3WYFB

Crystal structure of xpo1p-yrb2p-gsp1p-gtp complex
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
229
structure length
144
Chain Sequence
KFVFGAASKFGTGFAFGSGLSFGSGFNILLQKQEVKSGEESEECIYQVNAKLYQLSNEGWKERGVGIIKINKSKDKTRIVMRSRGILKVILNIQLVKGFTVQKGFTGSLQSEKFIRLLAVDAQYAIKTKKETTDELYNIIVKSV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Gtp-binding protein/gtp-binding protein inhibitor
molecule keywords Gsp1p
publication title Structural insights into how yrb2p accelerates the assembly of the xpo1p nuclear export complex
pubmed doi rcsb
source organism Saccharomyces cerevisiae awri796
total genus 24
structure length 144
sequence length 229
chains with identical sequence E
ec nomenclature
pdb deposition date 2014-08-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00638 Ran_BP1 RanBP1 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 3wyfB00
4HB4B 4HDQA 1KI1B 3U8ZA 2DTCA 3PG7A 2LOXA 1UNQA 3KRXA 2ROVA 3DXDA 2H7EA 3MPXA 4F7GA 4KVGB 3PSCA 4KHAA 4IFSA 2DKPA 4C0AA 2DA0A 2EJ8A 3SNHA 4TYZA 4WSFA 5J3YA 2D9VA 1LB1A 5LONB 4GPTB 3RCPA 4EKUA 2GCLA 1X05A 3TO1A 1EAZA 1MK7B 3WA0A 2DX1A 5HE2A 5LOPB 1UEFA 2MWNB 3V5WA 4A6FB 3DXEA 4F7UP 1Y19B 1UNPA 4Z2MB 2VSZA 2W2XD 5KQ1A 3BINA 3ULBA 2KGXB 1FB8A 2BCJA 2LKOA 3MDBC 1QQGA 2YT1A 2YS5A 3D8EA 1EVHA 4DXAB 3TFMA 1OY2A 2IYBA 5HE0A 4NY0A 4HB2B 3GYPA 1Q67A 1U5GA 2HE7A 4HAUB 1H4RA 1NTVA 2D10A 5D3WA 2MDXA 4H8SA 5GOWB 1IRSA 2CODA 1B55A 1AWEA 1UNRA 3ODOA 2Q13A 4NSWA 2K00A 4D0NB 5JHGA 3X23A 2Z0OA 1GG3A 5C79A 4GZUA 2L1CA 4CYEA 1PLSA 5C5BB 2I5CA 3CXBB 2P0DA 3T06A 3SYXA 1BTKA 2PZ1A 4EJNA 2FJLA 1XODA 3F5RA 1Z87A 1QC6A 2UVMA 1NI2A 1LW3A 5HE1A 2ELAA 3HQCA 2DHJA 2EMTA 3TCAA 4IAPA 1U5FA 1V61A 2J0JA 3ZVRA 2EC1A 2DFKA 2D11A 1OMWA 1EGXA 1J0WA 2D4QA 3CIKA 4EMOA 3F0WA 1MPHA 1I2HA 3A8PA 1MKEA 1XD4A 1W1GA 1MIZB 5DHFB 1GC7A 3KSYA 1PFJA 4A5KA 4GMVA 1DDWA 5HE3A 1EF1A 3QIJA 2P0HA 4K17A 1FHXA 3HW2B 2AEHA 1FHOA 2DKQA 3SO6A 5L81A 4GN1A 1SGHA 4CHJA 1FGZA 1ZSQA 1KZGA 1WJMA 2CY4A 2MKRA 3ML4A 4L6EA 5FI0A 4HAVB 4F7HA 2W2WA 3P7ZA 1KZ7A 4B6HA 1WGUA 2W2XC 1DBHA 2GJYA 2COAA 2XQNM 4A6FA 1UPRA 1OQNA 3HK0A 2DHKA 2R09A 1ZM0A 4Y94A 1V89A 5DIFB 2M38A 2D9XA 1XR0B 2VRWB 4K2PA 3VIAA 1Y5OA 4KAXB 4HAWB 3PEGA 1V5PA 1FAOA 4HAZB 1U5DA 3ZDTA 5DHAB 4PNKA 2ZPYA 5KQ4A 5CLLB 2ELBA 2RUKB 1J19A 4Z2NA 2OTXA 2D9YA 2IFSA 2YS3A 3UZTA 5C5BA 1TXDA 4TKNA 3FM8C 2CRFA 1UPQA 3PVLA 1P5TA 3TW1A 4ZRKA 3IVFA 1RRPB 2D9ZA 4K81A 5KCVA 5J3TA 1M7EA 2I5FA 1U29A 1N3HA 2DHIA 4P7IA 1ISNA 3PVUA 