3NSUA

A systematic screen for protein-lipid interactions in saccharomyces cerevisiae
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
117
structure length
109
Chain Sequence
PFTEIKSGFLERRSKFLKSYSKGYYVLTPNFLHEFKTADRKKDLVPVMSLALSECTVTEHSRKNSTSSPNSTGSDAKFVLHAKHNWVFKADSYESMMSWFDNLKILTST
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Phosphatidylinositol 4,5-bisphosphate-binding protein SLM1
publication title A systematic screen for protein-lipid interactions in Saccharomyces cerevisiae.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Signaling protein
total genus 24
structure length 109
sequence length 117
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00169 PH PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 3nsuA00
1X86A 3FEHA 2JP2A 5DH9B 4WVFB 3D8FA 1LW3A 2Q13A 1UPQA 1GC7A 4XWXA 3ULBA 1V61A 3M1IB 1X1FA 3KY9A 1UNRA 1Y19B 2P0HA 3U8ZA 4HAVB 1N3HA 2ROZB 1FGZA 2DFKA 4F7HA 2YT0A 5KQ1A 2K2JA 4GN1A 2CAYA 1K5GB 1SHCA 2DHJA 1TXDA 4HATB 2R09A 5LONB 2GCJA 4Z2NA 3VIAA 5C5BA 1NTVA 3WA0A 2LYDA 4BBKA 5CLQB 1Q67A 1TJ6A 4MY6A 3HW2B 2COAA 4HDQA 3FSSA 1Z87A 2I5FA 3AU4A 4L6EA 4P7IA 3TCAA 2NZ8B 1X11A 3IVFA 4DBBA 4WSFA 3PEGA 2DA0A 4TKNA 1MKEA 1BAKA 3X23A 4DX90 2DN6A 4B6HA 1DDWA 1ZSQA 1M7EA 5DIFB 1EF1A 2D11A 2RUKB 4HB2B 1W1DA 4WJ7A 2GS0A 5HE1A 2M38A 1FAOA 3HQCA 4CYEA 1U5DA 2UZRA 3QWMA 2YRYA 1OQNA 2P8VA 1XX0A 2VSZA 3AJ4A 2EMSA 1AWEA 4Z2MB 4GMXB 2J0MA 2YF0A 4IFSA 3BJIA 4GMVA 3A8PA 2QKMA 2X18A 3D8EA 2CODA 5KCVA 1WJ1A 5J3YA 1PFJA 3ODXA 5FI1A 1XKEA 3QIJA 5D3YA 1DBHA 3O96A 1NU2A 1RJ2A 1FGYA 2D9ZA 2COCA 3BINA 2D4QA 1ZC3B 4YONA 2L2IA 3PVLA 4TYZA 2I1JA 3PVUA 5C79A 1DROA 4PNKA 2RNRB 5C5BB 5FI0A 1WGQA 2W2XC 1WJMA 4K2PA 2Y8GA 2J0KA 2N23A 2CY4A 1OY2A 1PMSA 5L81A 3NSUA 3WYFB 5DHFB 1J19A 3SUZA 2I1KA 4K2OA 4HB4B 4KVGB 3A98B 2P0FA 3CIKA 1PLSA 2YS5A 3HK0A 4KHBB 1ZVRA 3OANA 3DXEA 2VRWB 3DXDA 1DDVA 2GCLA 2EMTA 4A6KA 1NTYA 1ZM0A 4IOYX 4F7UP 4DXAB 3PZDA 2P0DA 1P6SA 3AU5A 2D10A 2MFQA 1MAIA 4KHOA 4DX8A 3PVWA 4CHMA 1EGXA 5C16A 2LULA 5D3XA 1UNPA 1MIZB 2Y7BA 5HE0A 3ODOA 1H4RA 2AEHA 2D9YA 2DYNA 5D3VA 4F7GA 1V89A 2LKOA 2L1CA 5GOWB 4A6FA 3RCPA 4HAZB 2ADZA 3TW1A 4HAUB 1MK9B 2YS1A 2FJLA 5HE2A 4ZRJA 1SGHA 2LOZA 4K81A 2ROVA 1U27A 2UZSA 5JP4A 1RRPB 3KRXA 2DX1A 1WG7A 4KAXB 4ZRKA 2MDXA 5D3WA 2RGNB 1DYNA 2PZ1A 3KZ1A 1FB8A 3TFMA 3PP2A 5D27A 2RVBB 2H7DA 3MPXA 3SO6A 4A5KA 2E2XA 1KZGA 2V76A 2HE7A 5LOPB 2MWNB 5JLJB 1FHOA 1W1GA 3GYPA 3KSYA 5JHHA 1WGUA 4EJNA 1I7AA 2DLWA 2CRFA 1MIXA 2IYBA 2R0DA 1ZC4B 2YS3A 3TO1A 1U2BA 3PG7A 5KQ4A 1U5EA 4HDOA 4C0AA 2EC1A 2RSGA 3CXBB 3LJUX 4ZRIA 1EVHA 4Y94A 2D9XA 2IFSA 4EKUA 5J3QA 2Z0OA 1K5DB 1M7RA 1X1GA 2QKLA 3GYOA 1XD4A 2W2XD 3SV1A 2MKRA 2LOXA 1WI1A 1OMWA 3FM8C 2M14A 1J0WA 1QC6A 4A6FB 4GZUA 2ELAA 2COFA 1V5MA 2DTCA 1E5WA 1BWNA 3MDBC 5J3TA 2EJ8A 2D2QA 2H7EA 2K00A 4HB3B 1FOEA 2DHKA 3ML4A 3SNHA 2J0JA 1X05A 2XQNM 3TVVA 2GJYA 1FHWA 2OQBA 1W1HA 3ULCA 4CHJA 1MPHA 4HHVA 2OTXA 