3WYFB

Crystal structure of xpo1p-yrb2p-gsp1p-gtp complex
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
229
structure length
144
Chain Sequence
KFVFGAASKFGTGFAFGSGLSFGSGFNILLQKQEVKSGEESEECIYQVNAKLYQLSNEGWKERGVGIIKINKSKDKTRIVMRSRGILKVILNIQLVKGFTVQKGFTGSLQSEKFIRLLAVDAQYAIKTKKETTDELYNIIVKSV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Gsp1p
publication title Structural insights into how yrb2p accelerates the assembly of the xpo1p nuclear export complex
pubmed doi rcsb
source organism Saccharomyces cerevisiae awri796
molecule tags Gtp-binding protein/gtp-binding protein inhibitor
total genus 24
structure length 144
sequence length 229
chains with identical sequence E
ec nomenclature
pdb deposition date 2014-08-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00638 Ran_BP1 RanBP1 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 3wyfB00
2DLWA 2J0KA 2BCJA 2VSZA 3D8EA 3MDBC 1V89A 4H8SA 2ADZA 1DDWA 2Z0QA 1NU2A 4F7GA 5HE0A 4HB2B 2D2QA 2DX5A 4HATB 2DN6A 4ZRIA 4HB0B 4F7UP 1MK7B 2YSZA 2CODA 3KZ1A 3TO1A 1BTNA 5HE2A 3KY9A 3IVFA 3D8DA 3TFMA 1EVHA 3WA0A 1GG3A 2L1CA 1UPRA 2YVCA 1FHOA 1MAIA 4A5KA 5D3WA 4EKUA 2M38A 5FI0A 1NTYA 3HW2B 5KQ4A 4YONA 2YT1A 3TVVA 1ZM0A 2J59M 2J0JA 2EMTA 2MWNB 2X18A 2W2WA 3VIAA 1U5EA 2YS1A 3DXEA 2DHIA 3OANA 3SUZA 2DHKA 1RJ2A 4KAXB 4XWXA 4ZRKA 3PVUA 5L81A 1X86A 2V76A 3KSYA 2KGXB 2EJ8A 2Z0PA 5J3QA 3U8ZA 1PMSA 2I5CA 3A98B 2DX1A 3PP2A 2D9XA 2RSGA 4F7HA 2K2UA 5DH9B 3FEHA 4HDOA 1BTKA 1LW3A 1MPHA 3QWMA 1GC7A 3AU5A 2XQNM 1OY2A 4GN1A 1FAOA 1XKEA 1FOEA 1EGXA 1FB8A 5DHAB 1SGHA 2ROZB 4Z2MB 1J19A 1PLSA 2COAA 5HE3A 1W1DA 2P0FA 3ULCA 2KCJA 4MY6A 1FHWA 3DXDA 3QIJA 3SO6A 1XR0B 2D11A 4TYZA 2PZ1A 4A6KA 3ULBA 3KRWA 3PEGA 4HAWB 1X05A 2J0MA 3BJIA 1U2BA 1DYNA 2P0HA 3LJUX 4GZUA 2OTXA 5HE1A 1XX0A 1J0WA 1V5PA 5JP4A 2LOXA 5LONB 1MIZB 1Y19B 2Y7BA 3F5RA 2EMSA 2P8VA 3BINA 2KUPA 1U27A 4KHOA 1LB1A 2EC1A 1K5GB 2OQBA 1WGQA 4L6EA 1OQNA 4HB3B 2GCJA 1XODA 3PZDA 4IFSA 4KHAA 2E2XA 2K2JA 3D8FA 2GS0A 4B6HA 3A8PA 2NZ8B 2FJLA 4BBKA 2YS3A 3T06A 4HAXB 4P7IA 3VOQA 2D4QA 4HAUB 4PQ0A 3ODOA 4WVFB 3P6AA 2DHJA 4KHBB 1U5GA 1P6SA 1N3HA 5J3TA 1H10A 1KZGA 3M1IB 2LULA 5EFXA 2Y8GA 2IFSA 1X11A 2HE7A 2MDXA 4HHVA 3G9WA 1ZC3B 5DHFB 5D27A 5C79A 4CYEA 2JP2A 4WSFA 2IYBA 1EF1A 2UZRA 4CHJA 2D9WA 2I1JA 3RCPA 4IOYX 5FI1A 3KRXA 2DFKA 2CRFA 4D0NB 3SYXA 1W1GA 2MFQA 4TKNA 4GMVA 1Q67A 4K17A 1ZVRA 2CY5A 5D3XA 4GXBA 1EAZA 4ZRJA 3UZTA 1TJ6A 5DI9B 1BAKA 3GYOA 1V88A 4HDQA 5C16A 2L2IA 1M7RA 2N0YA 5LOPB 1WVHA 4KVGB 2RVBB 4WJ7A 4DBBA 1UEFA 2W2XD 5D3VA 1KI1B 1FGYA 4A6HA 2UVMA 1GC6A 3V5WA 1MIXA 2UZSA 1U29A 5DIFB 2CAYA 1WI1A 2DA0A 2I1KA 3ODXA 2COCA 1WG7A 4Z2NA 2DKQA 1H4RA 3CXBB 1XCGA 2ZPYA 3TW1A 4PNKA 2DYQA 3HQCA 1V5UA 3TCAA 2GJYA 3F0WA 3NSUA 1QQGA 4HAVB 2YS5A 3SNHA 2ELAA 1TXDA 2MKRA 1M7EA 1UNRA 3U7DA 3O96A 4DX8A 1Y5OA 3X23A 1FHXA 1QC6A 1ZC4B 2G35A 1SHCA 3ML4A 5GOWB 1Z87A 2R0DA 5KCVA 2RLOA 3MPXA 5CLQB 2I5FA 2K00A 1NI2A 2YT0A 