  2RUK B;  2RGN B;  5D3W A;  2VRW B;  1WGQ A;  5KQ4 A;  5C16 A;  5J3T A;  4EJN A;  1IRS A;  2GCJ A;  4Y94 A;  1H4R A;  4MY6 A;  2DKP A;  5J3Y A;  3CIK A;  1EVH A;  4K2P A;  3ODX A;  3F0W A;  3KZ1 A;  4F7U P; 
#chains in the Genus database with same CATH topology
 4ZRJ A;  1Q67 A;  5HE1 A;  5C6R A;  3KRX A;  3NWF A;  1FOE A;  1TXD A;  3PVW A;  4EMO A;  1M7R A;  2LKO A;  4GPT B;  2LOZ A;  2DFK A;  1XCG A;  2G35 A;  4Z2M B;  3BIN A;  1I2H A;  1KZG A;  5LON B;  4MT7 A;  3SNH A;  5KQ1 A;  1ZVR A;  2OQB A;  3VOQ A;  2YRY A;  2D9W A;  1X05 A;  3D8E A;  4F7G A;  2I5F A;  2YT1 A;  3DXD A;  5D3V A;  1RRP B;  4DX9 0;  2DLW A;  1PLS A;  2EJ8 A;  2LUL A;  2DHI A;  2LYD A;  3AU4 A;  1U2B A;  1WJ1 A;  1NTY A;  5HE3 A;  5EFX A;  4H8S A;  3O96 A;  2CAY A;  5LG4 B;  4PNK A;  2KCJ A;  1UNQ A;  3SUZ A;  1LW3 A;  2D10 A;  2VKI A;  2COC A;  1AWE A;  5J3Q A;  3PVL A;  4A6F A;  1DDW A;  1U29 A;  2IFS A;  1MAI A;  3HSA A;  5I2S A;  2AEH A;  4HAW B;  2I1J A;  4Z2N A;  3X23 A;  2P0F A;  1XX0 A;  3PSC A;  2YT0 A;  4ZRI A;  4A6H A;  2E2X A;  4IFS A;  1OY2 A;  2J59 M;  4HAX B;  2J0K A;  1WGU A;  4WVF B;  5L81 A;  3N7C A;  2W2X D;  4D0N B;  2P8V A;  3HQC A;  1B55 A;  3P6A A;  3NSU A;  1WVH A;  1M7E A;  3U12 A;  2D2Q A;  3NWA A;  2D9X A;  4GNK B;  3WYF B;  3DXC A;  4HAT B;  2EMT A;  2P0H A;  4MK0 A;  1K5D B;  2MKR A;  2RLO A;  3F5R A;  2DX5 A;  3QBV B;  2MFQ A;  4K17 A;  2DHK A;  1BTN A;  1U27 A;  4TKN A;  1J0W A;  4A6K A;  4GMV A;  2Y8F A;  4KHB A;  2GJY A;  3A98 B;  1U5E A;  1OQN A;  2KUP A;  3U8Z A;  2GCL A;  2IYB A;  2RNR B;  3PEG A;  2M38 A;  2D4Q A;  2BCJ A;  3TO1 A;  2LOX A;  5GOW B;  2J0J A;  1BTK A;  2K2U A;  2CRF A;  1MK9 B;  4IOY X;  4OSN A;  4HAU B;  4OT1 A;  2KIG A;  3GYP A;  2W2W A;  4GOU A;  3ODO A;  2HTH B;  2YSZ A;  4QJ4 B;  2V76 A;  5KCV A;  2DN6 A;  5LOP B;  1GG3 A;  4F7H A;  3SO6 A;  3AJ4 A;  3A58 A;  1U5D A;  5JHG A;  1EF1 A;  4K2O A;  4C0A A;  4A5K A;  2Z0O A;  2D9V A;  2D9Y A;  2P0D A;  1ZC3 B;  1ISN A;  4IAP A;  1XOD A;  4KVG B;  1X1G A;  2YS5 A;  2LG1 A;  1Y5O A;  2CY4 A;  3BJI A;  2RRF A;  2ELA A;  3KSY A;  2DTC A;  3LJU X;  2RVB B;  4DBB A;  4CYE A;  2H7E A;  2ZKM X;  1P5T A;  5DHF B;  2Z0P A;  5C5B B;  3U7D A;  1V5M A;  2L2I A;  4NSW A;  3ULB A;  1K5G B;  2I5C A;  1KI1 B;  2EC1 A;  1EAZ A;  1NI2 A;  2XQN M;  2RSG A;  4YL8 A;  2YVC A;  