3WYFB

Crystal structure of xpo1p-yrb2p-gsp1p-gtp complex
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
229
structure length
144
Chain Sequence
KFVFGAASKFGTGFAFGSGLSFGSGFNILLQKQEVKSGEESEECIYQVNAKLYQLSNEGWKERGVGIIKINKSKDKTRIVMRSRGILKVILNIQLVKGFTVQKGFTGSLQSEKFIRLLAVDAQYAIKTKKETTDELYNIIVKSV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Gsp1p
publication title Structural insights into how yrb2p accelerates the assembly of the xpo1p nuclear export complex
pubmed doi rcsb
source organism Saccharomyces cerevisiae awri796
molecule tags Gtp-binding protein/gtp-binding protein inhibitor
total genus 24
structure length 144
sequence length 229
chains with identical sequence E
ec nomenclature
pdb deposition date 2014-08-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00638 Ran_BP1 RanBP1 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 3wyfB00
1U2BA 2DKPA 4BBKA 4ZRIA 3TW1A 1H10A 1U5EA 3D8EA 4F7UP 4GZUA 2EMSA 4MY6A 1UNQA 1M7EA 4HB0B 4IOYX 4K2OA 2M38A 1FHWA 2K2JA 3ULBA 4HB3B 1I7AA 5JHGA 2ZPYA 3SYXA 4F7HA 2LOXA 1ISNA 2CRFA 1NU2A 2UZSA 4GPTB 5DIFB 2HTHB 5LONB 3DXCA 2L2IA 4ZRJA 4A6HA 5JP4A 2X18A 2YS1A 2LKOA 1WGUA 1ZC3B 2DHJA 1MK7B 4NSWA 5KQ1A 2YS5A 4CHMA 4K81A 4XWXA 5DI9B 4WSFA 1TXDA 1N3HA 1XCGA 4IFSA 2IYBA 3A98B 1OY2A 1PLSA 3KZ1A 1Y19B 1WGQA 2E2XA 4WVFB 1MIZB 4KAXB 3VOQA 2K00A 3D8DA 1W1DA 1XKEA 5J3QA 3ZDTA 5FI1A 2DKQA 5HE3A 1AQCA 3ML4A 3GYPA 3PEGA 4A6KA 1X86A 4HAVB 2OQBA 2NZ8B 2COCA 3G9WA 1U27A 2N23A 1LB1A 2FJLA 4GXBA 2ELBA 4HDQA 1OQNA 2CY5A 1EAZA 2Y8FA 4HAUB 2CY4A 2YRYA 4HDOA 1FOEA 1I2HA 3TO1A 2N0YA 4MT7A 5JLJB 3KSYA 3RCPA 3F0WA 4GN1A 3AU5A 2YSZA 1SGHA 3KRWA 3VIAA 2MWNB 1AWEA 1B55A 3QIJA 4P7IA 1ZSQA 4NY0A 3PSCA 2Y7BA 2D9YA 1W1GA 2RLOA 3SNHA 2DFKA 3AU4A 5KQ4A 2IFSA 4WJ7A 1XD4A 3ZVRA 4D0NB 4IAPA 1DDVA 1LW3A 2Z0OA 1NTVA 1Z87A 1U5GA 4CYEA 1UNRA 5JHHA 4HAXB 4B6HA 1FGZA 4HAWB 3KY9A 2YVCA 1RRPB 3HK0A 4HAZB 1QQGA 4GMVA 3PVLA 2DTCA 4YONA 1K5DB 2CODA 2J0JA 1P5TA 2DHKA 2J0KA 2COAA 2KCJA 2EC1A 2VKIA 1V89A 5DH9B 1MKEA 4HATB 2I5FA 4KHAA 2D10A 2D9VA 4K2PA 1BTKA 3V5WA 1FAOA 1GG3A 1H4RA 2L1CA 2LYDA 1UPQA 2MDXA 2GCJA 2YS3A 5HE0A 4EMOA 1PFJA 2GCLA 1MIXA 3FEHA 3WYFB 3BINA 2RGNB 3ODXA 2DN6A 2BCJA 1OMWA 1FB8A 3TVVA 2HE7A 1BAKA 2QKMA 1FHXA 2DHIA 3SUZA 1U5FA 2RNRB 2EMTA 1V88A 1XX0A 5L81A 2Y8GA 2DYNA 4HB2B 4HB4B 4MK0A 1M7RA 1XODA 1BTNA 2D4QA 1KZGA 2CAYA 1DDWA 3D8FA 1W1HA 4Y94A 3A8QA 3X23A 3QWMA 3F5RA 3KRXA 1GC6A 4HAYB 1P6SA 2GS0A 2K2UA 3IVFA 2MKRA 3P6AA 2D9ZA 2ROZB 5C5BB 3UZTA 1WVHA 1X1GA 2JP2A 2PZ1A 3PG7A 3A8PA 1P3RA 5J3YA 2RSGA 1E5WA 4KHOA 2DLWA 4C0AA 4TYZA 2LULA 5D3WA 3U8ZA 2I5CA 3P7ZA 1UNPA 3MPXA 1NTYA 4H8SA 2H7EA 5EFXA 1Y5OA 5DHAB 1U29A 1DBHA 1MPHA 3U7DA 2D9XA 1V5MA 1SHCA 3ODOA 2I1KA 3NSUA 2EJ8A 2R09A 4YL8A 4EJNA 2D11A 2KUPA 4L6EA 5C5BA 3MDBC 5C6RA 5LOPB 4A5KA 4EKUA 2W2WA 1TQZA 3QBVB 2AEHA 3OANA 2YF0A 2LG1A 1XR0B 1WI1A 1UPRA 2DA0A 2Q13A 3ODWA 2KGXB 1EVHA 2RUKB 3PVUA 4F7GA 3SO6A 2GJYA 4Z2NA 