3NSUA

A systematic screen for protein-lipid interactions in saccharomyces cerevisiae
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
117
structure length
109
Chain Sequence
PFTEIKSGFLERRSKFLKSYSKGYYVLTPNFLHEFKTADRKKDLVPVMSLALSECTVTEHSRKNSTSSPNSTGSDAKFVLHAKHNWVFKADSYESMMSWFDNLKILTST
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title A systematic screen for protein-lipid interactions in Saccharomyces cerevisiae.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Signaling protein
molecule keywords Phosphatidylinositol 4,5-bisphosphate-binding protein SLM1
total genus 24
structure length 109
sequence length 117
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00169 PH PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 3nsuA00
1W1DA 3SUZA 2COAA 5JHHA 3T06A 4HAZB 5C5BB 1J0WA 3WA0A 1Y19B 2ROZB 5C5BA 3CXBB 1NTVA 1FAOA 2D2QA 1DDVA 2W2WA 2LULA 3DXCA 4HAWB 1OMWA 1GG3A 2HTHB 4WJ7A 1XX0A 4MK0A 2DFKA 3ZVRA 1XD4A 2D9VA 4CHMA 3G9WA 4YONA 2NZ8B 4HAVB 4EKUA 2NMBA 4ZRKA 1EVHA 1GC6A 4DXAB 2YS1A 4ZRIA 4A6FA 2D11A 3PG7A 1RRPB 2MWNB 1MPHA 3MDBC 3HK0A 1BAKA 1FOEA 1PFJA 1NTYA 2P0DA 3TW1A 2AL6A 2MKRA 4HHVA 2YRYA 2EJ8A 3WYFB 2UZRA 1LB1A 2EMSA 1OY2A 2EC1A 2DX5A 2GCJA 2IFSA 2DKPA 1U5DA 1UPRA 1P3RA 3ODXA 3QIJA 2PZ1A 1M7RA 2ELAA 3AU5A 3O96A 3PVLA 1ZM0A 5D3WA 2CY5A 5D3YA 4B6HA 2Z0QA 1V5MA 5KCVA 1V89A 2K2JA 5L81A 3MPXA 3NSUA 2D10A 1SGHA 1KZGA 3TO1A 5C79A 2Y7BA 2GS0A 4A6FB 3IVFA 4DX8A 1DBHA 2D9YA 2LG1A 1U2BA 3TVVA 1WGUA 1TXDA 3GYOA 4PQ0A 1U27A 3D8EA 2QKMA 5DHFB 1EF1A 4KHAA 2RLOA 2H7DA 3SYXA 2YVCA 3QBVB 2VKIA 2YSZA 2J59M 4KVGB 1Z87A 1V5UA 3VIAA 1I2HA 3V5WA 1WI1A 4HB2B 4D0NB 2W2XD 2X18A 5J3YA 5J3QA 2MFQA 2DX1A 1K5GB 1MIXA 2RUKB 3FEHA 5C16A 2R09A 4F7HA 3QWMA 4Y94A 5GOWB 5FI0A 2DKQA 3OANA 3M1IB 3ODWA 1XODA 2VRWB 1KI1B 3PP2A 2W2XC 1N3HA 3X23A 1H10A 1P5TA 1TJ6A 5DI9B 1X11A 5C6RA 2DYNA 4IFSA 3PSCA 3PZDA 2UZSA 1B55A 4TKNA 4WVFB 5J3TA 3GYPA 4A6HA 1WJ1A 1W1GA 2GCLA 2DA0A 5DHAB 2UVMA 2YS5A 1NU2A 2L2IA 2Y8FA 1UNQA 5DH9B 3LJUX 1X05A 4GPTB 4EMOA 1IRSA 1M7EA 2D9XA 5KQ4A 1V5PA 1OQNA 5HE2A 3ML4A 4TYZA 2VSZA 5HE1A 2M38A 2Z0OA 2I1JA 3N7CA 1EGXA 1ZC4B 2R0DA 2Q13A 3TFMA 2RSGA 2YT1A 1DROA 3FM8C 3PVUA 1U5FA 1FHOA 1FGZA 1BTNA 2OQBA 2N0YA 2H7EA 2CY4A 5D3VA 1ZVRA 1X86A 2CAYA 4GXBA 4HB3B 4MT7A 4HAXB 4C0AA 4HDQA 5JP4A 3KZ1A 5CLQB 2D4QA 4MY6A 1P6SA 1ISNA 3HQCA 2COFA 5D27A 3PVWA 1K5DB 1XCGA 3PEGA 2JP2A 1AWEA 3DXEA 3KSYA 3KY9A 3U7DA 4HB0B 3UZTA 4PNKA 1KZ7A 2J0JA 1WG7A 1EAZA 3P7ZA 1DDWA 2DYQA 4H8SA 4DBBA 2HE7A 4IOYX 3ULCA 2RNRB 3ODOA 5EFXA 3BJIA 1NI2A 1DYNA 4NSWA 2OTXA 2LOZA 1QC6A 1Y5OA 4GZUA 5JHGA 4GN1A 2I5FA 2G35A 3KRWA 5HE3A 2LKOA 2YT0A 1FGYA 3A8PA 2DHIA 4HATB 4A5KA 3AU4A 4CHJA 1QQGA 1PMSA 1MAIA 2CRFA 3F5RA 2I5CA 5LOPB 2V76A 3D8FA 4XWXA 3ULBA 2BCJA 2N23A 2XQNM 1LW3A 1X1GA 1MIZB 2DHKA 2KCJA 1UPQA 4WSFA 3F0WA 4DX90 1GC7A 2YS3A 2FJLA 3BINA 3U8ZA 2AEHA 1BWNA 2P0HA 4K2OA 4L6EA 2K00A 4ZRJA 2E2XA 2I1KA 2J0MA 