3WYFB

Crystal structure of xpo1p-yrb2p-gsp1p-gtp complex
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
229
structure length
144
Chain Sequence
b'KFVFGAASKFGTGFAFGSGLSFGSGFNILLQKQEVKSGEESEECIYQVNAKLYQLSNEGWKERGVGIIKINKSKDKTRIVMRSRGILKVILNIQLVKGFTVQKGFTGSLQSEKFIRLLAVDAQYAIKTKKETTDELYNIIVKSV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Gsp1p
publication title Structural insights into how yrb2p accelerates the assembly of the xpo1p nuclear export complex
pubmed doi rcsb
source organism Saccharomyces cerevisiae awri796
molecule tags Gtp-binding protein/gtp-binding protein inhibitor
total genus 24
structure length 144
sequence length 229
chains with identical sequence E
ec nomenclature
pdb deposition date 2014-08-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00638 Ran_BP1 RanBP1 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 3wyfB00
4HB0B 4PQ0A 2AEHA 1IRSA 4HAXB 1QQGA 1NTVA 2X18A 1X05A 4HB2B 3QWMA 3N7CA 1DDMA 2Q13A 2J59M 2DYNA 1WJMA 1FHXA 4ZRIA 1U5FA 3MDBC 5JHGA 4DXAB 4ZRKA 5D3XA 3FSSA 1V5PA 2J0JA 3PVLA 4IOYX 5KQ4A 1P6SA 4WSFA 1MIZB 2MFQA 1LB1A 2YVCA 4CYEA 3D8FA 3WYFB 3FM8C 1XCGA 1XODA 2DTCA 5D3VA 3AU5A 5CLQB 4YL8A 1SGHA 4KVGB 2RGNB 4P7IA 3U8ZA 1FOEA 2J0MA 2COFA 5DH9B 2MKRA 3MPXA 1MKEA 3PEGA 2NZ8B 2W2XC 2CRFA 5C79A 2GJYA 1PLSA 3D8DA 2DHIA 3KY9A 4IFSA 4K81A 2K2JA 2ROVA 1BWNA 1K5GB 4A5KA 1P5TA 2IYBA 1V61A 2R0DA 1ZC4B 2RUKB 1RJ2A 2AL6A 2L1CA 4GMVA 1U29A 1H10A 4HAZB 2MDXA 1U5DA 1UNPA 2COAA 2ELAA 4NSWA 4HHVA 1X11A 3AU4A 3KRWA 4KHAA 1XX0A 5C5BB 2DYQA 4GMXB 5CLLB 2W2XD 3F0WA 4WVFB 4GPTB 5HE0A 5J3TA 3NSUA 4HAUB 1DBHA 2HTHB 1LW3A 5HE2A 2QKLA 1X1GA 1FB8A 2I5FA 2Z0PA 2Z0QA 3IVFA 2GCJA 3A8QA 1UNQA 2EMSA 3ULBA 1DYNA 3TVVA 1AWEA 1J19A 2ADZA 5C6RA 3PP2A 2DX1A 2D11A 4K17A 2Y8GA 4CHMA 2Z0OA 1V88A 3DXDA 1UEFA 2VKIA 4KHOA 2ZPYA 3ULCA 2ROZB 1M7EA 2YS3A 3U7DA 2D9VA 2M14A 1KZ7A 2LKOA 2ELBA 2H7DA 2P8VA 4A6FA 2CODA 2VRWB 3GYOA 2D10A 2DN6A 1OY2A 3P6AA 5DHFB 4D0NB 2UZRA 5EFXA 5JP4A 3WA0A 1KI1B 2R09A 2K2UA 3LJUX 2DFKA 3X23A 2KGXB 4F7HA 1ZM0A 2LG1A 1OMWA 1EVHA 1H4RA 1QC6A 4KHBB 2CY5A 1FAOA 4EJNA 4HDOA 1UPRA 5GOWB 1GC7A 3BINA 4DBBA 1E5WA 1Y19B 3A8PA 4K2OA 1MK7B 4HAWB 3PZDA 2M38A 1RRPB 4HDQA 1KZGA 3ML4A 3HK0A 2YT0A 1X1FA 4Z2MB 1V5UA 1WVHA 5J3YA 1WGQA 1MAIA 5D27A 4H8SA 1DROA 1ZSQA 1UPQA 1NU2A 1GC6A 5HE3A 1EGXA 3KRXA 5JLJB 4MY6A 2CY4A 4YONA 1W1DA 1BTKA 2E2XA 2UVMA 2IFSA 3ZVRA 5KCVA 1J0WA 1MIXA 3ODWA 4A6HA 4CHJA 3G9WA 5C16A 3AJ4A 4PNKA 1M7RA 2VSZA 2Y7BA 1V5MA 2YS5A 2FJLA 1TXDA 1X86A 4F7UP 2YF0A 3ZDTA 4DX8A 1SHCA 1AQCA 1GG3A 4K2PA 1BTNA 4TKNA 2RNRB 1XD4A 3QBVB 2YS1A 4NY0A 3PVWA 3T06A 1I7AA 1ZVRA 1EAZA 2Y8FA 3KZ1A 2DHJA 5JHHA 4WJ7A 3P7ZA 2OQBA 5L81A 2QKMA 3VOQA 1NI2A 5KQ1A 2D9YA 1V89A 2KUPA 4MT7A 2DLWA 1ZC3B 2DA0A 3FEHA 1OQNA 2NMBA 1I2HA 1Z87A 1U2BA 5DIFB 3V5WA 2N0YA 5DHAB 4HB3B 4XWXA 2K00A 2LYDA 1FHWA 3GYPA 4KAXB 3OANA 3TCAA 3UZTA 3DXEA 4HAVB 1UNRA 4B6HA 3A98B 1BAKA 4Z2NA 2HE7A 4IAPA 