3LJUX 1WJMA 1FGYA 4DBBA 4ZRKA 4PNKA 1DDMA 2D9WA 5C16A 2XQNM 1NI2A 2W2XD 3FSSA 1ZVRA 5D3VA 1X11A 1V61A 3PVWA 5HE1A 3T06A 1KZ7A 4DXAB 3FM8C 3PP2A 2LOZA 4PQ0A 1GC7A 1WJ1A 3M1IB 4HHVA 4K17A 2W2XC 5D3YA 3TFMA 2ROVA 2Z0PA 2P0FA 1DYNA 3PZDA 3HQCA 1V5PA 5KCVA 2H7DA 1EGXA 2AL6A 2G35A 2ADZA 1UEFA 2P8VA 5GOWB 3N7CA 5CLQB 1J0WA 3TCAA 4Z2MB 1K5GB 2YT1A 1ZM0A 1ZC4B 5J3TA 5D27A 1X1FA 2DYQA 3HW2B 3GYOA 2I1JA 2DX1A 5CLLB 3WA0A 2P0DA 3CXBB 1PMSA 1MK9B 2UVMA 4GMXB 2J59M 2COFA 3SV1A 1DROA 5D3XA 1KI1B 2OTXA 4A6FB 1EF1A 1WG7A 2NMBA 4TKNA 2P0HA 1FHOA 2ELAA 5C79A 1TJ6A 1IRSA 1Q67A 2J0MA 2MFQA 4KHBB 5HE2A 2QKLA 4DX8A 3DXDA 1BWNA 2D2QA 1MAIA 4KVGB 1J19A 1QC6A 1X05A 4CHJA 3CIKA 3BJIA 3AJ4A 2YT0A 2R0DA 3ULCA 2RVBB 2DX5A 3DXEA 2V76A 1V5UA 5DHFB 1U5DA 2UZRA 2Z0QA 2VRWB 4A6FA 2VSZA 5FI0A 2M14A 4DX90 1RJ2A 3O96A
chains in the Genus database with same CATH superfamily
1U2BA 2DKPA 4KHBA 4BBKA 4ZRIA 3TW1A 1H10A 1U5EA 3D8EA 4F7UP 4GZUA 2EMSA 4MY6A 1UNQA 3NWDA 1M7EA 4HB0B 4IOYX 4K2OA 2M38A 1FHWA 2K2JA 3ULBA 5LG4B 2Z4DA 4HB3B 1I7AA 5JHGA 2ZPYA 3SYXA 4F7HA 2LOXA 1ISNA 2CRFA 1NU2A 3NWAA 2UZSA 4GPTB 5DIFB 2HTHB 5LONB 3DXCA 2L2IA 4ZRJA 4A6HA 5JP4A 2X18A 2YS1A 2LKOA 1WGUA 1ZC3B 2DHJA 1MK7B 4NSWA 5KQ1A 2YS5A 4CHMA 4K81A 4XWXA 5DI9B 4WSFA 1TXDA 1N3HA 1XCGA 4IFSA 2IYBA 3A98B 3HIEA 1OY2A 4HSIA 2GUMA 1PLSA 3KZ1A 1Y19B 1WGQA 2E2XA 4WVFB 1MIZB 4KAXB 3VOQA 2K00A 3D8DA 1W1DA 1XKEA 5J3QA 2K8EA 3ZDTA 5FI1A 2DKQA 5HE3A 1AQCA 3ML4A 3GYPA 3PEGA 4A6KA 2FJUB 1X86A 4HAVB 2OQBA 2NZ8B 2COCA 3G9WA 1U27A 2N23A 1LB1A 2FJLA 4GXBA 2ELBA 4HDQA 1OQNA 2CY5A 1EAZA 2Y8FA 4HAUB 2CY4A 2YRYA 4HDOA 5I2SA 1FOEA 1I2HA 3TO1A 4D6WA 2YT2A 2N0YA 4MT7A 5JLJB 3KSYA 3RCPA 3F0WA 4GN1A 3AU5A 2KUQA 2YSZA 1SGHA 3KRWA 3VIAA 2MWNB 1AWEA 4QJ5B 1B55A 3QIJA 4P7IA 3B77A 3NWFA 1ZSQA 4NY0A 3PSCA 2Y7BA 2D9YA 1W1GA 2RLOA 3SNHA 3A58A 4QJ4B 2DFKA 3AU4A 5KQ4A 2IFSA 4WJ7A 1XD4A 3ZVRA 4D0NB 4IAPA 1DDVA 1LW3A 2Z0OA 4L1RA 1NTVA 1Z87A 1U5GA 4CYEA 1UNRA 5JHHA 4HAXB 4B6HA 1FGZA 4HAWB 3KY9A 2YVCA 1RRPB 3HK0A 4HAZB 1QQGA 4GMVA 3PVLA 2DTCA 4YONA 1K5DB 2CODA 2J0JA 1P5TA 2DHKA 2J0KA 2COAA 2KCJA 2EC1A 2VKIA 1V89A 5DH9B 1MKEA 4HATB 2I5FA 4KHAA 2D10A 2D9VA 4K2PA 1BTKA 5IRSA 3V5WA 1FAOA 1GG3A 1H4RA 2L1CA 2LYDA 1UPQA 2MDXA 2R2YA 2KIGA 2GCJA 2YS3A 4OSNA 5HE0A 4EMOA 1PFJA 2GCLA 1MIXA 3FEHA 3HSAA 3WYFB 3BINA 2RGNB 3ODXA 2DN6A 5M4YB 2BCJA 1OMWA 1FB8A 3TVVA 2HE7A 1BAKA 2QKMA 1FHXA 2DHIA 3SUZA 1U5FA 2RNRB 2EMTA 1V88A 1XX0A 5L81A 2Y8GA 2DYNA 4HB2B 4HB4B 4OT1A 4MK0A 1M7RA 1XODA 1BTNA 2D4QA 1KZGA 2CAYA 1DDWA 3D8FA 1W1HA 4Y94A 3A8QA 3X23A 3QWMA 3F5RA 3KRXA 1GC6A 4QXAB 4HAYB 3U12A 1P6SA 2GS0A 2K2UA 3IVFA 2MKRA 3P6AA 2D9ZA 2ROZB 5C5BB 3FVCA 3UZTA 1WVHA 1X1GA 2JP2A 2PZ1A 3PG7A 3A8PA 1P3RA 5J3YA 1ZYIA 2RSGA 1E5WA 4KHOA 2DLWA 4C0AA 4TYZA 2NBVA 2LULA 5D3WA 3U8ZA 2I5CA 3P7ZA 1UNPA 3MPXA 1NTYA 4H8SA 2H7EA 5EFXA 1Y5OA 5DHAB 1U29A 1DBHA 1MPHA 3U7DA 2D9XA 1V5MA 1SHCA 3ODOA 2I1KA 3NSUA 2EJ8A 2R09A 4YL8A 4EJNA 