3WYFB

Crystal structure of xpo1p-yrb2p-gsp1p-gtp complex
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
229
structure length
144
Chain Sequence
KFVFGAASKFGTGFAFGSGLSFGSGFNILLQKQEVKSGEESEECIYQVNAKLYQLSNEGWKERGVGIIKINKSKDKTRIVMRSRGILKVILNIQLVKGFTVQKGFTGSLQSEKFIRLLAVDAQYAIKTKKETTDELYNIIVKSV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural insights into how yrb2p accelerates the assembly of the xpo1p nuclear export complex
pubmed doi rcsb
source organism Saccharomyces cerevisiae awri796
molecule tags Gtp-binding protein/gtp-binding protein inhibitor
molecule keywords Gsp1p
total genus 24
structure length 144
sequence length 229
chains with identical sequence E
ec nomenclature
pdb deposition date 2014-08-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00638 Ran_BP1 RanBP1 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 3wyfB00
3NSUA 1TJ6A 1WGUA 2UZSA 2RSGA 2BCJA 2FJLA 1U29A 5D3WA 2ELBA 2N23A 1I7AA 1FB8A 2EC1A 1MKEA 1MIZB 3TFMA 1E5WA 2DHJA 4KAXB 3TW1A 2IYBA 4BBKA 2MWNB 1EAZA 4B6HA 3AU4A 3D8EA 1W1HA 3AJ4A 1OY2A 1XKEA 2COFA 2I5FA 4KHBB 3SO6A 3MPXA 3TO1A 4A6FA 2P0HA 5DHAB 4K2PA 5FI0A 2LOZA 5DHFB 1U5FA 4GPTB 2AEHA 2DHIA 2DFKA 2DHKA 2XQNM 2NMBA 2YRYA 2H7DA 1MAIA 3A8QA 1V89A 2RLOA 1X11A 3SV1A 4HAVB 4KVGB 4GZUA 5JP4A 2KUPA 4NY0A 4GMVA 2IFSA 3BINA 2RNRB 1FGYA 2ROVA 1Z87A 5C5BB 2LG1A 3U7DA 2J0MA 1FHXA 3LJUX 2R0DA 3OANA 1WVHA 1TXDA 2K00A 2UVMA 1LB1A 2Z0OA 3MDBC 1OMWA 1TQZA 5D27A 1FAOA 5HE3A 4XWXA 2DLWA 4EKUA 1M7EA 4K2OA 1EF1A 1FOEA 5JLJB 2EMSA 1ZSQA 2LKOA 2JP2A 1IRSA 1PMSA 3V5WA 5KCVA 3PVWA 2W2XD 2DYQA 1J0WA 4C0AA 2D4QA 4HATB 5HE1A 1P5TA 3ML4A 3BJIA 3ODOA 4IFSA 1EGXA 5C79A 4MT7A 1X1GA 4CYEA 1UEFA 5DH9B 5LONB 2DX5A 4KHAA 5JHHA 5DI9B 3VIAA 2W2XC 3HW2B 3DXDA 5C6RA 4DX90 4K17A 3PVLA 1UNRA 1Q67A 5D3VA 5D3XA 2M38A 1MK7B 3F5RA 3TVVA 1WJMA 2Z0QA 1EVHA 3ZVRA 3T06A 2MFQA 2K2JA 4ZRKA 1V5UA 5GOWB 2LYDA 2VRWB 4GXBA 1SHCA 3ZDTA 1ZC4B 4HHVA 1KZ7A 1X86A 2YVCA 1J19A 2I1JA 5D3YA 2CAYA 5FI1A 1LW3A 3WA0A 1ZVRA 4A6FB 5C5BA 4HB3B 1ZM0A 5CLQB 1DDMA 3M1IB 4ZRIA 2I5CA 1B55A 1RRPB 3PVUA 4CHMA 3KY9A 4GMXB 3PEGA 3FM8C 1K5GB 1NU2A 2LOXA 5HE0A 1PLSA 3FEHA 4HB0B 1W1DA 2I1KA 4DBBA 1XODA 4WJ7A 5JHGA 2D2QA 4HAYB 4HAZB 1KZGA 2D9WA 4HB4B 3ULBA 2K2UA 4TYZA 3CXBB 3KRXA 3ULCA 2KGXB 2QKMA 1X1FA 1Y5OA 1MPHA 1NTVA 2OTXA 3P7ZA 5DIFB 2YT1A 3TCAA 4PQ0A 1WGQA 1BTNA 4D0NB 4A6HA 1U5GA 2D9VA 1V88A 2E2XA 2D9YA 3KRWA 4ZRJA 4IAPA 3O96A 1WG7A 4DXAB 5C16A 3KZ1A 2GCLA 1QC6A 3AU5A 4F7HA 5J3YA 1H10A 2L2IA 3IVFA 1P3RA 3X23A 2EMTA 1FGZA 1MIXA 1ZC3B 4P7IA 1XX0A 2CY4A 3DXEA 2GS0A 1P6SA 1PFJA 2YSZA 3P6AA 2Y8FA 3SNHA 2ZPYA 2Q13A 1DROA 3A8PA 3HK0A 3RCPA 3DXCA 4F7UP 5LOPB 2DYNA 2HTHB 4CHJA 2CRFA 1NTYA 4YL8A 3ODXA 4A6KA 2LULA 1DDWA 4KHOA 2AL6A 2J0KA 3QBVB 1AQCA 2DN6A 2CODA 1FHWA 1WJ1A 1Y19B 2X18A 3GYPA 4A5KA 1M7RA 1OQNA 3D8DA 2DA0A 3CIKA 2ADZA 2D11A 2MDXA 1AWEA 2VSZA 3QIJA 2COAA 2DTCA 3U8ZA 3D8FA 2NZ8B 4MY6A 3G9WA 2DKQA 5J3QA 