3NSUA

A systematic screen for protein-lipid interactions in saccharomyces cerevisiae
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
117
structure length
109
Chain Sequence
PFTEIKSGFLERRSKFLKSYSKGYYVLTPNFLHEFKTADRKKDLVPVMSLALSECTVTEHSRKNSTSSPNSTGSDAKFVLHAKHNWVFKADSYESMMSWFDNLKILTST
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Signaling protein
molecule keywords Phosphatidylinositol 4,5-bisphosphate-binding protein SLM1
publication title A systematic screen for protein-lipid interactions in Saccharomyces cerevisiae.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 24
structure length 109
sequence length 117
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00169 PH PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 3nsuA00
2Y8GA 3F5RA 1UNPA 2QKLA 1BAKA 3PVLA 3ODWA 1M7EA 2N0YA 2BCJA 3M1IB 3G9WA 2I5CA 2NZ8B 4GXBA 1X11A 4IOYX 2D10A 4K2OA 3NSUA 3PEGA 1U5GA 4HB3B 1TJ6A 2EMSA 4GMVA 1AWEA 1Q67A 4NSWA 3PVUA 5KQ1A 1GC6A 1W1DA 1XODA 2MDXA 1ZC4B 2YF0A 3X23A 1U5FA 2Z0OA 3ULCA 2J0JA 3LJUX 1U2BA 3ULBA 1UNRA 3DXEA 3D8EA 1WG7A 4F7GA 1N3HA 2HE7A 2YSZA 3AU4A 4HDQA 1KZGA 2MKRA 2LOXA 2DTCA 4F7UP 2J0MA 5DHAB 2Q13A 1PMSA 2CY5A 1UNQA 2V76A 3ODXA 2DYQA 4EMOA 1AQCA 5C5BA 2YS5A 1WVHA 3QWMA 4DX90 3AJ4A 4HB4B 4H8SA 4KHAA 5C79A 2ROZB 1XX0A 5KQ4A 1FAOA 1WGUA 2P0HA 2X18A 1FGYA 1NTVA 2YRYA 1V5UA 2CODA 1QC6A 2ROVA 1UPRA 2K2JA 1DDVA 2COAA 4DX8A 2ZPYA 2D4QA 2L1CA 4A6HA 1X05A 2YS1A 4WSFA 4A6FB 1NI2A 1I2HA 4A5KA 2HTHB 1U5DA 1W1GA 3U7DA 2D11A 2EJ8A 2AL6A 2OTXA 4P7IA 3D8FA 2I5FA 4F7HA 2VSZA 3DXCA 1WGQA 4DBBA 5J3QA 4KHOA 2L2IA 1P3RA 2H7EA 3P6AA 1V88A 2J59M 3GYOA 2GCJA 1X1FA 1H4RA 1MK7B 3A8QA 1MK9B 2DFKA 5J3YA 4MT7A 2I1KA 2M38A 5JLJB 1TXDA 1ZC3B 1SGHA 2KGXB 3HK0A 3D8DA 4HAVB 4KAXB 5JHGA 2D9ZA 5D3YA 1U27A 2GJYA 4CYEA 1BWNA 2P0DA 3O96A 4IAPA 4NY0A 1ZM0A 1Y19B 3DXDA 3WA0A 1ISNA 3SNHA 1V61A 1V5PA 3FM8C 2LOZA 3BINA 4HAWB 1B55A 1Z87A 4HB2B 1SHCA 3KRXA 4HAXB 5D27A 4HHVA 2UZSA 5C6RA 2LYDA 4GMXB 5CLQB 5L81A 2COFA 3AU5A 2DLWA 2YVCA 4ZRIA 2MWNB 3VOQA 3TFMA 3KRWA 3V5WA 4KHBB 1MAIA 1NTYA 2I1JA 2Y7BA 4WJ7A 1OQNA 1PFJA 2DX1A 1FHXA 3UZTA 2YT1A 3P7ZA 3TW1A 2DHJA 1WI1A 1FOEA 2Z0QA 3A98B 5KCVA 5CLLB 2RGNB 5EFXA 5HE2A 2RVBB 1GG3A 3MPXA 4ZRKA 5JP4A 2ELBA 1MPHA 3F0WA 2YT0A 2D2QA 4HAUB 5LONB 4TYZA 5GOWB 1XD4A 3RCPA 3SV1A 2RLOA 1EVHA 1IRSA 2EC1A 2P8VA 2EMTA 1E5WA 5DI9B 1FB8A 1K5DB 2QKMA 3BJIA 2RUKB 4B6HA 1BTKA 2DX5A 3HW2B 4A6KA 3PSCA 1BTNA 2DHKA 2MFQA 1EGXA 2LULA 4YONA 2PZ1A 3N7CA 2FJLA 2DKPA 3VIAA 3GYPA 3ML4A 1LW3A 4ZRJA 5C16A 5HE0A 5J3TA 3PZDA 1W1HA 4Y94A 1U29A 4A6FA 2ADZA 1KZ7A 3KZ1A 1ZSQA 1FHOA 4BBKA 4Z2NA 2R09A 1RRPB 2NMBA 1RJ2A 2ELAA 1GC7A 2P0FA 2LG1A 1DDMA 4K2PA 2G35A 1KI1B 4IFSA 2D9WA 2LKOA 1P6SA 2M14A 5HE3A 3PVWA 4XWXA 4HAZB 1OY2A 1EF1A 5DH9B 1ZVRA 4HB0B 1QQGA 5JHHA 4GZUA 2DKQA 3QBVB 3U8ZA 3TO1A 3TVVA 3WYFB 1Y5OA 1K5GB 3SO6A 3ZDTA 5D3VA 1UEFA 1X1GA 1DYNA 2IFSA 1XCGA 1OMWA 2GS0A 2KCJA 1DBHA 