2D9ZA 4K17A 1MK9B 1V88A 2DLWA 4KHOA 4EJNA 1FB8A 1MKEA 1I7AA 1PLSA 2DTCA 5FI1A 2J0KA 4A6KA 5LONB 2LYDA 4NY0A 2COCA 1Q67A 2ADZA 1UNPA 4HAYB 3FSSA 5D3XA 1U29A 2P0FA 2K2UA 3A8QA 2EMTA 1SHCA 3RCPA 1FHXA 1WVHA 3DXDA 2MDXA 3CIKA 4F7GA 2Z0PA 4GMXB 1MK7B 3AJ4A 3D8DA 2RGNB 2LOXA 2KUPA 2P8VA 4CYEA 2YF0A 3HW2B 2DN6A 1X1FA 5KQ1A 2GJYA 2QKLA 1H4RA 3TCAA 4F7UP 5HE0A 1J19A 1FHWA 5CLLB 4GMVA 3SV1A 1ZC3B 3KRXA 1XKEA 4KAXB 2ROVA 2CODA 1TQZA 4Z2MB 2M14A 2IYBA 4KHBB 1W1HA 4YL8A 5JLJB 3P6AA 5DIFB 1E5WA 1U5EA 4P7IA 2L1CA 4Z2NA 1AQCA 2DHJA 1ZSQA 4HDOA 4K2PA 2ELBA 4BBKA 2RVBB 1DDMA 4HB4B 1RJ2A 3SNHA 1UNRA 4IAPA 3A98B 2Y8GA 2KGXB 3ZDTA 1WJMA 1XR0B 1U5GA 3VOQA 4HAUB 2D9WA 1V61A 1UEFA 3SO6A 4K81A 1WGQA 1BTKA 2ZPYA
chains in the Genus database with same CATH superfamily
1W1DA 3SUZA 2COAA 5JHHA 3T06A 4HAZB 5C5BB 1J0WA 3WA0A 1Y19B 2ROZB 2R2YA 5C5BA 3CXBB 1NTVA 3NW8A 1FAOA 2D2QA 1DDVA 2W2WA 2LULA 3DXCA 4HAWB 1OMWA 1GG3A 2HTHB 4WJ7A 1XX0A 4MK0A 5I2MA 2DFKA 3ZVRA 1XD4A 2D9VA 4L1RA 4CHMA 3G9WA 4YONA 2NZ8B 4HAVB 4EKUA 2NMBA 4ZRKA 1EVHA 1GC6A 4DXAB 2YS1A 4ZRIA 4A6FA 2D11A 3PG7A 1RRPB 2MWNB 1ZYIA 1MPHA 3MDBC 3HK0A 1BAKA 1FOEA 1PFJA 1NTYA 2P0DA 3TW1A 2AL6A 2MKRA 4HHVA 2YRYA 2EJ8A 3WYFB 2UZRA 1LB1A 2EMSA 1OY2A 2EC1A 2DX5A 2GCJA 2IFSA 2NBVA 2DKPA 1U5DA 1UPRA 1P3RA 3ODXA 3QIJA 2PZ1A 1M7RA 2ELAA 3AU5A 3O96A 3PVLA 1ZM0A 5D3WA 2CY5A 5D3YA 4B6HA 2Z0QA 1V5MA 5KCVA 1V89A 2K2JA 5L81A 3MPXA 4KHBA 4HSIA 3NSUA 2D10A 1SGHA 1KZGA 3TO1A 5C79A 2Y7BA 2GS0A 4A6FB 3IVFA 4DX8A 1DBHA 2D9YA 2LG1A 1U2BA 3TVVA 1WGUA 1TXDA 3GYOA 4PQ0A 1U27A 4GNKB 3D8EA 2QKMA 5DHFB 3HIEA 3OHMB 1EF1A 4KHAA 2RLOA 2H7DA 3SYXA 2YVCA 2KIGA 3QBVB 2VKIA 2Z59A 2YSZA 2J59M 3HSAA 4KVGB 1Z87A 1V5UA 3VIAA 1I2HA 3V5WA 1WI1A 4HB2B 4D0NB 2W2XD 2X18A 5J3YA 5J3QA 2MFQA 2DX1A 1K5GB 1MIXA 2RUKB 3FEHA 5C16A 2R09A 4F7HA 3QWMA 3NWFA 4Y94A 5GOWB 5FI0A 2DKQA 3OANA 3M1IB 3ODWA 1XODA 2VRWB 1KI1B 3PP2A 2W2XC 1N3HA 3X23A 1H10A 1P5TA 1TJ6A 5DI9B 1X11A 5C6RA 2DYNA 4IFSA 3PSCA 3PZDA 2UZSA 1B55A 4TKNA 4WVFB 5J3TA 3GYPA 4A6HA 1WJ1A 1W1GA 2GCLA 2DA0A 5DHAB 2UVMA 2YS5A 1NU2A 2L2IA 2Y8FA 1UNQA 2Z13A 5DH9B 4OT1A 3LJUX 1X05A 4GPTB 4EMOA 1IRSA 1M7EA 2D9XA 2GUMA 2YT2A 5KQ4A 1V5PA 1OQNA 5HE2A 3ML4A 4TYZA 2VSZA 5HE1A 2M38A 2Z0OA 2I1JA 3N7CA 1EGXA 1ZC4B 2R0DA 2Q13A 3TFMA 2RSGA 2YT1A 1DROA 3FM8C 3PVUA 1U5FA 1FHOA 1FGZA 1BTNA 2OQBA 2FJUB 2N0YA 2H7EA 2CY4A 5D3VA 1ZVRA 1X86A 2CAYA 4GXBA 4QJ3B 4HB3B 4MT7A 4HAXB 4C0AA 4HDQA 5JP4A 3KZ1A 5CLQB 2D4QA 4MY6A 1P6SA 1ISNA 3HQCA 2COFA 4QXAB 4GOUA 5D27A 5IRSA 3PVWA 1K5DB 1XCGA 3NWDA 3PEGA 2JP2A 1AWEA 3DXEA 3KSYA 3KY9A 3U7DA 4HB0B 4QJ4B 3UZTA 4PNKA 1KZ7A 2J0JA 4DIXA 1WG7A 1EAZA 3P7ZA 1DDWA 1T77A 2DYQA 4H8SA 4DBBA 2HE7A 4IOYX 3FVCA 3ULCA 2RNRB 3ODOA 5EFXA 3BJIA 1NI2A 1DYNA 4NSWA 2OTXA 2LOZA 1QC6A 1Y5OA 4GZUA 5JHGA 4GN1A 3U12A 2I5FA 2G35A 3KRWA 5HE3A 2LKOA 2YT0A 1FGYA 3A58A 2KR0A 3A8PA 2DHIA 4HATB 4A5KA 3AU4A 4CHJA 1QQGA 1PMSA 1MAIA 2CRFA 3F5RA 2I5CA 