2D11A 2KUPA 4L6EA 5C5BA 3MDBC 5C6RA 2KIEA 5LOPB 2KR0A 4A5KA 4EKUA 2W2WA 1TQZA 3QBVB 2AEHA 3OANA 2YF0A 2LG1A 1XR0B 1WI1A 1UPRA 2DA0A 2Q13A 3ODWA 4DIXA 2KGXB 1EVHA 2RUKB 3PVUA 4F7GA 3SO6A 2GJYA 4Z2NA 3LJUX 1WJMA 1MI1A 1FGYA 4DBBA 4ZRKA 4PNKA 1DDMA 2D9WA 5C16A 2XQNM 1NI2A 2W2XD 3FSSA 1ZVRA 5D3VA 1X11A 1V61A 3PVWA 5HE1A 5I2MA 3T06A 1KZ7A 2Z14A 4DXAB 3FM8C 3PP2A 2LOZA 4PQ0A 1GC7A 4GNKB 1WJ1A 3M1IB 2Z13A 4HHVA 4K17A 2W2XC 5D3YA 3TFMA 2ROVA 2Z0PA 2P0FA 1DYNA 3PZDA 3HQCA 1V5PA 5KCVA 2H7DA 1EGXA 2AL6A 2G35A 2ADZA 1UEFA 2P8VA 5GOWB 3N7CA 5CLQB 1J0WA 3TCAA 4Z2MB 1K5GB 2YT1A 3DCXA 1ZM0A 1ZC4B 5J3TA 2ZKMX 5D27A 1X1FA 2DYQA 3HW2B 3GYOA 2I1JA 2DX1A 5CLLB 3WA0A 2P0DA 3CXBB 1PMSA 1MK9B 2UVMA 4GMXB 2J59M 2COFA 3SV1A 1DROA 5D3XA 1KI1B 3OHMB 2OTXA 4A6FB 1EF1A 1WG7A 1T77A 2NMBA 4TKNA 2P0HA 1FHOA 2ELAA 5C79A 1TJ6A 1IRSA 1Q67A 2J0MA 2MFQA 4KHBB 4GOUA 5HE2A 2QKLA 4DX8A 4QJ3B 3DXDA 1BWNA 3NW8A 2D2QA 2Z59A 1MAIA 2K49A 4KVGB 4CSQA 1J19A 1QC6A 1X05A 4CHJA 3CIKA 3BJIA 3AJ4A 2YT0A 2R0DA 3ULCA 2RVBB 2DX5A 3DXEA 2V76A 1V5UA 5DHFB 1U5DA 2UZRA 2Z0QA 2VRWB 4A6FA 2VSZA 5FI0A 2M14A 4DX90 1RJ2A 3O96A 2RRFA
chains in the Genus database with same CATH topology
1U2BA 2DKPA 4BBKA 4ZRIA 3TW1A 1H10A 1U5EA 3D8EA 4F7UP 4GZUA 2EMSA 4MY6A 1UNQA 1M7EA 4HB0B 4IOYX 4K2OA 2M38A 1FHWA 2K2JA 3ULBA 4HB3B 1I7AA 5JHGA 2ZPYA 3SYXA 4F7HA 2LOXA 1ISNA 2CRFA 1NU2A 2UZSA 4GPTB 5DIFB 2HTHB 5LONB 3DXCA 2L2IA 4ZRJA 4A6HA 5JP4A 2X18A 2YS1A 2LKOA 1WGUA 1ZC3B 2DHJA 1MK7B 4NSWA 5KQ1A 2YS5A 4CHMA 4K81A 4XWXA 5DI9B 4WSFA 1TXDA 1N3HA 1XCGA 4IFSA 2IYBA 3A98B 1OY2A 1PLSA 3KZ1A 1Y19B 1WGQA 2E2XA 4WVFB 1MIZB 4KAXB 3VOQA 2K00A 3D8DA 1W1DA 1XKEA 5J3QA 3ZDTA 5FI1A 2DKQA 5HE3A 1AQCA 3ML4A 3GYPA 3PEGA 4A6KA 1X86A 4HAVB 2OQBA 2NZ8B 2COCA 3G9WA 1U27A 2N23A 1LB1A 2FJLA 4GXBA 2ELBA 4HDQA 1OQNA 2CY5A 1EAZA 2Y8FA 4HAUB 2CY4A 2YRYA 4HDOA 1FOEA 1I2HA 3TO1A 2N0YA 4MT7A 5JLJB 3KSYA 3RCPA 3F0WA 4GN1A 3AU5A 2YSZA 1SGHA 3KRWA 3VIAA 2MWNB 1AWEA 1B55A 3QIJA 4P7IA 1ZSQA 4NY0A 3PSCA 2Y7BA 2D9YA 1W1GA 2RLOA 3SNHA 2DFKA 3AU4A 5KQ4A 2IFSA 4WJ7A 1XD4A 3ZVRA 4D0NB 4IAPA 1DDVA 1LW3A 2Z0OA 1NTVA 1Z87A 1U5GA 4CYEA 1UNRA 5JHHA 4HAXB 4B6HA 1FGZA 4HAWB 3KY9A 2YVCA 1RRPB 3HK0A 4HAZB 1QQGA 4GMVA 3PVLA 2DTCA 4YONA 1K5DB 2CODA 2J0JA 1P5TA 2DHKA 2J0KA 2COAA 2KCJA 2EC1A 2VKIA 1V89A 5DH9B 1MKEA 4HATB 2I5FA 4KHAA 2D10A 2D9VA 4K2PA 1BTKA 3V5WA 1FAOA 1GG3A 1H4RA 2L1CA 2LYDA 1UPQA 2MDXA 2GCJA 2YS3A 5HE0A 4EMOA 1PFJA 2GCLA 1MIXA 3FEHA 3WYFB 3BINA 2RGNB 3ODXA 2DN6A 2BCJA 1OMWA 1FB8A 3TVVA 2HE7A 1BAKA 2QKMA 1FHXA 2DHIA 3SUZA 1U5FA 2RNRB 2EMTA 1V88A 1XX0A 5L81A 2Y8GA 2DYNA 4HB2B 4HB4B 4MK0A 1M7RA 1XODA 1BTNA 2D4QA 1KZGA 2CAYA 1DDWA 3D8FA 1W1HA 4Y94A 3A8QA 3X23A 3QWMA 3F5RA 3KRXA 1GC6A 4HAYB 1P6SA 2GS0A 2K2UA 3IVFA 2MKRA 3P6AA 2D9ZA 2ROZB 5C5BB 3UZTA 1WVHA 1X1GA 2JP2A 2PZ1A 3PG7A 3A8PA 1P3RA 5J3YA 2RSGA 1E5WA 4KHOA 2DLWA 4C0AA 4TYZA 2LULA 5D3WA 3U8ZA 2I5CA 3P7ZA 1UNPA 3MPXA 1NTYA 4H8SA 2H7EA 5EFXA 