4C0AA 3T06A 1DDWA 2DN6A 3SYXA 3OANA 1MIXA 2XQNM 1DROA 4HDOA 2CAYA 3A8PA 1PLSA 1FHWA 1WJMA 1I7AA 2DYNA 2CRFA 4KVGB 5C5BB 2DA0A 1J19A 4MK0A 1P5TA 2GCLA 3PG7A 2J0KA 4PNKA 1LB1A 1XKEA 2Y8FA 2K2UA 2E2XA 3CIKA 2W2XC 1WJ1A 2RSGA 2D9YA 3KY9A 1NU2A 2DHIA 3ZVRA 2IYBA 2CY4A 3PP2A 3SUZA 1J0WA 1H10A 3FEHA 4D0NB 5D3XA 4WVFB 1U5EA 3TCAA 4HATB 2KUPA 4K81A 5HE1A 1MKEA 2VRWB 3FSSA 2K00A 1MIZB 3ODOA 1V89A 2YS3A 4MY6A 5FI0A 4L6EA 2RNRB 2W2XD 2AEHA 2W2WA 3KSYA 1EAZA 2OQBA 5D3WA 1V5MA 1UPQA 4TKNA 3QIJA 3CXBB 2R0DA 1X86A 4HAYB 2UZRA 4EJNA 4GN1A 4CHMA 1XR0B 2Z0PA 4DXAB 1FGZA 4YL8A 4GPTB 3IVFA 2COCA 5FI1A 5DHFB 4K17A 2D9XA 2VKIA 1TQZA 2JP2A 3HQCA 5LOPB 1M7RA 2N23A 2UVMA 4CHJA 2H7DA 5DIFB 2D9VA 4Z2MB 4EKUA 3MDBC 4PQ0A
chains in the Genus database with same CATH superfamily
4D6WA 2Y8GA 3F5RA 1UNPA 2QKLA 1BAKA 3NWDA 3PVLA 3ODWA 1M7EA 2N0YA 2FJUB 2BCJA 3M1IB 2ZKMX 3G9WA 4HSIA 2I5CA 2NZ8B 4GXBA 1X11A 4IOYX 3B77A 2D10A 4K2OA 3NSUA 3PEGA 1U5GA 4HB3B 1TJ6A 2EMSA 4GMVA 2NBVA 1AWEA 1Q67A 4NSWA 3PVUA 5KQ1A 1GC6A 1W1DA 1XODA 2MDXA 1ZC4B 2YF0A 3X23A 1U5FA 2Z0OA 3ULCA 2J0JA 3LJUX 1U2BA 3ULBA 1UNRA 3DXEA 3D8EA 1WG7A 4F7GA 1N3HA 2HE7A 2YSZA 3AU4A 4HDQA 4OSNA 1KZGA 2MKRA 2LOXA 2DTCA 4F7UP 2J0MA 5DHAB 3NWAA 2Q13A 1PMSA 2CY5A 1UNQA 2V76A 3ODXA 2KIEA 4QJ5B 2DYQA 4EMOA 2Z14A 1AQCA 5C5BA 2YS5A 1WVHA 3QWMA 4DX90 3AJ4A 4HB4B 4H8SA 1MI1A 4KHAA 5C79A 2ROZB 1XX0A 4DIXA 5KQ4A 1FAOA 1WGUA 2P0HA 2X18A 1FGYA 2YT2A 1NTVA 2YRYA 1V5UA 2CODA 1QC6A 2ROVA 1UPRA 2K2JA 1DDVA 2COAA 4DX8A 2ZPYA 2D4QA 2L1CA 4A6HA 1X05A 2YS1A 4WSFA 4A6FB 1NI2A 1I2HA 2KIGA 4A5KA 4QJ4B 2HTHB 2Z59A 1U5DA 1W1GA 3U7DA 2D11A 2EJ8A 2AL6A 2OTXA 2Z4DA 4P7IA 3D8FA 4QXAB 2I5FA 4F7HA 2VSZA 3DXCA 1WGQA 4DBBA 5J3QA 4KHOA 2L2IA 1P3RA 2H7EA 3P6AA 1V88A 2J59M 3GYOA 2GCJA 1X1FA 1H4RA 1MK7B 3A8QA 1MK9B 2DFKA 5J3YA 4MT7A 2I1KA 2M38A 5JLJB 1TXDA 1ZC3B 1SGHA 2KGXB 3HK0A 3D8DA 4HAVB 4KAXB 5JHGA 2D9ZA 5D3YA 1U27A 2GJYA 4CYEA 1BWNA 2P0DA 3O96A 4IAPA 4NY0A 1ZM0A 1Y19B 3DXDA 3WA0A 1ISNA 4OT1A 3SNHA 1V61A 1V5PA 3FM8C 2LOZA 3BINA 4HAWB 1B55A 1Z87A 3HSAA 4HB2B 1SHCA 3KRXA 4HAXB 5D27A 4HHVA 2UZSA 5C6RA 2LYDA 4GMXB 5CLQB 5L81A 2COFA 3AU5A 2DLWA 2YVCA 4ZRIA 2MWNB 3VOQA 3TFMA 3KRWA 3V5WA 4KHBB 1MAIA 1NTYA 2I1JA 2Y7BA 4WJ7A 1OQNA 1PFJA 2DX1A 1FHXA 3UZTA 2YT1A 3P7ZA 3TW1A 2DHJA 1WI1A 1FOEA 2Z0QA 3A98B 5KCVA 5CLLB 2RGNB 5EFXA 3FVCA 3DCXA 5HE2A 2RVBB 1GG3A 3MPXA 4QJ3B 4ZRKA 5JP4A 2ELBA 1MPHA 3F0WA 2YT0A 4KHBA 2D2QA 4HAUB 5LONB 4TYZA 5GOWB 1XD4A 3RCPA 3SV1A 1T77A 2RLOA 1EVHA 1IRSA 2EC1A 2P8VA 2EMTA 1E5WA 5DI9B 1FB8A 1K5DB 2QKMA 3BJIA 2RUKB 5M4YB 2K8EA 4B6HA 1BTKA 2DX5A 3HW2B 4A6KA 3PSCA 1BTNA 2DHKA 2MFQA 3A58A 1EGXA 2LULA 2KR0A 4YONA 2PZ1A 3N7CA 2FJLA 2DKPA 3VIAA 3GYPA 3ML4A 1LW3A 4ZRJA 5C16A 5HE0A 5LG4B 5J3TA 3PZDA 1W1HA 4Y94A 1U29A 3NWFA 4A6FA 2ADZA 1KZ7A 3KZ1A 1ZSQA 1FHOA 4BBKA 4Z2NA 2R09A 1RRPB 2NMBA 1RJ2A 2ELAA 1GC7A 2P0FA 2LG1A 1DDMA 4GOUA 4K2PA 2G35A 3HIEA 1KI1B 4IFSA 2D9WA 2LKOA 