1AQCA 2DX5A 5JHHA 1E5WA 3NSUA 2G35A 2J0MA 1WGQA 1DYNA 1V5MA 2GCJA 4GMXB 4HHVA 2HTHB 5D3VA 3DXCA 2CAYA 1W1HA 2YF0A 4ZRJA 1FGYA 4BBKA 4HB0B 3A8QA 5FI1A 2JP2A 2CY5A 2R0DA 2LOZA 4DX8A 3PP2A 3U7DA 3GYOA 1NTYA 4MY6A 3TVVA 2D2QA 2GS0A 4HDOA 2KUPA 2J59M 2Y8FA 2YSZA 4PQ0A 1NU2A 4ZRIA 1X11A 2NZ8B 5D3XA 2NMBA 2RVBB 1MIXA 4HAXB 2M14A 4A6KA 2I1JA 4HATB 4DX90 3SV1A 1DDVA 1FOEA 3AU5A 3SUZA 4DBBA 4GXBA 2MFQA 3KRWA 1BTNA 1WI1A 2V76A 1P3RA 5JP4A 3AJ4A 1P6SA 2RSGA 3AU4A 1U2BA 2AL6A 3ULCA 3VOQA 3M1IB 4HAYB 1MAIA 3PVWA 2K2JA 1BAKA 3OANA 1MK9B 1XX0A 2LG1A 1BWNA 3QWMA 1GC6A 1X1GA 4IOYX 1DDMA 2DYNA 1DROA 3KZ1A 2YT0A 3LJUX 3A98B 5JLJB 2OQBA 4WVFB 4YONA 2YVCA 1I7AA 5C16A 2RNRB 1U27A 2L2IA 2DLWA 1V88A 2Y7BA 2I1KA 1WVHA 2RLOA 1WG7A 3P6AA 5EFXA 1ZC4B 2E2XA 1H10A 2N23A 1K5GB 3ODXA 1ZVRA 3KY9A 2LYDA 3D8FA 4MK0A 5CLQB 5DI9B 1K5DB 1U5EA 2EMSA 2YRYA 3QBVB 2DYQA 3WYFB 5C6RA 2Z0PA 2P8VA 5J3QA 2X18A 2K2UA 4YL8A 3PZDA 1SHCA 4K2OA 1TJ6A 2ADZA 3G9WA 4WJ7A 2LULA 2QKLA 1WJ1A 3FSSA 3FEHA 2ROZB 4MT7A 1X86A 1X1FA 2Z0QA 2H7DA 4A6HA 4KHOA 1V5UA 5D27A 1W1DA 1TQZA 2COFA 3D8DA 3O96A 2COCA 4HB3B 2UZSA 2KCJA 2N0YA 2P0FA 3BJIA 1PMSA 2YS1A 1FHWA 1XKEA 2DN6A 4CHMA 2QKMA 4XWXA 1XCGA 5DH9B 1M7RA 2J0KA 3ODWA 1RJ2A 2RGNB 2VKIA 2Y8GA 1ZC3B 3N7CA 2UZRA 5D3YA 4KHBB 2D9WA
chains in the Genus database with same CATH superfamily
4HB4B 4HDQA 4OT1A 1KI1B 3U8ZA 2DTCA 3PG7A 2LOXA 1UNQA 3KRXA 2ROVA 3DXDA 4GNKB 2H7EA 3MPXA 4F7GA 4KVGB 2K49A 3PSCA 3NWDA 4KHAA 4D6WA 4QJ4B 4IFSA 2DKPA 4C0AA 2DA0A 2EJ8A 3SNHA 4TYZA 4WSFA 5J3YA 2D9VA 1LB1A 5LONB 4GPTB 3RCPA 4EKUA 2GCLA 1X05A 3TO1A 1EAZA 1MK7B 3WA0A 2DX1A 3HSAA 5HE2A 2KIGA 5LOPB 1UEFA 2MWNB 3V5WA 4A6FB 3DXEA 4F7UP 1Y19B 2FJUB 1UNPA 4Z2MB 2VSZA 2W2XD 5KQ1A 3BINA 3ULBA 2NBVA 2KGXB 5M4YB 1FB8A 2YT2A 2BCJA 2LKOA 5I2SA 3MDBC 1QQGA 2YT1A 2YS5A 2RRFA 3D8EA 1EVHA 4DXAB 3TFMA 1OY2A 2IYBA 5HE0A 4NY0A 4HB2B 3GYPA 1Q67A 1MI1A 1U5GA 5IRSA 2HE7A 4HAUB 1H4RA 1NTVA 2D10A 5D3WA 2MDXA 4H8SA 5GOWB 1IRSA 2CODA 1B55A 1AWEA 1UNRA 3ODOA 2Q13A 4NSWA 2K00A 4D0NB 5JHGA 3X23A 2Z0OA 1GG3A 5C79A 4GZUA 2L1CA 4CYEA 1PLSA 5C5BB 2I5CA 3CXBB 2P0DA 3T06A 3SYXA 4QJ3B 3U12A 1BTKA 2PZ1A 4EJNA 2FJLA 1XODA 3F5RA 1Z87A 1QC6A 2UVMA 1NI2A 1LW3A 5HE1A 2ELAA 3HQCA 2DHJA 2EMTA 3TCAA 4IAPA 1U5FA 2Z59A 1V61A 2J0JA 3ZVRA 2EC1A 2DFKA 2D11A 1OMWA 1EGXA 1J0WA 2D4QA 3CIKA 4EMOA 3F0WA 1MPHA 1I2HA 3A8PA 1MKEA 4KHBA 1XD4A 1W1GA 1MIZB 5DHFB 1GC7A 3KSYA 1PFJA 4A5KA 4GMVA 3NWAA 1DDWA 2Z13A 5HE3A 1EF1A 3QIJA 2P0HA 4K17A 1FHXA 3HW2B 