1H10A 2KUPA 3ODWA 4HAYB 2Z0QA 2HTHB 1U5GA 1KI1B 2YVCA 5DHAB 3ZDTA 2ELBA 4HAWB 2UVMA 3A8QA 2RLOA 5CLLB 3P7ZA 3P6AA 2NMBA 4MT7A 2G35A 4MK0A 2LG1A 1KZ7A 2DKQA 2YT1A 1P5TA 4HB0B 1EAZA 4KHAA 2YSZA 2D9VA 3UZTA 1I2HA 2DX5A 1U5FA 2J59M 4H8SA 2D9WA 2BCJA 2DKPA 3D8DA 1B55A 3N7CA 1XCGA 1P3RA 1TQZA 5DI9B 2W2WA 2KCJA 1BTNA 3G9WA 3T06A 4YL8A 1Y5OA 1UPRA 2K2UA 1MK7B 1NI2A 1V88A 4PQ0A 3PSCA 3V5WA 2ZPYA 1WVHA 4HAXB 4NSWA 1ISNA 2Y8FA 1UNQA 5C6RA 4GPTB 2KGXB 1FHXA 1V5PA 3VOQA 1U29A 2VKIA 1BTKA 1V5UA 1GG3A 2DYQA 2I5CA 1UEFA 2AL6A 4GXBA 3U7DA 4D0NB 1XR0B 5HE3A 3DXCA 1AQCA 3ZVRA 5EFXA 1IRSA 1LB1A 4NY0A 4A6HA 1DDMA 1XODA 3KRWA 2CY5A 3F5RA 5JHGA 1GC6A 1QQGA 3SYXA 2N0YA 4K17A 2DHIA 4IAPA 2Z0PA 3QBVB 3F0WA 4EMOA
chains in the Genus database with same CATH superfamily
1X86A 3FEHA 2JP2A 5DH9B 4WVFB 3D8FA 1LW3A 2Q13A 1UPQA 1GC7A 4XWXA 3ULBA 1V61A 3M1IB 1X1FA 3KY9A 1UNRA 1Y19B 2P0HA 3U8ZA 4HAVB 1N3HA 2ROZB 4OSNA 1FGZA 2DFKA 4F7HA 2YT0A 5KQ1A 2K2JA 4GN1A 2CAYA 1K5GB 1SHCA 2DHJA 1TXDA 4HATB 2R09A 5LONB 2GCJA 4Z2NA 3VIAA 5C5BA 1NTVA 3WA0A 2LYDA 4BBKA 5CLQB 1Q67A 1TJ6A 4MY6A 3HW2B 2COAA 4HDQA 3FSSA 1Z87A 2I5FA 3AU4A 4L6EA 4KHBA 4P7IA 2KIEA 3TCAA 1ZYIA 2NZ8B 1X11A 3IVFA 4DBBA 3NWAA 4WSFA 3PEGA 2DA0A 4TKNA 1MKEA 1BAKA 3X23A 4DX90 2DN6A 4B6HA 1DDWA 1ZSQA 1M7EA 5DIFB 1EF1A 2D11A 2RUKB 4HB2B 2Z13A 1W1DA 3DCXA 2RRFA 4WJ7A 2GS0A 5HE1A 2M38A 4L1RA 1FAOA 3HQCA 4CYEA 1U5DA 4D6WA 4QXAB 2UZRA 3QWMA 2YRYA 1OQNA 2P8VA 1XX0A 2VSZA 3AJ4A 2EMSA 1AWEA 4Z2MB 4GMXB 2J0MA 2YF0A 4IFSA 3BJIA 4GMVA 3A8PA 2QKMA 2X18A 3D8EA 2CODA 5KCVA 1WJ1A 5J3YA 1PFJA 3ODXA 5FI1A 1XKEA 3QIJA 5D3YA 1DBHA 3O96A 1NU2A 1RJ2A 1FGYA 2D9ZA 2COCA 3BINA 2D4QA 1ZC3B 4YONA 2NBVA 2L2IA 3PVLA 4TYZA 1MI1A 2I1JA 3PVUA 5C79A 1DROA 4PNKA 2RNRB 5C5BB 5FI0A 1WGQA 2W2XC 1WJMA 4K2PA 2Y8GA 2J0KA 2N23A 2CY4A 1OY2A 1PMSA 5L81A 3NSUA 3WYFB 5DHFB 1J19A 3SUZA 2I1KA 4K2OA 4HB4B 2Z4DA 4KVGB 3A98B 2P0FA 3CIKA 1PLSA 2YS5A 3HK0A 4KHBB 1ZVRA 3OANA 2KUQA 3DXEA 4CSQA 3OHMB 2VRWB 3NW8A 3DXDA 1DDVA 2GCLA 2EMTA 4A6KA 1NTYA 1ZM0A 4IOYX 4F7UP 4DXAB 3PZDA 2P0DA 1P6SA 3AU5A 2D10A 2MFQA 1MAIA 4KHOA 4DX8A 5IRSA 3PVWA 4CHMA 1EGXA 5C16A 2LULA 5D3XA 2KR0A 1UNPA 1MIZB 2Y7BA 5HE0A 3ODOA 5LG4B 1H4RA 2AEHA 2D9YA 2DYNA 5D3VA 4F7GA 1V89A 2LKOA 2L1CA 5GOWB 4A6FA 3RCPA 4HAZB 2ADZA 2ZKMX 3TW1A 4HAUB 1MK9B 2YS1A 2FJLA 5HE2A 4ZRJA 1SGHA 2LOZA 4K81A 2K49A 2ROVA 1U27A 2UZSA 5JP4A 1RRPB 2K8EA 3KRXA 2DX1A 1WG7A 4KAXB 4ZRKA 2MDXA 5D3WA 2R2YA 2RGNB 1DYNA 2PZ1A 3KZ1A 1FB8A 4HSIA 3TFMA 3PP2A 5D27A 2RVBB 1T77A 2H7DA 4OT1A 3MPXA 3SO6A 3A58A 4A5KA 2E2XA 1KZGA 2V76A 2HE7A 5LOPB 2MWNB 5JLJB 1FHOA 1W1GA 3GYPA 3KSYA 4QJ4B 5JHHA 1WGUA 5I2SA 4EJNA 1I7AA 2DLWA 2CRFA 1MIXA 2IYBA 2R0DA 1ZC4B 2YS3A 3TO1A 3FVCA 1U2BA 2Z59A 3PG7A 2Z14A 5KQ4A 1U5EA 4HDOA 5M4YB 4C0AA 2EC1A 2RSGA 3CXBB 3LJUX 4ZRIA 1EVHA 4Y94A 2D9XA 2IFSA 4EKUA 5J3QA 2Z0OA 1K5DB 1M7RA 1X1GA 2QKLA 3GYOA 1XD4A 3HIEA 2W2XD 3B77A 3SV1A 2MKRA 2LOXA 1WI1A 1OMWA 