3DXCA 3P7ZA 1WGUA 1P3RA 2Z0OA 1DDMA 1UNPA 1DDVA 1XD4A 4A6FB 2RNRB 2LKOA 4A6FA 1MKEA 2VRWB 2LYDA 4GPTB 1OMWA 1V5MA 1AWEA 1MK9B 4HB4B 4EJNA 2QKMA 2P0DA 3A8QA 1AQCA 1V61A 1X1GA 1WJMA 4K2PA 3QBVB 3CIKA 4HAZB 5C5BB 5C5BA 3AJ4A 4NSWA 5JLJB 1ISNA 3ZVRA 2LG1A 3PVLA 4MK0A 1UPQA 2HTHB 2VKIA 4CHMA 1PFJA 3SV1A 1BWNA 5JHGA 2D9YA 2AL6A 3FSSA 3AU4A 4K81A 2DYNA 1I2HA 2COFA 2GCLA 4K2OA 1I7AA 2CY4A 4EMOA 5JHHA 2D9ZA 1FGZA 4C0AA 3ZDTA 2YRYA 1E5WA 4MT7A 4Y94A 2Y8FA 2RUKB 4GMXB 3PSCA 4NY0A 2M14A 5D3YA 1TQZA 2ELBA 1B55A 3PVWA 1DROA 2NMBA 1UNQA 2R09A 1K5DB 3ODWA 2YF0A 3PG7A 2DKPA 1X1FA 2D10A 3GYPA 1ZSQA 2D9VA 1KZ7A 2AEHA 1DBHA 3FM8C 1RRPB 1W1HA 2DTCA 5CLLB 3N7CA 3HK0A 1IRSA 1WJ1A 4IAPA 5J3YA 1U5FA 4DX90 4YL8A 1NTVA 5C6RA 5KQ1A 2W2XC 4DXAB 2ROVA 2H7DA 2H7EA 2RGNB 2QKLA 2N23A 1U5DA 4HAYB 2Q13A 2LOZA 3WYFB 1P5TA
chains in the Genus database with same CATH superfamily
2DLWA 2J0KA 2BCJA 2VSZA 3D8EA 3MDBC 1V89A 4H8SA 2ADZA 1DDWA 2Z0QA 1NU2A 4F7GA 5HE0A 4HB2B 2D2QA 2DX5A 4HATB 2DN6A 4ZRIA 4HB0B 4F7UP 1MK7B 2YSZA 2CODA 3KZ1A 3TO1A 1BTNA 5HE2A 3KY9A 3IVFA 3D8DA 3TFMA 1EVHA 3WA0A 1GG3A 2L1CA 1UPRA 2NBVA 2YVCA 1FHOA 2FJUB 1MAIA 4A5KA 5D3WA 4EKUA 2M38A 5FI0A 1NTYA 3HW2B 5KQ4A 4YONA 2YT1A 3TVVA 1ZM0A 2J59M 2J0JA 2EMTA 2GUMA 2X18A 2MWNB 2W2WA 3VIAA 1U5EA 2YS1A 3DXEA 2DHIA 3OANA 3SUZA 2DHKA 2RRFA 1RJ2A 4KAXB 4XWXA 4ZRKA 4QJ4B 3PVUA 5L81A 1X86A 2V76A 3KSYA 2KGXB 2EJ8A 2Z0PA 5J3QA 3U8ZA 1PMSA 2I5CA 3A98B 2DX1A 3PP2A 2D9XA 2RSGA 4F7HA 2K2UA 5DH9B 3FEHA 4HDOA 4HSIA 1BTKA 1LW3A 1MPHA 4D6WA 3QWMA 1GC7A 3AU5A 2XQNM 1OY2A 2Z59A 4GN1A 1FAOA 1XKEA 2Z4DA 1FOEA 1EGXA 1FB8A 5DHAB 1SGHA 2ROZB 4Z2MB 1J19A 1PLSA 3FVCA 2COAA 5HE3A 2ZKMX 1W1DA 2P0FA 2Z13A 3ULCA 2KCJA 4MY6A 1FHWA 3DXDA 3QIJA 3SO6A 1XR0B 2D11A 4TYZA 2PZ1A 4A6KA 3ULBA 3KRWA 3PEGA 4HAWB 2Z14A 1X05A 2J0MA 3BJIA 1U2BA 1DYNA 2P0HA 3LJUX 4GZUA 2OTXA 5HE1A 1XX0A 1J0WA 1V5PA 5JP4A 2LOXA 5LONB 1MIZB 1Y19B 2Y7BA 3F5RA 2EMSA 2P8VA 3BINA 2KUPA 1U27A 4KHOA 1LB1A 2EC1A 1K5GB 2OQBA 4QJ5B 1WGQA 4L6EA 1OQNA 4HB3B 5M4YB 2GCJA 1XODA 3PZDA 4IFSA 4KHAA 2E2XA 2K2JA 3D8FA 2GS0A 4B6HA 3A8PA 2NZ8B 2FJLA 4BBKA 2YS3A 3T06A 4HAXB 4P7IA 3VOQA 2D4QA 4HAUB 2K8EA 4PQ0A 3ODOA 4WVFB 5I2MA 3P6AA 2DHJA 4KHBB 1U5GA 1P6SA 1N3HA 3NWDA 4KHBA 5J3TA 1H10A 1KZGA 3M1IB 2LULA 5EFXA 2Y8GA 2IFSA 5I2SA 1X11A 2HE7A 2MDXA 4HHVA 3G9WA 1ZC3B 3NWAA 5DHFB 5D27A 5C79A 2KIGA 3HIEA 4CYEA 2JP2A 4WSFA 2IYBA 1EF1A 2UZRA 4CHJA 2D9WA 2I1JA 3RCPA 4IOYX 5FI1A 3KRXA 2DFKA 2CRFA 4D0NB 3SYXA 1W1GA 2MFQA 4TKNA 4GMVA 1Q67A 3U12A 4K17A 1ZVRA 2CY5A 4GOUA 5D3XA 4GXBA 1EAZA 4ZRJA 3UZTA 1TJ6A 5DI9B 1BAKA 3GYOA 1V88A 4HDQA 5C16A 2L2IA 1M7RA 2N0YA 5LOPB 1WVHA 4KVGB 2RVBB 4WJ7A 4DBBA 1UEFA 2W2XD 5D3VA 1KI1B 1FGYA 4A6HA 2UVMA 1GC6A 3V5WA 3NW8A 1MIXA 1MI1A 2UZSA 2KIEA 1U29A 5DIFB 2CAYA 1WI1A 2DA0A 2I1KA 3ODXA 2COCA 1WG7A 4Z2NA 2DKQA 1H4RA 3CXBB 1XCGA 4QJ3B 2ZPYA 3TW1A 4PNKA 3HSAA 2DYQA 3HQCA 1V5UA 3TCAA 2GJYA 3F0WA 3NSUA 1QQGA 4HAVB 2YS5A 3SNHA 