1ZM0 A;  4WJ7 A;  3SV1 A;  1PFJ A;  2VSZ A;  5FI0 A;  5DIF B;  2R09 A;  1U5G A;  2FJL A;  2COD A;  3MDB C;  2KGX B;  3CXB B;  4GXB A;  3WA0 A;  1GC6 A;  1Y19 B;  3OAN A;  3V5W A;  3KRW A;  2COF A;  2DX1 A;  3SYX A;  1KZ7 A;  4GMX B;  5CLL B;  2DHJ A;  3GYO A;  1WJM A;  3FM8 C;  3TVV A;  1N3H A;  5D3X A;  1QQG A;  1MPH A;  5I2M A;  1OMW A;  2OTX A;  2K2J A;  3MPX A;  3FVC A;  3PG7 A;  1Z87 A;  1FGY A;  1UNP A;  1V5U A;  2K8E A;  1MIX A;  3TFM A;  1TJ6 A;  2FJU B;  1NU2 A;  2ADZ A;  4QJ5 B;  4HDO A;  2Y7B A;  4HDQ A;  3KY9 A;  3NW8 A;  3ML4 A;  2NZ8 B;  3HK0 A;  2ELB A;  2Z14 A;  3FEH A;  1BAK A;  3PVU A;  4GN1 A;  2Y8G A;  1MIZ B;  4HAY B;  3A8Q A;  4NY0 A;  1FGZ A;  1XKE A;  4XWX A;  3A8P A;  1UPQ A;  2JP2 A;  5C5B A;  4HAZ B;  3VIA A;  3HW2 B;  2D11 A;  1U5F A;  3TW1 A;  2ROZ B;  2EMS A;  4A6F B;  2KIE A;  4HAV B;  4BBK A;  3HIE A;  1FB8 A;  3PZD A;  1FAO A;  2QKL A;  2R2Y A;  1WI1 A;  2R0D A;  1P6S A;  4KHA A;  2AL6 A;  1UEF A;  2K00 A;  4P7I A;  5JP4 A;  2UVM A;  5D3Y A;  1QC6 A;  1RJ2 A;  3OHM B;  4KAX B;  1FHX A;  3DCX A;  2COA A;  4PQ0 A;  2Z59 A;  3P7Z A;  3TCA A;  3ODW A;  3PP2 A;  1I7A A;  2GUM A;  4L6E A;  1MK7 B;  5FI1 A;  2UZR A;  3RCP A;  2YF0 A;  2H7D A;  3D8D A;  1XD4 A;  2PZ1 A;  4DX8 A;  1V89 A;  1X1F A;  1PMS A;  3IVF A;  1GC7 A;  2DA0 A;  1NTV A;  3AU5 A;  4HB0 B;  5HE2 A;  2ZPY A;  1BWN A;  4GZU A;  2Q13 A;  1V5P A;  4DXA B;  2J0M A;  2CY5 A;  4HSI A;  2Z13 A;  4HB2 B;  3NWD A;  1MKE A;  3ZDT A;  1DYN A;  2I1K A;  3FSS A;  2DYQ A;  1SHC A;  1UPR A;  3M1I B;  1E5W A;  2Z0Q A;  2X18 A;  2HE7 A;  4HB4 B;  1ZSQ A;  2YS3 A;  1W1G A;  5JLJ B;  4KHB B;  3DXE A;  4HB3 B;  5CLQ B;  5D27 A;  1EGX A;  2ROV A;  3ZVR A;  5C79 A;  2YS1 A;  4EKU A;  2N23 A;  1FHW A;  1DDM A;  1X11 A;  2YT2 A;  1P3R A;  4CHJ A;  1XR0 B;  1DBH A;  2KR0 A;  3UZT A;  1H10 A;  1SGH A;  2DYN A;  1TQZ A;  2MDX A;  1DDV A;  5M4Y B;  5DH9 B;  2UZS A;  4HHV A;  2M14 A;  1W1H A;  3QIJ A;  2D9Z A;  2KUQ A;  2QKM A;  3T06 A;  5HE0 A;  3QWM A;  2NBV A;  3ULC A;  5DHA B;  3G9W A;  1UNR A;  1V88 A;  4KHO A;  2N0Y A;  2DKQ A;  2NMB A;  4K81 A;  4CSQ A;  2W2X C;  1WG7 A;  1ZC4 B;  5DI9 B;  2Z4D A;  1AQC A;  5JHH A;  4ZRK A;  4CHM A;  1J19 A;  2MWN B;  2GS0 A;  2L1C A;  4B6H A;  3D8F A;  4YON A;  1W1D A;  3B77 A;  1V61 A;  4QXA B;  1FHO A;  1X86 A;  4TYZ A;  1DRO A;  1LB1 A;  4WSF A;  2RUK B;  2RGN B;  4QJ3 B;  5D3W A;  2VRW B;  1WGQ A;  1ZYI A;  5KQ4 A;  1T77 A;  5C16 A;  5J3T A;  1MI1 A;  4EJN A;  1IRS A;  2K49 A;  2GCJ A;  4Y94 A;  4DIX A;  1H4R A;  4MY6 A;  2DKP A;  5J3Y A;  3CIK A;  5IRS A;  1EVH A;  4K2P A;  3ODX A;  4D6W A;  3F0W A;  3KZ1 A;  4F7U P;  4L1R A; 