1U5EA 2EMTA 4BBKA 2JP2A 3F5RA 4HB4B 3DXCA 2N23A 5FI0A 4HATB 1EF1A 2D4QA 1FGZA 3SNHA 2D9WA 3SUZA 2P0HA 1W1GA 2G35A 2RSGA 2OTXA 4L6EA 3O96A 2H7EA 2UZSA 2YT1A 4DX90 4GXBA 2LOXA 4EMOA 5J3QA 1B55A 2L2IA 1MPHA 3SV1A 3ODXA 3PVUA 2GCLA 2MWNB 2D2QA 3SYXA 2V76A 2DX5A 2LOZA 1FGYA 3M1IB 3HQCA 1WJ1A 5DI9B 3ODOA 5D3YA 2D9ZA 1P3RA 2XQNM 2EC1A 2RVBB 2GS0A 4A6KA 4MK0A 3KSYA 1W1HA 1N3HA 2DKPA 1WI1A 1XR0B 2I1KA 3HW2B 1U5GA 4Y94A 2CAYA 4HAYB 2YRYA 1MK9B 2BCJA 2RLOA 1DDWA 4EKUA 3CIKA 2DKQA 2I1JA 4GZUA 3RCPA 3VIAA 5LONB 1TQZA 1Q67A 5FI1A 3PSCA 1PFJA 4GN1A 1WGUA 3TW1A 1WG7A 4TYZA 2I5CA 3TO1A 1K5DB 1FHOA 3QIJA 5HE1A 1PMSA 3PG7A 1U27A 1TJ6A 2LULA 2D9XA 2YSZA 3CXBB 3D8EA 5D3WA 4F7GA 2P0DA 3SO6A 3BJIA 4C0AA 2COCA 2DHKA 5LOPB 4ZRJA 2EJ8A 1XKEA 4A6FB 1DDVA 2PZ1A 5C5BA 1ISNA 1NTYA 2KCJA 1Y5OA 3TFMA 2J0KA 2P0FA 2W2WA
chains in the Genus database with same CATH superfamily
2K49A 4HB0B 2Z13A 4PQ0A 2AEHA 1IRSA 4HAXB 1QQGA 1NTVA 2X18A 1X05A 4HB2B 3QWMA 3N7CA 1DDMA 2Q13A 2J59M 2DYNA 1WJMA 1FHXA 4ZRIA 1U5FA 3MDBC 5JHGA 4DXAB 2FJUB 4ZRKA 5D3XA 3FSSA 4QXAB 1V5PA 2J0JA 3PVLA 4IOYX 5KQ4A 1P6SA 4WSFA 1MIZB 2MFQA 1LB1A 2YVCA 4CYEA 3D8FA 3WYFB 3FM8C 1XCGA 1XODA 2DTCA 5D3VA 3AU5A 2NBVA 4QJ4B 5CLQB 4YL8A 1SGHA 4KVGB 2RGNB 4P7IA 3DCXA 3U8ZA 1FOEA 2J0MA 2COFA 5DH9B 2MKRA 2KIEA 3MPXA 1MKEA 3PEGA 2K8EA 2NZ8B 2W2XC 2CRFA 5C79A 2GJYA 1PLSA 3D8DA 2DHIA 3KY9A 4IFSA 4K81A 2K2JA 2ROVA 1BWNA 1K5GB 4A5KA 1P5TA 2IYBA 1V61A 2R0DA 1ZC4B 2RUKB 1RJ2A 2AL6A 2L1CA 4GMVA 1U29A 1H10A 4HAZB 4DIXA 2MDXA 2Z14A 2R2YA 1U5DA 1UNPA 2COAA 2ELAA 4NSWA 4HHVA 5IRSA 1X11A 2KIGA 3AU4A 3NW8A 3KRWA 4KHAA 1XX0A 5C5BB 2DYQA 4GMXB 5CLLB 2W2XD 3F0WA 4WVFB 4GPTB 5HE0A 5J3TA 3NSUA 4HAUB 1DBHA 2KUQA 2HTHB 1LW3A 5HE2A 2QKLA 1X1GA 4OSNA 1FB8A 2I5FA 2Z0PA 2Z0QA 3IVFA 2GCJA 3A8QA 4D6WA 1UNQA 2EMSA 3ULBA 1DYNA 3TVVA 1AWEA 1J19A 2ADZA 5C6RA 3PP2A 4QJ3B 2DX1A 2D11A 4K17A 4HSIA 2Y8GA 4CHMA 2Z0OA 1V88A 3DXDA 1UEFA 2VKIA 4KHOA 2ZPYA 3ULCA 2ROZB 1M7EA 2YS3A 3U7DA 2D9VA 2M14A 1KZ7A 2LKOA 2ELBA 2H7DA 2GUMA 2P8VA 4A6FA 2CODA 2VRWB 2YT2A 2D10A 2DN6A 1OY2A 3GYOA 3P6AA 5DHFB 5LG4B 4D0NB 3HSAA 2UZRA 5EFXA 5JP4A 3WA0A 1KI1B 2R09A 2K2UA 3LJUX 2DFKA 3X23A 2KGXB 4F7HA 1ZM0A 2LG1A 1OMWA 1EVHA 2Z4DA 1H4RA 1QC6A 4KHBB 2CY5A 1FAOA 4EJNA 4HDOA 1UPRA 5GOWB 1GC7A 3BINA 4DBBA 1E5WA 1Y19B 3A8PA 4K2OA 1MK7B 4HAWB 2Z59A 3PZDA 2M38A 1RRPB 4GOUA 4HDQA 1KZGA 4OT1A 3ML4A 3HK0A 3FVCA 2YT0A 1X1FA 4Z2MB 1V5UA 1WVHA 5J3YA 1WGQA 1MAIA 5D27A 4H8SA 1DROA 1ZSQA 1UPQA 1NU2A 1GC6A 5HE3A 1EGXA 3KRXA 5JLJB 4MY6A 2CY4A 4YONA 1W1DA 1BTKA 2E2XA 2UVMA 5M4YB 2IFSA 3ZVRA 5KCVA 1J0WA 1MIXA 3ODWA 4A6HA 4CHJA 3G9WA 5C16A 3AJ4A 4PNKA 1M7RA 2VSZA 2RRFA 2Y7BA 1V5MA 2YS5A 2FJLA 1TXDA 1X86A 4F7UP 2YF0A 3ZDTA 4DX8A 1SHCA 1AQCA 1GG3A 4K2PA 1BTNA 4TKNA 2RNRB 1XD4A 3QBVB 2YS1A 4NY0A 3PVWA 3T06A 1I7AA 1ZVRA 1EAZA 2Y8FA 3KZ1A 2DHJA 5JHHA 4WJ7A 3P7ZA 2OQBA 5L81A 2QKMA 5I2MA 3VOQA 1NI2A 3HIEA 5KQ1A 2D9YA 1V89A 2KUPA 4MT7A 2DLWA 1ZC3B 