2RVBB 1X05A 4YONA 2H7EA 5EFXA 4L6EA 4HDQA 5J3TA 2V76A 1NI2A 2CY5A 2D10A 2Y7BA 1W1GA 4Z2MB 2P0FA 4HB2B 4H8SA 5CLLB 4DX8A 1BTKA 1XCGA 1U5EA 1XR0B 4GN1A 5KQ1A 2VKIA 4F7GA 2YF0A 3SUZA 1BWNA 2Y8GA 2R09A 2G35A 1GG3A 1DDVA 2J59M 1XD4A 3WYFB 2PZ1A 4IOYX 4Z2NA 3HQCA 1V61A 5HE2A 3VOQA 3N7CA 1I2HA 2L1CA 2P0DA 2KCJA 3SYXA 2EJ8A 1K5DB 1SGHA 4WVFB 2N0YA 3PG7A 2HE7A 1U2BA 4WSFA 4NSWA 3GYOA 4Y94A 4K81A 2YS3A 2UZRA 4EMOA 4TKNA 1MK9B 1ISNA 4HDOA 2DX1A 4HAWB 1RJ2A 2OQBA 2GCJA 1H4RA 1QQGA 4HAXB 4MK0A 2YT0A 1U27A 1KI1B 2GJYA 1UNPA 2RGNB 3PSCA 3FSSA 2ELAA 1V5PA 1V5MA 3PZDA 1GC6A 1WI1A 3A98B 2D9ZA 2W2WA 1U5DA 3PP2A 2RUKB 5L81A 3UZTA 1N3HA 2COCA 5KQ4A 3QWMA 1UNQA 2P8VA 2Z0PA 1FHOA 3ODWA 4EJNA 2QKLA 2DKPA 4HAUB 3F0WA 3KSYA 2D9XA 1UPQA 2ROZB 1BAKA 2M14A 2MKRA 2YS5A 4PNKA 1GC7A 1DYNA 2YS1A 1UPRA 2J0JA 1DBHA
chains in the Genus database with same CATH superfamily
3NSUA 1TJ6A 1WGUA 2UZSA 2RSGA 2BCJA 2FJLA 1U29A 5D3WA 2ELBA 2N23A 1I7AA 3NWAA 1FB8A 2EC1A 1MKEA 2KIEA 1MIZB 3TFMA 1E5WA 2DHJA 4KAXB 3TW1A 2IYBA 4BBKA 5I2SA 2MWNB 1EAZA 4B6HA 3AU4A 3D8EA 1W1HA 3AJ4A 1OY2A 1XKEA 2COFA 2I5FA 4KHBB 3SO6A 3MPXA 3TO1A 4A6FA 2P0HA 5DHAB 4K2PA 5FI0A 2LOZA 5DHFB 1U5FA 4GPTB 2AEHA 2KR0A 2DHIA 2DFKA 2DHKA 2XQNM 2NMBA 2YRYA 2H7DA 1MAIA 3A8QA 3U12A 1V89A 2RLOA 1X11A 3SV1A 2K8EA 4HAVB 4KVGB 4GZUA 5JP4A 2KUPA 4NY0A 4GMVA 2IFSA 4OSNA 3BINA 2RNRB 1FGYA 2ROVA 1Z87A 5C5BB 2LG1A 3U7DA 2J0MA 1FHXA 3LJUX 3NWDA 3OHMB 2R0DA 3OANA 1WVHA 1TXDA 2K00A 2UVMA 1LB1A 2Z0OA 2ZKMX 3MDBC 1OMWA 1TQZA 5D27A 1FAOA 5HE3A 4XWXA 4KHBA 2DLWA 4EKUA 1M7EA 4K2OA 1EF1A 1FOEA 5JLJB 2EMSA 1ZSQA 2LKOA 2JP2A 1IRSA 1PMSA 3V5WA 5KCVA 3PVWA 2W2XD 2DYQA 4QXAB 1J0WA 4C0AA 2D4QA 4HATB 5HE1A 1P5TA 3ML4A 3BJIA 3ODOA 4IFSA 1EGXA 5C79A 4MT7A 1X1GA 4CYEA 1UEFA 5DH9B 5LONB 1ZYIA 2DX5A 4KHAA 5JHHA 3DCXA 5DI9B 3VIAA 2W2XC 3HW2B 2Z59A 3DXDA 5C6RA 4DX90 4K17A 3PVLA 1UNRA 5I2MA 1Q67A 5D3VA 5D3XA 2M38A 1MK7B 4GNKB 3F5RA 3TVVA 1WJMA 2Z0QA 1EVHA 3ZVRA 2KIGA 3T06A 4QJ3B 2MFQA 2K2JA 4ZRKA 1V5UA 5GOWB 2LYDA 2VRWB 4GXBA 1SHCA 3ZDTA 1ZC4B 4HHVA 1KZ7A 1X86A 2YVCA 1J19A 2I1JA 5D3YA 2CAYA 5FI1A 1LW3A 3WA0A 1ZVRA 4A6FB 5C5BA 4HB3B 1ZM0A 5CLQB 1DDMA 1T77A 3M1IB 4ZRIA 2I5CA 4L1RA 1B55A 1RRPB 3PVUA 4CHMA 3KY9A 4GMXB 3PEGA 3FM8C 1K5GB 1NU2A 2LOXA 5HE0A 1PLSA 3FEHA 3NW8A 2Z14A 4HB0B 3FVCA 1W1DA 2I1KA 4DBBA 1XODA 4WJ7A 5JHGA 2D2QA 4HAYB 4D6WA 4HAZB 1KZGA 2D9WA 4HB4B 3ULBA 2K2UA 4TYZA 3CXBB 3KRXA 4DIXA 4HSIA 3ULCA 2KGXB 2QKMA 1X1FA 1Y5OA 1MPHA 1NTVA 2OTXA 3P7ZA 5LG4B 5DIFB 2YT1A 3TCAA 4PQ0A 1WGQA 1BTNA 4OT1A 4D0NB 3NWFA 4A6HA 1U5GA 2D9VA 1V88A 2E2XA 2D9YA 3KRWA 4ZRJA 4CSQA 4IAPA 3O96A 1WG7A 4DXAB 5C16A 3KZ1A 2GCLA 1QC6A 3AU5A 4F7HA 5J3YA 1H10A 2L2IA 3IVFA 1P3RA 3X23A 2EMTA 1FGZA 1MIXA 1ZC3B 4P7IA 1XX0A 2CY4A 3DXEA 2GS0A 1P6SA 1PFJA 2YSZA 3P6AA 2Y8FA 3SNHA 2ZPYA 2Q13A 2NBVA 1DROA 3A8PA 3HK0A 3RCPA 3DXCA 4F7UP 5LOPB 3A58A 2DYNA 2HTHB 4CHJA 2CRFA 4QJ4B 1NTYA 4YL8A 3ODXA 4A6KA 2LULA 1DDWA 4KHOA 2AL6A 