#chains in the Genus database with same CATH homology
 4ZRJ A;  1Q67 A;  5HE1 A;  5C6R A;  3KRX A;  1FOE A;  1TXD A;  3PVW A;  4EMO A;  1M7R A;  2LKO A;  4GPT B;  2LOZ A;  2DFK A;  1XCG A;  2G35 A;  4Z2M B;  3BIN A;  1I2H A;  1KZG A;  5LON B;  4MT7 A;  3SNH A;  5KQ1 A;  1ZVR A;  2OQB A;  3VOQ A;  2YRY A;  2D9W A;  1X05 A;  3D8E A;  4F7G A;  2I5F A;  2YT1 A;  3DXD A;  5D3V A;  1RRP B;  4DX9 0;  2DLW A;  1PLS A;  2EJ8 A;  2LUL A;  2DHI A;  2LYD A;  3AU4 A;  1U2B A;  1WJ1 A;  1NTY A;  5HE3 A;  5EFX A;  4H8S A;  3O96 A;  2CAY A;  4PNK A;  2KCJ A;  1UNQ A;  3SUZ A;  1LW3 A;  2D10 A;  2VKI A;  2COC A;  1AWE A;  5J3Q A;  3PVL A;  4A6F A;  1DDW A;  1U29 A;  2IFS A;  1MAI A;  2AEH A;  4HAW B;  2I1J A;  4Z2N A;  3X23 A;  2P0F A;  1XX0 A;  3PSC A;  2YT0 A;  4ZRI A;  4A6H A;  2E2X A;  4IFS A;  1OY2 A;  2J59 M;  4HAX B;  2J0K A;  1WGU A;  4WVF B;  5L81 A;  3N7C A;  2W2X D;  4D0N B;  2P8V A;  3HQC A;  1B55 A;  3P6A A;  3NSU A;  1WVH A;  1M7E A;  2D2Q A;  2D9X A;  3WYF B;  3DXC A;  4HAT B;  2EMT A;  2P0H A;  4MK0 A;  1K5D B;  2MKR A;  2RLO A;  3F5R A;  2DX5 A;  3QBV B;  2MFQ A;  4K17 A;  2DHK A;  1BTN A;  1U27 A;  4TKN A;  1J0W A;  4A6K A;  4GMV A;  2Y8F A;  2GJY A;  3A98 B;  1U5E A;  1OQN A;  2KUP A;  3U8Z A;  2GCL A;  2IYB A;  2RNR B;  3PEG A;  2M38 A;  2D4Q A;  2BCJ A;  3TO1 A;  2LOX A;  5GOW B;  2J0J A;  1BTK A;  2K2U A;  2CRF A;  1MK9 B;  4IOY X;  4HAU B;  3GYP A;  2W2W A;  3ODO A;  2HTH B;  2YSZ A;  2V76 A;  5KCV A;  2DN6 A;  5LOP B;  1GG3 A;  4F7H A;  3SO6 A;  3AJ4 A;  1U5D A;  5JHG A;  1EF1 A;  4K2O A;  4C0A A;  4A5K A;  2Z0O A;  2D9V A;  2D9Y A;  2P0D A;  1ZC3 B;  1ISN A;  4IAP A;  1XOD A;  4KVG B;  1X1G A;  2YS5 A;  2LG1 A;  1Y5O A;  2CY4 A;  3BJI A;  2ELA A;  3KSY A;  2DTC A;  3LJU X;  2RVB B;  4DBB A;  4CYE A;  2H7E A;  1P5T A;  5DHF B;  2Z0P A;  5C5B B;  3U7D A;  1V5M A;  2L2I A;  4NSW A;  3ULB A;  1K5G B;  2I5C A;  1KI1 B;  2EC1 A;  1EAZ A;  1NI2 A;  2XQN M;  2RSG A;  4YL8 A;  2YVC A;  1ZM0 A;  4WJ7 A;  3SV1 A;  1PFJ A;  2VSZ A;  5FI0 