3A58A 2ELAA 1TXDA 2MKRA 1M7EA 1UNRA 3U7DA 3O96A 4DX8A 1Y5OA 3X23A 1FHXA 1QC6A 1ZC4B 2G35A 1SHCA 3ML4A 5GOWB 1Z87A 2R0DA 5KCVA 2RLOA 3MPXA 5CLQB 2I5FA 2K00A 1NI2A 2YT0A 3DXCA 3P7ZA 1WGUA 1T77A 1P3RA 5LG4B 2Z0OA 1DDMA 1UNPA 1DDVA 1XD4A 4A6FB 2R2YA 3NWFA 2RNRB 2LKOA 4A6FA 1MKEA 2VRWB 2LYDA 4GPTB 1OMWA 1V5MA 1AWEA 1MK9B 4HB4B 4EJNA 2QKMA 2P0DA 3A8QA 1AQCA 5IRSA 1V61A 1X1GA 1WJMA 3DCXA 4K2PA 3QBVB 3CIKA 4HAZB 5C5BB 5C5BA 3AJ4A 4OT1A 4NSWA 5JLJB 1ISNA 3ZVRA 2LG1A 3PVLA 4MK0A 1UPQA 2HTHB 2VKIA 2KUQA 4CHMA 1PFJA 3SV1A 1BWNA 5JHGA 2D9YA 2AL6A 3FSSA 3B77A 3AU4A 1ZYIA 4K81A 2DYNA 1I2HA 2COFA 2GCLA 4K2OA 1I7AA 2CY4A 4EMOA 5JHHA 2D9ZA 2KR0A 1FGZA 4C0AA 3ZDTA 2YRYA 1E5WA 4MT7A 4Y94A 2Y8FA 2RUKB 4GMXB 3PSCA 4NY0A 2M14A 5D3YA 1TQZA 4L1RA 2ELBA 1B55A 3PVWA 1DROA 2NMBA 1UNQA 2R09A 1K5DB 3ODWA 2YF0A 3PG7A 2DKPA 1X1FA 2D10A 3GYPA 1ZSQA 2D9VA 1KZ7A 2AEHA 1DBHA 3FM8C 1RRPB 1W1HA 2DTCA 4GNKB 3N7CA 5CLLB 3OHMB 3HK0A 4QXAB 1IRSA 1WJ1A 4IAPA 5J3YA 1U5FA 4DX90 4YL8A 1NTVA 5C6RA 5KQ1A 2YT2A 2W2XC 4CSQA 4DXAB 2ROVA 2H7DA 2H7EA 2RGNB 2QKLA 4DIXA 4OSNA 2N23A 1U5DA 4HAYB 2Q13A 2LOZA 2K49A 3WYFB 1P5TA
chains in the Genus database with same CATH topology
2DLWA 2J0KA 2BCJA 2VSZA 3D8EA 3MDBC 1V89A 4H8SA 2ADZA 1DDWA 2Z0QA 1NU2A 4F7GA 5HE0A 4HB2B 2D2QA 2DX5A 4HATB 2DN6A 4ZRIA 4HB0B 4F7UP 1MK7B 2YSZA 2CODA 3KZ1A 3TO1A 1BTNA 5HE2A 3KY9A 3IVFA 3D8DA 3TFMA 1EVHA 3WA0A 1GG3A 2L1CA 1UPRA 2YVCA 1FHOA 1MAIA 4A5KA 5D3WA 4EKUA 2M38A 5FI0A 1NTYA 3HW2B 5KQ4A 4YONA 2YT1A 3TVVA 1ZM0A 2J59M 2J0JA 2EMTA 2MWNB 2X18A 2W2WA 3VIAA 1U5EA 2YS1A 3DXEA 2DHIA 3OANA 3SUZA 2DHKA 1RJ2A 4KAXB 4XWXA 4ZRKA 3PVUA 5L81A 1X86A 2V76A 3KSYA 2KGXB 2EJ8A 2Z0PA 5J3QA 3U8ZA 1PMSA 2I5CA 3A98B 2DX1A 3PP2A 2D9XA 2RSGA 4F7HA 2K2UA 5DH9B 3FEHA 4HDOA 1BTKA 1LW3A 1MPHA 3QWMA 1GC7A 3AU5A 2XQNM 1OY2A 4GN1A 1FAOA 1XKEA 1FOEA 1EGXA 1FB8A 5DHAB 1SGHA 2ROZB 4Z2MB 1J19A 1PLSA 2COAA 5HE3A 1W1DA 2P0FA 3ULCA 2KCJA 4MY6A 1FHWA 3DXDA 3QIJA 3SO6A 1XR0B 2D11A 4TYZA 2PZ1A 4A6KA 3ULBA 3KRWA 3PEGA 4HAWB 1X05A 2J0MA 3BJIA 1U2BA 1DYNA 2P0HA 3LJUX 4GZUA 2OTXA 5HE1A 1XX0A 1J0WA 1V5PA 5JP4A 2LOXA 5LONB 1MIZB 1Y19B 2Y7BA 3F5RA 2EMSA 2P8VA 3BINA 2KUPA 1U27A 4KHOA 1LB1A 2EC1A 1K5GB 2OQBA 1WGQA 4L6EA 1OQNA 4HB3B 2GCJA 1XODA 3PZDA 4IFSA 4KHAA 2E2XA 2K2JA 3D8FA 2GS0A 4B6HA 3A8PA 2NZ8B 2FJLA 4BBKA 2YS3A 3T06A 4HAXB 4P7IA 3VOQA 2D4QA 4HAUB 4PQ0A 3ODOA 4WVFB 3P6AA 2DHJA 4KHBB 1U5GA 1P6SA 1N3HA 5J3TA 1H10A 1KZGA 3M1IB 2LULA 5EFXA 2Y8GA 2IFSA 1X11A 2HE7A 2MDXA 4HHVA 3G9WA 1ZC3B 5DHFB 5D27A 5C79A 4CYEA 2JP2A 4WSFA 2IYBA 1EF1A 2UZRA 4CHJA 2D9WA 2I1JA 3RCPA 4IOYX 5FI1A 3KRXA 2DFKA 2CRFA 4D0NB 3SYXA 1W1GA 2MFQA 4TKNA 4GMVA 1Q67A 4K17A 1ZVRA 2CY5A 5D3XA 4GXBA 1EAZA 4ZRJA 3UZTA 1TJ6A 5DI9B 1BAKA 3GYOA 1V88A 4HDQA 5C16A 2L2IA 1M7RA 2N0YA 5LOPB 1WVHA 4KVGB 2RVBB 4WJ7A 4DBBA 1UEFA 2W2XD 5D3VA 1KI1B 1FGYA 4A6HA 2UVMA 1GC6A 3V5WA 1MIXA 2UZSA 1U29A 5DIFB 2CAYA 1WI1A 2DA0A 2I1KA 3ODXA 2COCA 1WG7A 4Z2NA 