2DA0A 3FEHA 1OQNA 2NMBA 1I2HA 1Z87A 1U2BA 5DIFB 3V5WA 3B77A 2N0YA 1T77A 5DHAB 4HB3B 4XWXA 2K00A 4CSQA 2LYDA 1FHWA 3GYPA 4KAXB 3OANA 3TCAA 3UZTA 3DXEA 4HAVB 1UNRA 4B6HA 3A98B 1BAKA 4QJ5B 4Z2NA 2HE7A 4IAPA 1U5EA 2EMTA 4BBKA 2JP2A 3F5RA 4HB4B 3DXCA 2N23A 5FI0A 4HATB 1EF1A 2D4QA 1FGZA 3A58A 3SNHA 2D9WA 3SUZA 2P0HA 1ZYIA 1W1GA 2G35A 2RSGA 2OTXA 4L6EA 3O96A 2H7EA 2UZSA 2YT1A 4DX90 4GXBA 2LOXA 4EMOA 5J3QA 1B55A 2L2IA 1MPHA 3SV1A 3ODXA 3PVUA 2GCLA 2MWNB 2D2QA 3SYXA 2V76A 2DX5A 2LOZA 1FGYA 3M1IB 3HQCA 3U12A 1WJ1A 5DI9B 3ODOA 5D3YA 2D9ZA 1P3RA 2XQNM 2EC1A 2RVBB 3OHMB 2GS0A 4GNKB 4A6KA 4MK0A 3KSYA 1W1HA 1N3HA 2DKPA 1WI1A 1XR0B 2I1KA 3HW2B 1U5GA 4Y94A 2CAYA 4HAYB 2YRYA 4KHBA 2ZKMX 1MK9B 2BCJA 2RLOA 1DDWA 4EKUA 3CIKA 2DKQA 2I1JA 4GZUA 5I2SA 2KR0A 3RCPA 3VIAA 5LONB 1TQZA 1Q67A 1MI1A 5FI1A 3PSCA 1PFJA 4GN1A 1WGUA 3TW1A 3NWDA 1WG7A 4TYZA 2I5CA 3TO1A 3NWAA 1K5DB 1FHOA 3QIJA 5HE1A 1PMSA 3PG7A 1U27A 1TJ6A 2LULA 4L1RA 2D9XA 2YSZA 3CXBB 3D8EA 5D3WA 4F7GA 2P0DA 3SO6A 3BJIA 4C0AA 2COCA 2DHKA 5LOPB 4ZRJA 2EJ8A 3NWFA 1XKEA 4A6FB 1DDVA 2PZ1A 5C5BA 1ISNA 1NTYA 2KCJA 1Y5OA 3TFMA 2J0KA 2P0FA 2W2WA
chains in the Genus database with same CATH topology
4HB0B 4PQ0A 2AEHA 1IRSA 4HAXB 1QQGA 1NTVA 2X18A 1X05A 4HB2B 3QWMA 3N7CA 1DDMA 2Q13A 2J59M 2DYNA 1WJMA 1FHXA 4ZRIA 1U5FA 3MDBC 5JHGA 4DXAB 4ZRKA 5D3XA 3FSSA 1V5PA 2J0JA 3PVLA 4IOYX 5KQ4A 1P6SA 4WSFA 1MIZB 2MFQA 1LB1A 2YVCA 4CYEA 3D8FA 3WYFB 3FM8C 1XCGA 1XODA 2DTCA 5D3VA 3AU5A 5CLQB 4YL8A 1SGHA 4KVGB 2RGNB 4P7IA 3U8ZA 1FOEA 2J0MA 2COFA 5DH9B 2MKRA 3MPXA 1MKEA 3PEGA 2NZ8B 2W2XC 2CRFA 5C79A 2GJYA 1PLSA 3D8DA 2DHIA 3KY9A 4IFSA 4K81A 2K2JA 2ROVA 1BWNA 1K5GB 4A5KA 1P5TA 2IYBA 1V61A 2R0DA 1ZC4B 2RUKB 1RJ2A 2AL6A 2L1CA 4GMVA 1U29A 1H10A 4HAZB 2MDXA 1U5DA 1UNPA 2COAA 2ELAA 4NSWA 4HHVA 1X11A 3AU4A 3KRWA 4KHAA 1XX0A 5C5BB 2DYQA 4GMXB 5CLLB 2W2XD 3F0WA 4WVFB 4GPTB 5HE0A 5J3TA 3NSUA 4HAUB 1DBHA 2HTHB 1LW3A 5HE2A 2QKLA 1X1GA 1FB8A 2I5FA 2Z0PA 2Z0QA 3IVFA 2GCJA 3A8QA 1UNQA 2EMSA 3ULBA 1DYNA 3TVVA 1AWEA 1J19A 2ADZA 5C6RA 3PP2A 2DX1A 2D11A 4K17A 2Y8GA 4CHMA 2Z0OA 1V88A 3DXDA 1UEFA 2VKIA 4KHOA 2ZPYA 3ULCA 2ROZB 1M7EA 2YS3A 3U7DA 2D9VA 2M14A 1KZ7A 2LKOA 2ELBA 2H7DA 2P8VA 4A6FA 2CODA 2VRWB 3GYOA 2D10A 2DN6A 1OY2A 3P6AA 5DHFB 4D0NB 2UZRA 5EFXA 5JP4A 3WA0A 1KI1B 2R09A 2K2UA 3LJUX 2DFKA 3X23A 2KGXB 4F7HA 1ZM0A 2LG1A 1OMWA 1EVHA 1H4RA 1QC6A 4KHBB 2CY5A 1FAOA 4EJNA 4HDOA 1UPRA 5GOWB 1GC7A 3BINA 4DBBA 1E5WA 1Y19B 3A8PA 4K2OA 1MK7B 4HAWB 3PZDA 2M38A 1RRPB 4HDQA 1KZGA 3ML4A 3HK0A 2YT0A 1X1FA 4Z2MB 1V5UA 1WVHA 5J3YA 1WGQA 1MAIA 5D27A 4H8SA 1DROA 1ZSQA 1UPQA 1NU2A 1GC6A 5HE3A 1EGXA 3KRXA 5JLJB 4MY6A 2CY4A 4YONA 1W1DA 1BTKA 2E2XA 2UVMA 2IFSA 3ZVRA 5KCVA 1J0WA 1MIXA 3ODWA 4A6HA 4CHJA 3G9WA 5C16A 3AJ4A 4PNKA 1M7RA 2VSZA 2Y7BA 1V5MA 2YS5A 2FJLA 1TXDA 1X86A 4F7UP 2YF0A 3ZDTA 4DX8A 1SHCA 1AQCA 1GG3A 4K2PA 1BTNA 4TKNA 2RNRB 1XD4A 3QBVB 2YS1A 4NY0A 3PVWA 3T06A 1I7AA 1ZVRA 1EAZA 2Y8FA 3KZ1A 2DHJA 