2AEHA 1FHOA 2DKQA 3SO6A 5L81A 2K8EA 4GN1A 1SGHA 4CHJA 1FGZA 1ZSQA 1KZGA 1WJMA 2CY4A 2MKRA 3ML4A 4L6EA 5FI0A 4HAVB 4F7HA 2W2WA 3P7ZA 1KZ7A 4B6HA 1WGUA 2W2XC 1DBHA 2GJYA 2COAA 2XQNM 1T77A 4A6FA 1UPRA 1OQNA 3HK0A 2DHKA 2R09A 5I2MA 1ZM0A 4Y94A 1V89A 3A58A 5DIFB 2M38A 2D9XA 1XR0B 2VRWB 4K2PA 3VIAA 1Y5OA 4KAXB 2KUQA 4HAWB 3PEGA 1V5PA 1FAOA 4HAZB 1U5DA 3ZDTA 5DHAB 4PNKA 2ZPYA 5KQ4A 5CLLB 2ELBA 2RUKB 1J19A 4Z2NA 2OTXA 2D9YA 2IFSA 2YS3A 3UZTA 5C5BA 1TXDA 4TKNA 4L1RA 3FM8C 2CRFA 1UPQA 3PVLA 3OHMB 1P5TA 3TW1A 4ZRKA 3IVFA 1RRPB 2Z4DA 2D9ZA 4K81A 5KCVA 5J3TA 1M7EA 2I5FA 1U29A 1N3HA 2DHIA 4P7IA 1ISNA 3PVUA 1AQCA 2DX5A 5JHHA 1E5WA 3NSUA 2G35A 2J0MA 1WGQA 1DYNA 1V5MA 2GCJA 4GMXB 4HHVA 2HTHB 5D3VA 3NWFA 3DXCA 2CAYA 1W1HA 2YF0A 4DIXA 1ZYIA 4ZRJA 1FGYA 4BBKA 4HB0B 3A8QA 5FI1A 4CSQA 2JP2A 2CY5A 2R0DA 2LOZA 4DX8A 3PP2A 3U7DA 3GYOA 1NTYA 4MY6A 3TVVA 2GUMA 2KR0A 2D2QA 2GS0A 4HDOA 2KUPA 2J59M 2Y8FA 2YSZA 4PQ0A 1NU2A 4ZRIA 1X11A 2NZ8B 5D3XA 5LG4B 2NMBA 2RVBB 1MIXA 4HAXB 2M14A 4A6KA 2I1JA 4HATB 4DX90 3SV1A 1DDVA 1FOEA 3AU5A 3SUZA 4DBBA 4GXBA 2MFQA 3KRWA 1BTNA 1WI1A 2V76A 1P3RA 5JP4A 3AJ4A 1P6SA 2RSGA 3AU4A 1U2BA 2AL6A 3ULCA 3VOQA 3M1IB 4HAYB 1MAIA 3PVWA 2K2JA 1BAKA 3OANA 1MK9B 1XX0A 2LG1A 1BWNA 3QWMA 1GC6A 1X1GA 4IOYX 1DDMA 2DYNA 1DROA 3KZ1A 3B77A 2YT0A 3LJUX 3A98B 5JLJB 2OQBA 4WVFB 4YONA 2YVCA 1I7AA 5C16A 2RNRB 1U27A 2L2IA 2DLWA 1V88A 2Y7BA 2I1KA 1WVHA 2R2YA 2RLOA 1WG7A 3P6AA 5EFXA 1ZC4B 2E2XA 1H10A 4OSNA 2N23A 1K5GB 3ODXA 1ZVRA 3KY9A 2LYDA 3D8FA 4MK0A 5CLQB 2Z14A 5DI9B 1K5DB 1U5EA 2EMSA 2YRYA 3QBVB 2DYQA 3WYFB 5C6RA 2Z0PA 2P8VA 5J3QA 2X18A 2K2UA 4YL8A 3PZDA 1SHCA 4K2OA 1TJ6A 2ADZA 3FVCA 3G9WA 4WJ7A 2LULA 2QKLA 1WJ1A 3FSSA 3FEHA 2ROZB 4MT7A 1X86A 1X1FA 2Z0QA 2H7DA 4A6HA 4KHOA 1V5UA 5D27A 4GOUA 1W1DA 1TQZA 2COFA 4QJ5B 3D8DA 3O96A 2COCA 4HB3B 2UZSA 4HSIA 2KCJA 2N0YA 2P0FA 4QXAB 3BJIA 1PMSA 2YS1A 1FHWA 1XKEA 2DN6A 4CHMA 2QKMA 4XWXA 1XCGA 5DH9B 1M7RA 2J0KA 3ODWA 2KIEA 1RJ2A 3HIEA 2RGNB 2VKIA 2Y8GA 2ZKMX 1ZC3B 3NW8A 3N7CA 2UZRA 5D3YA 4KHBB 3DCXA 2D9WA
chains in the Genus database with same CATH topology
4HB4B 4HDQA 1KI1B 3U8ZA 2DTCA 3PG7A 2LOXA 1UNQA 3KRXA 2ROVA 3DXDA 2H7EA 3MPXA 4F7GA 4KVGB 3PSCA 4KHAA 4IFSA 2DKPA 4C0AA 2DA0A 2EJ8A 3SNHA 4TYZA 4WSFA 5J3YA 2D9VA 1LB1A 5LONB 4GPTB 3RCPA 4EKUA 2GCLA 1X05A 3TO1A 1EAZA 1MK7B 3WA0A 2DX1A 5HE2A 5LOPB 1UEFA 2MWNB 3V5WA 4A6FB 3DXEA 4F7UP 1Y19B 1UNPA 4Z2MB 2VSZA 2W2XD 5KQ1A 3BINA 3ULBA 2KGXB 1FB8A 2BCJA 2LKOA 3MDBC 1QQGA 2YT1A 2YS5A 3D8EA 