2DKQA 1H4RA 3CXBB 1XCGA 2ZPYA 3TW1A 4PNKA 2DYQA 3HQCA 1V5UA 3TCAA 2GJYA 3F0WA 3NSUA 1QQGA 4HAVB 2YS5A 3SNHA 2ELAA 1TXDA 2MKRA 1M7EA 1UNRA 3U7DA 3O96A 4DX8A 1Y5OA 3X23A 1FHXA 1QC6A 1ZC4B 2G35A 1SHCA 3ML4A 5GOWB 1Z87A 2R0DA 5KCVA 2RLOA 3MPXA 5CLQB 2I5FA 2K00A 1NI2A 2YT0A 3DXCA 3P7ZA 1WGUA 1P3RA 2Z0OA 1DDMA 1UNPA 1DDVA 1XD4A 4A6FB 2RNRB 2LKOA 4A6FA 1MKEA 2VRWB 2LYDA 4GPTB 1OMWA 1V5MA 1AWEA 1MK9B 4HB4B 4EJNA 2QKMA 2P0DA 3A8QA 1AQCA 1V61A 1X1GA 1WJMA 4K2PA 3QBVB 3CIKA 4HAZB 5C5BB 5C5BA 3AJ4A 4NSWA 5JLJB 1ISNA 3ZVRA 2LG1A 3PVLA 4MK0A 1UPQA 2HTHB 2VKIA 4CHMA 1PFJA 3SV1A 1BWNA 5JHGA 2D9YA 2AL6A 3FSSA 3AU4A 4K81A 2DYNA 1I2HA 2COFA 2GCLA 4K2OA 1I7AA 2CY4A 4EMOA 5JHHA 2D9ZA 1FGZA 4C0AA 3ZDTA 2YRYA 1E5WA 4MT7A 4Y94A 2Y8FA 2RUKB 4GMXB 3PSCA 4NY0A 2M14A 5D3YA 1TQZA 2ELBA 1B55A 3PVWA 1DROA 2NMBA 1UNQA 2R09A 1K5DB 3ODWA 2YF0A 3PG7A 2DKPA 1X1FA 2D10A 3GYPA 1ZSQA 2D9VA 1KZ7A 2AEHA 1DBHA 3FM8C 1RRPB 1W1HA 2DTCA 5CLLB 3N7CA 3HK0A 1IRSA 1WJ1A 4IAPA 5J3YA 1U5FA 4DX90 4YL8A 1NTVA 5C6RA 5KQ1A 2W2XC 4DXAB 2ROVA 2H7DA 2H7EA 2RGNB 2QKLA 2N23A 1U5DA 4HAYB 2Q13A 2LOZA 3WYFB 1P5TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DLW A;  2J0K A;  2BCJ A;  2VSZ A;  3D8E A;  3MDB C;  1V89 A;  4H8S A;  2ADZ A;  1DDW A;  2Z0Q A;  1NU2 A;  4F7G A;  5HE0 A;  4HB2 B;  2D2Q A;  2DX5 A;  4HAT B;  2DN6 A;  4ZRI A;  4HB0 B;  4F7U P;  1MK7 B;  2YSZ A;  2COD A;  3KZ1 A;  3TO1 A;  1BTN A;  5HE2 A;  3KY9 A;  3IVF A;  3D8D A;  3TFM A;  1EVH A;  3WA0 A;  1GG3 A;  2L1C A;  1UPR A;  2YVC A;  1FHO A;  1MAI A;  4A5K A;  5D3W A;  4EKU A;  2M38 A;  5FI0 A;  1NTY A;  3HW2 B;  5KQ4 A;  4YON A;  2YT1 A;  3TVV A;  1ZM0 A;  2J59 M;  2J0J A;  2EMT A;  2MWN B;  2X18 A;  2W2W A;  3VIA A;  1U5E A;  2YS1 A;  3DXE A;  2DHI A;  3OAN A;  3SUZ A;  2DHK A;  1RJ2 A;  4KAX B;  4XWX A;  4ZRK A;  3PVU A;  5L81 A;  1X86 A;  2V76 A;  3KSY A;  2KGX B;  2EJ8 A;  2Z0P A;  5J3Q A;  3U8Z A;  1PMS A;  2I5C A;  3A98 B;  2DX1 A;  3PP2 A;  2D9X A;  2RSG A;  4F7H A;  2K2U A;  5DH9 B;  3FEH A;  4HDO A;  1BTK A;  1LW3 A;  1MPH A;  3QWM A;  1GC7 A;  3AU5 A;  2XQN M;  1OY2 A;  4GN1 A;  1FAO A;  1XKE A;  1FOE A;  1EGX A;  1FB8 A;  5DHA B;  1SGH A;  2ROZ B;  4Z2M B;  1J19 A;  1PLS A;  2COA A;  5HE3 A;  1W1D A;  2P0F A;  3ULC A;  2KCJ A;  4MY6 A;  1FHW A;  3DXD A;  3QIJ A;  3SO6 A;  1XR0 B;  2D11 A;  4TYZ A;  2PZ1 A;  4A6K A;  3ULB A;  3KRW A;  3PEG A;  4HAW B;  1X05 A;  2J0M A;  3BJI A;  1U2B A;  1DYN A;  2P0H A;  3LJU X;  4GZU A;  2OTX A;  5HE1 A;  1XX0 A;  1J0W A;  1V5P A;  5JP4 A;  2LOX A;  5LON B;  1MIZ B;  1Y19 B;  2Y7B A;  3F5R A;  2EMS A;  2P8V A;  3BIN A;  2KUP A;  1U27 A;  4KHO A;  1LB1 A;  2EC1 A;  1K5G B;  2OQB A;  1WGQ A;  4L6E A;  1OQN A;  4HB3 B;  2GCJ A;  1XOD A;  3PZD A;  4IFS A;  4KHA A;  2E2X A;  2K2J A;  3D8F A;  2GS0 A;  4B6H A;  3A8P A;  2NZ8 B;  2FJL A;  4BBK A;  2YS3 A;  3T06 A;  4HAX B;  4P7I A;  3VOQ A;  2D4Q A;  4HAU B;  4PQ0 A;  3ODO A;  