5JHHA 4WJ7A 3P7ZA 2OQBA 5L81A 2QKMA 3VOQA 1NI2A 5KQ1A 2D9YA 1V89A 2KUPA 4MT7A 2DLWA 1ZC3B 2DA0A 3FEHA 1OQNA 2NMBA 1I2HA 1Z87A 1U2BA 5DIFB 3V5WA 2N0YA 5DHAB 4HB3B 4XWXA 2K00A 2LYDA 1FHWA 3GYPA 4KAXB 3OANA 3TCAA 3UZTA 3DXEA 4HAVB 1UNRA 4B6HA 3A98B 1BAKA 4Z2NA 2HE7A 4IAPA 1U5EA 2EMTA 4BBKA 2JP2A 3F5RA 4HB4B 3DXCA 2N23A 5FI0A 4HATB 1EF1A 2D4QA 1FGZA 3SNHA 2D9WA 3SUZA 2P0HA 1W1GA 2G35A 2RSGA 2OTXA 4L6EA 3O96A 2H7EA 2UZSA 2YT1A 4DX90 4GXBA 2LOXA 4EMOA 5J3QA 1B55A 2L2IA 1MPHA 3SV1A 3ODXA 3PVUA 2GCLA 2MWNB 2D2QA 3SYXA 2V76A 2DX5A 2LOZA 1FGYA 3M1IB 3HQCA 1WJ1A 5DI9B 3ODOA 5D3YA 2D9ZA 1P3RA 2XQNM 2EC1A 2RVBB 2GS0A 4A6KA 4MK0A 3KSYA 1W1HA 1N3HA 2DKPA 1WI1A 1XR0B 2I1KA 3HW2B 1U5GA 4Y94A 2CAYA 4HAYB 2YRYA 1MK9B 2BCJA 2RLOA 1DDWA 4EKUA 3CIKA 2DKQA 2I1JA 4GZUA 3RCPA 3VIAA 5LONB 1TQZA 1Q67A 5FI1A 3PSCA 1PFJA 4GN1A 1WGUA 3TW1A 1WG7A 4TYZA 2I5CA 3TO1A 1K5DB 1FHOA 3QIJA 5HE1A 1PMSA 3PG7A 1U27A 1TJ6A 2LULA 2D9XA 2YSZA 3CXBB 3D8EA 5D3WA 4F7GA 2P0DA 3SO6A 3BJIA 4C0AA 2COCA 2DHKA 5LOPB 4ZRJA 2EJ8A 1XKEA 4A6FB 1DDVA 2PZ1A 5C5BA 1ISNA 1NTYA 2KCJA 1Y5OA 3TFMA 2J0KA 2P0FA 2W2WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HB0 B;  4PQ0 A;  2AEH A;  1IRS A;  4HAX B;  1QQG A;  1NTV A;  2X18 A;  1X05 A;  4HB2 B;  3QWM A;  3N7C A;  1DDM A;  2Q13 A;  2J59 M;  2DYN A;  1WJM A;  1FHX A;  4ZRI A;  1U5F A;  3MDB C;  5JHG A;  4DXA B;  4ZRK A;  5D3X A;  3FSS A;  1V5P A;  2J0J A;  3PVL A;  4IOY X;  5KQ4 A;  1P6S A;  4WSF A;  1MIZ B;  2MFQ A;  1LB1 A;  2YVC A;  4CYE A;  3D8F A;  3WYF B;  3FM8 C;  1XCG A;  1XOD A;  2DTC A;  5D3V A;  3AU5 A;  5CLQ B;  4YL8 A;  1SGH A;  4KVG B;  2RGN B;  4P7I A;  3U8Z A;  1FOE A;  2J0M A;  2COF A;  5DH9 B;  2MKR A;  3MPX A;  1MKE A;  3PEG A;  2NZ8 B;  2W2X C;  2CRF A;  5C79 A;  2GJY A;  1PLS A;  3D8D A;  2DHI A;  3KY9 A;  4IFS A;  4K81 A;  2K2J A;  2ROV A;  1BWN A;  1K5G B;  4A5K A;  1P5T A;  2IYB A;  1V61 A;  2R0D A;  1ZC4 B;  2RUK B;  1RJ2 A;  2AL6 A;  2L1C A;  4GMV A;  1U29 A;  1H10 A;  4HAZ B;  2MDX A;  1U5D A;  1UNP A;  2COA A;  2ELA A;  4NSW A;  4HHV A;  1X11 A;  3AU4 A;  3KRW A;  4KHA A;  1XX0 A;  5C5B B;  2DYQ A;  4GMX B;  5CLL B;  2W2X D;  3F0W A;  4WVF B;  4GPT B;  5HE0 A;  5J3T A;  3NSU A;  4HAU B;  1DBH A;  2HTH B;  1LW3 A;  5HE2 A;  2QKL A;  1X1G A;  1FB8 A;  2I5F A;  2Z0P A;  2Z0Q A;  3IVF A;  2GCJ A;  3A8Q A;  1UNQ A;  2EMS A;  3ULB A;  1DYN A;  3TVV A;  1AWE A;  1J19 A;  2ADZ A;  5C6R A;  3PP2 A;  2DX1 A;  2D11 A;  4K17 A;  2Y8G A;  4CHM A;  2Z0O A;  1V88 A;  3DXD A;  1UEF A;  2VKI A;  4KHO A;  2ZPY A;  3ULC A;  2ROZ B;  1M7E A;  2YS3 A;  3U7D A;  2D9V A;  2M14 A;  1KZ7 A;  2LKO A;  2ELB A;  2H7D A;  2P8V A;  4A6F A;  2COD A;  2VRW B;  3GYO A;  2D10 A;  2DN6 A;  1OY2 A;  3P6A A;  5DHF B;  4D0N B;  2UZR A;  5EFX A;  5JP4 A;  3WA0 A;  1KI1 B;  2R09 A;  2K2U A;  3LJU X;  2DFK A;  3X23 A;  2KGX B;  4F7H A;  1ZM0 A;  2LG1 A;  1OMW A;  1EVH A;  1H4R A;  1QC6 A;  4KHB B;  