5LOPB 2V76A 3D8FA 4XWXA 5LG4B 3ULBA 2BCJA 2N23A 2XQNM 1LW3A 1X1GA 1MI1A 1MIZB 2DHKA 2KCJA 1UPQA 4WSFA 3F0WA 4DX90 1GC7A 2KIEA 2YS3A 2K8EA 2FJLA 3BINA 3U8ZA 2AEHA 1BWNA 4OSNA 2P0HA 4K2OA 4L6EA 2K00A 4D6WA 4ZRJA 2E2XA 2I1KA 2J0MA 2D9ZA 4K17A 1MK9B 1V88A 2DLWA 4KHOA 4EJNA 1FB8A 1MKEA 1I7AA 1PLSA 2DTCA 5FI1A 2J0KA 4A6KA 5LONB 2LYDA 4NY0A 2COCA 1Q67A 2ADZA 1UNPA 4HAYB 3FSSA 5D3XA 1U29A 2P0FA 2Z14A 2K2UA 3DCXA 3A8QA 2EMTA 1SHCA 3RCPA 1FHXA 1WVHA 4QJ5B 2ZKMX 3DXDA 2MDXA 3CIKA 4F7GA 2Z0PA 4GMXB 1MK7B 3AJ4A 3D8DA 2RGNB 2LOXA 2KUPA 2P8VA 4CYEA 2RRFA 2YF0A 2KUQA 3HW2B 2DN6A 1X1FA 5KQ1A 2GJYA 2QKLA 1H4RA 3TCAA 4F7UP 5HE0A 1J19A 1FHWA 4CSQA 5CLLB 4GMVA 3SV1A 1ZC3B 3KRXA 1XKEA 4KAXB 2ROVA 2CODA 1TQZA 4Z2MB 2M14A 2IYBA 4KHBB 1W1HA 4YL8A 5JLJB 3P6AA 5DIFB 1E5WA 5I2SA 1U5EA 4P7IA 2L1CA 4Z2NA 1AQCA 2DHJA 1ZSQA 4HDOA 4K2PA 2ELBA 4BBKA 2RVBB 1DDMA 4HB4B 1RJ2A 2Z4DA 3SNHA 1UNRA 3A98B 4IAPA 2Y8GA 2KGXB 3ZDTA 1WJMA 1XR0B 3B77A 1U5GA 3NWAA 3VOQA 2K49A 4HAUB 2D9WA 1V61A 5M4YB 1UEFA 3SO6A 4K81A 1WGQA 1BTKA 2ZPYA
chains in the Genus database with same CATH topology
1W1DA 3SUZA 2COAA 5JHHA 3T06A 4HAZB 5C5BB 1J0WA 3WA0A 1Y19B 2ROZB 5C5BA 3CXBB 1NTVA 1FAOA 2D2QA 1DDVA 2W2WA 2LULA 3DXCA 4HAWB 1OMWA 1GG3A 2HTHB 4WJ7A 1XX0A 4MK0A 2DFKA 3ZVRA 1XD4A 2D9VA 4CHMA 3G9WA 4YONA 2NZ8B 4HAVB 4EKUA 2NMBA 4ZRKA 1EVHA 1GC6A 4DXAB 2YS1A 4ZRIA 4A6FA 2D11A 3PG7A 1RRPB 2MWNB 1MPHA 3MDBC 3HK0A 1BAKA 1FOEA 1PFJA 1NTYA 2P0DA 3TW1A 2AL6A 2MKRA 4HHVA 2YRYA 2EJ8A 3WYFB 2UZRA 1LB1A 2EMSA 1OY2A 2EC1A 2DX5A 2GCJA 2IFSA 2DKPA 1U5DA 1UPRA 1P3RA 3ODXA 3QIJA 2PZ1A 1M7RA 2ELAA 3AU5A 3O96A 3PVLA 1ZM0A 5D3WA 2CY5A 5D3YA 4B6HA 2Z0QA 1V5MA 5KCVA 1V89A 2K2JA 5L81A 3MPXA 3NSUA 2D10A 1SGHA 1KZGA 3TO1A 5C79A 2Y7BA 2GS0A 4A6FB 3IVFA 4DX8A 1DBHA 2D9YA 2LG1A 1U2BA 3TVVA 1WGUA 1TXDA 3GYOA 4PQ0A 1U27A 3D8EA 2QKMA 5DHFB 1EF1A 4KHAA 2RLOA 2H7DA 3SYXA 2YVCA 3QBVB 2VKIA 2YSZA 2J59M 4KVGB 1Z87A 1V5UA 3VIAA 1I2HA 3V5WA 1WI1A 4HB2B 4D0NB 2W2XD 2X18A 5J3YA 5J3QA 2MFQA 2DX1A 1K5GB 1MIXA 2RUKB 3FEHA 5C16A 2R09A 4F7HA 3QWMA 4Y94A 5GOWB 5FI0A 2DKQA 3OANA 3M1IB 3ODWA 1XODA 2VRWB 1KI1B 3PP2A 2W2XC 1N3HA 3X23A 1H10A 1P5TA 1TJ6A 5DI9B 1X11A 5C6RA 2DYNA 4IFSA 3PSCA 3PZDA 2UZSA 1B55A 4TKNA 4WVFB 5J3TA 3GYPA 4A6HA 1WJ1A 1W1GA 2GCLA 2DA0A 5DHAB 2UVMA 2YS5A 1NU2A 2L2IA 2Y8FA 1UNQA 5DH9B 3LJUX 1X05A 4GPTB 4EMOA 1IRSA 1M7EA 2D9XA 5KQ4A 1V5PA 1OQNA 5HE2A 3ML4A 4TYZA 2VSZA 5HE1A 2M38A 2Z0OA 2I1JA 3N7CA 1EGXA 1ZC4B 2R0DA 2Q13A 3TFMA 2RSGA 2YT1A 1DROA 3FM8C 3PVUA 1U5FA 1FHOA 1FGZA 1BTNA 2OQBA 2N0YA 2H7EA 2CY4A 5D3VA 1ZVRA 1X86A 2CAYA 4GXBA 4HB3B 4MT7A 4HAXB 4C0AA 4HDQA 5JP4A 3KZ1A 5CLQB 2D4QA 4MY6A 1P6SA 1ISNA 3HQCA 2COFA 5D27A 3PVWA 1K5DB 1XCGA 3PEGA 2JP2A 1AWEA 3DXEA 3KSYA 3KY9A 3U7DA 4HB0B 3UZTA 4PNKA 1KZ7A 2J0JA 1WG7A 1EAZA 3P7ZA 1DDWA 2DYQA 4H8SA 4DBBA 2HE7A 4IOYX 3ULCA 2RNRB 3ODOA 5EFXA 3BJIA 1NI2A 1DYNA 4NSWA 2OTXA 2LOZA 1QC6A 1Y5OA 4GZUA 5JHGA 4GN1A 2I5FA 