1EVHA 4DXAB 3TFMA 1OY2A 2IYBA 5HE0A 4NY0A 4HB2B 3GYPA 1Q67A 1U5GA 2HE7A 4HAUB 1H4RA 1NTVA 2D10A 5D3WA 2MDXA 4H8SA 5GOWB 1IRSA 2CODA 1B55A 1AWEA 1UNRA 3ODOA 2Q13A 4NSWA 2K00A 4D0NB 5JHGA 3X23A 2Z0OA 1GG3A 5C79A 4GZUA 2L1CA 4CYEA 1PLSA 5C5BB 2I5CA 3CXBB 2P0DA 3T06A 3SYXA 1BTKA 2PZ1A 4EJNA 2FJLA 1XODA 3F5RA 1Z87A 1QC6A 2UVMA 1NI2A 1LW3A 5HE1A 2ELAA 3HQCA 2DHJA 2EMTA 3TCAA 4IAPA 1U5FA 1V61A 2J0JA 3ZVRA 2EC1A 2DFKA 2D11A 1OMWA 1EGXA 1J0WA 2D4QA 3CIKA 4EMOA 3F0WA 1MPHA 1I2HA 3A8PA 1MKEA 1XD4A 1W1GA 1MIZB 5DHFB 1GC7A 3KSYA 1PFJA 4A5KA 4GMVA 1DDWA 5HE3A 1EF1A 3QIJA 2P0HA 4K17A 1FHXA 3HW2B 2AEHA 1FHOA 2DKQA 3SO6A 5L81A 4GN1A 1SGHA 4CHJA 1FGZA 1ZSQA 1KZGA 1WJMA 2CY4A 2MKRA 3ML4A 4L6EA 5FI0A 4HAVB 4F7HA 2W2WA 3P7ZA 1KZ7A 4B6HA 1WGUA 2W2XC 1DBHA 2GJYA 2COAA 2XQNM 4A6FA 1UPRA 1OQNA 3HK0A 2DHKA 2R09A 1ZM0A 4Y94A 1V89A 5DIFB 2M38A 2D9XA 1XR0B 2VRWB 4K2PA 3VIAA 1Y5OA 4KAXB 4HAWB 3PEGA 1V5PA 1FAOA 4HAZB 1U5DA 3ZDTA 5DHAB 4PNKA 2ZPYA 5KQ4A 5CLLB 2ELBA 2RUKB 1J19A 4Z2NA 2OTXA 2D9YA 2IFSA 2YS3A 3UZTA 5C5BA 1TXDA 4TKNA 3FM8C 2CRFA 1UPQA 3PVLA 1P5TA 3TW1A 4ZRKA 3IVFA 1RRPB 2D9ZA 4K81A 5KCVA 5J3TA 1M7EA 2I5FA 1U29A 1N3HA 2DHIA 4P7IA 1ISNA 3PVUA 1AQCA 2DX5A 5JHHA 1E5WA 3NSUA 2G35A 2J0MA 1WGQA 1DYNA 1V5MA 2GCJA 4GMXB 4HHVA 2HTHB 5D3VA 3DXCA 2CAYA 1W1HA 2YF0A 4ZRJA 1FGYA 4BBKA 4HB0B 3A8QA 5FI1A 2JP2A 2CY5A 2R0DA 2LOZA 4DX8A 3PP2A 3U7DA 3GYOA 1NTYA 4MY6A 3TVVA 2D2QA 2GS0A 4HDOA 2KUPA 2J59M 2Y8FA 2YSZA 4PQ0A 1NU2A 4ZRIA 1X11A 2NZ8B 5D3XA 2NMBA 2RVBB 1MIXA 4HAXB 2M14A 4A6KA 2I1JA 4HATB 4DX90 3SV1A 1DDVA 1FOEA 3AU5A 3SUZA 4DBBA 4GXBA 2MFQA 3KRWA 1BTNA 1WI1A 2V76A 1P3RA 5JP4A 3AJ4A 1P6SA 2RSGA 3AU4A 1U2BA 2AL6A 3ULCA 3VOQA 3M1IB 4HAYB 1MAIA 3PVWA 2K2JA 1BAKA 3OANA 1MK9B 1XX0A 2LG1A 1BWNA 3QWMA 1GC6A 1X1GA 4IOYX 1DDMA 2DYNA 1DROA 3KZ1A 2YT0A 3LJUX 3A98B 5JLJB 2OQBA 4WVFB 4YONA 2YVCA 1I7AA 5C16A 2RNRB 1U27A 2L2IA 2DLWA 1V88A 2Y7BA 2I1KA 1WVHA 2RLOA 1WG7A 3P6AA 5EFXA 1ZC4B 2E2XA 1H10A 2N23A 1K5GB 3ODXA 1ZVRA 3KY9A 2LYDA 3D8FA 4MK0A 5CLQB 5DI9B 1K5DB 1U5EA 2EMSA 2YRYA 3QBVB 2DYQA 3WYFB 5C6RA 2Z0PA 2P8VA 5J3QA 2X18A 2K2UA 4YL8A 3PZDA 1SHCA 4K2OA 1TJ6A 2ADZA 3G9WA 4WJ7A 2LULA 2QKLA 1WJ1A 3FSSA 3FEHA 2ROZB 4MT7A 1X86A 1X1FA 2Z0QA 2H7DA 4A6HA 4KHOA 1V5UA 5D27A 1W1DA 1TQZA 2COFA 3D8DA 3O96A 2COCA 4HB3B 2UZSA 2KCJA 2N0YA 2P0FA 3BJIA 1PMSA 2YS1A 1FHWA 1XKEA 2DN6A 4CHMA 2QKMA 4XWXA 1XCGA 5DH9B 1M7RA 2J0KA 3ODWA 1RJ2A 2RGNB 2VKIA 2Y8GA 1ZC3B 3N7CA 2UZRA 5D3YA 4KHBB 