2CY5 A;  1FAO A;  4EJN A;  4HDO A;  1UPR A;  5GOW B;  1GC7 A;  3BIN A;  4DBB A;  1E5W A;  1Y19 B;  3A8P A;  4K2O A;  1MK7 B;  4HAW B;  3PZD A;  2M38 A;  1RRP B;  4HDQ A;  1KZG A;  3ML4 A;  3HK0 A;  2YT0 A;  1X1F A;  4Z2M B;  1V5U A;  1WVH A;  5J3Y A;  1WGQ A;  1MAI A;  5D27 A;  4H8S A;  1DRO A;  1ZSQ A;  1UPQ A;  1NU2 A;  1GC6 A;  5HE3 A;  1EGX A;  3KRX A;  5JLJ B;  4MY6 A;  2CY4 A;  4YON A;  1W1D A;  1BTK A;  2E2X A;  2UVM A;  2IFS A;  3ZVR A;  5KCV A;  1J0W A;  1MIX A;  3ODW A;  4A6H A;  4CHJ A;  3G9W A;  5C16 A;  3AJ4 A;  4PNK A;  1M7R A;  2VSZ A;  2Y7B A;  1V5M A;  2YS5 A;  2FJL A;  1TXD A;  1X86 A;  4F7U P;  2YF0 A;  3ZDT A;  4DX8 A;  1SHC A;  1AQC A;  1GG3 A;  4K2P A;  1BTN A;  4TKN A;  2RNR B;  1XD4 A;  3QBV B;  2YS1 A;  4NY0 A;  3PVW A;  3T06 A;  1I7A A;  1ZVR A;  1EAZ A;  2Y8F A;  3KZ1 A;  2DHJ A;  5JHH A;  4WJ7 A;  3P7Z A;  2OQB A;  5L81 A;  2QKM A;  3VOQ A;  1NI2 A;  5KQ1 A;  2D9Y A;  1V89 A;  2KUP A;  4MT7 A;  2DLW A;  1ZC3 B;  2DA0 A;  3FEH A;  1OQN A;  2NMB A;  1I2H A;  1Z87 A;  1U2B A;  5DIF B;  3V5W A;  2N0Y A;  5DHA B;  4HB3 B;  4XWX A;  2K00 A;  2LYD A;  1FHW A;  3GYP A;  4KAX B;  3OAN A;  3TCA A;  3UZT A;  3DXE A;  4HAV B;  1UNR A;  4B6H A;  3A98 B;  1BAK A;  4Z2N A;  2HE7 A;  4IAP A;  1U5E A;  2EMT A;  4BBK A;  2JP2 A;  3F5R A;  4HB4 B;  3DXC A;  2N23 A;  5FI0 A;  4HAT B;  1EF1 A;  2D4Q A;  1FGZ A;  3SNH A;  2D9W A;  3SUZ A;  2P0H A;  1W1G A;  2G35 A;  2RSG A;  2OTX A;  4L6E A;  3O96 A;  2H7E A;  2UZS A;  2YT1 A;  4DX9 0;  4GXB A;  2LOX A;  4EMO A;  5J3Q A;  1B55 A;  2L2I A;  1MPH A;  3SV1 A;  3ODX A;  3PVU A;  2GCL A;  2MWN B;  2D2Q A;  3SYX A;  2V76 A;  2DX5 A;  2LOZ A;  1FGY A;  3M1I B;  3HQC A;  1WJ1 A;  5DI9 B;  3ODO A;  5D3Y A;  2D9Z A;  1P3R A;  2XQN M;  2EC1 A;  2RVB B;  2GS0 A;  4A6K A;  4MK0 A;  3KSY A;  1W1H A;  1N3H A;  2DKP A;  1WI1 A;  1XR0 B;  2I1K A;  3HW2 B;  1U5G A;  4Y94 A;  2CAY A;  4HAY B;  2YRY A;  1MK9 B;  2BCJ A;  2RLO A;  1DDW A;  4EKU A;  3CIK A;  2DKQ A;  2I1J A;  4GZU A;  3RCP A;  3VIA A;  5LON B;  1TQZ A;  1Q67 A;  5FI1 A;  3PSC A;  1PFJ A;  4GN1 A;  1WGU A;  3TW1 A;  1WG7 A;  4TYZ A;  2I5C A;  3TO1 A;  1K5D B;  1FHO A;  3QIJ A;  5HE1 A;  1PMS A;  3PG7 A;  1U27 A;  1TJ6 A;  2LUL A;  2D9X A;  2YSZ A;  3CXB B;  3D8E A;  5D3W A;  4F7G A;  2P0D A;  3SO6 A;  3BJI A;  4C0A A;  2COC A;  2DHK A;  5LOP B;  4ZRJ A;  2EJ8 A;  1XKE A;  4A6F B;  1DDV A;  2PZ1 A;  5C5B A;  1ISN A;  1NTY A;  2KCJ A;  1Y5O A;  3TFM A;  2J0K A;  2P0F A;  2W2W A; 
#chains in the Genus database with same CATH topology