2G35A 3KRWA 5HE3A 2LKOA 2YT0A 1FGYA 3A8PA 2DHIA 4HATB 4A5KA 3AU4A 4CHJA 1QQGA 1PMSA 1MAIA 2CRFA 3F5RA 2I5CA 5LOPB 2V76A 3D8FA 4XWXA 3ULBA 2BCJA 2N23A 2XQNM 1LW3A 1X1GA 1MIZB 2DHKA 2KCJA 1UPQA 4WSFA 3F0WA 4DX90 1GC7A 2YS3A 2FJLA 3BINA 3U8ZA 2AEHA 1BWNA 2P0HA 4K2OA 4L6EA 2K00A 4ZRJA 2E2XA 2I1KA 2J0MA 2D9ZA 4K17A 1MK9B 1V88A 2DLWA 4KHOA 4EJNA 1FB8A 1MKEA 1I7AA 1PLSA 2DTCA 5FI1A 2J0KA 4A6KA 5LONB 2LYDA 4NY0A 2COCA 1Q67A 2ADZA 1UNPA 4HAYB 3FSSA 5D3XA 1U29A 2P0FA 2K2UA 3A8QA 2EMTA 1SHCA 3RCPA 1FHXA 1WVHA 3DXDA 2MDXA 3CIKA 4F7GA 2Z0PA 4GMXB 1MK7B 3AJ4A 3D8DA 2RGNB 2LOXA 2KUPA 2P8VA 4CYEA 2YF0A 3HW2B 2DN6A 1X1FA 5KQ1A 2GJYA 2QKLA 1H4RA 3TCAA 4F7UP 5HE0A 1J19A 1FHWA 5CLLB 4GMVA 3SV1A 1ZC3B 3KRXA 1XKEA 4KAXB 2ROVA 2CODA 1TQZA 4Z2MB 2M14A 2IYBA 4KHBB 1W1HA 4YL8A 5JLJB 3P6AA 5DIFB 1E5WA 1U5EA 4P7IA 2L1CA 4Z2NA 1AQCA 2DHJA 1ZSQA 4HDOA 4K2PA 2ELBA 4BBKA 2RVBB 1DDMA 4HB4B 1RJ2A 3SNHA 1UNRA 4IAPA 3A98B 2Y8GA 2KGXB 3ZDTA 1WJMA 1XR0B 1U5GA 3VOQA 4HAUB 2D9WA 1V61A 1UEFA 3SO6A 4K81A 1WGQA 1BTKA 2ZPYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1W1D A;  3SUZ A;  2COA A;  5JHH A;  3T06 A;  4HAZ B;  5C5B B;  1J0W A;  3WA0 A;  1Y19 B;  2ROZ B;  5C5B A;  3CXB B;  1NTV A;  1FAO A;  2D2Q A;  1DDV A;  2W2W A;  2LUL A;  3DXC A;  4HAW B;  1OMW A;  1GG3 A;  2HTH B;  4WJ7 A;  1XX0 A;  4MK0 A;  2DFK A;  3ZVR A;  1XD4 A;  2D9V A;  4CHM A;  3G9W A;  4YON A;  2NZ8 B;  4HAV B;  4EKU A;  2NMB A;  4ZRK A;  1EVH A;  1GC6 A;  4DXA B;  2YS1 A;  4ZRI A;  4A6F A;  2D11 A;  3PG7 A;  1RRP B;  2MWN B;  1MPH A;  3MDB C;  3HK0 A;  1BAK A;  1FOE A;  1PFJ A;  1NTY A;  2P0D A;  3TW1 A;  2AL6 A;  2MKR A;  4HHV A;  2YRY A;  2EJ8 A;  3WYF B;  2UZR A;  1LB1 A;  2EMS A;  1OY2 A;  2EC1 A;  2DX5 A;  2GCJ A;  2IFS A;  2DKP A;  1U5D A;  1UPR A;  1P3R A;  3ODX A;  3QIJ A;  2PZ1 A;  1M7R A;  2ELA A;  3AU5 A;  3O96 A;  3PVL A;  1ZM0 A;  5D3W A;  2CY5 A;  5D3Y A;  4B6H A;  2Z0Q A;  1V5M A;  5KCV A;  1V89 A;  2K2J A;  5L81 A;  3MPX A;  3NSU A;  2D10 A;  1SGH A;  1KZG A;  3TO1 A;  5C79 A;  2Y7B A;  2GS0 A;  4A6F B;  3IVF A;  4DX8 A;  1DBH A;  2D9Y A;  2LG1 A;  1U2B A;  3TVV A;  1WGU A;  1TXD A;  3GYO A;  4PQ0 A;  1U27 A;  3D8E A;  2QKM A;  5DHF B;  1EF1 A;  4KHA A;  2RLO A;  2H7D A;  3SYX A;  2YVC A;  3QBV B;  2VKI A;  2YSZ A;  2J59 M;  4KVG B;  1Z87 A;  1V5U A;  3VIA A;  1I2H A;  3V5W A;  1WI1 A;  4HB2 B;  4D0N B;  2W2X D;  2X18 A;  5J3Y A;  5J3Q A;  2MFQ A;  2DX1 A;  1K5G B;  1MIX A;  2RUK B;  3FEH A;  5C16 A;  2R09 A;  4F7H A;  3QWM A;  4Y94 A;  5GOW B;  5FI0 A;  2DKQ A;  3OAN A;  3M1I B;  3ODW A;  1XOD A;  2VRW B;  1KI1 B;  3PP2 A;  2W2X C;  1N3H A;  3X23 A;  1H10 A;  1P5T A;  1TJ6 A;  5DI9 B;  1X11 A;  5C6R A;  2DYN A;  4IFS A;  3PSC A;  3PZD A;  2UZS A;  1B55 A;  4TKN A;  4WVF B;  5J3T A;  3GYP A;  4A6H A;  1WJ1 A;  1W1G A;  2GCL A;  2DA0 A;  5DHA B;  2UVM A;  2YS5 A;  1NU2 A;  2L2I A;  2Y8F A;  1UNQ A;  5DH9 B;  