2GUMA 2J0KA 3QBVB 1AQCA 2DN6A 2CODA 1FHWA 1WJ1A 1Y19B 2Z4DA 2X18A 3GYPA 4A5KA 1M7RA 1OQNA 3D8DA 2DA0A 3CIKA 2ADZA 2D11A 2MDXA 1AWEA 2VSZA 3QIJA 2K49A 2COAA 2DTCA 3U8ZA 3D8FA 2NZ8B 4MY6A 3G9WA 2DKQA 5J3QA 2RVBB 1X05A 4YONA 4QJ5B 2H7EA 5EFXA 4L6EA 4HDQA 5IRSA 5J3TA 2V76A 1MI1A 1NI2A 2CY5A 2D10A 2Y7BA 1W1GA 4Z2MB 2P0FA 4HB2B 4H8SA 5CLLB 4DX8A 1BTKA 1XCGA 1U5EA 1XR0B 4GN1A 5KQ1A 2VKIA 4F7GA 2YF0A 3SUZA 1BWNA 2Y8GA 2R09A 2G35A 1GG3A 1DDVA 2J59M 1XD4A 3WYFB 2PZ1A 4IOYX 4Z2NA 3HQCA 3B77A 1V61A 5HE2A 3VOQA 3N7CA 1I2HA 2L1CA 2P0DA 2KCJA 3HSAA 2KUQA 3SYXA 2FJUB 2EJ8A 1K5DB 1SGHA 3HIEA 2R2YA 4WVFB 2N0YA 3PG7A 2HE7A 1U2BA 4WSFA 4NSWA 3GYOA 4Y94A 4K81A 2YS3A 2UZRA 2RRFA 4EMOA 4TKNA 1MK9B 1ISNA 4HDOA 2DX1A 4HAWB 5M4YB 1RJ2A 2OQBA 2GCJA 1H4RA 1QQGA 4HAXB 4MK0A 2YT0A 1U27A 1KI1B 2GJYA 1UNPA 2RGNB 3PSCA 3FSSA 2ELAA 1V5PA 1V5MA 3PZDA 1GC6A 1WI1A 3A98B 2D9ZA 2W2WA 1U5DA 3PP2A 2RUKB 2Z13A 5L81A 3UZTA 1N3HA 2COCA 5KQ4A 3QWMA 1UNQA 2P8VA 2Z0PA 2YT2A 1FHOA 3ODWA 4EJNA 2QKLA 2DKPA 4HAUB 3F0WA 3KSYA 2D9XA 1UPQA 2ROZB 1BAKA 2M14A 2MKRA 2YS5A 4PNKA 1GC7A 1DYNA 2YS1A 1UPRA 4GOUA 2J0JA 1DBHA
chains in the Genus database with same CATH topology
3NSUA 1TJ6A 1WGUA 2UZSA 2RSGA 2BCJA 2FJLA 1U29A 5D3WA 2ELBA 2N23A 1I7AA 1FB8A 2EC1A 1MKEA 1MIZB 3TFMA 1E5WA 2DHJA 4KAXB 3TW1A 2IYBA 4BBKA 2MWNB 1EAZA 4B6HA 3AU4A 3D8EA 1W1HA 3AJ4A 1OY2A 1XKEA 2COFA 2I5FA 4KHBB 3SO6A 3MPXA 3TO1A 4A6FA 2P0HA 5DHAB 4K2PA 5FI0A 2LOZA 5DHFB 1U5FA 4GPTB 2AEHA 2DHIA 2DFKA 2DHKA 2XQNM 2NMBA 2YRYA 2H7DA 1MAIA 3A8QA 1V89A 2RLOA 1X11A 3SV1A 4HAVB 4KVGB 4GZUA 5JP4A 2KUPA 4NY0A 4GMVA 2IFSA 3BINA 2RNRB 1FGYA 2ROVA 1Z87A 5C5BB 2LG1A 3U7DA 2J0MA 1FHXA 3LJUX 2R0DA 3OANA 1WVHA 1TXDA 2K00A 2UVMA 1LB1A 2Z0OA 3MDBC 1OMWA 1TQZA 5D27A 1FAOA 5HE3A 4XWXA 2DLWA 4EKUA 1M7EA 4K2OA 1EF1A 1FOEA 5JLJB 2EMSA 1ZSQA 2LKOA 2JP2A 1IRSA 1PMSA 3V5WA 5KCVA 3PVWA 2W2XD 2DYQA 1J0WA 4C0AA 2D4QA 4HATB 5HE1A 1P5TA 3ML4A 3BJIA 3ODOA 4IFSA 1EGXA 5C79A 4MT7A 1X1GA 4CYEA 1UEFA 5DH9B 5LONB 2DX5A 4KHAA 5JHHA 5DI9B 3VIAA 2W2XC 3HW2B 3DXDA 5C6RA 4DX90 4K17A 3PVLA 1UNRA 1Q67A 5D3VA 5D3XA 2M38A 1MK7B 3F5RA 3TVVA 1WJMA 2Z0QA 1EVHA 3ZVRA 3T06A 2MFQA 2K2JA 4ZRKA 1V5UA 5GOWB 2LYDA 2VRWB 4GXBA 1SHCA 3ZDTA 1ZC4B 4HHVA 1KZ7A 1X86A 2YVCA 1J19A 2I1JA 5D3YA 2CAYA 5FI1A 1LW3A 3WA0A 1ZVRA 4A6FB 5C5BA 4HB3B 1ZM0A 5CLQB 1DDMA 3M1IB 4ZRIA 2I5CA 1B55A 1RRPB 3PVUA 4CHMA 3KY9A 4GMXB 3PEGA 3FM8C 1K5GB 1NU2A 2LOXA 5HE0A 1PLSA 3FEHA 4HB0B 1W1DA 2I1KA 4DBBA 1XODA 4WJ7A 5JHGA 2D2QA 4HAYB 4HAZB 1KZGA 2D9WA 4HB4B 3ULBA 2K2UA 4TYZA 3CXBB 3KRXA 3ULCA 2KGXB 2QKMA 1X1FA 1Y5OA 1MPHA 1NTVA 2OTXA 3P7ZA 5DIFB 2YT1A 3TCAA 4PQ0A 1WGQA 1BTNA 4D0NB 4A6HA 1U5GA 2D9VA 1V88A 2E2XA 2D9YA 3KRWA 4ZRJA 4IAPA 3O96A 1WG7A 4DXAB 5C16A 3KZ1A 2GCLA 1QC6A 3AU5A 4F7HA 5J3YA 1H10A 2L2IA 3IVFA 1P3RA 3X23A 2EMTA 1FGZA 1MIXA 1ZC3B 4P7IA 1XX0A 2CY4A 3DXEA 2GS0A 1P6SA 1PFJA 2YSZA 3P6AA 2Y8FA 3SNHA 2ZPYA 2Q13A 1DROA 3A8PA 3HK0A 3RCPA 3DXCA 