3FM8C 2M14A 1J0WA 1QC6A 4A6FB 4GZUA 2ELAA 2COFA 1V5MA 2DTCA 1E5WA 1BWNA 3MDBC 5J3TA 2EJ8A 4DIXA 2D2QA 2H7EA 2KIGA 2K00A 4HB3B 1FOEA 2DHKA 3HSAA 3ML4A 3SNHA 2J0JA 1X05A 4GOUA 2XQNM 3TVVA 2GJYA 1FHWA 2OQBA 1W1HA 3ULCA 4CHJA 1MPHA 4HHVA 2YT2A 2OTXA 1H10A 2KUPA 3ODWA 4HAYB 2Z0QA 2HTHB 1U5GA 1KI1B 2YVCA 5DHAB 3ZDTA 2ELBA 4HAWB 2UVMA 3A8QA 2RLOA 5CLLB 3P7ZA 3P6AA 2NMBA 4MT7A 2G35A 4MK0A 2LG1A 1KZ7A 2DKQA 2YT1A 1P5TA 4HB0B 1EAZA 4KHAA 2YSZA 2D9VA 3UZTA 1I2HA 2DX5A 1U5FA 3U12A 2J59M 4H8SA 2D9WA 4QJ3B 2BCJA 2DKPA 3D8DA 1B55A 3N7CA 1XCGA 1P3RA 1TQZA 5DI9B 2W2WA 2KCJA 1BTNA 3G9WA 4QJ5B 3T06A 2FJUB 4YL8A 1Y5OA 1UPRA 2K2UA 5I2MA 1MK7B 1NI2A 1V88A 4PQ0A 3PSCA 3V5WA 2ZPYA 1WVHA 3NWDA 4HAXB 4NSWA 1ISNA 2Y8FA 1UNQA 5C6RA 4GPTB 4GNKB 2KGXB 1FHXA 1V5PA 3VOQA 1U29A 2VKIA 1BTKA 1V5UA 1GG3A 2DYQA 2I5CA 1UEFA 2AL6A 4GXBA 3U7DA 4D0NB 1XR0B 5HE3A 3DXCA 1AQCA 3ZVRA 5EFXA 1IRSA 1LB1A 4NY0A 4A6HA 1DDMA 1XODA 3KRWA 2CY5A 3F5RA 5JHGA 1GC6A 1QQGA 2GUMA 3SYXA 2N0YA 4K17A 2DHIA 3NWFA 4IAPA 2Z0PA 3QBVB 3F0WA 4EMOA
chains in the Genus database with same CATH topology
1X86A 3FEHA 2JP2A 5DH9B 4WVFB 3D8FA 1LW3A 2Q13A 1UPQA 1GC7A 4XWXA 3ULBA 1V61A 3M1IB 1X1FA 3KY9A 1UNRA 1Y19B 2P0HA 3U8ZA 4HAVB 1N3HA 2ROZB 1FGZA 2DFKA 4F7HA 2YT0A 5KQ1A 2K2JA 4GN1A 2CAYA 1K5GB 1SHCA 2DHJA 1TXDA 4HATB 2R09A 5LONB 2GCJA 4Z2NA 3VIAA 5C5BA 1NTVA 3WA0A 2LYDA 4BBKA 5CLQB 1Q67A 1TJ6A 4MY6A 3HW2B 2COAA 4HDQA 3FSSA 1Z87A 2I5FA 3AU4A 4L6EA 4P7IA 3TCAA 2NZ8B 1X11A 3IVFA 4DBBA 4WSFA 3PEGA 2DA0A 4TKNA 1MKEA 1BAKA 3X23A 4DX90 2DN6A 4B6HA 1DDWA 1ZSQA 1M7EA 5DIFB 1EF1A 2D11A 2RUKB 4HB2B 1W1DA 4WJ7A 2GS0A 5HE1A 2M38A 1FAOA 3HQCA 4CYEA 1U5DA 2UZRA 3QWMA 2YRYA 1OQNA 2P8VA 1XX0A 2VSZA 3AJ4A 2EMSA 1AWEA 4Z2MB 4GMXB 2J0MA 2YF0A 4IFSA 3BJIA 4GMVA 3A8PA 2QKMA 2X18A 3D8EA 2CODA 5KCVA 1WJ1A 5J3YA 1PFJA 3ODXA 5FI1A 1XKEA 3QIJA 5D3YA 1DBHA 3O96A 1NU2A 1RJ2A 1FGYA 2D9ZA 2COCA 3BINA 2D4QA 1ZC3B 4YONA 2L2IA 3PVLA 4TYZA 2I1JA 3PVUA 5C79A 1DROA 4PNKA 2RNRB 5C5BB 5FI0A 1WGQA 2W2XC 1WJMA 4K2PA 2Y8GA 2J0KA 2N23A 2CY4A 1OY2A 1PMSA 5L81A 3NSUA 3WYFB 5DHFB 1J19A 3SUZA 2I1KA 4K2OA 4HB4B 4KVGB 3A98B 2P0FA 3CIKA 1PLSA 2YS5A 3HK0A 4KHBB 1ZVRA 3OANA 3DXEA 2VRWB 3DXDA 1DDVA 2GCLA 2EMTA 4A6KA 1NTYA 1ZM0A 4IOYX 4F7UP 4DXAB 3PZDA 2P0DA 1P6SA 3AU5A 2D10A 2MFQA 1MAIA 4KHOA 4DX8A 3PVWA 4CHMA 1EGXA 5C16A 2LULA 5D3XA 1UNPA 1MIZB 2Y7BA 5HE0A 3ODOA 1H4RA 2AEHA 2D9YA 2DYNA 5D3VA 4F7GA 1V89A 2LKOA 2L1CA 5GOWB 4A6FA 3RCPA 4HAZB 2ADZA 3TW1A 4HAUB 1MK9B 2YS1A 2FJLA 5HE2A 4ZRJA 1SGHA 2LOZA 4K81A 2ROVA 1U27A 2UZSA 5JP4A 1RRPB 3KRXA 2DX1A 1WG7A 4KAXB 4ZRKA 2MDXA 5D3WA 2RGNB 1DYNA 2PZ1A 3KZ1A 1FB8A 3TFMA 3PP2A 5D27A 2RVBB 2H7DA 3MPXA 3SO6A 4A5KA 2E2XA 1KZGA 2V76A 2HE7A 5LOPB 2MWNB 5JLJB 1FHOA 1W1GA 3GYPA 3KSYA 5JHHA 1WGUA 4EJNA 1I7AA 2DLWA 2CRFA 1MIXA 2IYBA 2R0DA 1ZC4B 2YS3A 3TO1A 1U2BA 3PG7A 5KQ4A 1U5EA 4HDOA 4C0AA 2EC1A 2RSGA 3CXBB 3LJUX 4ZRIA 1EVHA 4Y94A 2D9XA 2IFSA 4EKUA 