1Y5OA 5DHAB 1U29A 1DBHA 1MPHA 3U7DA 2D9XA 1V5MA 1SHCA 3ODOA 2I1KA 3NSUA 2EJ8A 2R09A 4YL8A 4EJNA 2D11A 2KUPA 4L6EA 5C5BA 3MDBC 5C6RA 5LOPB 4A5KA 4EKUA 2W2WA 1TQZA 3QBVB 2AEHA 3OANA 2YF0A 2LG1A 1XR0B 1WI1A 1UPRA 2DA0A 2Q13A 3ODWA 2KGXB 1EVHA 2RUKB 3PVUA 4F7GA 3SO6A 2GJYA 4Z2NA 3LJUX 1WJMA 1FGYA 4DBBA 4ZRKA 4PNKA 1DDMA 2D9WA 5C16A 2XQNM 1NI2A 2W2XD 3FSSA 1ZVRA 5D3VA 1X11A 1V61A 3PVWA 5HE1A 3T06A 1KZ7A 4DXAB 3FM8C 3PP2A 2LOZA 4PQ0A 1GC7A 1WJ1A 3M1IB 4HHVA 4K17A 2W2XC 5D3YA 3TFMA 2ROVA 2Z0PA 2P0FA 1DYNA 3PZDA 3HQCA 1V5PA 5KCVA 2H7DA 1EGXA 2AL6A 2G35A 2ADZA 1UEFA 2P8VA 5GOWB 3N7CA 5CLQB 1J0WA 3TCAA 4Z2MB 1K5GB 2YT1A 1ZM0A 1ZC4B 5J3TA 5D27A 1X1FA 2DYQA 3HW2B 3GYOA 2I1JA 2DX1A 5CLLB 3WA0A 2P0DA 3CXBB 1PMSA 1MK9B 2UVMA 4GMXB 2J59M 2COFA 3SV1A 1DROA 5D3XA 1KI1B 2OTXA 4A6FB 1EF1A 1WG7A 2NMBA 4TKNA 2P0HA 1FHOA 2ELAA 5C79A 1TJ6A 1IRSA 1Q67A 2J0MA 2MFQA 4KHBB 5HE2A 2QKLA 4DX8A 3DXDA 1BWNA 2D2QA 1MAIA 4KVGB 1J19A 1QC6A 1X05A 4CHJA 3CIKA 3BJIA 3AJ4A 2YT0A 2R0DA 3ULCA 2RVBB 2DX5A 3DXEA 2V76A 1V5UA 5DHFB 1U5DA 2UZRA 2Z0QA 2VRWB 4A6FA 2VSZA 5FI0A 2M14A 4DX90 1RJ2A 3O96A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1U2B A;  2DKP A;  4BBK A;  4ZRI A;  3TW1 A;  1H10 A;  1U5E A;  3D8E A;  4F7U P;  4GZU A;  2EMS A;  4MY6 A;  1UNQ A;  1M7E A;  4HB0 B;  4IOY X;  4K2O A;  2M38 A;  1FHW A;  2K2J A;  3ULB A;  4HB3 B;  1I7A A;  5JHG A;  2ZPY A;  3SYX A;  4F7H A;  2LOX A;  1ISN A;  2CRF A;  1NU2 A;  2UZS A;  4GPT B;  5DIF B;  2HTH B;  5LON B;  3DXC A;  2L2I A;  4ZRJ A;  4A6H A;  5JP4 A;  2X18 A;  2YS1 A;  2LKO A;  1WGU A;  1ZC3 B;  2DHJ A;  1MK7 B;  4NSW A;  5KQ1 A;  2YS5 A;  4CHM A;  4K81 A;  4XWX A;  5DI9 B;  4WSF A;  1TXD A;  1N3H A;  1XCG A;  4IFS A;  2IYB A;  3A98 B;  1OY2 A;  1PLS A;  3KZ1 A;  1Y19 B;  1WGQ A;  2E2X A;  4WVF B;  1MIZ B;  4KAX B;  3VOQ A;  2K00 A;  3D8D A;  1W1D A;  1XKE A;  5J3Q A;  3ZDT A;  5FI1 A;  2DKQ A;  5HE3 A;  1AQC A;  3ML4 A;  3GYP A;  3PEG A;  4A6K A;  1X86 A;  4HAV B;  2OQB A;  2NZ8 B;  2COC A;  3G9W A;  1U27 A;  2N23 A;  1LB1 A;  2FJL A;  4GXB A;  2ELB A;  4HDQ A;  1OQN A;  2CY5 A;  1EAZ A;  2Y8F A;  4HAU B;  2CY4 A;  2YRY A;  4HDO A;  1FOE A;  1I2H A;  3TO1 A;  2N0Y A;  4MT7 A;  5JLJ B;  3KSY A;  3RCP A;  3F0W A;  4GN1 A;  3AU5 A;  2YSZ A;  1SGH A;  3KRW A;  3VIA A;  2MWN B;  1AWE A;  1B55 A;  3QIJ A;  4P7I A;  1ZSQ A;  4NY0 A;  3PSC A;  2Y7B A;  2D9Y A;  1W1G A;  2RLO A;  3SNH A;  2DFK A;  3AU4 A;  5KQ4 A;  2IFS A;  4WJ7 A;  1XD4 A;  3ZVR A;  4D0N B;  4IAP A;  1DDV A;  1LW3 A;  2Z0O A;  1NTV A;  1Z87 A;  1U5G A;  4CYE A;  1UNR A;  5JHH A;  4HAX B;  4B6H A;  1FGZ A;  4HAW B;  3KY9 A;  2YVC A;  1RRP B;  3HK0 A;  4HAZ B;  1QQG A;  4GMV A;  3PVL A;  2DTC A;  4YON A;  1K5D B;  2COD A;  2J0J A;  1P5T A;  2DHK A;  2J0K A;  2COA A;  2KCJ A;  2EC1 A;  2VKI A;  1V89 A;  5DH9 B;  1MKE A;  4HAT B;  2I5F A;  4KHA A;  2D10 A;  2D9V A;  4K2P A;  1BTK A;  3V5W A;  1FAO A;  1GG3 A;  