1P6SA 1ZYIA 2M14A 5HE3A 3PVWA 4XWXA 4HAZB 1OY2A 2K49A 1EF1A 5DH9B 1ZVRA 4HB0B 1QQGA 5JHHA 4GZUA 2DKQA 3QBVB 3U8ZA 3TO1A 3TVVA 3WYFB 1Y5OA 1K5GB 3SO6A 3ZDTA 5D3VA 1UEFA 4CSQA 1X1GA 1DYNA 2IFSA 1XCGA 1OMWA 2GS0A 2KCJA 1DBHA 4C0AA 3T06A 1DDWA 2DN6A 3SYXA 3NW8A 3OANA 1MIXA 2XQNM 1DROA 4HDOA 2CAYA 3A8PA 1PLSA 1FHWA 1WJMA 1I7AA 2DYNA 2KUQA 2CRFA 4KVGB 5C5BB 2DA0A 1J19A 4MK0A 1P5TA 2GCLA 3PG7A 2J0KA 4PNKA 1LB1A 1XKEA 2Y8FA 2K2UA 2E2XA 3CIKA 2W2XC 1WJ1A 2RSGA 2Z13A 2D9YA 3KY9A 1NU2A 2DHIA 3ZVRA 2IYBA 2CY4A 3PP2A 3SUZA 1J0WA 1H10A 3FEHA 4D0NB 5D3XA 4WVFB 1U5EA 3TCAA 4HATB 2KUPA 4K81A 5HE1A 1MKEA 2VRWB 3FSSA 2K00A 1MIZB 3ODOA 1V89A 2YS3A 4MY6A 5FI0A 4L6EA 4GNKB 2RNRB 2W2XD 2AEHA 2W2WA 4L1RA 5I2MA 3KSYA 1EAZA 2OQBA 5D3WA 1V5MA 1UPQA 2RRFA 4TKNA 3QIJA 3CXBB 2R0DA 3OHMB 1X86A 4HAYB 2UZRA 4EJNA 4GN1A 4CHMA 1XR0B 2Z0PA 4DXAB 1FGZA 4YL8A 2R2YA 4GPTB 3IVFA 2COCA 5I2SA 5FI1A 5DHFB 4K17A 2D9XA 5IRSA 3U12A 2VKIA 1TQZA 2JP2A 3HQCA 5LOPB 1M7RA 2N23A 2UVMA 4CHJA 2H7DA 5DIFB 2D9VA 4Z2MB 4EKUA 3MDBC 2GUMA 4PQ0A
chains in the Genus database with same CATH topology
2Y8GA 3F5RA 1UNPA 2QKLA 1BAKA 3PVLA 3ODWA 1M7EA 2N0YA 2BCJA 3M1IB 3G9WA 2I5CA 2NZ8B 4GXBA 1X11A 4IOYX 2D10A 4K2OA 3NSUA 3PEGA 1U5GA 4HB3B 1TJ6A 2EMSA 4GMVA 1AWEA 1Q67A 4NSWA 3PVUA 5KQ1A 1GC6A 1W1DA 1XODA 2MDXA 1ZC4B 2YF0A 3X23A 1U5FA 2Z0OA 3ULCA 2J0JA 3LJUX 1U2BA 3ULBA 1UNRA 3DXEA 3D8EA 1WG7A 4F7GA 1N3HA 2HE7A 2YSZA 3AU4A 4HDQA 1KZGA 2MKRA 2LOXA 2DTCA 4F7UP 2J0MA 5DHAB 2Q13A 1PMSA 2CY5A 1UNQA 2V76A 3ODXA 2DYQA 4EMOA 1AQCA 5C5BA 2YS5A 1WVHA 3QWMA 4DX90 3AJ4A 4HB4B 4H8SA 4KHAA 5C79A 2ROZB 1XX0A 5KQ4A 1FAOA 1WGUA 2P0HA 2X18A 1FGYA 1NTVA 2YRYA 1V5UA 2CODA 1QC6A 2ROVA 1UPRA 2K2JA 1DDVA 2COAA 4DX8A 2ZPYA 2D4QA 2L1CA 4A6HA 1X05A 2YS1A 4WSFA 4A6FB 1NI2A 1I2HA 4A5KA 2HTHB 1U5DA 1W1GA 3U7DA 2D11A 2EJ8A 2AL6A 2OTXA 4P7IA 3D8FA 2I5FA 4F7HA 2VSZA 3DXCA 1WGQA 4DBBA 5J3QA 4KHOA 2L2IA 1P3RA 2H7EA 3P6AA 1V88A 2J59M 3GYOA 2GCJA 1X1FA 1H4RA 1MK7B 3A8QA 1MK9B 2DFKA 5J3YA 4MT7A 2I1KA 2M38A 5JLJB 1TXDA 1ZC3B 1SGHA 2KGXB 3HK0A 3D8DA 4HAVB 4KAXB 5JHGA 2D9ZA 5D3YA 1U27A 2GJYA 4CYEA 1BWNA 2P0DA 3O96A 4IAPA 4NY0A 1ZM0A 1Y19B 3DXDA 3WA0A 1ISNA 3SNHA 1V61A 1V5PA 3FM8C 2LOZA 3BINA 4HAWB 1B55A 1Z87A 4HB2B 1SHCA 3KRXA 4HAXB 5D27A 4HHVA 2UZSA 5C6RA 2LYDA 4GMXB 5CLQB 5L81A 2COFA 3AU5A 2DLWA 2YVCA 4ZRIA 2MWNB 3VOQA 3TFMA 3KRWA 3V5WA 4KHBB 1MAIA 1NTYA 2I1JA 2Y7BA 4WJ7A 1OQNA 1PFJA 2DX1A 1FHXA 3UZTA 2YT1A 3P7ZA 3TW1A 2DHJA 1WI1A 1FOEA 2Z0QA 3A98B 5KCVA 5CLLB 2RGNB 5EFXA 5HE2A 2RVBB 1GG3A 3MPXA 4ZRKA 5JP4A 2ELBA 1MPHA 3F0WA 2YT0A 2D2QA 4HAUB 5LONB 4TYZA 5GOWB 1XD4A 3RCPA 3SV1A 2RLOA 1EVHA 1IRSA 2EC1A 2P8VA 2EMTA 1E5WA 5DI9B 1FB8A 1K5DB 2QKMA 3BJIA 2RUKB 4B6HA 1BTKA 2DX5A 3HW2B 4A6KA 3PSCA 1BTNA 2DHKA 2MFQA 1EGXA 2LULA 4YONA 2PZ1A 3N7CA 2FJLA 2DKPA 3VIAA 3GYPA 3ML4A 1LW3A 4ZRJA 5C16A 5HE0A 5J3TA 3PZDA 1W1HA 4Y94A 1U29A 4A6FA 2ADZA 1KZ7A 3KZ1A 1ZSQA 1FHOA 4BBKA 4Z2NA 