2D9WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HB4 B;  4HDQ A;  1KI1 B;  3U8Z A;  2DTC A;  3PG7 A;  2LOX A;  1UNQ A;  3KRX A;  2ROV A;  3DXD A;  2H7E A;  3MPX A;  4F7G A;  4KVG B;  3PSC A;  4KHA A;  4IFS A;  2DKP A;  4C0A A;  2DA0 A;  2EJ8 A;  3SNH A;  4TYZ A;  4WSF A;  5J3Y A;  2D9V A;  1LB1 A;  5LON B;  4GPT B;  3RCP A;  4EKU A;  2GCL A;  1X05 A;  3TO1 A;  1EAZ A;  1MK7 B;  3WA0 A;  2DX1 A;  5HE2 A;  5LOP B;  1UEF A;  2MWN B;  3V5W A;  4A6F B;  3DXE A;  4F7U P;  1Y19 B;  1UNP A;  4Z2M B;  2VSZ A;  2W2X D;  5KQ1 A;  3BIN A;  3ULB A;  2KGX B;  1FB8 A;  2BCJ A;  2LKO A;  3MDB C;  1QQG A;  2YT1 A;  2YS5 A;  3D8E A;  1EVH A;  4DXA B;  3TFM A;  1OY2 A;  2IYB A;  5HE0 A;  4NY0 A;  4HB2 B;  3GYP A;  1Q67 A;  1U5G A;  2HE7 A;  4HAU B;  1H4R A;  1NTV A;  2D10 A;  5D3W A;  2MDX A;  4H8S A;  5GOW B;  1IRS A;  2COD A;  1B55 A;  1AWE A;  1UNR A;  3ODO A;  2Q13 A;  4NSW A;  2K00 A;  4D0N B;  5JHG A;  3X23 A;  2Z0O A;  1GG3 A;  5C79 A;  4GZU A;  2L1C A;  4CYE A;  1PLS A;  5C5B B;  2I5C A;  3CXB B;  2P0D A;  3T06 A;  3SYX A;  1BTK A;  2PZ1 A;  4EJN A;  2FJL A;  1XOD A;  3F5R A;  1Z87 A;  1QC6 A;  2UVM A;  1NI2 A;  1LW3 A;  5HE1 A;  2ELA A;  3HQC A;  2DHJ A;  2EMT A;  3TCA A;  4IAP A;  1U5F A;  1V61 A;  2J0J A;  3ZVR A;  2EC1 A;  2DFK A;  2D11 A;  1OMW A;  1EGX A;  1J0W A;  2D4Q A;  3CIK A;  4EMO A;  3F0W A;  1MPH A;  1I2H A;  3A8P A;  1MKE A;  1XD4 A;  1W1G A;  1MIZ B;  5DHF B;  1GC7 A;  3KSY A;  1PFJ A;  4A5K A;  4GMV A;  1DDW A;  5HE3 A;  1EF1 A;  3QIJ A;  2P0H A;  4K17 A;  1FHX A;  3HW2 B;  2AEH A;  1FHO A;  2DKQ A;  3SO6 A;  5L81 A;  4GN1 A;  1SGH A;  4CHJ A;  1FGZ A;  1ZSQ A;  1KZG A;  1WJM A;  2CY4 A;  2MKR A;  3ML4 A;  4L6E A;  5FI0 A;  4HAV B;  4F7H A;  2W2W A;  3P7Z A;  1KZ7 A;  4B6H A;  1WGU A;  2W2X C;  1DBH A;  2GJY A;  2COA A;  2XQN M;  4A6F A;  1UPR A;  1OQN A;  3HK0 A;  2DHK A;  2R09 A;  1ZM0 A;  4Y94 A;  1V89 A;  5DIF B;  2M38 A;  2D9X A;  1XR0 B;  2VRW B;  4K2P A;  3VIA A;  1Y5O A;  4KAX B;  4HAW B;  3PEG A;  1V5P A;  1FAO A;  4HAZ B;  1U5D A;  3ZDT A;  5DHA B;  4PNK A;  2ZPY A;  5KQ4 A;  5CLL B;  2ELB A;  2RUK B;  1J19 A;  4Z2N A;  2OTX A;  2D9Y A;  2IFS A;  2YS3 A;  3UZT A;  5C5B A;  1TXD A;  4TKN A;  3FM8 C;  2CRF A;  1UPQ A;  3PVL A;  1P5T A;  3TW1 A;  4ZRK A;  3IVF A;  1RRP B;  2D9Z A;  4K81 A;  5KCV A;  5J3T A;  1M7E A;  2I5F A;  1U29 A;  1N3H A;  2DHI A;  4P7I A;  1ISN A;  3PVU A;  1AQC A;  2DX5 A;  5JHH A;  1E5W A;  3NSU A;  2G35 A;  2J0M A;  1WGQ A;  1DYN A;  