4F7UP 5LOPB 2DYNA 2HTHB 4CHJA 2CRFA 1NTYA 4YL8A 3ODXA 4A6KA 2LULA 1DDWA 4KHOA 2AL6A 2J0KA 3QBVB 1AQCA 2DN6A 2CODA 1FHWA 1WJ1A 1Y19B 2X18A 3GYPA 4A5KA 1M7RA 1OQNA 3D8DA 2DA0A 3CIKA 2ADZA 2D11A 2MDXA 1AWEA 2VSZA 3QIJA 2COAA 2DTCA 3U8ZA 3D8FA 2NZ8B 4MY6A 3G9WA 2DKQA 5J3QA 2RVBB 1X05A 4YONA 2H7EA 5EFXA 4L6EA 4HDQA 5J3TA 2V76A 1NI2A 2CY5A 2D10A 2Y7BA 1W1GA 4Z2MB 2P0FA 4HB2B 4H8SA 5CLLB 4DX8A 1BTKA 1XCGA 1U5EA 1XR0B 4GN1A 5KQ1A 2VKIA 4F7GA 2YF0A 3SUZA 1BWNA 2Y8GA 2R09A 2G35A 1GG3A 1DDVA 2J59M 1XD4A 3WYFB 2PZ1A 4IOYX 4Z2NA 3HQCA 1V61A 5HE2A 3VOQA 3N7CA 1I2HA 2L1CA 2P0DA 2KCJA 3SYXA 2EJ8A 1K5DB 1SGHA 4WVFB 2N0YA 3PG7A 2HE7A 1U2BA 4WSFA 4NSWA 3GYOA 4Y94A 4K81A 2YS3A 2UZRA 4EMOA 4TKNA 1MK9B 1ISNA 4HDOA 2DX1A 4HAWB 1RJ2A 2OQBA 2GCJA 1H4RA 1QQGA 4HAXB 4MK0A 2YT0A 1U27A 1KI1B 2GJYA 1UNPA 2RGNB 3PSCA 3FSSA 2ELAA 1V5PA 1V5MA 3PZDA 1GC6A 1WI1A 3A98B 2D9ZA 2W2WA 1U5DA 3PP2A 2RUKB 5L81A 3UZTA 1N3HA 2COCA 5KQ4A 3QWMA 1UNQA 2P8VA 2Z0PA 1FHOA 3ODWA 4EJNA 2QKLA 2DKPA 4HAUB 3F0WA 3KSYA 2D9XA 1UPQA 2ROZB 1BAKA 2M14A 2MKRA 2YS5A 4PNKA 1GC7A 1DYNA 2YS1A 1UPRA 2J0JA 1DBHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NSU A;  1TJ6 A;  1WGU A;  2UZS A;  2RSG A;  2BCJ A;  2FJL A;  1U29 A;  5D3W A;  2ELB A;  2N23 A;  1I7A A;  1FB8 A;  2EC1 A;  1MKE A;  1MIZ B;  3TFM A;  1E5W A;  2DHJ A;  4KAX B;  3TW1 A;  2IYB A;  4BBK A;  2MWN B;  1EAZ A;  4B6H A;  3AU4 A;  3D8E A;  1W1H A;  3AJ4 A;  1OY2 A;  1XKE A;  2COF A;  2I5F A;  4KHB B;  3SO6 A;  3MPX A;  3TO1 A;  4A6F A;  2P0H A;  5DHA B;  4K2P A;  5FI0 A;  2LOZ A;  5DHF B;  1U5F A;  4GPT B;  2AEH A;  2DHI A;  2DFK A;  2DHK A;  2XQN M;  2NMB A;  2YRY A;  2H7D A;  1MAI A;  3A8Q A;  1V89 A;  2RLO A;  1X11 A;  3SV1 A;  4HAV B;  4KVG B;  4GZU A;  5JP4 A;  2KUP A;  4NY0 A;  4GMV A;  2IFS A;  3BIN A;  2RNR B;  1FGY A;  2ROV A;  1Z87 A;  5C5B B;  2LG1 A;  3U7D A;  2J0M A;  1FHX A;  3LJU X;  2R0D A;  3OAN A;  1WVH A;  1TXD A;  2K00 A;  2UVM A;  1LB1 A;  2Z0O A;  3MDB C;  1OMW A;  1TQZ A;  5D27 A;  1FAO A;  5HE3 A;  4XWX A;  2DLW A;  4EKU A;  1M7E A;  4K2O A;  1EF1 A;  1FOE A;  5JLJ B;  2EMS A;  1ZSQ A;  2LKO A;  2JP2 A;  1IRS A;  1PMS A;  3V5W A;  5KCV A;  3PVW A;  2W2X D;  2DYQ A;  1J0W A;  4C0A A;  2D4Q A;  4HAT B;  5HE1 A;  1P5T A;  3ML4 A;  3BJI A;  3ODO A;  4IFS A;  1EGX A;  5C79 A;  4MT7 A;  1X1G A;  4CYE A;  1UEF A;  5DH9 B;  5LON B;  2DX5 A;  4KHA A;  5JHH A;  5DI9 B;  3VIA A;  2W2X C;  3HW2 B;  3DXD A;  5C6R A;  4DX9 0;  4K17 A;  3PVL A;  1UNR A;  1Q67 A;  5D3V A;  5D3X A;  2M38 A;  1MK7 B;  3F5R A;  3TVV A;  1WJM A;  2Z0Q A;  1EVH A;  3ZVR A;  3T06 A;  2MFQ A;  2K2J A;  4ZRK A;  1V5U A;  5GOW B;  2LYD A;  2VRW B;  4GXB A;  1SHC A;  3ZDT A;  1ZC4 B;  4HHV A;  1KZ7 A;  1X86 A;  2YVC A;  1J19 A;  2I1J A;  5D3Y A;  2CAY A;  5FI1 A;  1LW3 A;  3WA0 A;  1ZVR A;  4A6F B;  5C5B A;  4HB3 B;  1ZM0 A;  5CLQ B;  1DDM A;  3M1I B;  4ZRI A;  2I5C A;  1B55 A;  1RRP B;  