2R09A 1RRPB 2NMBA 1RJ2A 2ELAA 1GC7A 2P0FA 2LG1A 1DDMA 4K2PA 2G35A 1KI1B 4IFSA 2D9WA 2LKOA 1P6SA 2M14A 5HE3A 3PVWA 4XWXA 4HAZB 1OY2A 1EF1A 5DH9B 1ZVRA 4HB0B 1QQGA 5JHHA 4GZUA 2DKQA 3QBVB 3U8ZA 3TO1A 3TVVA 3WYFB 1Y5OA 1K5GB 3SO6A 3ZDTA 5D3VA 1UEFA 1X1GA 1DYNA 2IFSA 1XCGA 1OMWA 2GS0A 2KCJA 1DBHA 4C0AA 3T06A 1DDWA 2DN6A 3SYXA 3OANA 1MIXA 2XQNM 1DROA 4HDOA 2CAYA 3A8PA 1PLSA 1FHWA 1WJMA 1I7AA 2DYNA 2CRFA 4KVGB 5C5BB 2DA0A 1J19A 4MK0A 1P5TA 2GCLA 3PG7A 2J0KA 4PNKA 1LB1A 1XKEA 2Y8FA 2K2UA 2E2XA 3CIKA 2W2XC 1WJ1A 2RSGA 2D9YA 3KY9A 1NU2A 2DHIA 3ZVRA 2IYBA 2CY4A 3PP2A 3SUZA 1J0WA 1H10A 3FEHA 4D0NB 5D3XA 4WVFB 1U5EA 3TCAA 4HATB 2KUPA 4K81A 5HE1A 1MKEA 2VRWB 3FSSA 2K00A 1MIZB 3ODOA 1V89A 2YS3A 4MY6A 5FI0A 4L6EA 2RNRB 2W2XD 2AEHA 2W2WA 3KSYA 1EAZA 2OQBA 5D3WA 1V5MA 1UPQA 4TKNA 3QIJA 3CXBB 2R0DA 1X86A 4HAYB 2UZRA 4EJNA 4GN1A 4CHMA 1XR0B 2Z0PA 4DXAB 1FGZA 4YL8A 4GPTB 3IVFA 2COCA 5FI1A 5DHFB 4K17A 2D9XA 2VKIA 1TQZA 2JP2A 3HQCA 5LOPB 1M7RA 2N23A 2UVMA 4CHJA 2H7DA 5DIFB 2D9VA 4Z2MB 4EKUA 3MDBC 4PQ0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Y8G A;  3F5R A;  1UNP A;  2QKL A;  1BAK A;  3PVL A;  3ODW A;  1M7E A;  2N0Y A;  2BCJ A;  3M1I B;  3G9W A;  2I5C A;  2NZ8 B;  4GXB A;  1X11 A;  4IOY X;  2D10 A;  4K2O A;  3NSU A;  3PEG A;  1U5G A;  4HB3 B;  1TJ6 A;  2EMS A;  4GMV A;  1AWE A;  1Q67 A;  4NSW A;  3PVU A;  5KQ1 A;  1GC6 A;  1W1D A;  1XOD A;  2MDX A;  1ZC4 B;  2YF0 A;  3X23 A;  1U5F A;  2Z0O A;  3ULC A;  2J0J A;  3LJU X;  1U2B A;  3ULB A;  1UNR A;  3DXE A;  3D8E A;  1WG7 A;  4F7G A;  1N3H A;  2HE7 A;  2YSZ A;  3AU4 A;  4HDQ A;  1KZG A;  2MKR A;  2LOX A;  2DTC A;  4F7U P;  2J0M A;  5DHA B;  2Q13 A;  1PMS A;  2CY5 A;  1UNQ A;  2V76 A;  3ODX A;  2DYQ A;  4EMO A;  1AQC A;  5C5B A;  2YS5 A;  1WVH A;  3QWM A;  4DX9 0;  3AJ4 A;  4HB4 B;  4H8S A;  4KHA A;  5C79 A;  2ROZ B;  1XX0 A;  5KQ4 A;  1FAO A;  1WGU A;  2P0H A;  2X18 A;  1FGY A;  1NTV A;  2YRY A;  1V5U A;  2COD A;  1QC6 A;  2ROV A;  1UPR A;  2K2J A;  1DDV A;  2COA A;  4DX8 A;  2ZPY A;  2D4Q A;  2L1C A;  4A6H A;  1X05 A;  2YS1 A;  4WSF A;  4A6F B;  1NI2 A;  1I2H A;  4A5K A;  2HTH B;  1U5D A;  1W1G A;  3U7D A;  2D11 A;  2EJ8 A;  2AL6 A;  2OTX A;  4P7I A;  3D8F A;  2I5F A;  4F7H A;  2VSZ A;  3DXC A;  1WGQ A;  4DBB A;  5J3Q A;  4KHO A;  2L2I A;  1P3R A;  2H7E A;  3P6A A;  1V88 A;  2J59 M;  3GYO A;  2GCJ A;  1X1F A;  1H4R A;  1MK7 B;  3A8Q A;  1MK9 B;  2DFK A;  5J3Y A;  4MT7 A;  2I1K A;  2M38 A;  5JLJ B;  1TXD A;  1ZC3 B;  1SGH A;  2KGX B;  3HK0 A;  3D8D A;  4HAV B;  4KAX B;  5JHG A;  2D9Z A;  5D3Y A;  1U27 A;  2GJY A;  4CYE A;  1BWN A;  2P0D A;  3O96 A;  4IAP A;  4NY0 A;  1ZM0 A;  1Y19 B;  3DXD A;  3WA0 A;  1ISN A;  3SNH A;  1V61 A;  1V5P A;  3FM8 C;  2LOZ A;  3BIN A;  4HAW B;  1B55 A;  1Z87 A;  4HB2 B;  1SHC A;  3KRX A;  4HAX B;  5D27 A;  4HHV A;  2UZS A;  5C6R A;  2LYD A;  4GMX B;  5CLQ B;  5L81 A;  2COF A;  3AU5 A;  2DLW A;  