4WVF B;  3P6A A;  2DHJ A;  4KHB B;  1U5G A;  1P6S A;  1N3H A;  5J3T A;  1H10 A;  1KZG A;  3M1I B;  2LUL A;  5EFX A;  2Y8G A;  2IFS A;  1X11 A;  2HE7 A;  2MDX A;  4HHV A;  3G9W A;  1ZC3 B;  5DHF B;  5D27 A;  5C79 A;  4CYE A;  2JP2 A;  4WSF A;  2IYB A;  1EF1 A;  2UZR A;  4CHJ A;  2D9W A;  2I1J A;  3RCP A;  4IOY X;  5FI1 A;  3KRX A;  2DFK A;  2CRF A;  4D0N B;  3SYX A;  1W1G A;  2MFQ A;  4TKN A;  4GMV A;  1Q67 A;  4K17 A;  1ZVR A;  2CY5 A;  5D3X A;  4GXB A;  1EAZ A;  4ZRJ A;  3UZT A;  1TJ6 A;  5DI9 B;  1BAK A;  3GYO A;  1V88 A;  4HDQ A;  5C16 A;  2L2I A;  1M7R A;  2N0Y A;  5LOP B;  1WVH A;  4KVG B;  2RVB B;  4WJ7 A;  4DBB A;  1UEF A;  2W2X D;  5D3V A;  1KI1 B;  1FGY A;  4A6H A;  2UVM A;  1GC6 A;  3V5W A;  1MIX A;  2UZS A;  1U29 A;  5DIF B;  2CAY A;  1WI1 A;  2DA0 A;  2I1K A;  3ODX A;  2COC A;  1WG7 A;  4Z2N A;  2DKQ A;  1H4R A;  3CXB B;  1XCG A;  2ZPY A;  3TW1 A;  4PNK A;  2DYQ A;  3HQC A;  1V5U A;  3TCA A;  2GJY A;  3F0W A;  3NSU A;  1QQG A;  4HAV B;  2YS5 A;  3SNH A;  2ELA A;  1TXD A;  2MKR A;  1M7E A;  1UNR A;  3U7D A;  3O96 A;  4DX8 A;  1Y5O A;  3X23 A;  1FHX A;  1QC6 A;  1ZC4 B;  2G35 A;  1SHC A;  3ML4 A;  5GOW B;  1Z87 A;  2R0D A;  5KCV A;  2RLO A;  3MPX A;  5CLQ B;  2I5F A;  2K00 A;  1NI2 A;  2YT0 A;  3DXC A;  3P7Z A;  1WGU A;  1P3R A;  2Z0O A;  1DDM A;  1UNP A;  1DDV A;  1XD4 A;  4A6F B;  2RNR B;  2LKO A;  4A6F A;  1MKE A;  2VRW B;  2LYD A;  4GPT B;  1OMW A;  1V5M A;  1AWE A;  1MK9 B;  4HB4 B;  4EJN A;  2QKM A;  2P0D A;  3A8Q A;  1AQC A;  1V61 A;  1X1G A;  1WJM A;  4K2P A;  3QBV B;  3CIK A;  4HAZ B;  5C5B B;  5C5B A;  3AJ4 A;  4NSW A;  5JLJ B;  1ISN A;  3ZVR A;  2LG1 A;  3PVL A;  4MK0 A;  1UPQ A;  2HTH B;  2VKI A;  4CHM A;  1PFJ A;  3SV1 A;  1BWN A;  5JHG A;  2D9Y A;  2AL6 A;  3FSS A;  3AU4 A;  4K81 A;  2DYN A;  1I2H A;  2COF A;  2GCL A;  4K2O A;  1I7A A;  2CY4 A;  4EMO A;  5JHH A;  2D9Z A;  1FGZ A;  4C0A A;  3ZDT A;  2YRY A;  1E5W A;  4MT7 A;  4Y94 A;  2Y8F A;  2RUK B;  4GMX B;  3PSC A;  4NY0 A;  2M14 A;  5D3Y A;  1TQZ A;  2ELB A;  1B55 A;  3PVW A;  1DRO A;  2NMB A;  1UNQ A;  2R09 A;  1K5D B;  3ODW A;  2YF0 A;  3PG7 A;  2DKP A;  1X1F A;  2D10 A;  3GYP A;  1ZSQ A;  2D9V A;  1KZ7 A;  2AEH A;  1DBH A;  3FM8 C;  1RRP B;  1W1H A;  2DTC A;  5CLL B;  3N7C A;  3HK0 A;  1IRS A;  1WJ1 A;  4IAP A;  5J3Y A;  1U5F A;  4DX9 0;  4YL8 A;  1NTV A;  5C6R A;  5KQ1 A;  2W2X C;  4DXA B;  2ROV A;  2H7D A;  2H7E A;  2RGN B;  2QKL A;  2N23 A;  1U5D A;  4HAY B;  2Q13 A;  2LOZ A;  3WYF B;  1P5T A; 
#chains in the Genus database with same CATH topology