5J3QA 2Z0OA 1K5DB 1M7RA 1X1GA 2QKLA 3GYOA 1XD4A 2W2XD 3SV1A 2MKRA 2LOXA 1WI1A 1OMWA 3FM8C 2M14A 1J0WA 1QC6A 4A6FB 4GZUA 2ELAA 2COFA 1V5MA 2DTCA 1E5WA 1BWNA 3MDBC 5J3TA 2EJ8A 2D2QA 2H7EA 2K00A 4HB3B 1FOEA 2DHKA 3ML4A 3SNHA 2J0JA 1X05A 2XQNM 3TVVA 2GJYA 1FHWA 2OQBA 1W1HA 3ULCA 4CHJA 1MPHA 4HHVA 2OTXA 1H10A 2KUPA 3ODWA 4HAYB 2Z0QA 2HTHB 1U5GA 1KI1B 2YVCA 5DHAB 3ZDTA 2ELBA 4HAWB 2UVMA 3A8QA 2RLOA 5CLLB 3P7ZA 3P6AA 2NMBA 4MT7A 2G35A 4MK0A 2LG1A 1KZ7A 2DKQA 2YT1A 1P5TA 4HB0B 1EAZA 4KHAA 2YSZA 2D9VA 3UZTA 1I2HA 2DX5A 1U5FA 2J59M 4H8SA 2D9WA 2BCJA 2DKPA 3D8DA 1B55A 3N7CA 1XCGA 1P3RA 1TQZA 5DI9B 2W2WA 2KCJA 1BTNA 3G9WA 3T06A 4YL8A 1Y5OA 1UPRA 2K2UA 1MK7B 1NI2A 1V88A 4PQ0A 3PSCA 3V5WA 2ZPYA 1WVHA 4HAXB 4NSWA 1ISNA 2Y8FA 1UNQA 5C6RA 4GPTB 2KGXB 1FHXA 1V5PA 3VOQA 1U29A 2VKIA 1BTKA 1V5UA 1GG3A 2DYQA 2I5CA 1UEFA 2AL6A 4GXBA 3U7DA 4D0NB 1XR0B 5HE3A 3DXCA 1AQCA 3ZVRA 5EFXA 1IRSA 1LB1A 4NY0A 4A6HA 1DDMA 1XODA 3KRWA 2CY5A 3F5RA 5JHGA 1GC6A 1QQGA 3SYXA 2N0YA 4K17A 2DHIA 4IAPA 2Z0PA 3QBVB 3F0WA 4EMOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1X86 A;  3FEH A;  2JP2 A;  5DH9 B;  4WVF B;  3D8F A;  1LW3 A;  2Q13 A;  1UPQ A;  1GC7 A;  4XWX A;  3ULB A;  1V61 A;  3M1I B;  1X1F A;  3KY9 A;  1UNR A;  1Y19 B;  2P0H A;  3U8Z A;  4HAV B;  1N3H A;  2ROZ B;  1FGZ A;  2DFK A;  4F7H A;  2YT0 A;  5KQ1 A;  2K2J A;  4GN1 A;  2CAY A;  1K5G B;  1SHC A;  2DHJ A;  1TXD A;  4HAT B;  2R09 A;  5LON B;  2GCJ A;  4Z2N A;  3VIA A;  5C5B A;  1NTV A;  3WA0 A;  2LYD A;  4BBK A;  5CLQ B;  1Q67 A;  1TJ6 A;  4MY6 A;  3HW2 B;  2COA A;  4HDQ A;  3FSS A;  1Z87 A;  2I5F A;  3AU4 A;  4L6E A;  4P7I A;  3TCA A;  2NZ8 B;  1X11 A;  3IVF A;  4DBB A;  4WSF A;  3PEG A;  2DA0 A;  4TKN A;  1MKE A;  1BAK A;  3X23 A;  4DX9 0;  2DN6 A;  4B6H A;  1DDW A;  1ZSQ A;  1M7E A;  5DIF B;  1EF1 A;  2D11 A;  2RUK B;  4HB2 B;  1W1D A;  4WJ7 A;  2GS0 A;  5HE1 A;  2M38 A;  1FAO A;  3HQC A;  4CYE A;  1U5D A;  2UZR A;  3QWM A;  2YRY A;  1OQN A;  2P8V A;  1XX0 A;  2VSZ A;  3AJ4 A;  2EMS A;  1AWE A;  4Z2M B;  4GMX B;  2J0M A;  2YF0 A;  4IFS A;  3BJI A;  4GMV A;  3A8P A;  2QKM A;  2X18 A;  3D8E A;  2COD A;  5KCV A;  1WJ1 A;  5J3Y A;  1PFJ A;  3ODX A;  5FI1 A;  1XKE A;  3QIJ A;  5D3Y A;  1DBH A;  3O96 A;  1NU2 A;  1RJ2 A;  1FGY A;  2D9Z A;  2COC A;  3BIN A;  2D4Q A;  1ZC3 B;  4YON A;  2L2I A;  3PVL A;  4TYZ A;  2I1J A;  3PVU A;  5C79 A;  1DRO A;  4PNK A;  2RNR B;  5C5B B;  5FI0 A;  1WGQ A;  2W2X C;  1WJM A;  4K2P A;  2Y8G A;  2J0K A;  2N23 A;  2CY4 A;  1OY2 A;  1PMS A;  5L81 A;  3NSU A;  3WYF B;  5DHF B;  1J19 A;  3SUZ A;  2I1K A;  4K2O A;  4HB4 B;  4KVG B;  3A98 B;  2P0F A;  3CIK A;  1PLS A;  2YS5 A;  3HK0 A;  4KHB B;  1ZVR A;  3OAN A;  3DXE A;  2VRW B;  3DXD A;  1DDV A;  2GCL A;  2EMT A;  4A6K A;  1NTY A;  1ZM0 A;  4IOY X;  4F7U P;  4DXA B;  3PZD A;  2P0D A;  1P6S A;  3AU5 A;  2D10 A;  2MFQ A;  1MAI A;  4KHO A;  4DX8 A;  3PVW A;  4CHM A;  1EGX