3PVU A;  4CHM A;  3KY9 A;  4GMX B;  3PEG A;  3FM8 C;  1K5G B;  1NU2 A;  2LOX A;  5HE0 A;  1PLS A;  3FEH A;  4HB0 B;  1W1D A;  2I1K A;  4DBB A;  1XOD A;  4WJ7 A;  5JHG A;  2D2Q A;  4HAY B;  4HAZ B;  1KZG A;  2D9W A;  4HB4 B;  3ULB A;  2K2U A;  4TYZ A;  3CXB B;  3KRX A;  3ULC A;  2KGX B;  2QKM A;  1X1F A;  1Y5O A;  1MPH A;  1NTV A;  2OTX A;  3P7Z A;  5DIF B;  2YT1 A;  3TCA A;  4PQ0 A;  1WGQ A;  1BTN A;  4D0N B;  4A6H A;  1U5G A;  2D9V A;  1V88 A;  2E2X A;  2D9Y A;  3KRW A;  4ZRJ A;  4IAP A;  3O96 A;  1WG7 A;  4DXA B;  5C16 A;  3KZ1 A;  2GCL A;  1QC6 A;  3AU5 A;  4F7H A;  5J3Y A;  1H10 A;  2L2I A;  3IVF A;  1P3R A;  3X23 A;  2EMT A;  1FGZ A;  1MIX A;  1ZC3 B;  4P7I A;  1XX0 A;  2CY4 A;  3DXE A;  2GS0 A;  1P6S A;  1PFJ A;  2YSZ A;  3P6A A;  2Y8F A;  3SNH A;  2ZPY A;  2Q13 A;  1DRO A;  3A8P A;  3HK0 A;  3RCP A;  3DXC A;  4F7U P;  5LOP B;  2DYN A;  2HTH B;  4CHJ A;  2CRF A;  1NTY A;  4YL8 A;  3ODX A;  4A6K A;  2LUL A;  1DDW A;  4KHO A;  2AL6 A;  2J0K A;  3QBV B;  1AQC A;  2DN6 A;  2COD A;  1FHW A;  1WJ1 A;  1Y19 B;  2X18 A;  3GYP A;  4A5K A;  1M7R A;  1OQN A;  3D8D A;  2DA0 A;  3CIK A;  2ADZ A;  2D11 A;  2MDX A;  1AWE A;  2VSZ A;  3QIJ A;  2COA A;  2DTC A;  3U8Z A;  3D8F A;  2NZ8 B;  4MY6 A;  3G9W A;  2DKQ A;  5J3Q A;  2RVB B;  1X05 A;  4YON A;  2H7E A;  5EFX A;  4L6E A;  4HDQ A;  5J3T A;  2V76 A;  1NI2 A;  2CY5 A;  2D10 A;  2Y7B A;  1W1G A;  4Z2M B;  2P0F A;  4HB2 B;  4H8S A;  5CLL B;  4DX8 A;  1BTK A;  1XCG A;  1U5E A;  1XR0 B;  4GN1 A;  5KQ1 A;  2VKI A;  4F7G A;  2YF0 A;  3SUZ A;  1BWN A;  2Y8G A;  2R09 A;  2G35 A;  1GG3 A;  1DDV A;  2J59 M;  1XD4 A;  3WYF B;  2PZ1 A;  4IOY X;  4Z2N A;  3HQC A;  1V61 A;  5HE2 A;  3VOQ A;  3N7C A;  1I2H A;  2L1C A;  2P0D A;  2KCJ A;  3SYX A;  2EJ8 A;  1K5D B;  1SGH A;  4WVF B;  2N0Y A;  3PG7 A;  2HE7 A;  1U2B A;  4WSF A;  4NSW A;  3GYO A;  4Y94 A;  4K81 A;  2YS3 A;  2UZR A;  4EMO A;  4TKN A;  1MK9 B;  1ISN A;  4HDO A;  2DX1 A;  4HAW B;  1RJ2 A;  2OQB A;  2GCJ A;  1H4R A;  1QQG A;  4HAX B;  4MK0 A;  2YT0 A;  1U27 A;  1KI1 B;  2GJY A;  1UNP A;  2RGN B;  3PSC A;  3FSS A;  2ELA A;  1V5P A;  1V5M A;  3PZD A;  1GC6 A;  1WI1 A;  3A98 B;  2D9Z A;  2W2W A;  1U5D A;  3PP2 A;  2RUK B;  5L81 A;  3UZT A;  1N3H A;  2COC A;  5KQ4 A;  3QWM A;  1UNQ A;  2P8V A;  2Z0P A;  1FHO A;  3ODW A;  4EJN A;  2QKL A;  2DKP A;  4HAU B;  3F0W A;  3KSY A;  2D9X A;  1UPQ A;  2ROZ B;  1BAK A;  2M14 A;  2MKR A;  2YS5 A;  4PNK A;  1GC7 A;  1DYN A;  2YS1 A;  1UPR A;  2J0J A;  1DBH A; 
#chains in the Genus database with same CATH topology