1V5M A;  2GCJ A;  4GMX B;  4HHV A;  2HTH B;  5D3V A;  3DXC A;  2CAY A;  1W1H A;  2YF0 A;  4ZRJ A;  1FGY A;  4BBK A;  4HB0 B;  3A8Q A;  5FI1 A;  2JP2 A;  2CY5 A;  2R0D A;  2LOZ A;  4DX8 A;  3PP2 A;  3U7D A;  3GYO A;  1NTY A;  4MY6 A;  3TVV A;  2D2Q A;  2GS0 A;  4HDO A;  2KUP A;  2J59 M;  2Y8F A;  2YSZ A;  4PQ0 A;  1NU2 A;  4ZRI A;  1X11 A;  2NZ8 B;  5D3X A;  2NMB A;  2RVB B;  1MIX A;  4HAX B;  2M14 A;  4A6K A;  2I1J A;  4HAT B;  4DX9 0;  3SV1 A;  1DDV A;  1FOE A;  3AU5 A;  3SUZ A;  4DBB A;  4GXB A;  2MFQ A;  3KRW A;  1BTN A;  1WI1 A;  2V76 A;  1P3R A;  5JP4 A;  3AJ4 A;  1P6S A;  2RSG A;  3AU4 A;  1U2B A;  2AL6 A;  3ULC A;  3VOQ A;  3M1I B;  4HAY B;  1MAI A;  3PVW A;  2K2J A;  1BAK A;  3OAN A;  1MK9 B;  1XX0 A;  2LG1 A;  1BWN A;  3QWM A;  1GC6 A;  1X1G A;  4IOY X;  1DDM A;  2DYN A;  1DRO A;  3KZ1 A;  2YT0 A;  3LJU X;  3A98 B;  5JLJ B;  2OQB A;  4WVF B;  4YON A;  2YVC A;  1I7A A;  5C16 A;  2RNR B;  1U27 A;  2L2I A;  2DLW A;  1V88 A;  2Y7B A;  2I1K A;  1WVH A;  2RLO A;  1WG7 A;  3P6A A;  5EFX A;  1ZC4 B;  2E2X A;  1H10 A;  2N23 A;  1K5G B;  3ODX A;  1ZVR A;  3KY9 A;  2LYD A;  3D8F A;  4MK0 A;  5CLQ B;  5DI9 B;  1K5D B;  1U5E A;  2EMS A;  2YRY A;  3QBV B;  2DYQ A;  3WYF B;  5C6R A;  2Z0P A;  2P8V A;  5J3Q A;  2X18 A;  2K2U A;  4YL8 A;  3PZD A;  1SHC A;  4K2O A;  1TJ6 A;  2ADZ A;  3G9W A;  4WJ7 A;  2LUL A;  2QKL A;  1WJ1 A;  3FSS A;  3FEH A;  2ROZ B;  4MT7 A;  1X86 A;  1X1F A;  2Z0Q A;  2H7D A;  4A6H A;  4KHO A;  1V5U A;  5D27 A;  1W1D A;  1TQZ A;  2COF A;  3D8D A;  3O96 A;  2COC A;  4HB3 B;  2UZS A;  2KCJ A;  2N0Y A;  2P0F A;  3BJI A;  1PMS A;  2YS1 A;  1FHW A;  1XKE A;  2DN6 A;  4CHM A;  2QKM A;  4XWX A;  1XCG A;  5DH9 B;  1M7R A;  2J0K A;  3ODW A;  1RJ2 A;  2RGN B;  2VKI A;  2Y8G A;  1ZC3 B;  3N7C A;  2UZR A;  5D3Y A;  4KHB B;  2D9W A; 
#chains in the Genus database with same CATH topology
 4HB4 B;  4HDQ A;  4OT1 A;  1KI1 B;  3U8Z A;  2DTC A;  3PG7 A;  2LOX A;  1UNQ A;  3KRX A;  2ROV A;  3DXD A;  4GNK B;  2H7E A;  3MPX A;  4F7G A;  4KVG B;  2K49 A;  3PSC A;  3NWD A;  4KHA A;  4D6W A;  4QJ4 B;  4IFS A;  2DKP A;  4C0A A;  2DA0 A;  2EJ8 A;  3SNH A;  4TYZ A;  4WSF A;  5J3Y A;  2D9V A;  1LB1 A;  5LON B;  4GPT B;  3RCP A;  4EKU A;  2GCL A;  1X05 A;  3TO1 A;  1EAZ A;  1MK7 B;  3WA0 A;  2DX1 A;  3HSA A;  5HE2 A;  2KIG A;  5LOP B;  1UEF A;  2MWN B;  3V5W A;  4A6F B;  3DXE A;  4F7U P;  1Y19 B;  2FJU B;  1UNP A;  4Z2M B;  2VSZ A;  2W2X D;  5KQ1 A;  3BIN A;  3ULB