 2K49 A;  4HB0 B;  2Z13 A;  4PQ0 A;  2AEH A;  1IRS A;  4HAX B;  1QQG A;  1NTV A;  2X18 A;  1X05 A;  4HB2 B;  3QWM A;  3N7C A;  1DDM A;  2Q13 A;  2J59 M;  2DYN A;  1WJM A;  1FHX A;  4ZRI A;  1U5F A;  3MDB C;  5JHG A;  4DXA B;  2FJU B;  4ZRK A;  5D3X A;  3FSS A;  4QXA B;  1V5P A;  2J0J A;  3PVL A;  4IOY X;  5KQ4 A;  1P6S A;  4WSF A;  1MIZ B;  2MFQ A;  1LB1 A;  2YVC A;  4CYE A;  3D8F A;  3WYF B;  3FM8 C;  1XCG A;  1XOD A;  2DTC A;  5D3V A;  3AU5 A;  2NBV A;  4QJ4 B;  5CLQ B;  4YL8 A;  1SGH A;  4KVG B;  2RGN B;  4P7I A;  3DCX A;  3U8Z A;  1FOE A;  2J0M A;  2COF A;  5DH9 B;  2MKR A;  2KIE A;  3MPX A;  1MKE A;  3PEG A;  2K8E A;  2NZ8 B;  2W2X C;  2CRF A;  5C79 A;  2GJY A;  1PLS A;  3D8D A;  2DHI A;  3KY9 A;  4IFS A;  4K81 A;  2K2J A;  2ROV A;  1BWN A;  1K5G B;  4A5K A;  1P5T A;  2IYB A;  1V61 A;  2R0D A;  1ZC4 B;  2RUK B;  1RJ2 A;  2AL6 A;  2L1C A;  4GMV A;  1U29 A;  1H10 A;  4HAZ B;  4DIX A;  2MDX A;  2Z14 A;  2R2Y A;  1U5D A;  1UNP A;  2COA A;  2ELA A;  4NSW A;  4HHV A;  5IRS A;  1X11 A;  2KIG A;  3AU4 A;  3NW8 A;  3KRW A;  4KHA A;  1XX0 A;  5C5B B;  2DYQ A;  4GMX B;  5CLL B;  2W2X D;  3F0W A;  4WVF B;  4GPT B;  5HE0 A;  5J3T A;  3NSU A;  4HAU B;  1DBH A;  2KUQ A;  2HTH B;  1LW3 A;  5HE2 A;  2QKL A;  1X1G A;  4OSN A;  1FB8 A;  2I5F A;  2Z0P A;  2Z0Q A;  3IVF A;  2GCJ A;  3A8Q A;  4D6W A;  1UNQ A;  2EMS A;  3ULB A;  1DYN A;  3TVV A;  1AWE A;  1J19 A;  2ADZ A;  5C6R A;  3PP2 A;  4QJ3 B;  2DX1 A;  2D11 A;  4K17 A;  4HSI A;  2Y8G A;  4CHM A;  2Z0O A;  1V88 A;  3DXD A;  1UEF A;  2VKI A;  4KHO A;  2ZPY A;  3ULC A;  2ROZ B;  1M7E A;  2YS3 A;  3U7D A;  2D9V A;  2M14 A;  1KZ7 A;  2LKO A;  2ELB A;  2H7D A;  2GUM A;  2P8V A;  4A6F A;  2COD A;  2VRW B;  2YT2 A;  2D10 A;  2DN6 A;  1OY2 A;  3GYO A;  3P6A A;  5DHF B;  5LG4 B;  4D0N B;  3HSA A;  2UZR A;  5EFX A;  5JP4 A;  3WA0 A;  1KI1 B;  2R09 A;  2K2U A;  3LJU X;  2DFK A;  3X23 A;  2KGX B;  4F7H A;  1ZM0 A;  2LG1 A;  1OMW A;  1EVH A;  2Z4D A;  1H4R A;  1QC6 A;  4KHB B;  2CY5 A;  1FAO A;  4EJN A;  4HDO A;  1UPR A;  5GOW B;  1GC7 A;  3BIN A;  4DBB A;  1E5W A;  1Y19 B;  3A8P A;  4K2O A;  1MK7 B;  4HAW B;  2Z59 A;  3PZD A;  2M38 A;  1RRP B;  4GOU A;  4HDQ A;  1KZG A;  4OT1 A;  3ML4 A;  3HK0 A;  3FVC A;  2YT0 A;  1X1F A;  4Z2M B;  1V5U A;  1WVH A;  5J3Y A;  1WGQ A;  1MAI A;  5D27 A;  4H8S A;  1DRO A;  1ZSQ A;  1UPQ A;  1NU2 A;  1GC6 A;  5HE3 A;  1EGX A;  3KRX A;  5JLJ B;  4MY6 A;  2CY4 A;  4YON A;  1W1D A;  1BTK A;  2E2X A;  2UVM A;  5M4Y B;  2IFS A;  3ZVR A;  5KCV A;  1J0W A;  1MIX A;  3ODW A;  4A6H A;  4CHJ A;  3G9W A;  5C16 A;  3AJ4 A;  4PNK A;  1M7R A;  2VSZ A;  2RRF A;  2Y7B A;  1V5M A;  2YS5 A;  2FJL A;  1TXD A;  1X86 A;  4F7U P;  2YF0 A;  3ZDT A;  4DX8 A;  1SHC A;  1AQC A;  1GG3 A;  4K2P A;  1BTN A;  4TKN A;  2RNR B;  1XD4 A;  3QBV B;  2YS1 A;  4NY0 A;  3PVW A;  3T06 A;  1I7A A;  1ZVR A;  1EAZ A;  2Y8F A;  3KZ1 A;  2DHJ A;  5JHH A;  4WJ7 A;  3P7Z A;  2OQB A;  5L81 A;  2QKM A;  5I2M A;  3VOQ A;  1NI2 A;  3HIE A;  5KQ1 A;  2D9Y A;  1V89 A;  2KUP A;  4MT7 A;  2DLW A;  1ZC3 B;  2DA0 A;  3FEH A;  1OQN A;  2NMB A;  1I2H A;  1Z87 A;  1U2B A;  5DIF B;  3V5W A;  3B77 A;  2N0Y A;  1T77 A;  5DHA B;  4HB3 B;  4XWX A;  2K00 A;  4CSQ A;  2LYD A;  1FHW A;  3GYP A;  4KAX B;  3OAN A;  3TCA A;  3UZT