3LJU X;  1X05 A;  4GPT B;  4EMO A;  1IRS A;  1M7E A;  2D9X A;  5KQ4 A;  1V5P A;  1OQN A;  5HE2 A;  3ML4 A;  4TYZ A;  2VSZ A;  5HE1 A;  2M38 A;  2Z0O A;  2I1J A;  3N7C A;  1EGX A;  1ZC4 B;  2R0D A;  2Q13 A;  3TFM A;  2RSG A;  2YT1 A;  1DRO A;  3FM8 C;  3PVU A;  1U5F A;  1FHO A;  1FGZ A;  1BTN A;  2OQB A;  2N0Y A;  2H7E A;  2CY4 A;  5D3V A;  1ZVR A;  1X86 A;  2CAY A;  4GXB A;  4HB3 B;  4MT7 A;  4HAX B;  4C0A A;  4HDQ A;  5JP4 A;  3KZ1 A;  5CLQ B;  2D4Q A;  4MY6 A;  1P6S A;  1ISN A;  3HQC A;  2COF A;  5D27 A;  3PVW A;  1K5D B;  1XCG A;  3PEG A;  2JP2 A;  1AWE A;  3DXE A;  3KSY A;  3KY9 A;  3U7D A;  4HB0 B;  3UZT A;  4PNK A;  1KZ7 A;  2J0J A;  1WG7 A;  1EAZ A;  3P7Z A;  1DDW A;  2DYQ A;  4H8S A;  4DBB A;  2HE7 A;  4IOY X;  3ULC A;  2RNR B;  3ODO A;  5EFX A;  3BJI A;  1NI2 A;  1DYN A;  4NSW A;  2OTX A;  2LOZ A;  1QC6 A;  1Y5O A;  4GZU A;  5JHG A;  4GN1 A;  2I5F A;  2G35 A;  3KRW A;  5HE3 A;  2LKO A;  2YT0 A;  1FGY A;  3A8P A;  2DHI A;  4HAT B;  4A5K A;  3AU4 A;  4CHJ A;  1QQG A;  1PMS A;  1MAI A;  2CRF A;  3F5R A;  2I5C A;  5LOP B;  2V76 A;  3D8F A;  4XWX A;  3ULB A;  2BCJ A;  2N23 A;  2XQN M;  1LW3 A;  1X1G A;  1MIZ B;  2DHK A;  2KCJ A;  1UPQ A;  4WSF A;  3F0W A;  4DX9 0;  1GC7 A;  2YS3 A;  2FJL A;  3BIN A;  3U8Z A;  2AEH A;  1BWN A;  2P0H A;  4K2O A;  4L6E A;  2K00 A;  4ZRJ A;  2E2X A;  2I1K A;  2J0M A;  2D9Z A;  4K17 A;  1MK9 B;  1V88 A;  2DLW A;  4KHO A;  4EJN A;  1FB8 A;  1MKE A;  1I7A A;  1PLS A;  2DTC A;  5FI1 A;  2J0K A;  4A6K A;  5LON B;  2LYD A;  4NY0 A;  2COC A;  1Q67 A;  2ADZ A;  1UNP A;  4HAY B;  3FSS A;  5D3X A;  1U29 A;  2P0F A;  2K2U A;  3A8Q A;  2EMT A;  1SHC A;  3RCP A;  1FHX A;  1WVH A;  3DXD A;  2MDX A;  3CIK A;  4F7G A;  2Z0P A;  4GMX B;  1MK7 B;  3AJ4 A;  3D8D A;  2RGN B;  2LOX A;  2KUP A;  2P8V A;  4CYE A;  2YF0 A;  3HW2 B;  2DN6 A;  1X1F A;  5KQ1 A;  2GJY A;  2QKL A;  1H4R A;  3TCA A;  4F7U P;  5HE0 A;  1J19 A;  1FHW A;  5CLL B;  4GMV A;  3SV1 A;  1ZC3 B;  3KRX A;  1XKE A;  4KAX B;  2ROV A;  2COD A;  1TQZ A;  4Z2M B;  2M14 A;  2IYB A;  4KHB B;  1W1H A;  4YL8 A;  5JLJ B;  3P6A A;  5DIF B;  1E5W A;  1U5E A;  4P7I A;  2L1C A;  4Z2N A;  1AQC A;  2DHJ A;  1ZSQ A;  4HDO A;  4K2P A;  2ELB A;  4BBK A;  2RVB B;  1DDM A;  4HB4 B;  1RJ2 A;  3SNH A;  1UNR A;  4IAP A;  3A98 B;  2Y8G A;  2KGX B;  3ZDT A;  1WJM A;  1XR0 B;  1U5G A;  3VOQ A;  4HAU B;  2D9W A;  1V61 A;  1UEF A;  3SO6 A;  4K81 A;  1WGQ A;  1BTK A;  2ZPY A; 
#chains in the Genus database with same CATH topology