A;  5C16 A;  2LUL A;  5D3X A;  1UNP A;  1MIZ B;  2Y7B A;  5HE0 A;  3ODO A;  1H4R A;  2AEH A;  2D9Y A;  2DYN A;  5D3V A;  4F7G A;  1V89 A;  2LKO A;  2L1C A;  5GOW B;  4A6F A;  3RCP A;  4HAZ B;  2ADZ A;  3TW1 A;  4HAU B;  1MK9 B;  2YS1 A;  2FJL A;  5HE2 A;  4ZRJ A;  1SGH A;  2LOZ A;  4K81 A;  2ROV A;  1U27 A;  2UZS A;  5JP4 A;  1RRP B;  3KRX A;  2DX1 A;  1WG7 A;  4KAX B;  4ZRK A;  2MDX A;  5D3W A;  2RGN B;  1DYN A;  2PZ1 A;  3KZ1 A;  1FB8 A;  3TFM A;  3PP2 A;  5D27 A;  2RVB B;  2H7D A;  3MPX A;  3SO6 A;  4A5K A;  2E2X A;  1KZG A;  2V76 A;  2HE7 A;  5LOP B;  2MWN B;  5JLJ B;  1FHO A;  1W1G A;  3GYP A;  3KSY A;  5JHH A;  1WGU A;  4EJN A;  1I7A A;  2DLW A;  2CRF A;  1MIX A;  2IYB A;  2R0D A;  1ZC4 B;  2YS3 A;  3TO1 A;  1U2B A;  3PG7 A;  5KQ4 A;  1U5E A;  4HDO A;  4C0A A;  2EC1 A;  2RSG A;  3CXB B;  3LJU X;  4ZRI A;  1EVH A;  4Y94 A;  2D9X A;  2IFS A;  4EKU A;  5J3Q A;  2Z0O A;  1K5D B;  1M7R A;  1X1G A;  2QKL A;  3GYO A;  1XD4 A;  2W2X D;  3SV1 A;  2MKR A;  2LOX A;  1WI1 A;  1OMW A;  3FM8 C;  2M14 A;  1J0W A;  1QC6 A;  4A6F B;  4GZU A;  2ELA A;  2COF A;  1V5M A;  2DTC A;  1E5W A;  1BWN A;  3MDB C;  5J3T A;  2EJ8 A;  2D2Q A;  2H7E A;  2K00 A;  4HB3 B;  1FOE A;  2DHK A;  3ML4 A;  3SNH A;  2J0J A;  1X05 A;  2XQN M;  3TVV A;  2GJY A;  1FHW A;  2OQB A;  1W1H A;  3ULC A;  4CHJ A;  1MPH A;  4HHV A;  2OTX A;  1H10 A;  2KUP A;  3ODW A;  4HAY B;  2Z0Q A;  2HTH B;  1U5G A;  1KI1 B;  2YVC A;  5DHA B;  3ZDT A;  2ELB A;  4HAW B;  2UVM A;  3A8Q A;  2RLO A;  5CLL B;  3P7Z A;  3P6A A;  2NMB A;  4MT7 A;  2G35 A;  4MK0 A;  2LG1 A;  1KZ7 A;  2DKQ A;  2YT1 A;  1P5T A;  4HB0 B;  1EAZ A;  4KHA A;  2YSZ A;  2D9V A;  3UZT A;  1I2H A;  2DX5 A;  1U5F A;  2J59 M;  4H8S A;  2D9W A;  2BCJ A;  2DKP A;  3D8D A;  1B55 A;  3N7C A;  1XCG A;  1P3R A;  1TQZ A;  5DI9 B;  2W2W A;  2KCJ A;  1BTN A;  3G9W A;  3T06 A;  4YL8 A;  1Y5O A;  1UPR A;  2K2U A;  1MK7 B;  1NI2 A;  1V88 A;  4PQ0 A;  3PSC A;  3V5W A;  2ZPY A;  1WVH A;  4HAX B;  4NSW A;  1ISN A;  2Y8F A;  1UNQ A;  5C6R A;  4GPT B;  2KGX B;  1FHX A;  1V5P A;  3VOQ A;  1U29 A;  2VKI A;  1BTK A;  1V5U A;  1GG3 A;  2DYQ A;  2I5C A;  1UEF A;  2AL6 A;  4GXB A;  3U7D A;  4D0N B;  1XR0 B;  5HE3 A;  3DXC A;  1AQC A;  3ZVR A;  5EFX A;  1IRS A;  1LB1 A;  4NY0 A;  4A6H A;  1DDM A;  1XOD A;  3KRW A;  2CY5 A;  3F5R A;  5JHG A;  1GC6 A;  1QQG A;  3SYX A;  2N0Y A;  4K17 A;  2DHI A;  4IAP A;  2Z0P A;  3QBV B;  3F0W A;  4EMO A; 
#chains in the Genus database with same CATH topology