 3NSU A;  1TJ6 A;  1WGU A;  2UZS A;  2RSG A;  2BCJ A;  2FJL A;  1U29 A;  5D3W A;  2ELB A;  2N23 A;  1I7A A;  3NWA A;  1FB8 A;  2EC1 A;  1MKE A;  2KIE A;  1MIZ B;  3TFM A;  1E5W A;  2DHJ A;  4KAX B;  3TW1 A;  2IYB A;  4BBK A;  5I2S A;  2MWN B;  1EAZ A;  4B6H A;  3AU4 A;  3D8E A;  1W1H A;  3AJ4 A;  1OY2 A;  1XKE A;  2COF A;  2I5F A;  4KHB B;  3SO6 A;  3MPX A;  3TO1 A;  4A6F A;  2P0H A;  5DHA B;  4K2P A;  5FI0 A;  2LOZ A;  5DHF B;  1U5F A;  4GPT B;  2AEH A;  2KR0 A;  2DHI A;  2DFK A;  2DHK A;  2XQN M;  2NMB A;  2YRY A;  2H7D A;  1MAI A;  3A8Q A;  3U12 A;  1V89 A;  2RLO A;  1X11 A;  3SV1 A;  2K8E A;  4HAV B;  4KVG B;  4GZU A;  5JP4 A;  2KUP A;  4NY0 A;  4GMV A;  2IFS A;  4OSN A;  3BIN A;  2RNR B;  1FGY A;  2ROV A;  1Z87 A;  5C5B B;  2LG1 A;  3U7D A;  2J0M A;  1FHX A;  3LJU X;  3NWD A;  3OHM B;  2R0D A;  3OAN A;  1WVH A;  1TXD A;  2K00 A;  2UVM A;  1LB1 A;  2Z0O A;  2ZKM X;  3MDB C;  1OMW A;  1TQZ A;  5D27 A;  1FAO A;  5HE3 A;  4XWX A;  4KHB A;  2DLW A;  4EKU A;  1M7E A;  4K2O A;  1EF1 A;  1FOE A;  5JLJ B;  2EMS A;  1ZSQ A;  2LKO A;  2JP2 A;  1IRS A;  1PMS A;  3V5W A;  5KCV A;  3PVW A;  2W2X D;  2DYQ A;  4QXA B;  1J0W A;  4C0A A;  2D4Q A;  4HAT B;  5HE1 A;  1P5T A;  3ML4 A;  3BJI A;  3ODO A;  4IFS A;  1EGX A;  5C79 A;  4MT7 A;  1X1G A;  4CYE A;  1UEF A;  5DH9 B;  5LON B;  1ZYI A;  2DX5 A;  4KHA A;  5JHH A;  3DCX A;  5DI9 B;  3VIA A;  2W2X C;  3HW2 B;  2Z59 A;  3DXD A;  5C6R A;  4DX9 0;  4K17 A;  3PVL A;  1UNR A;  5I2M A;  1Q67 A;  5D3V A;  5D3X A;  2M38 A;  1MK7 B;  4GNK B;  3F5R A;  3TVV A;  1WJM A;  2Z0Q A;  1EVH A;  3ZVR A;  2KIG A;  3T06 A;  4QJ3 B;  2MFQ A;  2K2J A;  4ZRK A;  1V5U A;  5GOW B;  2LYD A;  2VRW B;  4GXB A;  1SHC A;  3ZDT A;  1ZC4 B;  4HHV A;  1KZ7 A;  1X86 A;  2YVC A;  1J19 A;  2I1J A;  5D3Y A;  2CAY A;  5FI1 A;  1LW3 A;  3WA0 A;  1ZVR A;  4A6F B;  5C5B A;  4HB3 B;  1ZM0 A;  5CLQ B;  1DDM A;  1T77 A;  3M1I B;  4ZRI A;  2I5C A;  4L1R A;  1B55 A;  1RRP B;  3PVU A;  4CHM A;  3KY9 A;  4GMX B;  3PEG A;  3FM8 C;  1K5G B;  1NU2 A;  2LOX A;  5HE0 A;  1PLS A;  3FEH A;  3NW8 A;  2Z14 A;  4HB0 B;  3FVC A;  1W1D A;  2I1K A;  4DBB A;  1XOD A;  4WJ7 A;  5JHG A;  2D2Q A;  4HAY B;  4D6W A;  4HAZ B;  1KZG A;  2D9W A;  4HB4 B;  3ULB A;  2K2U A;  4TYZ A;  3CXB B;  3KRX A;  4DIX A;  4HSI A;  3ULC A;  2KGX B;  2QKM A;  1X1F A;  1Y5O A;  1MPH A;  1NTV A;  2OTX A;  3P7Z A;  5LG4 B;  5DIF B;  2YT1 A;  3TCA A;  4PQ0 A;  1WGQ A;  1BTN A;  4OT1 A;  4D0N B;  3NWF A;  4A6H A;  1U5G A;  2D9V A;  1V88 A;  2E2X A;  2D9Y A;  3KRW A;  4ZRJ A;  4CSQ A;  4IAP A;  3O96 A;  1WG7 A;  4DXA B;  5C16 A;  3KZ1 A;  2GCL A;  1QC6 A;  3AU5 A;  4F7H A;  5J3Y A;  1H10 A;  2L2I A;  3IVF A;  1P3R A;  3X23 A;  2EMT A;  1FGZ A;  1MIX A;  1ZC3 B;  4P7I A;  1XX0 A;  2CY4 A;  3DXE A;  2GS0 A;  1P6S A;  1PFJ A;  2YSZ A;  3P6A A;  2Y8F A;  3SNH A;  2ZPY A;  2Q13 A;  2NBV A;  1DRO A;  3A8P A;  3HK0 A;  3RCP A;  3DXC A;  4F7U P;  5LOP B;  3A58 A;  2DYN A;  2HTH B;  4CHJ A;  2CRF A;  4QJ4 B;  1NTY A;  4YL8 A;  3ODX A;  4A6K A;  2LUL A;  1DDW A;  4KHO A;  2AL6 A;  2GUM A;  2J0K A;  3QBV B;  1AQC A;  2DN6 A;  2COD A;  1FHW A;  1WJ1 A;  1Y19 B;  2Z4D A;  2X18 A;  3GYP A;  4A5K A;  1M7R A;  1OQN A;  3D8D A;  2DA0 A;  3CIK A;  2ADZ A;  2D11 A;  2MDX A;  1AWE A;  2VSZ A;  