 1W1D A;  3SUZ A;  2COA A;  5JHH A;  3T06 A;  4HAZ B;  5C5B B;  1J0W A;  3WA0 A;  1Y19 B;  2ROZ B;  2R2Y A;  5C5B A;  3CXB B;  1NTV A;  3NW8 A;  1FAO A;  2D2Q A;  1DDV A;  2W2W A;  2LUL A;  3DXC A;  4HAW B;  1OMW A;  1GG3 A;  2HTH B;  4WJ7 A;  1XX0 A;  4MK0 A;  5I2M A;  2DFK A;  3ZVR A;  1XD4 A;  2D9V A;  4L1R A;  4CHM A;  3G9W A;  4YON A;  2NZ8 B;  4HAV B;  4EKU A;  2NMB A;  4ZRK A;  1EVH A;  1GC6 A;  4DXA B;  2YS1 A;  4ZRI A;  4A6F A;  2D11 A;  3PG7 A;  1RRP B;  2MWN B;  1ZYI A;  1MPH A;  3MDB C;  3HK0 A;  1BAK A;  1FOE A;  1PFJ A;  1NTY A;  2P0D A;  3TW1 A;  2AL6 A;  2MKR A;  4HHV A;  2YRY A;  2EJ8 A;  3WYF B;  2UZR A;  1LB1 A;  2EMS A;  1OY2 A;  2EC1 A;  2DX5 A;  2GCJ A;  2IFS A;  2NBV A;  2DKP A;  1U5D A;  1UPR A;  1P3R A;  3ODX A;  3QIJ A;  2PZ1 A;  1M7R A;  2ELA A;  3AU5 A;  3O96 A;  3PVL A;  1ZM0 A;  5D3W A;  2CY5 A;  5D3Y A;  4B6H A;  2Z0Q A;  1V5M A;  5KCV A;  1V89 A;  2K2J A;  5L81 A;  3MPX A;  4KHB A;  4HSI A;  3NSU A;  2D10 A;  1SGH A;  1KZG A;  3TO1 A;  5C79 A;  2Y7B A;  2GS0 A;  4A6F B;  3IVF A;  4DX8 A;  1DBH A;  2D9Y A;  2LG1 A;  1U2B A;  3TVV A;  1WGU A;  1TXD A;  3GYO A;  4PQ0 A;  1U27 A;  4GNK B;  3D8E A;  2QKM A;  5DHF B;  3HIE A;  3OHM B;  1EF1 A;  4KHA A;  2RLO A;  2H7D A;  3SYX A;  2YVC A;  2KIG A;  3QBV B;  2VKI A;  2Z59 A;  2YSZ A;  2J59 M;  3HSA A;  4KVG B;  1Z87 A;  1V5U A;  3VIA A;  1I2H A;  3V5W A;  1WI1 A;  4HB2 B;  4D0N B;  2W2X D;  2X18 A;  5J3Y A;  5J3Q A;  2MFQ A;  2DX1 A;  1K5G B;  1MIX A;  2RUK B;  3FEH A;  5C16 A;  2R09 A;  4F7H A;  3QWM A;  3NWF A;  4Y94 A;  5GOW B;  5FI0 A;  2DKQ A;  3OAN A;  3M1I B;  3ODW A;  1XOD A;  2VRW B;  1KI1 B;  3PP2 A;  2W2X C;  1N3H A;  3X23 A;  1H10 A;  1P5T A;  1TJ6 A;  5DI9 B;  1X11 A;  5C6R A;  2DYN A;  4IFS A;  3PSC A;  3PZD A;  2UZS A;  1B55 A;  4TKN A;  4WVF B;  5J3T A;  3GYP A;  4A6H A;  1WJ1 A;  1W1G A;  2GCL A;  2DA0 A;  5DHA B;  2UVM A;  2YS5 A;  1NU2 A;  2L2I A;  2Y8F A;  1UNQ A;  2Z13 A;  5DH9 B;  4OT1 A;  3LJU X;  1X05 A;  4GPT B;  4EMO A;  1IRS A;  1M7E A;  2D9X A;  2GUM A;  2YT2 A;  5KQ4 A;  1V5P A;  1OQN A;  5HE2 A;  3ML4 A;  4TYZ A;  2VSZ A;  5HE1 A;  2M38 A;  2Z0O A;  2I1J A;  3N7C A;  1EGX A;  1ZC4 B;  2R0D A;  2Q13 A;  3TFM A;  2RSG A;  2YT1 A;  1DRO A;  3FM8 C;  3PVU A;  1U5F A;  1FHO A;  1FGZ A;  1BTN A;  2OQB A;  2FJU B;  2N0Y A;  2H7E A;  2CY4 A;  5D3V A;  1ZVR A;  1X86 A;  2CAY A;  4GXB A;  4QJ3 B;  4HB3 B;  4MT7 A;  4HAX B;  4C0A A;  4HDQ A;  5JP4 A;  3KZ1 A;  5CLQ B;  2D4Q A;  4MY6 A;  1P6S A;  1ISN A;  3HQC A;  2COF A;  4QXA B;  4GOU A;  5D27 A;  5IRS A;  3PVW A;  1K5D B;  1XCG A;  3NWD A;  3PEG A;  2JP2 A;  1AWE A;  3DXE A;  3KSY A;  3KY9 A;  3U7D A;  4HB0 B;  4QJ4 B;  3UZT A;  4PNK A;  1KZ7 A;  2J0J A;  4DIX A;  1WG7 A;  1EAZ A;  3P7Z A;  1DDW A;  1T77 A;  2DYQ A;  4H8S A;  4DBB A;  2HE7 A;  4IOY X;  3FVC A;  3ULC A;  2RNR B;  3ODO A;  5EFX A;  3BJI A;  1NI2 A;  1DYN A;  4NSW A;  2OTX A;  2LOZ A;  1QC6 A;  1Y5O A;  4GZU A;  5JHG A;  4GN1 A;  3U12 A;  2I5F A;  2G35 A;  3KRW A;  5HE3 A;  2LKO A;  2YT0 A;  1FGY A;  3A58 A;  2KR0 A;  3A8P A;  2DHI A;  4HAT B;  4A5K A;  3AU4 A;  4CHJ A;  1QQG A;  1PMS A;  1MAI A;  2CRF A;  3F5R A;  2I5C A;  5LOP B;  2V76 A;  3D8F A;  4XWX A;  5LG4 B;  3ULB A;  2BCJ A;  2N23 A;  2XQN M;  1LW3 A;  1X1G A;  1MI1 A;  1MIZ B;  2DHK A;  2KCJ A;  1UPQ A;  4WSF A;  3F0W A;  4DX9 0;  1GC7 A;  2KIE A;  2YS3 A;  2K8E A;  2FJL A;  3BIN A;  3U8Z A;  2AEH A;  1BWN A;  4OSN A;  2P0H A;  4K2O A;  4L6E A;  2K00 A;  4D6W A;  4ZRJ A;  2E2X A;  2I1K A;  2J0M A;  2D9Z A;  4K17 A;  1MK9 B;  1V88 A;  2DLW A;  4KHO A;  4EJN A;  1FB8 A;  1MKE A;  1I7A A;  1PLS A;  2DTC A;  5FI1 A;  2J0K A;  4A6K A;  5LON B;  2LYD A;  4NY0 A;  2COC A;  1Q67 A;  2ADZ A;  1UNP A;  4HAY B;  3FSS A;  5D3X A;  1U29 A;  2P0F A;  2Z14 A;  2K2U A;  3DCX A;  3A8Q A;  2EMT A;  1SHC A;  3RCP A;  1FHX A;  1WVH A;  4QJ5 B;  2ZKM X;  3DXD A;  2MDX A;  3CIK A;  4F7G A;  2Z0P A;  4GMX B;  1MK7 B;  3AJ4 A;  3D8D A;  2RGN B;  2LOX A;  2KUP A;  2P8V A;  4CYE A;  2RRF A;  2YF0 A;  2KUQ A;  3HW2 B;  2DN6 A;  1X1F A;  5KQ1 A;  2GJY A;  2QKL A;  1H4R A;  3TCA A;  4F7U P;  5HE0 A;  1J19 A;  1FHW A;  4CSQ A;  5CLL B;  4GMV A;  3SV1 A;  1ZC3 B;  3KRX A;  1XKE A;  4KAX B;  2ROV A;  2COD A;  1TQZ A;  4Z2M B;  2M14 A;  2IYB A;  4KHB B;  1W1H A;  4YL8 A;  5JLJ B;  3P6A A;  5DIF B;  1E5W A;  5I2S A;  1U5E A;  4P7I A;  2L1C A;  4Z2N A;  1AQC A;  2DHJ A;  1ZSQ A;  4HDO A;  4K2P A;  2ELB A;  4BBK A;  2RVB B;  1DDM A;  4HB4 B;  1RJ2 A;  2Z4D A;  3SNH A;  1UNR A;  3A98 B;  4IAP A;  2Y8G A;  2KGX B;  3ZDT A;  1WJM A;  1XR0 B;  3B77 A;  1U5G A;  3NWA A;  3VOQ A;  2K49 A;  4HAU B;  2D9W A;  1V61 A;  5M4Y B;  1UEF A;  3SO6 A;  4K81 A;  1WGQ A;  1BTK A;  2ZPY A; 
#chains in the Genus database with same CATH homology
 1W1D A;  3SUZ A;  2COA A;  5JHH A;  3T06 A;  4HAZ B;  5C5B B;  1J0W A;  3WA0 A;  1Y19 B;  2ROZ B;  5C5B A;  3CXB B;  1NTV A;  1FAO A;  2D2Q A;  1DDV A;  2W2W A;  2LUL A;  3DXC A;  4HAW B;  1OMW A;  1GG3 A;  2HTH B;  4WJ7 A;  1XX0 A;  4MK0 A;  2DFK A;  3ZVR A;  1XD4 A;  2D9V A;  4CHM A;  3G9W A;  4YON A;  2NZ8 B;  4HAV B;  4EKU A;  2NMB A;  4ZRK A;  1EVH A;  1GC6 A;  4DXA B;  2YS1 A;  4ZRI A;  4A6F A;  2D11 A;  3PG7 A;  1RRP B;  2MWN B;  1MPH A;  3MDB C;  3HK0 A;  1BAK A;  1FOE A;  1PFJ A;  1NTY A;  2P0D A;  3TW1 A;  2AL6 A;  2MKR A;  4HHV A;  2YRY A;  2EJ8 A;  3WYF B;  2UZR A;  1LB1 A;  2EMS A;  1OY2 A;  2EC1 A;  2DX5 A;  2GCJ A;  2IFS A;  2DKP A;  1U5D A;  1UPR A;  1P3R A;  3ODX A;  3QIJ A;  2PZ1 A;  1M7R A;  2ELA A;  3AU5 A;  3O96 A;  3PVL A;  1ZM0 A;  5D3W A;  2CY5 A;  5D3Y A;  4B6H A;  2Z0Q A;  1V5M A;  5KCV A;  1V89 A;  2K2J A;  5L81 A;  3MPX A;  3NSU A;  2D10 A;  1SGH A;  1KZG A;  3TO1 A;  5C79 A;  2Y7B A;  2GS0 A;  4A6F B;  3IVF A;  4DX8 A;  1DBH A;  2D9Y A;  2LG1 A;  1U2B A;  3TVV A;  1WGU A;  1TXD A;  3GYO A;  4PQ0 A;  1U27 A;  3D8E A;  2QKM A;  5DHF B;  1EF1 A;  4KHA A;  2RLO A;  2H7D A;  3SYX A;  2YVC A;  3QBV B;  2VKI A;  2YSZ A;  2J59 M;  4KVG B;  1Z87 A;  1V5U A;  3VIA A;  1I2H A;  3V5W A;  1WI1 A;  4HB2 B;  4D0N B;  2W2X D;  2X18 A;  5J3Y A;  5J3Q A;  2MFQ A;  2DX1 A;  1K5G B;  1MIX A;  2RUK B;  3FEH A;  5C16 A;  2R09 A;  4F7H A;  