 2DLW A;  2J0K A;  2BCJ A;  2VSZ A;  3D8E A;  3MDB C;  1V89 A;  4H8S A;  2ADZ A;  1DDW A;  2Z0Q A;  1NU2 A;  4F7G A;  5HE0 A;  4HB2 B;  2D2Q A;  2DX5 A;  4HAT B;  2DN6 A;  4ZRI A;  4HB0 B;  4F7U P;  1MK7 B;  2YSZ A;  2COD A;  3KZ1 A;  3TO1 A;  1BTN A;  5HE2 A;  3KY9 A;  3IVF A;  3D8D A;  3TFM A;  1EVH A;  3WA0 A;  1GG3 A;  2L1C A;  1UPR A;  2NBV A;  2YVC A;  1FHO A;  2FJU B;  1MAI A;  4A5K A;  5D3W A;  4EKU A;  2M38 A;  5FI0 A;  1NTY A;  3HW2 B;  5KQ4 A;  4YON A;  2YT1 A;  3TVV A;  1ZM0 A;  2J59 M;  2J0J A;  2EMT A;  2GUM A;  2X18 A;  2MWN B;  2W2W A;  3VIA A;  1U5E A;  2YS1 A;  3DXE A;  2DHI A;  3OAN A;  3SUZ A;  2DHK A;  2RRF A;  1RJ2 A;  4KAX B;  4XWX A;  4ZRK A;  4QJ4 B;  3PVU A;  5L81 A;  1X86 A;  2V76 A;  3KSY A;  2KGX B;  2EJ8 A;  2Z0P A;  5J3Q A;  3U8Z A;  1PMS A;  2I5C A;  3A98 B;  2DX1 A;  3PP2 A;  2D9X A;  2RSG A;  4F7H A;  2K2U A;  5DH9 B;  3FEH A;  4HDO A;  4HSI A;  1BTK A;  1LW3 A;  1MPH A;  4D6W A;  3QWM A;  1GC7 A;  3AU5 A;  2XQN M;  1OY2 A;  2Z59 A;  4GN1 A;  1FAO A;  1XKE A;  2Z4D A;  1FOE A;  1EGX A;  1FB8 A;  5DHA B;  1SGH A;  2ROZ B;  4Z2M B;  1J19 A;  1PLS A;  3FVC A;  2COA A;  5HE3 A;  2ZKM X;  1W1D A;  2P0F A;  2Z13 A;  3ULC A;  2KCJ A;  4MY6 A;  1FHW A;  3DXD A;  3QIJ A;  3SO6 A;  1XR0 B;  2D11 A;  4TYZ A;  2PZ1 A;  4A6K A;  3ULB A;  3KRW A;  3PEG A;  4HAW B;  2Z14 A;  1X05 A;  2J0M A;  3BJI A;  1U2B A;  1DYN A;  2P0H A;  3LJU X;  4GZU A;  2OTX A;  5HE1 A;  1XX0 A;  1J0W A;  1V5P A;  5JP4 A;  2LOX A;  5LON B;  1MIZ B;  1Y19 B;  2Y7B A;  3F5R A;  2EMS A;  2P8V A;  3BIN A;  2KUP A;  1U27 A;  4KHO A;  1LB1 A;  2EC1 A;  1K5G B;  2OQB A;  4QJ5 B;  1WGQ A;  4L6E A;  1OQN A;  4HB3 B;  5M4Y B;  2GCJ A;  1XOD A;  3PZD A;  4IFS A;  4KHA A;  2E2X A;  2K2J A;  3D8F A;  2GS0 A;  4B6H A;  3A8P A;  2NZ8 B;  2FJL A;  4BBK A;  2YS3 A;  3T06 A;  4HAX B;  4P7I A;  3VOQ A;  2D4Q A;  4HAU B;  2K8E A;  4PQ0 A;  3ODO A;  4WVF B;  5I2M A;  3P6A A;  2DHJ A;  4KHB B;  1U5G A;  1P6S A;  1N3H A;  3NWD A;  4KHB A;  5J3T A;  1H10 A;  1KZG A;  3M1I B;  2LUL A;  5EFX A;  2Y8G A;  2IFS A;  5I2S A;  1X11 A;  2HE7 A;  2MDX A;  4HHV A;  3G9W A;  1ZC3 B;  3NWA A;  5DHF B;  5D27 A;  5C79 A;  2KIG A;  3HIE A;  4CYE A;  2JP2 A;  4WSF A;  2IYB A;  1EF1 A;  2UZR A;  4CHJ A;  2D9W A;  2I1J A;  3RCP A;  4IOY X;  5FI1 A;  3KRX A;  2DFK A;  2CRF A;  4D0N B;  3SYX A;  1W1G A;  2MFQ A;  4TKN A;  4GMV A;  1Q67 A;  3U12 A;  4K17 A;  1ZVR A;  2CY5 A;  4GOU A;  5D3X A;  4GXB A;  1EAZ A;  4ZRJ A;  3UZT A;  1TJ6 A;  5DI9 B;  1BAK A;  3GYO A;  1V88 A;  4HDQ A;  5C16 A;  2L2I A;  1M7R A;  2N0Y A;  5LOP B;  1WVH A;  4KVG B;  2RVB B;  4WJ7 A;  4DBB A;  1UEF A;  2W2X D;  5D3V A;  1KI1 B;  1FGY A;  4A6H A;  2UVM A;  1GC6 A;  3V5W A;  3NW8 A;  1MIX A;  1MI1 A;  2UZS A;  2KIE A;  1U29 A;  5DIF B;  2CAY A;  1WI1 A;  2DA0 A;  2I1K A;  3ODX A;  2COC A;  1WG7 A;  4Z2N A;  2DKQ A;  1H4R A;  3CXB B;  1XCG A;  4QJ3 B;  2ZPY A;  3TW1 A;  4PNK A;  3HSA A;  2DYQ A;  3HQC A;  1V5U A;  3TCA A;  2GJY A;  3F0W A;  3NSU A;  1QQG A;  4HAV B;  2YS5 A;  3SNH A;  3A58 A;  2ELA A;  1TXD A;  2MKR A;  1M7E A;  1UNR A;  3U7D A;  3O96 A;  4DX8 A;  1Y5O A;  3X23 A;  1FHX A;  1QC6 A;  1ZC4 B;  2G35 A;  1SHC A;  3ML4 A;  5GOW B;  1Z87 A;  2R0D A;  5KCV A;  2RLO A;  3MPX A;  5CLQ B;  