A;  2NBV A;  2KGX B;  5M4Y B;  1FB8 A;  2YT2 A;  2BCJ A;  2LKO A;  5I2S A;  3MDB C;  1QQG A;  2YT1 A;  2YS5 A;  2RRF A;  3D8E A;  1EVH A;  4DXA B;  3TFM A;  1OY2 A;  2IYB A;  5HE0 A;  4NY0 A;  4HB2 B;  3GYP A;  1Q67 A;  1MI1 A;  1U5G A;  5IRS A;  2HE7 A;  4HAU B;  1H4R A;  1NTV A;  2D10 A;  5D3W A;  2MDX A;  4H8S A;  5GOW B;  1IRS A;  2COD A;  1B55 A;  1AWE A;  1UNR A;  3ODO A;  2Q13 A;  4NSW A;  2K00 A;  4D0N B;  5JHG A;  3X23 A;  2Z0O A;  1GG3 A;  5C79 A;  4GZU A;  2L1C A;  4CYE A;  1PLS A;  5C5B B;  2I5C A;  3CXB B;  2P0D A;  3T06 A;  3SYX A;  4QJ3 B;  3U12 A;  1BTK A;  2PZ1 A;  4EJN A;  2FJL A;  1XOD A;  3F5R A;  1Z87 A;  1QC6 A;  2UVM A;  1NI2 A;  1LW3 A;  5HE1 A;  2ELA A;  3HQC A;  2DHJ A;  2EMT A;  3TCA A;  4IAP A;  1U5F A;  2Z59 A;  1V61 A;  2J0J A;  3ZVR A;  2EC1 A;  2DFK A;  2D11 A;  1OMW A;  1EGX A;  1J0W A;  2D4Q A;  3CIK A;  4EMO A;  3F0W A;  1MPH A;  1I2H A;  3A8P A;  1MKE A;  4KHB A;  1XD4 A;  1W1G A;  1MIZ B;  5DHF B;  1GC7 A;  3KSY A;  1PFJ A;  4A5K A;  4GMV A;  3NWA A;  1DDW A;  2Z13 A;  5HE3 A;  1EF1 A;  3QIJ A;  2P0H A;  4K17 A;  1FHX A;  3HW2 B;  2AEH A;  1FHO A;  2DKQ A;  3SO6 A;  5L81 A;  2K8E A;  4GN1 A;  1SGH A;  4CHJ A;  1FGZ A;  1ZSQ A;  1KZG A;  1WJM A;  2CY4 A;  2MKR A;  3ML4 A;  4L6E A;  5FI0 A;  4HAV B;  4F7H A;  2W2W A;  3P7Z A;  1KZ7 A;  4B6H A;  1WGU A;  2W2X C;  1DBH A;  2GJY A;  2COA A;  2XQN M;  1T77 A;  4A6F A;  1UPR A;  1OQN A;  3HK0 A;  2DHK A;  2R09 A;  5I2M A;  1ZM0 A;  4Y94 A;  1V89 A;  3A58 A;  5DIF B;  2M38 A;  2D9X A;  1XR0 B;  2VRW B;  4K2P A;  3VIA A;  1Y5O A;  4KAX B;  2KUQ A;  4HAW B;  3PEG A;  1V5P A;  1FAO A;  4HAZ B;  1U5D A;  3ZDT A;  5DHA B;  4PNK A;  2ZPY A;  5KQ4 A;  5CLL B;  2ELB A;  2RUK B;  1J19 A;  4Z2N A;  2OTX A;  2D9Y A;  2IFS A;  2YS3 A;  3UZT A;  5C5B A;  1TXD A;  4TKN A;  4L1R A;  3FM8 C;  2CRF A;  1UPQ A;  3PVL A;  3OHM B;  1P5T A;  3TW1 A;  4ZRK A;  3IVF A;  1RRP B;  2Z4D A;  2D9Z A;  4K81 A;  5KCV A;  5J3T A;  1M7E A;  2I5F A;  1U29 A;  1N3H A;  2DHI A;  4P7I A;  1ISN A;  3PVU A;  1AQC A;  2DX5 A;  5JHH A;  1E5W A;  3NSU A;  2G35 A;  2J0M A;  1WGQ A;  1DYN A;  1V5M A;  2GCJ A;  4GMX B;  4HHV A;  2HTH B;  5D3V A;  3NWF A;  3DXC A;  2CAY A;  1W1H A;  2YF0 A;  4DIX A;  1ZYI A;  4ZRJ A;  1FGY A;  4BBK A;  4HB0 B;  3A8Q A;  5FI1 A;  4CSQ A;  2JP2 A;  2CY5 A;  2R0D A;  2LOZ A;  4DX8 A;  3PP2 A;  3U7D A;  3GYO A;  1NTY A;  4MY6 A;  3TVV A;  2GUM A;  2KR0 A;  2D2Q A;  2GS0 A;  4HDO A;  2KUP