3QIJ A;  2K49 A;  2COA A;  2DTC A;  3U8Z A;  3D8F A;  2NZ8 B;  4MY6 A;  3G9W A;  2DKQ A;  5J3Q A;  2RVB B;  1X05 A;  4YON A;  4QJ5 B;  2H7E A;  5EFX A;  4L6E A;  4HDQ A;  5IRS A;  5J3T A;  2V76 A;  1MI1 A;  1NI2 A;  2CY5 A;  2D10 A;  2Y7B A;  1W1G A;  4Z2M B;  2P0F A;  4HB2 B;  4H8S A;  5CLL B;  4DX8 A;  1BTK A;  1XCG A;  1U5E A;  1XR0 B;  4GN1 A;  5KQ1 A;  2VKI A;  4F7G A;  2YF0 A;  3SUZ A;  1BWN A;  2Y8G A;  2R09 A;  2G35 A;  1GG3 A;  1DDV A;  2J59 M;  1XD4 A;  3WYF B;  2PZ1 A;  4IOY X;  4Z2N A;  3HQC A;  3B77 A;  1V61 A;  5HE2 A;  3VOQ A;  3N7C A;  1I2H A;  2L1C A;  2P0D A;  2KCJ A;  3HSA A;  2KUQ A;  3SYX A;  2FJU B;  2EJ8 A;  1K5D B;  1SGH A;  3HIE A;  2R2Y A;  4WVF B;  2N0Y A;  3PG7 A;  2HE7 A;  1U2B A;  4WSF A;  4NSW A;  3GYO A;  4Y94 A;  4K81 A;  2YS3 A;  2UZR A;  2RRF A;  4EMO A;  4TKN A;  1MK9 B;  1ISN A;  4HDO A;  2DX1 A;  4HAW B;  5M4Y B;  1RJ2 A;  2OQB A;  2GCJ A;  1H4R A;  1QQG A;  4HAX B;  4MK0 A;  2YT0 A;  1U27 A;  1KI1 B;  2GJY A;  1UNP A;  2RGN B;  3PSC A;  3FSS A;  2ELA A;  1V5P A;  1V5M A;  3PZD A;  1GC6 A;  1WI1 A;  3A98 B;  2D9Z A;  2W2W A;  1U5D A;  3PP2 A;  2RUK B;  2Z13 A;  5L81 A;  3UZT A;  1N3H A;  2COC A;  5KQ4 A;  3QWM A;  1UNQ A;  2P8V A;  2Z0P A;  2YT2 A;  1FHO A;  3ODW A;  4EJN A;  2QKL A;  2DKP A;  4HAU B;  3F0W A;  3KSY A;  2D9X A;  1UPQ A;  2ROZ B;  1BAK A;  2M14 A;  2MKR A;  2YS5 A;  4PNK A;  1GC7 A;  1DYN A;  2YS1 A;  1UPR A;  4GOU A;  2J0J A;  1DBH A; 
#chains in the Genus database with same CATH homology
 3NSU A;  1TJ6 A;  1WGU A;  2UZS A;  2RSG A;  2BCJ A;  2FJL A;  1U29 A;  5D3W A;  2ELB A;  2N23 A;  1I7A A;  1FB8 A;  2EC1 A;  1MKE A;  1MIZ B;  3TFM A;  1E5W A;  2DHJ A;  4KAX B;  3TW1 A;  2IYB A;  4BBK A;  2MWN B;  1EAZ A;  4B6H A;  3AU4 A;  3D8E A;  1W1H A;  3AJ4 A;  1OY2 A;  1XKE A;  2COF A;  2I5F A;  4KHB B;  3SO6 A;  3MPX A;  3TO1 A;  4A6F A;  2P0H A;  5DHA B;  4K2P A;  5FI0 A;  2LOZ A;  5DHF B;  1U5F A;  4GPT B;  2AEH A;  2DHI A;  2DFK A;  2DHK A;  2XQN M;  2NMB A;  2YRY A;  2H7D A;  1MAI A;  3A8Q A;  1V89 A;  2RLO A;  1X11 A;  3SV1 A;  4HAV B;  4KVG B;  4GZU A;  5JP4 A;  2KUP A;  4NY0 A;  4GMV A;  2IFS A;  3BIN A;  2RNR B;  1FGY A;  2ROV A;  1Z87 A;  5C5B B;  2LG1 A;  3U7D A;  2J0M A;  1FHX A;  3LJU X;  2R0D A;  3OAN A;  1WVH A;  1TXD A;  2K00 A;  2UVM A;  1LB1 A;  2Z0O A;  3MDB C;  1OMW A;  1TQZ A;  5D27 A;  1FAO A;  5HE3 A;  4XWX A;  2DLW A;  4EKU A;  1M7E A;  4K2O A;  1EF1 A;  1FOE A;  5JLJ B;  2EMS A;  1ZSQ A;  2LKO A;  2JP2 A;  1IRS A;  1PMS A;  3V5W A;  5KCV A;  3PVW A;  2W2X D;  2DYQ A;  1J0W A;  4C0A A;  2D4Q A;  4HAT B;  5HE1 A;  1P5T A;  3ML4 A;  3BJI A;  3ODO A;  4IFS A;  1EGX A;  5C79 A;  4MT7 A;  1X1G A;  4CYE A;  1UEF A;  5DH9 B;  5LON B;  2DX5 A;  4KHA A;  5JHH A;  5DI9 B;  3VIA A;  2W2X C;  3HW2 B;  3DXD A;  5C6R A;  4DX9 0;  4K17 A;  3PVL A;  1UNR A;  1Q67 A;  5D3V A;  5D3X A;  2M38 A;  1MK7 B;  3F5R A;  3TVV