 1X86 A;  3FEH A;  2JP2 A;  5DH9 B;  4WVF B;  3D8F A;  1LW3 A;  2Q13 A;  1UPQ A;  1GC7 A;  4XWX A;  3ULB A;  1V61 A;  3M1I B;  1X1F A;  3KY9 A;  1UNR A;  1Y19 B;  2P0H A;  3U8Z A;  4HAV B;  1N3H A;  2ROZ B;  4OSN A;  1FGZ A;  2DFK A;  4F7H A;  2YT0 A;  5KQ1 A;  2K2J A;  4GN1 A;  2CAY A;  1K5G B;  1SHC A;  2DHJ A;  1TXD A;  4HAT B;  2R09 A;  5LON B;  2GCJ A;  4Z2N A;  3VIA A;  5C5B A;  1NTV A;  3WA0 A;  2LYD A;  4BBK A;  5CLQ B;  1Q67 A;  1TJ6 A;  4MY6 A;  3HW2 B;  2COA A;  4HDQ A;  3FSS A;  1Z87 A;  2I5F A;  3AU4 A;  4L6E A;  4KHB A;  4P7I A;  2KIE A;  3TCA A;  1ZYI A;  2NZ8 B;  1X11 A;  3IVF A;  4DBB A;  3NWA A;  4WSF A;  3PEG A;  2DA0 A;  4TKN A;  1MKE A;  1BAK A;  3X23 A;  4DX9 0;  2DN6 A;  4B6H A;  1DDW A;  1ZSQ A;  1M7E A;  5DIF B;  1EF1 A;  2D11 A;  2RUK B;  4HB2 B;  2Z13 A;  1W1D A;  3DCX A;  2RRF A;  4WJ7 A;  2GS0 A;  5HE1 A;  2M38 A;  4L1R A;  1FAO A;  3HQC A;  4CYE A;  1U5D A;  4D6W A;  4QXA B;  2UZR A;  3QWM A;  2YRY A;  1OQN A;  2P8V A;  1XX0 A;  2VSZ A;  3AJ4 A;  2EMS A;  1AWE A;  4Z2M B;  4GMX B;  2J0M A;  2YF0 A;  4IFS A;  3BJI A;  4GMV A;  3A8P A;  2QKM A;  2X18 A;  3D8E A;  2COD A;  5KCV A;  1WJ1 A;  5J3Y A;  1PFJ A;  3ODX A;  5FI1 A;  1XKE A;  3QIJ A;  5D3Y A;  1DBH A;  3O96 A;  1NU2 A;  1RJ2 A;  1FGY A;  2D9Z A;  2COC A;  3BIN A;  2D4Q A;  1ZC3 B;  4YON A;  2NBV A;  2L2I A;  3PVL A;  4TYZ A;  1MI1 A;  2I1J A;  3PVU A;  5C79 A;  1DRO A;  4PNK A;  2RNR B;  5C5B B;  5FI0 A;  1WGQ A;  2W2X C;  1WJM A;  4K2P A;  2Y8G A;  2J0K A;  2N23 A;  2CY4 A;  1OY2 A;  1PMS A;  5L81 A;  3NSU A;  3WYF B;  5DHF B;  1J19 A;  3SUZ A;  2I1K A;  4K2O A;  4HB4 B;  2Z4D A;  4KVG B;  3A98 B;  2P0F A;  3CIK A;  1PLS A;  2YS5 A;  3HK0 A;  4KHB B;  1ZVR A;  3OAN A;  2KUQ A;  3DXE A;  4CSQ A;  3OHM B;  2VRW B;  3NW8 A;  3DXD A;  1DDV A;  2GCL A;  2EMT A;  4A6K A;  1NTY A;  1ZM0 A;  4IOY X;  4F7U P;  4DXA B;  3PZD A;  2P0D A;  1P6S A;  3AU5 A;  2D10 A;  2MFQ A;  1MAI A;  4KHO A;  4DX8 A;  5IRS A;  3PVW A;  4CHM A;  1EGX A;  5C16 A;  2LUL A;  5D3X A;  2KR0 A;  1UNP A;  1MIZ B;  2Y7B A;  5HE0 A;  3ODO A;  5LG4 B;  1H4R A;  2AEH A;  2D9Y A;  2DYN A;  5D3V A;  4F7G A;  1V89 A;  2LKO A;  2L1C A;  5GOW B;  4A6F A;  3RCP A;  4HAZ B;  2ADZ A;  2ZKM X;  3TW1 A;  4HAU B;  1MK9 B;  2YS1 A;  2FJL A;  5HE2 A;  4ZRJ A;  1SGH A;  2LOZ A;  4K81 A;  2K49 A;  2ROV A;  1U27 A;  2UZS A;  5JP4 A;  1RRP B;  2K8E A;  3KRX A;  2DX1 A;  1WG7 A;  4KAX B;  4ZRK A;  2MDX A;  5D3W A;  2R2Y A;  2RGN B;  1DYN A;  2PZ1 A;  3KZ1 A;  1FB8 A;  4HSI A;  3TFM A;  3PP2 A;  5D27 A;  2RVB B;  1T77 A;  2H7D A;  4OT1 A;  3MPX A;  3SO6 A;  3A58 A;  4A5K A;  2E2X A;  1KZG A;  2V76 A;  2HE7 A;  5LOP B;  2MWN B;  5JLJ B;  1FHO A;  1W1G A;  3GYP A;  3KSY A;  4QJ4 B;  5JHH A;  1WGU A;  5I2S A;  4EJN A;  1I7A A;  2DLW A;  2CRF A;  1MIX A;  2IYB A;  2R0D A;  1ZC4 B;  2YS3 A;  3TO1 A;  3FVC A;  1U2B A;  2Z59 A;  3PG7 A;  2Z14 A;  5KQ4 A;  1U5E A;  4HDO A;  5M4Y B;  4C0A A;  2EC1 A;  2RSG A;  3CXB B;  3LJU X;  4ZRI A;  1EVH A;  4Y94 A;  2D9X A;  2IFS A;  4EKU A;  5J3Q A;  2Z0O A;  1K5D B;  1M7R A;  1X1G A;  2QKL A;  3GYO A;  1XD4 A;  3HIE A;  2W2X D;  3B77 A;  3SV1 A;  2MKR A;  2LOX A;  1WI1 A;  1OMW A;  3FM8 C;  2M14 A;  1J0W A;  1QC6 A;  4A6F B;  4GZU A;  2ELA A;  2COF A;  1V5M A;  2DTC A;  1E5W A;  1BWN A;  