1H4R A;  2L1C A;  2LYD A;  1UPQ A;  2MDX A;  2GCJ A;  2YS3 A;  5HE0 A;  4EMO A;  1PFJ A;  2GCL A;  1MIX A;  3FEH A;  3WYF B;  3BIN A;  2RGN B;  3ODX A;  2DN6 A;  2BCJ A;  1OMW A;  1FB8 A;  3TVV A;  2HE7 A;  1BAK A;  2QKM A;  1FHX A;  2DHI A;  3SUZ A;  1U5F A;  2RNR B;  2EMT A;  1V88 A;  1XX0 A;  5L81 A;  2Y8G A;  2DYN A;  4HB2 B;  4HB4 B;  4MK0 A;  1M7R A;  1XOD A;  1BTN A;  2D4Q A;  1KZG A;  2CAY A;  1DDW A;  3D8F A;  1W1H A;  4Y94 A;  3A8Q A;  3X23 A;  3QWM A;  3F5R A;  3KRX A;  1GC6 A;  4HAY B;  1P6S A;  2GS0 A;  2K2U A;  3IVF A;  2MKR A;  3P6A A;  2D9Z A;  2ROZ B;  5C5B B;  3UZT A;  1WVH A;  1X1G A;  2JP2 A;  2PZ1 A;  3PG7 A;  3A8P A;  1P3R A;  5J3Y A;  2RSG A;  1E5W A;  4KHO A;  2DLW A;  4C0A A;  4TYZ A;  2LUL A;  5D3W A;  3U8Z A;  2I5C A;  3P7Z A;  1UNP A;  3MPX A;  1NTY A;  4H8S A;  2H7E A;  5EFX A;  1Y5O A;  5DHA B;  1U29 A;  1DBH A;  1MPH A;  3U7D A;  2D9X A;  1V5M A;  1SHC A;  3ODO A;  2I1K A;  3NSU A;  2EJ8 A;  2R09 A;  4YL8 A;  4EJN A;  2D11 A;  2KUP A;  4L6E A;  5C5B A;  3MDB C;  5C6R A;  5LOP B;  4A5K A;  4EKU A;  2W2W A;  1TQZ A;  3QBV B;  2AEH A;  3OAN A;  2YF0 A;  2LG1 A;  1XR0 B;  1WI1 A;  1UPR A;  2DA0 A;  2Q13 A;  3ODW A;  2KGX B;  1EVH A;  2RUK B;  3PVU A;  4F7G A;  3SO6 A;  2GJY A;  4Z2N A;  3LJU X;  1WJM A;  1FGY A;  4DBB A;  4ZRK A;  4PNK A;  1DDM A;  2D9W A;  5C16 A;  2XQN M;  1NI2 A;  2W2X D;  3FSS A;  1ZVR A;  5D3V A;  1X11 A;  1V61 A;  3PVW A;  5HE1 A;  3T06 A;  1KZ7 A;  4DXA B;  3FM8 C;  3PP2 A;  2LOZ A;  4PQ0 A;  1GC7 A;  1WJ1 A;  3M1I B;  4HHV A;  4K17 A;  2W2X C;  5D3Y A;  3TFM A;  2ROV A;  2Z0P A;  2P0F A;  1DYN A;  3PZD A;  3HQC A;  1V5P A;  5KCV A;  2H7D A;  1EGX A;  2AL6 A;  2G35 A;  2ADZ A;  1UEF A;  2P8V A;  5GOW B;  3N7C A;  5CLQ B;  1J0W A;  3TCA A;  4Z2M B;  1K5G B;  2YT1 A;  1ZM0 A;  1ZC4 B;  5J3T A;  5D27 A;  1X1F A;  2DYQ A;  3HW2 B;  3GYO A;  2I1J A;  2DX1 A;  5CLL B;  3WA0 A;  2P0D A;  3CXB B;  1PMS A;  1MK9 B;  2UVM A;  4GMX B;  2J59 M;  2COF A;  3SV1 A;  1DRO A;  5D3X A;  1KI1 B;  2OTX A;  4A6F B;  1EF1 A;  1WG7 A;  2NMB A;  4TKN A;  2P0H A;  1FHO A;  2ELA A;  5C79 A;  1TJ6 A;  1IRS A;  1Q67 A;  2J0M A;  2MFQ A;  4KHB B;  5HE2 A;  2QKL A;  4DX8 A;  3DXD A;  1BWN A;  2D2Q A;  1MAI A;  4KVG B;  1J19 A;  1QC6 A;  1X05 A;  4CHJ A;  3CIK A;  3BJI A;  3AJ4 A;  2YT0 A;  2R0D A;  3ULC A;  2RVB B;  2DX5 A;  3DXE A;  2V76 A;  1V5U A;  5DHF B;  1U5D A;  2UZR A;  2Z0Q A;  2VRW B;  4A6F A;  2VSZ A;  5FI0 A;  2M14 A;  4DX9 0;  1RJ2 A;  3O96 A; 
#chains in the Genus database with same CATH topology