2YVC A;  4ZRI A;  2MWN B;  3VOQ A;  3TFM A;  3KRW A;  3V5W A;  4KHB B;  1MAI A;  1NTY A;  2I1J A;  2Y7B A;  4WJ7 A;  1OQN A;  1PFJ A;  2DX1 A;  1FHX A;  3UZT A;  2YT1 A;  3P7Z A;  3TW1 A;  2DHJ A;  1WI1 A;  1FOE A;  2Z0Q A;  3A98 B;  5KCV A;  5CLL B;  2RGN B;  5EFX A;  5HE2 A;  2RVB B;  1GG3 A;  3MPX A;  4ZRK A;  5JP4 A;  2ELB A;  1MPH A;  3F0W A;  2YT0 A;  2D2Q A;  4HAU B;  5LON B;  4TYZ A;  5GOW B;  1XD4 A;  3RCP A;  3SV1 A;  2RLO A;  1EVH A;  1IRS A;  2EC1 A;  2P8V A;  2EMT A;  1E5W A;  5DI9 B;  1FB8 A;  1K5D B;  2QKM A;  3BJI A;  2RUK B;  4B6H A;  1BTK A;  2DX5 A;  3HW2 B;  4A6K A;  3PSC A;  1BTN A;  2DHK A;  2MFQ A;  1EGX A;  2LUL A;  4YON A;  2PZ1 A;  3N7C A;  2FJL A;  2DKP A;  3VIA A;  3GYP A;  3ML4 A;  1LW3 A;  4ZRJ A;  5C16 A;  5HE0 A;  5J3T A;  3PZD A;  1W1H A;  4Y94 A;  1U29 A;  4A6F A;  2ADZ A;  1KZ7 A;  3KZ1 A;  1ZSQ A;  1FHO A;  4BBK A;  4Z2N A;  2R09 A;  1RRP B;  2NMB A;  1RJ2 A;  2ELA A;  1GC7 A;  2P0F A;  2LG1 A;  1DDM A;  4K2P A;  2G35 A;  1KI1 B;  4IFS A;  2D9W A;  2LKO A;  1P6S A;  2M14 A;  5HE3 A;  3PVW A;  4XWX A;  4HAZ B;  1OY2 A;  1EF1 A;  5DH9 B;  1ZVR A;  4HB0 B;  1QQG A;  5JHH A;  4GZU A;  2DKQ A;  3QBV B;  3U8Z A;  3TO1 A;  3TVV A;  3WYF B;  1Y5O A;  1K5G B;  3SO6 A;  3ZDT A;  5D3V A;  1UEF A;  1X1G A;  1DYN A;  2IFS A;  1XCG A;  1OMW A;  2GS0 A;  2KCJ A;  1DBH A;  4C0A A;  3T06 A;  1DDW A;  2DN6 A;  3SYX A;  3OAN A;  1MIX A;  2XQN M;  1DRO A;  4HDO A;  2CAY A;  3A8P A;  1PLS A;  1FHW A;  1WJM A;  1I7A A;  2DYN A;  2CRF A;  4KVG B;  5C5B B;  2DA0 A;  1J19 A;  4MK0 A;  1P5T A;  2GCL A;  3PG7 A;  2J0K A;  4PNK A;  1LB1 A;  1XKE A;  2Y8F A;  2K2U A;  2E2X A;  3CIK A;  2W2X C;  1WJ1 A;  2RSG A;  2D9Y A;  3KY9 A;  1NU2 A;  2DHI A;  3ZVR A;  2IYB A;  2CY4 A;  3PP2 A;  3SUZ A;  1J0W A;  1H10 A;  3FEH A;  4D0N B;  5D3X A;  4WVF B;  1U5E A;  3TCA A;  4HAT B;  2KUP A;  4K81 A;  5HE1 A;  1MKE A;  2VRW B;  3FSS A;  2K00 A;  1MIZ B;  3ODO A;  1V89 A;  2YS3 A;  4MY6 A;  5FI0 A;  4L6E A;  2RNR B;  2W2X D;  2AEH A;  2W2W A;  3KSY A;  1EAZ A;  2OQB A;  5D3W A;  1V5M A;  1UPQ A;  4TKN A;  3QIJ A;  3CXB B;  2R0D A;  1X86 A;  4HAY B;  2UZR A;  4EJN A;  4GN1 A;  4CHM A;  1XR0 B;  2Z0P A;  4DXA B;  1FGZ A;  4YL8 A;  4GPT B;  3IVF A;  2COC A;  5FI1 A;  5DHF B;  4K17 A;  2D9X A;  2VKI A;  1TQZ A;  2JP2 A;  3HQC A;  5LOP B;  1M7R A;  2N23 A;  2UVM A;  4CHJ A;  2H7D A;  5DIF B;  2D9V A;  4Z2M B;  4EKU A;  3MDB C;  4PQ0 A; 
#chains in the Genus database with same CATH topology