3MDB C;  5J3T A;  2EJ8 A;  4DIX A;  2D2Q A;  2H7E A;  2KIG A;  2K00 A;  4HB3 B;  1FOE A;  2DHK A;  3HSA A;  3ML4 A;  3SNH A;  2J0J A;  1X05 A;  4GOU A;  2XQN M;  3TVV A;  2GJY A;  1FHW A;  2OQB A;  1W1H A;  3ULC A;  4CHJ A;  1MPH A;  4HHV A;  2YT2 A;  2OTX A;  1H10 A;  2KUP A;  3ODW A;  4HAY B;  2Z0Q A;  2HTH B;  1U5G A;  1KI1 B;  2YVC A;  5DHA B;  3ZDT A;  2ELB A;  4HAW B;  2UVM A;  3A8Q A;  2RLO A;  5CLL B;  3P7Z A;  3P6A A;  2NMB A;  4MT7 A;  2G35 A;  4MK0 A;  2LG1 A;  1KZ7 A;  2DKQ A;  2YT1 A;  1P5T A;  4HB0 B;  1EAZ A;  4KHA A;  2YSZ A;  2D9V A;  3UZT A;  1I2H A;  2DX5 A;  1U5F A;  3U12 A;  2J59 M;  4H8S A;  2D9W A;  4QJ3 B;  2BCJ A;  2DKP A;  3D8D A;  1B55 A;  3N7C A;  1XCG A;  1P3R A;  1TQZ A;  5DI9 B;  2W2W A;  2KCJ A;  1BTN A;  3G9W A;  4QJ5 B;  3T06 A;  2FJU B;  4YL8 A;  1Y5O A;  1UPR A;  2K2U A;  5I2M A;  1MK7 B;  1NI2 A;  1V88 A;  4PQ0 A;  3PSC A;  3V5W A;  2ZPY A;  1WVH A;  3NWD A;  4HAX B;  4NSW A;  1ISN A;  2Y8F A;  1UNQ A;  5C6R A;  4GPT B;  4GNK B;  2KGX B;  1FHX A;  1V5P A;  3VOQ A;  1U29 A;  2VKI A;  1BTK A;  1V5U A;  1GG3 A;  2DYQ A;  2I5C A;  1UEF A;  2AL6 A;  4GXB A;  3U7D A;  4D0N B;  1XR0 B;  5HE3 A;  3DXC A;  1AQC A;  3ZVR A;  5EFX A;  1IRS A;  1LB1 A;  4NY0 A;  4A6H A;  1DDM A;  1XOD A;  3KRW A;  2CY5 A;  3F5R A;  5JHG A;  1GC6 A;  1QQG A;  2GUM A;  3SYX A;  2N0Y A;  4K17 A;  2DHI A;  3NWF A;  4IAP A;  2Z0P A;  3QBV B;  3F0W A;  4EMO A; 
#chains in the Genus database with same CATH homology
 1X86 A;  3FEH A;  2JP2 A;  5DH9 B;  4WVF B;  3D8F A;  1LW3 A;  2Q13 A;  1UPQ A;  1GC7 A;  4XWX A;  3ULB A;  1V61 A;  3M1I B;  1X1F A;  3KY9 A;  1UNR A;  1Y19 B;  2P0H A;  3U8Z A;  4HAV B;  1N3H A;  2ROZ B;  1FGZ A;  2DFK A;  4F7H A;  2YT0 A;  5KQ1 A;  2K2J A;  4GN1 A;  2CAY A;  1K5G B;  1SHC A;  2DHJ A;  1TXD A;  4HAT B;  2R09 A;  5LON B;  2GCJ A;  4Z2N A;  3VIA A;  5C5B A;  1NTV A;  3WA0 A;  2LYD A;  4BBK A;  5CLQ B;  1Q67 A;  1TJ6 A;  4MY6 A;  3HW2 B;  2COA A;  4HDQ A;  3FSS A;  1Z87 A;  2I5F A;  3AU4 A;  4L6E A;  4P7I A;  3TCA A;  2NZ8 B;  1X11 A;  3IVF A;  4DBB A;  4WSF A;  3PEG A;  2DA0 A;  4TKN A;  1MKE A;  1BAK A;  3X23 A;  4DX9 0;  2DN6 A;  4B6H A;  1DDW A;  1ZSQ A;  1M7E A;  5DIF B;  1EF1 A;  2D11 A;  2RUK B;  4HB2 B;  1W1D A;  4WJ7 A;  2GS0 A;  5HE1 A;  2M38 A;  1FAO A;  3HQC A;  4CYE A;  1U5D A;  2UZR A;  3QWM A;  2YRY A;  1OQN A;  2P8V A;  1XX0 A;  2VSZ A;  3AJ4 A;  2EMS A;  1AWE A;  4Z2M B;  4GMX B;  2J0M A;  2YF0 A;  4IFS A;  3BJI A;  4GMV A;  3A8P A;  2QKM A;  2X18 A;  3D8E A;  2COD A;  5KCV A;  1WJ1 A;  5J3Y A;  1PFJ A;  3ODX A;  5FI1 A;  1XKE A;  3QIJ A;  5D3Y A;  1DBH A;  3O96 A;  1NU2 A;  1RJ2 A;  1FGY A;  2D9Z A;  2COC A;  3BIN A;  2D4Q A;  1ZC3 B;  4YON A;  2L2I A;  3PVL A;  4TYZ A;  2I1J A;  3PVU A;  5C79 A;  1DRO A;  4PNK A;  2RNR B;  5C5B B;  5FI0 A;  1WGQ A;  2W2X C;  1WJM A;  4K2P A;  2Y8G A;  2J0K A;  2N23 A;  2CY4 A;  