A;  5DIF B;  2R09 A;  1U5G A;  2FJL A;  2COD A;  3MDB C;  2KGX B;  3CXB B;  4GXB A;  3WA0 A;  1GC6 A;  1Y19 B;  3OAN A;  3V5W A;  3KRW A;  2COF A;  2DX1 A;  3SYX A;  1KZ7 A;  4GMX B;  5CLL B;  2DHJ A;  3GYO A;  1WJM A;  3FM8 C;  3TVV A;  1N3H A;  5D3X A;  1QQG A;  1MPH A;  1OMW A;  2OTX A;  2K2J A;  3MPX A;  3PG7 A;  1Z87 A;  1FGY A;  1UNP A;  1V5U A;  1MIX A;  3TFM A;  1TJ6 A;  1NU2 A;  2ADZ A;  4HDO A;  2Y7B A;  4HDQ A;  3KY9 A;  3ML4 A;  2NZ8 B;  3HK0 A;  2ELB A;  3FEH A;  1BAK A;  3PVU A;  4GN1 A;  2Y8G A;  1MIZ B;  4HAY B;  3A8Q A;  4NY0 A;  1FGZ A;  1XKE A;  4XWX A;  3A8P A;  1UPQ A;  2JP2 A;  5C5B A;  4HAZ B;  3VIA A;  3HW2 B;  2D11 A;  1U5F A;  3TW1 A;  2ROZ B;  2EMS A;  4A6F B;  4HAV B;  4BBK A;  1FB8 A;  3PZD A;  1FAO A;  2QKL A;  1WI1 A;  2R0D A;  1P6S A;  4KHA A;  2AL6 A;  1UEF A;  2K00 A;  4P7I A;  5JP4 A;  2UVM A;  5D3Y A;  1QC6 A;  1RJ2 A;  4KAX B;  1FHX A;  2COA A;  4PQ0 A;  3P7Z A;  3TCA A;  3ODW A;  3PP2 A;  1I7A A;  4L6E A;  1MK7 B;  5FI1 A;  2UZR A;  3RCP A;  2YF0 A;  2H7D A;  3D8D A;  1XD4 A;  2PZ1 A;  4DX8 A;  1V89 A;  1X1F A;  1PMS A;  3IVF A;  1GC7 A;  2DA0 A;  1NTV A;  3AU5 A;  4HB0 B;  5HE2 A;  2ZPY A;  1BWN A;  4GZU A;  2Q13 A;  1V5P A;  4DXA B;  2J0M A;  2CY5 A;  4HB2 B;  1MKE A;  3ZDT A;  1DYN A;  2I1K A;  3FSS A;  2DYQ A;  1SHC A;  1UPR A;  3M1I B;  1E5W A;  2Z0Q A;  2X18 A;  2HE7 A;  4HB4 B;  1ZSQ A;  2YS3 A;  1W1G A;  5JLJ B;  4KHB B;  3DXE A;  4HB3 B;  5CLQ B;  5D27 A;  1EGX A;  2ROV A;  3ZVR A;  5C79 A;  2YS1 A;  4EKU A;  2N23 A;  1FHW A;  1DDM A;  1X11 A;  1P3R A;  4CHJ A;  1XR0 B;  1DBH A;  3UZT A;  1H10 A;  1SGH A;  2DYN A;  1TQZ A;  2MDX A;  1DDV A;  5DH9 B;  2UZS A;  4HHV A;  2M14 A;  1W1H A;  3QIJ A;  2D9Z A;  2QKM A;  3T06 A;  5HE0 A;  3QWM A;  3ULC A;  5DHA B;  3G9W A;  1UNR A;  1V88 A;  4KHO A;  2N0Y A;  2DKQ A;  2NMB A;  4K81 A;  2W2X C;  1WG7 A;  1ZC4 B;  5DI9 B;  1AQC A;  5JHH A;  4ZRK A;  4CHM A;  1J19 A;  2MWN B;  2GS0 A;  2L1C A;  4B6H A;  3D8F A;  4YON A;  1W1D A;  1FHO A;  1V61 A;  1X86 A;  4TYZ A;  1DRO A;  1LB1 A;  4WSF A;  2RUK B;  2RGN B;  5D3W A;  2VRW B;  1WGQ A;  5KQ4 A;  5C16 A;  5J3T A;  4EJN A;  1IRS A;  2GCJ A;  4Y94 A;  1H4R A;  4MY6 A;  2DKP A;  5J3Y A;  3CIK A;  1EVH A;  4K2P A;  3ODX A;  3F0W A;  3KZ1 A;  4F7U P; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...