 1U2B A;  2DKP A;  4KHB A;  4BBK A;  4ZRI A;  3TW1 A;  1H10 A;  1U5E A;  3D8E A;  4F7U P;  4GZU A;  2EMS A;  4MY6 A;  1UNQ A;  3NWD A;  1M7E A;  4HB0 B;  4IOY X;  4K2O A;  2M38 A;  1FHW A;  2K2J A;  3ULB A;  5LG4 B;  2Z4D A;  4HB3 B;  1I7A A;  5JHG A;  2ZPY A;  3SYX A;  4F7H A;  2LOX A;  1ISN A;  2CRF A;  1NU2 A;  3NWA A;  2UZS A;  4GPT B;  5DIF B;  2HTH B;  5LON B;  3DXC A;  2L2I A;  4ZRJ A;  4A6H A;  5JP4 A;  2X18 A;  2YS1 A;  2LKO A;  1WGU A;  1ZC3 B;  2DHJ A;  1MK7 B;  4NSW A;  5KQ1 A;  2YS5 A;  4CHM A;  4K81 A;  4XWX A;  5DI9 B;  4WSF A;  1TXD A;  1N3H A;  1XCG A;  4IFS A;  2IYB A;  3A98 B;  3HIE A;  1OY2 A;  4HSI A;  2GUM A;  1PLS A;  3KZ1 A;  1Y19 B;  1WGQ A;  2E2X A;  4WVF B;  1MIZ B;  4KAX B;  3VOQ A;  2K00 A;  3D8D A;  1W1D A;  1XKE A;  5J3Q A;  2K8E A;  3ZDT A;  5FI1 A;  2DKQ A;  5HE3 A;  1AQC A;  3ML4 A;  3GYP A;  3PEG A;  4A6K A;  2FJU B;  1X86 A;  4HAV B;  2OQB A;  2NZ8 B;  2COC A;  3G9W A;  1U27 A;  2N23 A;  1LB1 A;  2FJL A;  4GXB A;  2ELB A;  4HDQ A;  1OQN A;  2CY5 A;  1EAZ A;  2Y8F A;  4HAU B;  2CY4 A;  2YRY A;  4HDO A;  5I2S A;  1FOE A;  1I2H A;  3TO1 A;  4D6W A;  2YT2 A;  2N0Y A;  4MT7 A;  5JLJ B;  3KSY A;  3RCP A;  3F0W A;  4GN1 A;  3AU5 A;  2KUQ A;  2YSZ A;  1SGH A;  3KRW A;  3VIA A;  2MWN B;  1AWE A;  4QJ5 B;  1B55 A;  3QIJ A;  4P7I A;  3B77 A;  3NWF A;  1ZSQ A;  4NY0 A;  3PSC A;  2Y7B A;  2D9Y A;  1W1G A;  2RLO A;  3SNH A;  3A58 A;  4QJ4 B;  2DFK A;  3AU4 A;  5KQ4 A;  2IFS A;  4WJ7 A;  1XD4 A;  3ZVR A;  4D0N B;  4IAP A;  1DDV A;  1LW3 A;  2Z0O A;  4L1R A;  1NTV A;  1Z87 A;  1U5G A;  4CYE A;  1UNR A;  5JHH A;  4HAX B;  4B6H A;  1FGZ A;  4HAW B;  3KY9 A;  2YVC A;  1RRP B;  3HK0 A;  4HAZ B;  1QQG A;  4GMV A;  3PVL A;  2DTC A;  4YON A;  1K5D B;  2COD A;  2J0J A;  1P5T A;  2DHK A;  2J0K A;  2COA A;  2KCJ A;  2EC1 A;  2VKI A;  1V89 A;  5DH9 B;  1MKE A;  4HAT B;  2I5F A;  4KHA A;  2D10 A;  2D9V A;  4K2P A;  1BTK A;  5IRS A;  3V5W A;  1FAO A;  1GG3 A;  1H4R A;  2L1C A;  2LYD A;  1UPQ A;  2MDX A;  2R2Y A;  2KIG A;  2GCJ A;  2YS3 A;  4OSN A;  5HE0 A;  4EMO A;  1PFJ A;  2GCL A;  1MIX A;  3FEH A;  3HSA A;  3WYF B;  3BIN A;  2RGN B;  3ODX A;  2DN6 A;  5M4Y B;  2BCJ A;  1OMW A;  1FB8 A;  3TVV A;  2HE7 A;  1BAK A;  2QKM A;  1FHX A;  2DHI A;  3SUZ A;  1U5F A;  2RNR B;  2EMT A;  1V88 A;  1XX0 A;  5L81 A;  2Y8G A;  2DYN A;  4HB2 B;  4HB4 B;  4OT1 A;  4MK0 A;  1M7R A;  1XOD A;  1BTN A;  2D4Q A;  1KZG A;  2CAY A;  1DDW A;  3D8F A;  1W1H A;  4Y94 A;  3A8Q A;  3X23 A;  3QWM A;  3F5R A;  3KRX A;  1GC6 A;  4QXA B;  4HAY B;  3U12 A;  1P6S A;  2GS0 A;  2K2U A;  3IVF A;  2MKR A;  3P6A A;  2D9Z A;  2ROZ B;  5C5B B;  3FVC A;  3UZT A;  1WVH A;  1X1G A;  2JP2 A;  2PZ1 A;  3PG7 A;  3A8P A;  1P3R A;  5J3Y A;  1ZYI A;  2RSG A;  1E5W A;  4KHO A;  2DLW A;  4C0A A;  4TYZ A;  2NBV A;  2LUL A;  5D3W A;  3U8Z A;  2I5C A;  3P7Z A;  1UNP A;  3MPX A;  1NTY A;  4H8S A;  2H7E A;  5EFX A;  1Y5O A;  5DHA B;  1U29 A;  1DBH A;  1MPH A;  3U7D A;  2D9X A;  1V5M A;  1SHC A;  3ODO A;  2I1K A;  3NSU A;  2EJ8 A;  2R09 A;  4YL8 A;  4EJN A;  2D11 A;  2KUP A;  4L6E A;  5C5B A;  3MDB C;  5C6R A;  2KIE A;  5LOP B;  2KR0 A;  4A5K A;  4EKU A;  2W2W A;  1TQZ A;  3QBV B;  2AEH A;  3OAN A;  2YF0 A;  2LG1 A;  1XR0 B;  1WI1 A;  1UPR A;  2DA0 A;  2Q13 A;  3ODW A;  