 4D6W A;  2Y8G A;  3F5R A;  1UNP A;  2QKL A;  1BAK A;  3NWD A;  3PVL A;  3ODW A;  1M7E A;  2N0Y A;  2FJU B;  2BCJ A;  3M1I B;  2ZKM X;  3G9W A;  4HSI A;  2I5C A;  2NZ8 B;  4GXB A;  1X11 A;  4IOY X;  3B77 A;  2D10 A;  4K2O A;  3NSU A;  3PEG A;  1U5G A;  4HB3 B;  1TJ6 A;  2EMS A;  4GMV A;  2NBV A;  1AWE A;  1Q67 A;  4NSW A;  3PVU A;  5KQ1 A;  1GC6 A;  1W1D A;  1XOD A;  2MDX A;  1ZC4 B;  2YF0 A;  3X23 A;  1U5F A;  2Z0O A;  3ULC A;  2J0J A;  3LJU X;  1U2B A;  3ULB A;  1UNR A;  3DXE A;  3D8E A;  1WG7 A;  4F7G A;  1N3H A;  2HE7 A;  2YSZ A;  3AU4 A;  4HDQ A;  4OSN A;  1KZG A;  2MKR A;  2LOX A;  2DTC A;  4F7U P;  2J0M A;  5DHA B;  3NWA A;  2Q13 A;  1PMS A;  2CY5 A;  1UNQ A;  2V76 A;  3ODX A;  2KIE A;  4QJ5 B;  2DYQ A;  4EMO A;  2Z14 A;  1AQC A;  5C5B A;  2YS5 A;  1WVH A;  3QWM A;  4DX9 0;  3AJ4 A;  4HB4 B;  4H8S A;  1MI1 A;  4KHA A;  5C79 A;  2ROZ B;  1XX0 A;  4DIX A;  5KQ4 A;  1FAO A;  1WGU A;  2P0H A;  2X18 A;  1FGY A;  2YT2 A;  1NTV A;  2YRY A;  1V5U A;  2COD A;  1QC6 A;  2ROV A;  1UPR A;  2K2J A;  1DDV A;  2COA A;  4DX8 A;  2ZPY A;  2D4Q A;  2L1C A;  4A6H A;  1X05 A;  2YS1 A;  4WSF A;  4A6F B;  1NI2 A;  1I2H A;  2KIG A;  4A5K A;  4QJ4 B;  2HTH B;  2Z59 A;  1U5D A;  1W1G A;  3U7D A;  2D11 A;  2EJ8 A;  2AL6 A;  2OTX A;  2Z4D A;  4P7I A;  3D8F A;  4QXA B;  2I5F A;  4F7H A;  2VSZ A;  3DXC A;  1WGQ A;  4DBB A;  5J3Q A;  4KHO A;  2L2I A;  1P3R A;  2H7E A;  3P6A A;  1V88 A;  2J59 M;  3GYO A;  2GCJ A;  1X1F A;  1H4R A;  1MK7 B;  3A8Q A;  1MK9 B;  2DFK A;  5J3Y A;  4MT7 A;  2I1K A;  2M38 A;  5JLJ B;  1TXD A;  1ZC3 B;  1SGH A;  2KGX B;  3HK0 A;  3D8D A;  4HAV B;  4KAX B;  5JHG A;  2D9Z A;  5D3Y A;  1U27 A;  2GJY A;  4CYE A;  1BWN A;  2P0D A;  3O96 A;  4IAP A;  4NY0 A;  1ZM0 A;  1Y19 B;  3DXD A;  3WA0 A;  1ISN A;  4OT1 A;  3SNH A;  1V61 A;  1V5P A;  3FM8 C;  2LOZ A;  3BIN A;  4HAW B;  1B55 A;  1Z87 A;  3HSA A;  4HB2 B;  1SHC A;  3KRX A;  4HAX B;  5D27 A;  4HHV A;  2UZS A;  5C6R A;  2LYD A;  4GMX B;  5CLQ B;  5L81 A;  2COF A;  3AU5 A;  2DLW A;  2YVC A;  4ZRI A;  2MWN B;  3VOQ A;  3TFM A;  3KRW A;  3V5W A;  4KHB B;  1MAI A;  1NTY A;  2I1J A;  2Y7B A;  4WJ7 A;  1OQN A;  1PFJ A;  2DX1 A;  1FHX A;  3UZT A;  2YT1 A;  3P7Z A;  3TW1 A;  2DHJ A;  1WI1 A;  1FOE A;  2Z0Q A;  3A98 B;  5KCV A;  5CLL B;  2RGN B;  5EFX A;  3FVC A;  3DCX A;  5HE2 A;  2RVB B;  1GG3 A;  3MPX A;  4QJ3 B;  4ZRK A;  5JP4 A;  2ELB A;  1MPH A;  3F0W A;  2YT0 A;  4KHB A;  2D2Q A;  4HAU B;  5LON B;  4TYZ A;  5GOW B;  1XD4 A;  3RCP A;  3SV1 A;  1T77 A;  2RLO A;  1EVH A;  1IRS A;  2EC1 A;  2P8V A;  2EMT A;  1E5W A;  5DI9 B;  1FB8 A;  1K5D B;  2QKM A;  3BJI A;  2RUK B;  5M4Y B;  2K8E A;  4B6H A;  1BTK A;  2DX5 A;  3HW2 B;  4A6K A;  3PSC A;  1BTN A;  2DHK A;  2MFQ A;  3A58 A;  1EGX A;  2LUL A;  2KR0 A;  4YON A;  2PZ1 A;  3N7C A;  2FJL A;  2DKP A;  3VIA A;  3GYP A;  3ML4 A;  1LW3 A;  4ZRJ A;  5C16 A;  5HE0 A;  5LG4 B;  5J3T A;  3PZD A;  1W1H A;  4Y94 A;  1U29 A;  3NWF A;  4A6F A;  2ADZ A;  1KZ7 A;  3KZ1 A;  1ZSQ A;  1FHO A;  4BBK A;  4Z2N A;  2R09 A;  1RRP B;  2NMB A;  1RJ2 A;  2ELA A;  1GC7 A;  2P0F A;  2LG1 A;  1DDM A;  4GOU A;  4K2P A;  2G35 A;  3HIE A;  1KI1 B;  4IFS A;  2D9W A;  2LKO A;  1P6S A;  1ZYI A;  2M14 A;  5HE3 A;  3PVW A;  4XWX A;  4HAZ B;  1OY2 A;  2K49 A;  1EF1 A;  5DH9 B;  1ZVR A;  4HB0 B;  