2I5F A;  2K00 A;  1NI2 A;  2YT0 A;  3DXC A;  3P7Z A;  1WGU A;  1T77 A;  1P3R A;  5LG4 B;  2Z0O A;  1DDM A;  1UNP A;  1DDV A;  1XD4 A;  4A6F B;  2R2Y A;  3NWF A;  2RNR B;  2LKO A;  4A6F A;  1MKE A;  2VRW B;  2LYD A;  4GPT B;  1OMW A;  1V5M A;  1AWE A;  1MK9 B;  4HB4 B;  4EJN A;  2QKM A;  2P0D A;  3A8Q A;  1AQC A;  5IRS A;  1V61 A;  1X1G A;  1WJM A;  3DCX A;  4K2P A;  3QBV B;  3CIK A;  4HAZ B;  5C5B B;  5C5B A;  3AJ4 A;  4OT1 A;  4NSW A;  5JLJ B;  1ISN A;  3ZVR A;  2LG1 A;  3PVL A;  4MK0 A;  1UPQ A;  2HTH B;  2VKI A;  2KUQ A;  4CHM A;  1PFJ A;  3SV1 A;  1BWN A;  5JHG A;  2D9Y A;  2AL6 A;  3FSS A;  3B77 A;  3AU4 A;  1ZYI A;  4K81 A;  2DYN A;  1I2H A;  2COF A;  2GCL A;  4K2O A;  1I7A A;  2CY4 A;  4EMO A;  5JHH A;  2D9Z A;  2KR0 A;  1FGZ A;  4C0A A;  3ZDT A;  2YRY A;  1E5W A;  4MT7 A;  4Y94 A;  2Y8F A;  2RUK B;  4GMX B;  3PSC A;  4NY0 A;  2M14 A;  5D3Y A;  1TQZ A;  4L1R A;  2ELB A;  1B55 A;  3PVW A;  1DRO A;  2NMB A;  1UNQ A;  2R09 A;  1K5D B;  3ODW A;  2YF0 A;  3PG7 A;  2DKP A;  1X1F A;  2D10 A;  3GYP A;  1ZSQ A;  2D9V A;  1KZ7 A;  2AEH A;  1DBH A;  3FM8 C;  1RRP B;  1W1H A;  2DTC A;  4GNK B;  3N7C A;  5CLL B;  3OHM B;  3HK0 A;  4QXA B;  1IRS A;  1WJ1 A;  4IAP A;  5J3Y A;  1U5F A;  4DX9 0;  4YL8 A;  1NTV A;  5C6R A;  5KQ1 A;  2YT2 A;  2W2X C;  4CSQ A;  4DXA B;  2ROV A;  2H7D A;  2H7E A;  2RGN B;  2QKL A;  4DIX A;  4OSN A;  2N23 A;  1U5D A;  4HAY B;  2Q13 A;  2LOZ A;  2K49 A;  3WYF B;  1P5T A; 
#chains in the Genus database with same CATH homology
 2DLW A;  2J0K A;  2BCJ A;  2VSZ A;  3D8E A;  3MDB C;  1V89 A;  4H8S A;  2ADZ A;  1DDW A;  2Z0Q A;  1NU2 A;  4F7G A;  5HE0 A;  4HB2 B;  2D2Q A;  2DX5 A;  4HAT B;  2DN6 A;  4ZRI A;  4HB0 B;  4F7U P;  1MK7 B;  2YSZ A;  2COD A;  3KZ1 A;  3TO1 A;  1BTN A;  5HE2 A;  3KY9 A;  3IVF A;  3D8D A;  3TFM A;  1EVH A;  3WA0 A;  1GG3 A;  2L1C A;  1UPR A;  2YVC A;  1FHO A;  1MAI A;  4A5K A;  5D3W A;  4EKU A;  2M38 A;  5FI0 A;  1NTY A;  3HW2 B;  5KQ4 A;  4YON A;  2YT1 A;  3TVV A;  1ZM0 A;  2J59 M;  2J0J A;  2EMT A;  2MWN B;  2X18 A;  2W2W A;  3VIA A;  1U5E A;  2YS1 A;  3DXE A;  2DHI A;  3OAN A;  3SUZ A;  2DHK A;  1RJ2 A;  4KAX B;  4XWX A;  4ZRK A;  3PVU A;  5L81 A;  1X86 A;  2V76 A;  3KSY A;  2KGX B;  2EJ8 A;  2Z0P A;  5J3Q A;  3U8Z A;  1PMS A;  2I5C A;  3A98 B;  2DX1 A;  3PP2 A;  2D9X A;  2RSG A;  4F7H A;  2K2U A;  5DH9 B;  3FEH A;  4HDO A;  1BTK A;  1LW3 A;  1MPH A;  3QWM A;  1GC7 A;  3AU5 A;  2XQN M;  1OY2 A;  4GN1 A;  1FAO A;  1XKE A;  1FOE A;  1EGX A;  1FB8 A;  5DHA B;  1SGH A;  2ROZ B;  4Z2M B;  1J19 A;  1PLS A;  2COA A;  5HE3 A;  1W1D A;  2P0F A;  3ULC A;  2KCJ A;  4MY6 A;  1FHW A;  3DXD A;  3QIJ A;  3SO6 A;  1XR0 B;  2D11 A;  4TYZ A;  2PZ1 A;  4A6K A;  3ULB A;  3KRW A;  3PEG A;  4HAW B;  1X05 A;  2J0M A;  3BJI A;  1U2B A;  1DYN A;  2P0H A;  3LJU X;  4GZU A;  2OTX A;  5HE1 A;  1XX0 A;  1J0W A;  1V5P A;  5JP4 A;  2LOX A;  5LON B;  1MIZ B;  1Y19 