4DIX A;  2KGX B;  1EVH A;  2RUK B;  3PVU A;  4F7G A;  3SO6 A;  2GJY A;  4Z2N A;  3LJU X;  1WJM A;  1MI1 A;  1FGY A;  4DBB A;  4ZRK A;  4PNK A;  1DDM A;  2D9W A;  5C16 A;  2XQN M;  1NI2 A;  2W2X D;  3FSS A;  1ZVR A;  5D3V A;  1X11 A;  1V61 A;  3PVW A;  5HE1 A;  5I2M A;  3T06 A;  1KZ7 A;  2Z14 A;  4DXA B;  3FM8 C;  3PP2 A;  2LOZ A;  4PQ0 A;  1GC7 A;  4GNK B;  1WJ1 A;  3M1I B;  2Z13 A;  4HHV A;  4K17 A;  2W2X C;  5D3Y A;  3TFM A;  2ROV A;  2Z0P A;  2P0F A;  1DYN A;  3PZD A;  3HQC A;  1V5P A;  5KCV A;  2H7D A;  1EGX A;  2AL6 A;  2G35 A;  2ADZ A;  1UEF A;  2P8V A;  5GOW B;  3N7C A;  5CLQ B;  1J0W A;  3TCA A;  4Z2M B;  1K5G B;  2YT1 A;  3DCX A;  1ZM0 A;  1ZC4 B;  5J3T A;  2ZKM X;  5D27 A;  1X1F A;  2DYQ A;  3HW2 B;  3GYO A;  2I1J A;  2DX1 A;  5CLL B;  3WA0 A;  2P0D A;  3CXB B;  1PMS A;  1MK9 B;  2UVM A;  4GMX B;  2J59 M;  2COF A;  3SV1 A;  1DRO A;  5D3X A;  1KI1 B;  3OHM B;  2OTX A;  4A6F B;  1EF1 A;  1WG7 A;  1T77 A;  2NMB A;  4TKN A;  2P0H A;  1FHO A;  2ELA A;  5C79 A;  1TJ6 A;  1IRS A;  1Q67 A;  2J0M A;  2MFQ A;  4KHB B;  4GOU A;  5HE2 A;  2QKL A;  4DX8 A;  4QJ3 B;  3DXD A;  1BWN A;  3NW8 A;  2D2Q A;  2Z59 A;  1MAI A;  2K49 A;  4KVG B;  4CSQ A;  1J19 A;  1QC6 A;  1X05 A;  4CHJ A;  3CIK A;  3BJI A;  3AJ4 A;  2YT0 A;  2R0D A;  3ULC A;  2RVB B;  2DX5 A;  3DXE A;  2V76 A;  1V5U A;  5DHF B;  1U5D A;  2UZR A;  2Z0Q A;  2VRW B;  4A6F A;  2VSZ A;  5FI0 A;  2M14 A;  4DX9 0;  1RJ2 A;  3O96 A;  2RRF A; 
#chains in the Genus database with same CATH homology
 1U2B A;  2DKP A;  4BBK A;  4ZRI A;  3TW1 A;  1H10 A;  1U5E A;  3D8E A;  4F7U P;  4GZU A;  2EMS A;  4MY6 A;  1UNQ A;  1M7E A;  4HB0 B;  4IOY X;  4K2O A;  2M38 A;  1FHW A;  2K2J A;  3ULB A;  4HB3 B;  1I7A A;  5JHG A;  2ZPY A;  3SYX A;  4F7H A;  2LOX A;  1ISN A;  2CRF A;  1NU2 A;  2UZS A;  4GPT B;  5DIF B;  2HTH B;  5LON B;  3DXC A;  2L2I A;  4ZRJ A;  4A6H A;  5JP4 A;  2X18 A;  2YS1 A;  2LKO A;  1WGU A;  1ZC3 B;  2DHJ A;  1MK7 B;  4NSW A;  5KQ1 A;  2YS5 A;  4CHM A;  4K81 A;  4XWX A;  5DI9 B;  4WSF A;  1TXD A;  1N3H A;  1XCG A;  4IFS A;  2IYB A;  3A98 B;  1OY2 A;  1PLS A;  3KZ1 A;  1Y19 B;  1WGQ A;  2E2X A;  4WVF B;  1MIZ B;  4KAX B;  3VOQ A;  2K00 A;  3D8D A;  1W1D A;  1XKE A;  5J3Q A;  3ZDT A;  5FI1 A;  2DKQ A;  5HE3 A;  1AQC A;  3ML4 A;  3GYP A;  3PEG A;  4A6K A;  1X86 A;  4HAV B;  2OQB A;  2NZ8 B;  2COC A;  3G9W A;  1U27 A;  2N23 A;  1LB1 A;  2FJL A;  4GXB A;  2ELB A;  4HDQ A;  1OQN A;  2CY5 A;  1EAZ A;  2Y8F A;  4HAU B;  2CY4 A;  2YRY A;  4HDO A;  1FOE A;  1I2H A;  3TO1 A;  2N0Y A;  4MT7 A;  5JLJ B;  3KSY A;  3RCP A;  3F0W A;  4GN1 A;  3AU5 A;  2YSZ A;  1SGH A;  3KRW A;  3VIA A;  2MWN B;  1AWE A;  1B55 A;  3QIJ A;  4P7I A;  1ZSQ A;  4NY0 A;  3PSC A;  2Y7B A;  2D9Y A;  1W1G A;  2RLO A;  3SNH A;  2DFK A;  3AU4 A;  5KQ4 A;  2IFS A;  4WJ7 A;  1XD4 A;  3ZVR A;  4D0N B;  4IAP A;  1DDV A;  1LW3 A;  2Z0O A;  1NTV A;  1Z87 A;  1U5G A;  4CYE