1OY2 A;  1PMS A;  5L81 A;  3NSU A;  3WYF B;  5DHF B;  1J19 A;  3SUZ A;  2I1K A;  4K2O A;  4HB4 B;  4KVG B;  3A98 B;  2P0F A;  3CIK A;  1PLS A;  2YS5 A;  3HK0 A;  4KHB B;  1ZVR A;  3OAN A;  3DXE A;  2VRW B;  3DXD A;  1DDV A;  2GCL A;  2EMT A;  4A6K A;  1NTY A;  1ZM0 A;  4IOY X;  4F7U P;  4DXA B;  3PZD A;  2P0D A;  1P6S A;  3AU5 A;  2D10 A;  2MFQ A;  1MAI A;  4KHO A;  4DX8 A;  3PVW A;  4CHM A;  1EGX A;  5C16 A;  2LUL A;  5D3X A;  1UNP A;  1MIZ B;  2Y7B A;  5HE0 A;  3ODO A;  1H4R A;  2AEH A;  2D9Y A;  2DYN A;  5D3V A;  4F7G A;  1V89 A;  2LKO A;  2L1C A;  5GOW B;  4A6F A;  3RCP A;  4HAZ B;  2ADZ A;  3TW1 A;  4HAU B;  1MK9 B;  2YS1 A;  2FJL A;  5HE2 A;  4ZRJ A;  1SGH A;  2LOZ A;  4K81 A;  2ROV A;  1U27 A;  2UZS A;  5JP4 A;  1RRP B;  3KRX A;  2DX1 A;  1WG7 A;  4KAX B;  4ZRK A;  2MDX A;  5D3W A;  2RGN B;  1DYN A;  2PZ1 A;  3KZ1 A;  1FB8 A;  3TFM A;  3PP2 A;  5D27 A;  2RVB B;  2H7D A;  3MPX A;  3SO6 A;  4A5K A;  2E2X A;  1KZG A;  2V76 A;  2HE7 A;  5LOP B;  2MWN B;  5JLJ B;  1FHO A;  1W1G A;  3GYP A;  3KSY A;  5JHH A;  1WGU A;  4EJN A;  1I7A A;  2DLW A;  2CRF A;  1MIX A;  2IYB A;  2R0D A;  1ZC4 B;  2YS3 A;  3TO1 A;  1U2B A;  3PG7 A;  5KQ4 A;  1U5E A;  4HDO A;  4C0A A;  2EC1 A;  2RSG A;  3CXB B;  3LJU X;  4ZRI A;  1EVH A;  4Y94 A;  2D9X A;  2IFS A;  4EKU A;  5J3Q A;  2Z0O A;  1K5D B;  1M7R A;  1X1G A;  2QKL A;  3GYO A;  1XD4 A;  2W2X D;  3SV1 A;  2MKR A;  2LOX A;  1WI1 A;  1OMW A;  3FM8 C;  2M14 A;  1J0W A;  1QC6 A;  4A6F B;  4GZU A;  2ELA A;  2COF A;  1V5M A;  2DTC A;  1E5W A;  1BWN A;  3MDB C;  5J3T A;  2EJ8 A;  2D2Q A;  2H7E A;  2K00 A;  4HB3 B;  1FOE A;  2DHK A;  3ML4 A;  3SNH A;  2J0J A;  1X05 A;  2XQN M;  3TVV A;  2GJY A;  1FHW A;  2OQB A;  1W1H A;  3ULC A;  4CHJ A;  1MPH A;  4HHV A;  2OTX A;  1H10 A;  2KUP A;  3ODW A;  4HAY B;  2Z0Q A;  2HTH B;  1U5G A;  1KI1 B;  2YVC A;  5DHA B;  3ZDT A;  2ELB A;  4HAW B;  2UVM A;  3A8Q A;  2RLO A;  5CLL B;  3P7Z A;  3P6A A;  2NMB A;  4MT7 A;  2G35 A;  4MK0 A;  2LG1 A;  1KZ7 A;  2DKQ A;  2YT1 A;  1P5T A;  4HB0 B;  1EAZ A;  4KHA A;  2YSZ A;  2D9V A;  3UZT A;  1I2H A;  2DX5 A;  1U5F A;  2J59 M;  4H8S A;  2D9W A;  2BCJ A;  2DKP A;  3D8D A;  1B55 A;  3N7C A;  1XCG A;  1P3R A;  1TQZ A;  5DI9 B;  2W2W A;  2KCJ A;  1BTN A;  3G9W A;  3T06 A;  4YL8 A;  1Y5O A;  1UPR A;  2K2U A;  1MK7 B;  1NI2 A;  1V88 A;  4PQ0 A;  3PSC A;  3V5W A;  2ZPY A;  1WVH A;  4HAX B;  4NSW A;  1ISN A;  2Y8F A;  1UNQ A;  5C6R A;  4GPT B;  2KGX B;  1FHX A;  1V5P A;  3VOQ A;  1U29 A;  2VKI A;  1BTK A;  1V5U A;  1GG3 A;  2DYQ A;  2I5C A;  1UEF A;  2AL6 A;  4GXB A;  3U7D A;  4D0N B;  1XR0 B;  5HE3 A;  3DXC A;  1AQC A;  3ZVR A;  5EFX A;  1IRS A;  1LB1 A;  4NY0 A;  4A6H A;  1DDM A;  1XOD A;  3KRW A;  2CY5 A;  3F5R A;  5JHG A;  1GC6 A;  1QQG A;  3SYX A;  2N0Y A;  4K17 A;  2DHI A;  4IAP A;  2Z0P A;  3QBV B;  3F0W A;  4EMO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...