B;  2Y7B A;  3F5R A;  2EMS A;  2P8V A;  3BIN A;  2KUP A;  1U27 A;  4KHO A;  1LB1 A;  2EC1 A;  1K5G B;  2OQB A;  1WGQ A;  4L6E A;  1OQN A;  4HB3 B;  2GCJ A;  1XOD A;  3PZD A;  4IFS A;  4KHA A;  2E2X A;  2K2J A;  3D8F A;  2GS0 A;  4B6H A;  3A8P A;  2NZ8 B;  2FJL A;  4BBK A;  2YS3 A;  3T06 A;  4HAX B;  4P7I A;  3VOQ A;  2D4Q A;  4HAU B;  4PQ0 A;  3ODO A;  4WVF B;  3P6A A;  2DHJ A;  4KHB B;  1U5G A;  1P6S A;  1N3H A;  5J3T A;  1H10 A;  1KZG A;  3M1I B;  2LUL A;  5EFX A;  2Y8G A;  2IFS A;  1X11 A;  2HE7 A;  2MDX A;  4HHV A;  3G9W A;  1ZC3 B;  5DHF B;  5D27 A;  5C79 A;  4CYE A;  2JP2 A;  4WSF A;  2IYB A;  1EF1 A;  2UZR A;  4CHJ A;  2D9W A;  2I1J A;  3RCP A;  4IOY X;  5FI1 A;  3KRX A;  2DFK A;  2CRF A;  4D0N B;  3SYX A;  1W1G A;  2MFQ A;  4TKN A;  4GMV A;  1Q67 A;  4K17 A;  1ZVR A;  2CY5 A;  5D3X A;  4GXB A;  1EAZ A;  4ZRJ A;  3UZT A;  1TJ6 A;  5DI9 B;  1BAK A;  3GYO A;  1V88 A;  4HDQ A;  5C16 A;  2L2I A;  1M7R A;  2N0Y A;  5LOP B;  1WVH A;  4KVG B;  2RVB B;  4WJ7 A;  4DBB A;  1UEF A;  2W2X D;  5D3V A;  1KI1 B;  1FGY A;  4A6H A;  2UVM A;  1GC6 A;  3V5W A;  1MIX A;  2UZS A;  1U29 A;  5DIF B;  2CAY A;  1WI1 A;  2DA0 A;  2I1K A;  3ODX A;  2COC A;  1WG7 A;  4Z2N A;  2DKQ A;  1H4R A;  3CXB B;  1XCG A;  2ZPY A;  3TW1 A;  4PNK A;  2DYQ A;  3HQC A;  1V5U A;  3TCA A;  2GJY A;  3F0W A;  3NSU A;  1QQG A;  4HAV B;  2YS5 A;  3SNH A;  2ELA A;  1TXD A;  2MKR A;  1M7E A;  1UNR A;  3U7D A;  3O96 A;  4DX8 A;  1Y5O A;  3X23 A;  1FHX A;  1QC6 A;  1ZC4 B;  2G35 A;  1SHC A;  3ML4 A;  5GOW B;  1Z87 A;  2R0D A;  5KCV A;  2RLO A;  3MPX A;  5CLQ B;  2I5F A;  2K00 A;  1NI2 A;  2YT0 A;  3DXC A;  3P7Z A;  1WGU A;  1P3R A;  2Z0O A;  1DDM A;  1UNP A;  1DDV A;  1XD4 A;  4A6F B;  2RNR B;  2LKO A;  4A6F A;  1MKE A;  2VRW B;  2LYD A;  4GPT B;  1OMW A;  1V5M A;  1AWE A;  1MK9 B;  4HB4 B;  4EJN A;  2QKM A;  2P0D A;  3A8Q A;  1AQC A;  1V61 A;  1X1G A;  1WJM A;  4K2P A;  3QBV B;  3CIK A;  4HAZ B;  5C5B B;  5C5B A;  3AJ4 A;  4NSW A;  5JLJ B;  1ISN A;  3ZVR A;  2LG1 A;  3PVL A;  4MK0 A;  1UPQ A;  2HTH B;  2VKI A;  4CHM A;  1PFJ A;  3SV1 A;  1BWN A;  5JHG A;  2D9Y A;  2AL6 A;  3FSS A;  3AU4 A;  4K81 A;  2DYN A;  1I2H A;  2COF A;  2GCL A;  4K2O A;  1I7A A;  2CY4 A;  4EMO A;  5JHH A;  2D9Z A;  1FGZ A;  4C0A A;  3ZDT A;  2YRY A;  1E5W A;  4MT7 A;  4Y94 A;  2Y8F A;  2RUK B;  4GMX B;  3PSC A;  4NY0 A;  2M14 A;  5D3Y A;  1TQZ A;  2ELB A;  1B55 A;  3PVW A;  1DRO A;  2NMB A;  1UNQ A;  2R09 A;  1K5D B;  3ODW A;  2YF0 A;  3PG7 A;  2DKP A;  1X1F A;  2D10 A;  3GYP A;  1ZSQ A;  2D9V A;  1KZ7 A;  2AEH A;  1DBH A;  3FM8 C;  1RRP B;  1W1H A;  2DTC A;  5CLL B;  3N7C A;  3HK0 A;  1IRS A;  1WJ1 A;  4IAP A;  5J3Y A;  1U5F A;  4DX9 0;  4YL8 A;  1NTV A;  5C6R A;  5KQ1 A;  2W2X C;  4DXA B;  2ROV A;  2H7D A;  2H7E A;  2RGN B;  2QKL A;  2N23 A;  1U5D A;  4HAY B;  2Q13 A;  2LOZ A;  3WYF B;  1P5T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...