1QQG A;  5JHH A;  4GZU A;  2DKQ A;  3QBV B;  3U8Z A;  3TO1 A;  3TVV A;  3WYF B;  1Y5O A;  1K5G B;  3SO6 A;  3ZDT A;  5D3V A;  1UEF A;  4CSQ A;  1X1G A;  1DYN A;  2IFS A;  1XCG A;  1OMW A;  2GS0 A;  2KCJ A;  1DBH A;  4C0A A;  3T06 A;  1DDW A;  2DN6 A;  3SYX A;  3NW8 A;  3OAN A;  1MIX A;  2XQN M;  1DRO A;  4HDO A;  2CAY A;  3A8P A;  1PLS A;  1FHW A;  1WJM A;  1I7A A;  2DYN A;  2KUQ A;  2CRF A;  4KVG B;  5C5B B;  2DA0 A;  1J19 A;  4MK0 A;  1P5T A;  2GCL A;  3PG7 A;  2J0K A;  4PNK A;  1LB1 A;  1XKE A;  2Y8F A;  2K2U A;  2E2X A;  3CIK A;  2W2X C;  1WJ1 A;  2RSG A;  2Z13 A;  2D9Y A;  3KY9 A;  1NU2 A;  2DHI A;  3ZVR A;  2IYB A;  2CY4 A;  3PP2 A;  3SUZ A;  1J0W A;  1H10 A;  3FEH A;  4D0N B;  5D3X A;  4WVF B;  1U5E A;  3TCA A;  4HAT B;  2KUP A;  4K81 A;  5HE1 A;  1MKE A;  2VRW B;  3FSS A;  2K00 A;  1MIZ B;  3ODO A;  1V89 A;  2YS3 A;  4MY6 A;  5FI0 A;  4L6E A;  4GNK B;  2RNR B;  2W2X D;  2AEH A;  2W2W A;  4L1R A;  5I2M A;  3KSY A;  1EAZ A;  2OQB A;  5D3W A;  1V5M A;  1UPQ A;  2RRF A;  4TKN A;  3QIJ A;  3CXB B;  2R0D A;  3OHM B;  1X86 A;  4HAY B;  2UZR A;  4EJN A;  4GN1 A;  4CHM A;  1XR0 B;  2Z0P A;  4DXA B;  1FGZ A;  4YL8 A;  2R2Y A;  4GPT B;  3IVF A;  2COC A;  5I2S A;  5FI1 A;  5DHF B;  4K17 A;  2D9X A;  5IRS A;  3U12 A;  2VKI A;  1TQZ A;  2JP2 A;  3HQC A;  5LOP B;  1M7R A;  2N23 A;  2UVM A;  4CHJ A;  2H7D A;  5DIF B;  2D9V A;  4Z2M B;  4EKU A;  3MDB C;  2GUM A;  4PQ0 A; 
#chains in the Genus database with same CATH homology
 2Y8G A;  3F5R A;  1UNP A;  2QKL A;  1BAK A;  3PVL A;  3ODW A;  1M7E A;  2N0Y A;  2BCJ A;  3M1I B;  3G9W A;  2I5C A;  2NZ8 B;  4GXB A;  1X11 A;  4IOY X;  2D10 A;  4K2O A;  3NSU A;  3PEG A;  1U5G A;  4HB3 B;  1TJ6 A;  2EMS A;  4GMV A;  1AWE A;  1Q67 A;  4NSW A;  3PVU A;  5KQ1 A;  1GC6 A;  1W1D A;  1XOD A;  2MDX A;  1ZC4 B;  2YF0 A;  3X23 A;  1U5F A;  2Z0O A;  3ULC A;  2J0J A;  3LJU X;  1U2B A;  3ULB A;  1UNR A;  3DXE A;  3D8E A;  1WG7 A;  4F7G A;  1N3H A;  2HE7 A;  2YSZ A;  3AU4 A;  4HDQ A;  1KZG A;  2MKR A;  2LOX A;  2DTC A;  4F7U P;  2J0M A;  5DHA B;  2Q13 A;  1PMS A;  2CY5 A;  1UNQ A;  2V76 A;  3ODX A;  2DYQ A;  4EMO A;  1AQC A;  5C5B A;  2YS5 A;  1WVH A;  3QWM A;  4DX9 0;  3AJ4 A;  4HB4 B;  4H8S A;  4KHA A;  5C79 A;  2ROZ B;  1XX0 A;  5KQ4 A;  1FAO A;  1WGU A;  2P0H A;  2X18 A;  1FGY A;  1NTV A;  2YRY A;  1V5U A;  2COD A;  1QC6 A;  2ROV A;  1UPR A;  2K2J A;  1DDV A;  2COA A;  4DX8 A;  2ZPY A;  2D4Q A;  2L1C A;  4A6H A;  1X05 A;  2YS1 A;  4WSF A;  4A6F B;  1NI2 A;  1I2H A;  4A5K A;  2HTH B;  1U5D A;  1W1G A;  3U7D A;  2D11 A;  2EJ8 A;  2AL6 A;  2OTX A;  4P7I A;  3D8F A;  2I5F A;  4F7H A;  2VSZ A;  3DXC A;  1WGQ A;  4DBB A;  5J3Q A;  4KHO A;  2L2I A;  1P3R A;  2H7E A;  3P6A A;  1V88 A;  2J59 M;  3GYO A;  2GCJ A;  1X1F A;  1H4R A;  1MK7 B;  3A8Q A;  1MK9 B;  2DFK A;  5J3Y A;  4MT7 A;  2I1K A;  2M38 A;  5JLJ B;  1TXD A;  1ZC3 B;  1SGH A;  2KGX B;  