A;  1UNR A;  5JHH A;  4HAX B;  4B6H A;  1FGZ A;  4HAW B;  3KY9 A;  2YVC A;  1RRP B;  3HK0 A;  4HAZ B;  1QQG A;  4GMV A;  3PVL A;  2DTC A;  4YON A;  1K5D B;  2COD A;  2J0J A;  1P5T A;  2DHK A;  2J0K A;  2COA A;  2KCJ A;  2EC1 A;  2VKI A;  1V89 A;  5DH9 B;  1MKE A;  4HAT B;  2I5F A;  4KHA A;  2D10 A;  2D9V A;  4K2P A;  1BTK A;  3V5W A;  1FAO A;  1GG3 A;  1H4R A;  2L1C A;  2LYD A;  1UPQ A;  2MDX A;  2GCJ A;  2YS3 A;  5HE0 A;  4EMO A;  1PFJ A;  2GCL A;  1MIX A;  3FEH A;  3WYF B;  3BIN A;  2RGN B;  3ODX A;  2DN6 A;  2BCJ A;  1OMW A;  1FB8 A;  3TVV A;  2HE7 A;  1BAK A;  2QKM A;  1FHX A;  2DHI A;  3SUZ A;  1U5F A;  2RNR B;  2EMT A;  1V88 A;  1XX0 A;  5L81 A;  2Y8G A;  2DYN A;  4HB2 B;  4HB4 B;  4MK0 A;  1M7R A;  1XOD A;  1BTN A;  2D4Q A;  1KZG A;  2CAY A;  1DDW A;  3D8F A;  1W1H A;  4Y94 A;  3A8Q A;  3X23 A;  3QWM A;  3F5R A;  3KRX A;  1GC6 A;  4HAY B;  1P6S A;  2GS0 A;  2K2U A;  3IVF A;  2MKR A;  3P6A A;  2D9Z A;  2ROZ B;  5C5B B;  3UZT A;  1WVH A;  1X1G A;  2JP2 A;  2PZ1 A;  3PG7 A;  3A8P A;  1P3R A;  5J3Y A;  2RSG A;  1E5W A;  4KHO A;  2DLW A;  4C0A A;  4TYZ A;  2LUL A;  5D3W A;  3U8Z A;  2I5C A;  3P7Z A;  1UNP A;  3MPX A;  1NTY A;  4H8S A;  2H7E A;  5EFX A;  1Y5O A;  5DHA B;  1U29 A;  1DBH A;  1MPH A;  3U7D A;  2D9X A;  1V5M A;  1SHC A;  3ODO A;  2I1K A;  3NSU A;  2EJ8 A;  2R09 A;  4YL8 A;  4EJN A;  2D11 A;  2KUP A;  4L6E A;  5C5B A;  3MDB C;  5C6R A;  5LOP B;  4A5K A;  4EKU A;  2W2W A;  1TQZ A;  3QBV B;  2AEH A;  3OAN A;  2YF0 A;  2LG1 A;  1XR0 B;  1WI1 A;  1UPR A;  2DA0 A;  2Q13 A;  3ODW A;  2KGX B;  1EVH A;  2RUK B;  3PVU A;  4F7G A;  3SO6 A;  2GJY A;  4Z2N A;  3LJU X;  1WJM A;  1FGY A;  4DBB A;  4ZRK A;  4PNK A;  1DDM A;  2D9W A;  5C16 A;  2XQN M;  1NI2 A;  2W2X D;  3FSS A;  1ZVR A;  5D3V A;  1X11 A;  1V61 A;  3PVW A;  5HE1 A;  3T06 A;  1KZ7 A;  4DXA B;  3FM8 C;  3PP2 A;  2LOZ A;  4PQ0 A;  1GC7 A;  1WJ1 A;  3M1I B;  4HHV A;  4K17 A;  2W2X C;  5D3Y A;  3TFM A;  2ROV A;  2Z0P A;  2P0F A;  1DYN A;  3PZD A;  3HQC A;  1V5P A;  5KCV A;  2H7D A;  1EGX A;  2AL6 A;  2G35 A;  2ADZ A;  1UEF A;  2P8V A;  5GOW B;  3N7C A;  5CLQ B;  1J0W A;  3TCA A;  4Z2M B;  1K5G B;  2YT1 A;  1ZM0 A;  1ZC4 B;  5J3T A;  5D27 A;  1X1F A;  2DYQ A;  3HW2 B;  3GYO A;  2I1J A;  2DX1 A;  5CLL B;  3WA0 A;  2P0D A;  3CXB B;  1PMS A;  1MK9 B;  2UVM A;  4GMX B;  2J59 M;  2COF A;  3SV1 A;  1DRO A;  5D3X A;  1KI1 B;  2OTX A;  4A6F B;  1EF1 A;  1WG7 A;  2NMB A;  4TKN A;  2P0H A;  1FHO A;  2ELA A;  5C79 A;  1TJ6 A;  1IRS A;  1Q67 A;  2J0M A;  2MFQ A;  4KHB B;  5HE2 A;  2QKL A;  4DX8 A;  3DXD A;  1BWN A;  2D2Q A;  1MAI A;  4KVG B;  1J19 A;  1QC6 A;  1X05 A;  4CHJ A;  3CIK A;  3BJI A;  3AJ4 A;  2YT0 A;  2R0D A;  3ULC A;  2RVB B;  2DX5 A;  3DXE A;  2V76 A;  1V5U A;  5DHF B;  1U5D A;  2UZR A;  2Z0Q A;  2VRW B;  4A6F A;  2VSZ A;  5FI0 A;  2M14 A;  4DX9 0;  1RJ2 A;  3O96 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...