A;  1WJM A;  2Z0Q A;  1EVH A;  3ZVR A;  3T06 A;  2MFQ A;  2K2J A;  4ZRK A;  1V5U A;  5GOW B;  2LYD A;  2VRW B;  4GXB A;  1SHC A;  3ZDT A;  1ZC4 B;  4HHV A;  1KZ7 A;  1X86 A;  2YVC A;  1J19 A;  2I1J A;  5D3Y A;  2CAY A;  5FI1 A;  1LW3 A;  3WA0 A;  1ZVR A;  4A6F B;  5C5B A;  4HB3 B;  1ZM0 A;  5CLQ B;  1DDM A;  3M1I B;  4ZRI A;  2I5C A;  1B55 A;  1RRP B;  3PVU A;  4CHM A;  3KY9 A;  4GMX B;  3PEG A;  3FM8 C;  1K5G B;  1NU2 A;  2LOX A;  5HE0 A;  1PLS A;  3FEH A;  4HB0 B;  1W1D A;  2I1K A;  4DBB A;  1XOD A;  4WJ7 A;  5JHG A;  2D2Q A;  4HAY B;  4HAZ B;  1KZG A;  2D9W A;  4HB4 B;  3ULB A;  2K2U A;  4TYZ A;  3CXB B;  3KRX A;  3ULC A;  2KGX B;  2QKM A;  1X1F A;  1Y5O A;  1MPH A;  1NTV A;  2OTX A;  3P7Z A;  5DIF B;  2YT1 A;  3TCA A;  4PQ0 A;  1WGQ A;  1BTN A;  4D0N B;  4A6H A;  1U5G A;  2D9V A;  1V88 A;  2E2X A;  2D9Y A;  3KRW A;  4ZRJ A;  4IAP A;  3O96 A;  1WG7 A;  4DXA B;  5C16 A;  3KZ1 A;  2GCL A;  1QC6 A;  3AU5 A;  4F7H A;  5J3Y A;  1H10 A;  2L2I A;  3IVF A;  1P3R A;  3X23 A;  2EMT A;  1FGZ A;  1MIX A;  1ZC3 B;  4P7I A;  1XX0 A;  2CY4 A;  3DXE A;  2GS0 A;  1P6S A;  1PFJ A;  2YSZ A;  3P6A A;  2Y8F A;  3SNH A;  2ZPY A;  2Q13 A;  1DRO A;  3A8P A;  3HK0 A;  3RCP A;  3DXC A;  4F7U P;  5LOP B;  2DYN A;  2HTH B;  4CHJ A;  2CRF A;  1NTY A;  4YL8 A;  3ODX A;  4A6K A;  2LUL A;  1DDW A;  4KHO A;  2AL6 A;  2J0K A;  3QBV B;  1AQC A;  2DN6 A;  2COD A;  1FHW A;  1WJ1 A;  1Y19 B;  2X18 A;  3GYP A;  4A5K A;  1M7R A;  1OQN A;  3D8D A;  2DA0 A;  3CIK A;  2ADZ A;  2D11 A;  2MDX A;  1AWE A;  2VSZ A;  3QIJ A;  2COA A;  2DTC A;  3U8Z A;  3D8F A;  2NZ8 B;  4MY6 A;  3G9W A;  2DKQ A;  5J3Q A;  2RVB B;  1X05 A;  4YON A;  2H7E A;  5EFX A;  4L6E A;  4HDQ A;  5J3T A;  2V76 A;  1NI2 A;  2CY5 A;  2D10 A;  2Y7B A;  1W1G A;  4Z2M B;  2P0F A;  4HB2 B;  4H8S A;  5CLL B;  4DX8 A;  1BTK A;  1XCG A;  1U5E A;  1XR0 B;  4GN1 A;  5KQ1 A;  2VKI A;  4F7G A;  2YF0 A;  3SUZ A;  1BWN A;  2Y8G A;  2R09 A;  2G35 A;  1GG3 A;  1DDV A;  2J59 M;  1XD4 A;  3WYF B;  2PZ1 A;  4IOY X;  4Z2N A;  3HQC A;  1V61 A;  5HE2 A;  3VOQ A;  3N7C A;  1I2H A;  2L1C A;  2P0D A;  2KCJ A;  3SYX A;  2EJ8 A;  1K5D B;  1SGH A;  4WVF B;  2N0Y A;  3PG7 A;  2HE7 A;  1U2B A;  4WSF A;  4NSW A;  3GYO A;  4Y94 A;  4K81 A;  2YS3 A;  2UZR A;  4EMO A;  4TKN A;  1MK9 B;  1ISN A;  4HDO A;  2DX1 A;  4HAW B;  1RJ2 A;  2OQB A;  2GCJ A;  1H4R A;  1QQG A;  4HAX B;  4MK0 A;  2YT0 A;  1U27 A;  1KI1 B;  2GJY A;  1UNP A;  2RGN B;  3PSC A;  3FSS A;  2ELA A;  1V5P A;  1V5M A;  3PZD A;  1GC6 A;  1WI1 A;  3A98 B;  2D9Z A;  2W2W A;  1U5D A;  3PP2 A;  2RUK B;  5L81 A;  3UZT A;  1N3H A;  2COC A;  5KQ4 A;  3QWM A;  1UNQ A;  2P8V A;  2Z0P A;  1FHO A;  3ODW A;  4EJN A;  2QKL A;  2DKP A;  4HAU B;  3F0W A;  3KSY A;  2D9X A;  1UPQ A;  2ROZ B;  1BAK A;  2M14 A;  2MKR A;  2YS5 A;  4PNK A;  1GC7 A;  1DYN A;  2YS1 A;  1UPR A;  2J0J A;  1DBH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...