3HK0 A;  3D8D A;  4HAV B;  4KAX B;  5JHG A;  2D9Z A;  5D3Y A;  1U27 A;  2GJY A;  4CYE A;  1BWN A;  2P0D A;  3O96 A;  4IAP A;  4NY0 A;  1ZM0 A;  1Y19 B;  3DXD A;  3WA0 A;  1ISN A;  3SNH A;  1V61 A;  1V5P A;  3FM8 C;  2LOZ A;  3BIN A;  4HAW B;  1B55 A;  1Z87 A;  4HB2 B;  1SHC A;  3KRX A;  4HAX B;  5D27 A;  4HHV A;  2UZS A;  5C6R A;  2LYD A;  4GMX B;  5CLQ B;  5L81 A;  2COF A;  3AU5 A;  2DLW A;  2YVC A;  4ZRI A;  2MWN B;  3VOQ A;  3TFM A;  3KRW A;  3V5W A;  4KHB B;  1MAI A;  1NTY A;  2I1J A;  2Y7B A;  4WJ7 A;  1OQN A;  1PFJ A;  2DX1 A;  1FHX A;  3UZT A;  2YT1 A;  3P7Z A;  3TW1 A;  2DHJ A;  1WI1 A;  1FOE A;  2Z0Q A;  3A98 B;  5KCV A;  5CLL B;  2RGN B;  5EFX A;  5HE2 A;  2RVB B;  1GG3 A;  3MPX A;  4ZRK A;  5JP4 A;  2ELB A;  1MPH A;  3F0W A;  2YT0 A;  2D2Q A;  4HAU B;  5LON B;  4TYZ A;  5GOW B;  1XD4 A;  3RCP A;  3SV1 A;  2RLO A;  1EVH A;  1IRS A;  2EC1 A;  2P8V A;  2EMT A;  1E5W A;  5DI9 B;  1FB8 A;  1K5D B;  2QKM A;  3BJI A;  2RUK B;  4B6H A;  1BTK A;  2DX5 A;  3HW2 B;  4A6K A;  3PSC A;  1BTN A;  2DHK A;  2MFQ A;  1EGX A;  2LUL A;  4YON A;  2PZ1 A;  3N7C A;  2FJL A;  2DKP A;  3VIA A;  3GYP A;  3ML4 A;  1LW3 A;  4ZRJ A;  5C16 A;  5HE0 A;  5J3T A;  3PZD A;  1W1H A;  4Y94 A;  1U29 A;  4A6F A;  2ADZ A;  1KZ7 A;  3KZ1 A;  1ZSQ A;  1FHO A;  4BBK A;  4Z2N A;  2R09 A;  1RRP B;  2NMB A;  1RJ2 A;  2ELA A;  1GC7 A;  2P0F A;  2LG1 A;  1DDM A;  4K2P A;  2G35 A;  1KI1 B;  4IFS A;  2D9W A;  2LKO A;  1P6S A;  2M14 A;  5HE3 A;  3PVW A;  4XWX A;  4HAZ B;  1OY2 A;  1EF1 A;  5DH9 B;  1ZVR A;  4HB0 B;  1QQG A;  5JHH A;  4GZU A;  2DKQ A;  3QBV B;  3U8Z A;  3TO1 A;  3TVV A;  3WYF B;  1Y5O A;  1K5G B;  3SO6 A;  3ZDT A;  5D3V A;  1UEF A;  1X1G A;  1DYN A;  2IFS A;  1XCG A;  1OMW A;  2GS0 A;  2KCJ A;  1DBH A;  4C0A A;  3T06 A;  1DDW A;  2DN6 A;  3SYX A;  3OAN A;  1MIX A;  2XQN M;  1DRO A;  4HDO A;  2CAY A;  3A8P A;  1PLS A;  1FHW A;  1WJM A;  1I7A A;  2DYN A;  2CRF A;  4KVG B;  5C5B B;  2DA0 A;  1J19 A;  4MK0 A;  1P5T A;  2GCL A;  3PG7 A;  2J0K A;  4PNK A;  1LB1 A;  1XKE A;  2Y8F A;  2K2U A;  2E2X A;  3CIK A;  2W2X C;  1WJ1 A;  2RSG A;  2D9Y A;  3KY9 A;  1NU2 A;  2DHI A;  3ZVR A;  2IYB A;  2CY4 A;  3PP2 A;  3SUZ A;  1J0W A;  1H10 A;  3FEH A;  4D0N B;  5D3X A;  4WVF B;  1U5E A;  3TCA A;  4HAT B;  2KUP A;  4K81 A;  5HE1 A;  1MKE A;  2VRW B;  3FSS A;  2K00 A;  1MIZ B;  3ODO A;  1V89 A;  2YS3 A;  4MY6 A;  5FI0 A;  4L6E A;  2RNR B;  2W2X D;  2AEH A;  2W2W A;  3KSY A;  1EAZ A;  2OQB A;  5D3W A;  1V5M A;  1UPQ A;  4TKN A;  3QIJ A;  3CXB B;  2R0D A;  1X86 A;  4HAY B;  2UZR A;  4EJN A;  4GN1 A;  4CHM A;  1XR0 B;  2Z0P A;  4DXA B;  1FGZ A;  4YL8 A;  4GPT B;  3IVF A;  2COC A;  5FI1 A;  5DHF B;  4K17 A;  2D9X A;  2VKI A;  1TQZ A;  2JP2 A;  3HQC A;  5LOP B;  1M7R A;  2N23 A;  2UVM A;  4CHJ A;  2H7D A;  5DIF B;  2D9V A;  4Z2M B;  4EKU A;  3MDB C;  4PQ0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...