A;  3DXE A;  4HAV B;  1UNR A;  4B6H A;  3A98 B;  1BAK A;  4QJ5 B;  4Z2N A;  2HE7 A;  4IAP A;  1U5E A;  2EMT A;  4BBK A;  2JP2 A;  3F5R A;  4HB4 B;  3DXC A;  2N23 A;  5FI0 A;  4HAT B;  1EF1 A;  2D4Q A;  1FGZ A;  3A58 A;  3SNH A;  2D9W A;  3SUZ A;  2P0H A;  1ZYI A;  1W1G A;  2G35 A;  2RSG A;  2OTX A;  4L6E A;  3O96 A;  2H7E A;  2UZS A;  2YT1 A;  4DX9 0;  4GXB A;  2LOX A;  4EMO A;  5J3Q A;  1B55 A;  2L2I A;  1MPH A;  3SV1 A;  3ODX A;  3PVU A;  2GCL A;  2MWN B;  2D2Q A;  3SYX A;  2V76 A;  2DX5 A;  2LOZ A;  1FGY A;  3M1I B;  3HQC A;  3U12 A;  1WJ1 A;  5DI9 B;  3ODO A;  5D3Y A;  2D9Z A;  1P3R A;  2XQN M;  2EC1 A;  2RVB B;  3OHM B;  2GS0 A;  4GNK B;  4A6K A;  4MK0 A;  3KSY A;  1W1H A;  1N3H A;  2DKP A;  1WI1 A;  1XR0 B;  2I1K A;  3HW2 B;  1U5G A;  4Y94 A;  2CAY A;  4HAY B;  2YRY A;  4KHB A;  2ZKM X;  1MK9 B;  2BCJ A;  2RLO A;  1DDW A;  4EKU A;  3CIK A;  2DKQ A;  2I1J A;  4GZU A;  5I2S A;  2KR0 A;  3RCP A;  3VIA A;  5LON B;  1TQZ A;  1Q67 A;  1MI1 A;  5FI1 A;  3PSC A;  1PFJ A;  4GN1 A;  1WGU A;  3TW1 A;  3NWD A;  1WG7 A;  4TYZ A;  2I5C A;  3TO1 A;  3NWA A;  1K5D B;  1FHO A;  3QIJ A;  5HE1 A;  1PMS A;  3PG7 A;  1U27 A;  1TJ6 A;  2LUL A;  4L1R A;  2D9X A;  2YSZ A;  3CXB B;  3D8E A;  5D3W A;  4F7G A;  2P0D A;  3SO6 A;  3BJI A;  4C0A A;  2COC A;  2DHK A;  5LOP B;  4ZRJ A;  2EJ8 A;  3NWF A;  1XKE A;  4A6F B;  1DDV A;  2PZ1 A;  5C5B A;  1ISN A;  1NTY A;  2KCJ A;  1Y5O A;  3TFM A;  2J0K A;  2P0F A;  2W2W A; 
#chains in the Genus database with same CATH homology
 4HB0 B;  4PQ0 A;  2AEH A;  1IRS A;  4HAX B;  1QQG A;  1NTV A;  2X18 A;  1X05 A;  4HB2 B;  3QWM A;  3N7C A;  1DDM A;  2Q13 A;  2J59 M;  2DYN A;  1WJM A;  1FHX A;  4ZRI A;  1U5F A;  3MDB C;  5JHG A;  4DXA B;  4ZRK A;  5D3X A;  3FSS A;  1V5P A;  2J0J A;  3PVL A;  4IOY X;  5KQ4 A;  1P6S A;  4WSF A;  1MIZ B;  2MFQ A;  1LB1 A;  2YVC A;  4CYE A;  3D8F A;  3WYF B;  3FM8 C;  1XCG A;  1XOD A;  2DTC A;  5D3V A;  3AU5 A;  5CLQ B;  4YL8 A;  1SGH A;  4KVG B;  2RGN B;  4P7I A;  3U8Z A;  1FOE A;  2J0M A;  2COF A;  5DH9 B;  2MKR A;  3MPX A;  1MKE A;  3PEG A;  2NZ8 B;  2W2X C;  2CRF A;  5C79 A;  2GJY A;  1PLS A;  3D8D A;  2DHI A;  3KY9 A;  4IFS A;  4K81 A;  2K2J A;  2ROV A;  1BWN A;  1K5G B;  4A5K A;  1P5T A;  2IYB A;  1V61 A;  2R0D A;  1ZC4 B;  2RUK B;  1RJ2 A;  2AL6 A;  2L1C A;  4GMV A;  1U29 A;  1H10 A;  4HAZ B;  2MDX A;  1U5D A;  1UNP A;  2COA A;  2ELA A;  4NSW A;  4HHV A;  1X11 A;  3AU4 A;  3KRW A;  4KHA A;  1XX0 A;  5C5B B;  2DYQ A;  4GMX B;  5CLL B;  2W2X D;  3F0W A;  4WVF B;  4GPT B;  5HE0 A;  5J3T A;  3NSU A;  4HAU B;  1DBH A;  2HTH B;  1LW3 A;  5HE2 A;  2QKL A;  1X1G A;  1FB8 A;  2I5F A;  2Z0P A;  2Z0Q A;  3IVF A;  2GCJ A;  3A8Q A;  1UNQ A;  2EMS A;  3ULB A;  1DYN A;  3TVV A;  1AWE A;  1J19 A;  2ADZ A;  5C6R A;  3PP2 A;  2DX1 A;  2D11 A;  4K17 A;  2Y8G A;  4CHM A;  2Z0O A;  1V88 A;  3DXD A;  1UEF A;  2VKI A;  4KHO A;  2ZPY A;  3ULC A;  2ROZ B;  1M7E A;  2YS3 A;  3U7D A;  2D9V A;  2M14 A;  1KZ7 A;  2LKO A;  2ELB A;  2H7D A;  2P8V A;  4A6F A;  2COD A;  2VRW B;  3GYO A;  2D10 A;  2DN6 A;  1OY2 A;  3P6A A;  5DHF B;  4D0N B;  2UZR A;  5EFX A;  5JP4 A;  3WA0 A;  1KI1 B;  2R09 A;  2K2U A;  3LJU X;  2DFK A;  3X23 A;  2KGX B;  4F7H A;  1ZM0 A;  2LG1 A;  1OMW A;  1EVH A;  1H4R A;  1QC6 A;  4KHB B;  2CY5 A;  1FAO A;  4EJN A;  4HDO A;  1UPR A;  5GOW B;  1GC7 A;  3BIN A;  4DBB A;  1E5W A;  1Y19 B;  3A8P A;  4K2O A;  1MK7 B;  4HAW B;  3PZD A;  2M38 A;  1RRP B;  4HDQ A;  1KZG A;  3ML4 A;  3HK0 A;  2YT0 A;  1X1F A;  4Z2M B;  1V5U A;  1WVH A;  5J3Y A;  1WGQ A;  1MAI A;  5D27 A;  4H8S A;  1DRO A;  1ZSQ A;  1UPQ A;  1NU2 A;  1GC6 A;  5HE3 A;  1EGX A;  3KRX A;  5JLJ B;  4MY6 A;  2CY4 A;  4YON A;  1W1D A;  1BTK A;  2E2X A;  2UVM A;  2IFS A;  3ZVR A;  5KCV A;  1J0W A;  1MIX A;  3ODW A;  4A6H A;  4CHJ A;  3G9W A;  5C16 A;  3AJ4 A;  4PNK A;  1M7R A;  2VSZ A;  2Y7B A;  1V5M A;  2YS5 A;  2FJL A;  1TXD A;  1X86 A;  4F7U P;  2YF0 A;  3ZDT A;  4DX8 A;  1SHC A;  1AQC A;  1GG3 A;  4K2P A;  1BTN A;  4TKN A;  2RNR B;  1XD4 A;  3QBV B;  2YS1 A;  4NY0 A;  3PVW A;  3T06 A;  1I7A A;  1ZVR A;  1EAZ A;  2Y8F A;  3KZ1 A;  2DHJ A;  5JHH A;  4WJ7 A;  3P7Z A;  2OQB A;  5L81 A;  2QKM A;  3VOQ A;  1NI2 A;  5KQ1 A;  2D9Y A;  1V89 A;  2KUP A;  4MT7 A;  2DLW A;  1ZC3 B;  2DA0 A;  3FEH A;  1OQN A;  2NMB A;  1I2H A;  1Z87 A;  1U2B A;  5DIF B;  3V5W A;  2N0Y A;  5DHA B;  4HB3 B;  4XWX A;  2K00 A;  2LYD A;  1FHW A;  3GYP A;  4KAX B;  3OAN A;  3TCA A;  3UZT A;  3DXE A;  4HAV B;  1UNR A;  4B6H A;  3A98 B;  1BAK A;  4Z2N A;  2HE7 A;  4IAP A;  1U5E A;  2EMT A;  4BBK A;  2JP2 A;  3F5R A;  4HB4 B;  3DXC A;  2N23 A;  5FI0 A;  4HAT B;  1EF1 A;  2D4Q A;  1FGZ A;  3SNH A;  2D9W A;  3SUZ A;  2P0H A;  1W1G A;  2G35 A;  2RSG A;  2OTX A;  4L6E A;  3O96 A;  2H7E A;  2UZS A;  2YT1 A;  4DX9 0;  4GXB A;  2LOX A;  4EMO A;  5J3Q A;  1B55 A;  2L2I A;  1MPH A;  3SV1 A;  3ODX A;  3PVU A;  2GCL A;  2MWN B;  2D2Q A;  3SYX A;  2V76 A;  2DX5 A;  2LOZ A;  1FGY A;  3M1I B;  3HQC A;  1WJ1 A;  5DI9 B;  3ODO A;  5D3Y A;  2D9Z A;  1P3R A;  2XQN M;  2EC1 A;  2RVB B;  2GS0 A;  4A6K A;  4MK0 A;  3KSY A;  1W1H A;  1N3H A;  2DKP A;  1WI1 A;  1XR0 B;  2I1K A;  3HW2 B;  1U5G A;  4Y94 A;  2CAY A;  4HAY B;  2YRY A;  1MK9 B;  2BCJ A;  2RLO A;  1DDW A;  4EKU A;  3CIK A;  2DKQ A;  2I1J A;  4GZU A;  3RCP A;  3VIA A;  5LON B;  1TQZ A;  1Q67 A;  5FI1 A;  3PSC A;  1PFJ A;  4GN1 A;  1WGU A;  3TW1 A;  1WG7 A;  4TYZ A;  2I5C A;  3TO1 A;  1K5D B;  1FHO A;  3QIJ A;  5HE1 A;  1PMS A;  3PG7 A;  1U27 A;  1TJ6 A;  2LUL A;  2D9X A;  2YSZ A;  3CXB B;  3D8E A;  5D3W A;  4F7G A;  2P0D A;  3SO6 A;  3BJI A;  4C0A A;  2COC A;  2DHK A;  5LOP B;  4ZRJ A;  2EJ8 A;  1XKE A;  4A6F B;  1DDV A;  2PZ1 A;  5C5B A;  1ISN A;  1NTY A;  2KCJ A;  1Y5O A;  3TFM A;  2J0K A;  2P0F A;  2W2W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...