3QWM A;  4Y94 A;  5GOW B;  5FI0 A;  2DKQ A;  3OAN A;  3M1I B;  3ODW A;  1XOD A;  2VRW B;  1KI1 B;  3PP2 A;  2W2X C;  1N3H A;  3X23 A;  1H10 A;  1P5T A;  1TJ6 A;  5DI9 B;  1X11 A;  5C6R A;  2DYN A;  4IFS A;  3PSC A;  3PZD A;  2UZS A;  1B55 A;  4TKN A;  4WVF B;  5J3T A;  3GYP A;  4A6H A;  1WJ1 A;  1W1G A;  2GCL A;  2DA0 A;  5DHA B;  2UVM A;  2YS5 A;  1NU2 A;  2L2I A;  2Y8F A;  1UNQ A;  5DH9 B;  3LJU X;  1X05 A;  4GPT B;  4EMO A;  1IRS A;  1M7E A;  2D9X A;  5KQ4 A;  1V5P A;  1OQN A;  5HE2 A;  3ML4 A;  4TYZ A;  2VSZ A;  5HE1 A;  2M38 A;  2Z0O A;  2I1J A;  3N7C A;  1EGX A;  1ZC4 B;  2R0D A;  2Q13 A;  3TFM A;  2RSG A;  2YT1 A;  1DRO A;  3FM8 C;  3PVU A;  1U5F A;  1FHO A;  1FGZ A;  1BTN A;  2OQB A;  2N0Y A;  2H7E A;  2CY4 A;  5D3V A;  1ZVR A;  1X86 A;  2CAY A;  4GXB A;  4HB3 B;  4MT7 A;  4HAX B;  4C0A A;  4HDQ A;  5JP4 A;  3KZ1 A;  5CLQ B;  2D4Q A;  4MY6 A;  1P6S A;  1ISN A;  3HQC A;  2COF A;  5D27 A;  3PVW A;  1K5D B;  1XCG A;  3PEG A;  2JP2 A;  1AWE A;  3DXE A;  3KSY A;  3KY9 A;  3U7D A;  4HB0 B;  3UZT A;  4PNK A;  1KZ7 A;  2J0J A;  1WG7 A;  1EAZ A;  3P7Z A;  1DDW A;  2DYQ A;  4H8S A;  4DBB A;  2HE7 A;  4IOY X;  3ULC A;  2RNR B;  3ODO A;  5EFX A;  3BJI A;  1NI2 A;  1DYN A;  4NSW A;  2OTX A;  2LOZ A;  1QC6 A;  1Y5O A;  4GZU A;  5JHG A;  4GN1 A;  2I5F A;  2G35 A;  3KRW A;  5HE3 A;  2LKO A;  2YT0 A;  1FGY A;  3A8P A;  2DHI A;  4HAT B;  4A5K A;  3AU4 A;  4CHJ A;  1QQG A;  1PMS A;  1MAI A;  2CRF A;  3F5R A;  2I5C A;  5LOP B;  2V76 A;  3D8F A;  4XWX A;  3ULB A;  2BCJ A;  2N23 A;  2XQN M;  1LW3 A;  1X1G A;  1MIZ B;  2DHK A;  2KCJ A;  1UPQ A;  4WSF A;  3F0W A;  4DX9 0;  1GC7 A;  2YS3 A;  2FJL A;  3BIN A;  3U8Z A;  2AEH A;  1BWN A;  2P0H A;  4K2O A;  4L6E A;  2K00 A;  4ZRJ A;  2E2X A;  2I1K A;  2J0M A;  2D9Z A;  4K17 A;  1MK9 B;  1V88 A;  2DLW A;  4KHO A;  4EJN A;  1FB8 A;  1MKE A;  1I7A A;  1PLS A;  2DTC A;  5FI1 A;  2J0K A;  4A6K A;  5LON B;  2LYD A;  4NY0 A;  2COC A;  1Q67 A;  2ADZ A;  1UNP A;  4HAY B;  3FSS A;  5D3X A;  1U29 A;  2P0F A;  2K2U A;  3A8Q A;  2EMT A;  1SHC A;  3RCP A;  1FHX A;  1WVH A;  3DXD A;  2MDX A;  3CIK A;  4F7G A;  2Z0P A;  4GMX B;  1MK7 B;  3AJ4 A;  3D8D A;  2RGN B;  2LOX A;  2KUP A;  2P8V A;  4CYE A;  2YF0 A;  3HW2 B;  2DN6 A;  1X1F A;  5KQ1 A;  2GJY A;  2QKL A;  1H4R A;  3TCA A;  4F7U P;  5HE0 A;  1J19 A;  1FHW A;  5CLL B;  4GMV A;  3SV1 A;  1ZC3 B;  3KRX A;  1XKE A;  4KAX B;  2ROV A;  2COD A;  1TQZ A;  4Z2M B;  2M14 A;  2IYB A;  4KHB B;  1W1H A;  4YL8 A;  5JLJ B;  3P6A A;  5DIF B;  1E5W A;  1U5E A;  4P7I A;  2L1C A;  4Z2N A;  1AQC A;  2DHJ A;  1ZSQ A;  4HDO A;  4K2P A;  2ELB A;  4BBK A;  2RVB B;  1DDM A;  4HB4 B;  1RJ2 A;  3SNH A;  1UNR A;  4IAP A;  3A98 B;  2Y8G A;  2KGX B;  3ZDT A;  1WJM A;  1XR0 B;  1U5G A;  3VOQ A;  4HAU B;  2D9W A;  1V61 A;  1UEF A;  3SO6 A;  4K81 A;  1WGQ A;  1BTK A;  2ZPY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...