A;  2J59 M;  2Y8F A;  2YSZ A;  4PQ0 A;  1NU2 A;  4ZRI A;  1X11 A;  2NZ8 B;  5D3X A;  5LG4 B;  2NMB A;  2RVB B;  1MIX A;  4HAX B;  2M14 A;  4A6K A;  2I1J A;  4HAT B;  4DX9 0;  3SV1 A;  1DDV A;  1FOE A;  3AU5 A;  3SUZ A;  4DBB A;  4GXB A;  2MFQ A;  3KRW A;  1BTN A;  1WI1 A;  2V76 A;  1P3R A;  5JP4 A;  3AJ4 A;  1P6S A;  2RSG A;  3AU4 A;  1U2B A;  2AL6 A;  3ULC A;  3VOQ A;  3M1I B;  4HAY B;  1MAI A;  3PVW A;  2K2J A;  1BAK A;  3OAN A;  1MK9 B;  1XX0 A;  2LG1 A;  1BWN A;  3QWM A;  1GC6 A;  1X1G A;  4IOY X;  1DDM A;  2DYN A;  1DRO A;  3KZ1 A;  3B77 A;  2YT0 A;  3LJU X;  3A98 B;  5JLJ B;  2OQB A;  4WVF B;  4YON A;  2YVC A;  1I7A A;  5C16 A;  2RNR B;  1U27 A;  2L2I A;  2DLW A;  1V88 A;  2Y7B A;  2I1K A;  1WVH A;  2R2Y A;  2RLO A;  1WG7 A;  3P6A A;  5EFX A;  1ZC4 B;  2E2X A;  1H10 A;  4OSN A;  2N23 A;  1K5G B;  3ODX A;  1ZVR A;  3KY9 A;  2LYD A;  3D8F A;  4MK0 A;  5CLQ B;  2Z14 A;  5DI9 B;  1K5D B;  1U5E A;  2EMS A;  2YRY A;  3QBV B;  2DYQ A;  3WYF B;  5C6R A;  2Z0P A;  2P8V A;  5J3Q A;  2X18 A;  2K2U A;  4YL8 A;  3PZD A;  1SHC A;  4K2O A;  1TJ6 A;  2ADZ A;  3FVC A;  3G9W A;  4WJ7 A;  2LUL A;  2QKL A;  1WJ1 A;  3FSS A;  3FEH A;  2ROZ B;  4MT7 A;  1X86 A;  1X1F A;  2Z0Q A;  2H7D A;  4A6H A;  4KHO A;  1V5U A;  5D27 A;  4GOU A;  1W1D A;  1TQZ A;  2COF A;  4QJ5 B;  3D8D A;  3O96 A;  2COC A;  4HB3 B;  2UZS A;  4HSI A;  2KCJ A;  2N0Y A;  2P0F A;  4QXA B;  3BJI A;  1PMS A;  2YS1 A;  1FHW A;  1XKE A;  2DN6 A;  4CHM A;  2QKM A;  4XWX A;  1XCG A;  5DH9 B;  1M7R A;  2J0K A;  3ODW A;  2KIE A;  1RJ2 A;  3HIE A;  2RGN B;  2VKI A;  2Y8G A;  2ZKM X;  1ZC3 B;  3NW8 A;  3N7C A;  2UZR A;  5D3Y A;  4KHB B;  3DCX A;  2D9W A; 
#chains in the Genus database with same CATH homology
 4HB4 B;  4HDQ A;  1KI1 B;  3U8Z A;  2DTC A;  3PG7 A;  2LOX A;  1UNQ A;  3KRX A;  2ROV A;  3DXD A;  2H7E A;  3MPX A;  4F7G A;  4KVG B;  3PSC A;  4KHA A;  4IFS A;  2DKP A;  4C0A A;  2DA0 A;  2EJ8 A;  3SNH A;  4TYZ A;  4WSF A;  5J3Y A;  2D9V A;  1LB1 A;  5LON B;  4GPT B;  3RCP A;  4EKU A;  2GCL A;  1X05 A;  3TO1 A;  1EAZ A;  1MK7 B;  3WA0 A;  2DX1 A;  5HE2 A;  5LOP B;  1UEF A;  2MWN B;  3V5W A;  4A6F B;  3DXE A;  4F7U P;  1Y19 B;  1UNP A;  4Z2M B;  2VSZ A;  2W2X D;  5KQ1 A;  3BIN A;  3ULB A;  2KGX B;  1FB8 A;  2BCJ A;  2LKO A;  3MDB C;  1QQG A;  2YT1 A;  2YS5 A;  3D8E A;  1EVH A;  4DXA B;  3TFM A;  1OY2 A;  2IYB A;  5HE0 A;  4NY0 A;  4HB2 B;  3GYP A;  1Q67 A;  1U5G A;  2HE7 A;  4HAU B;  1H4R A;  1NTV A;  2D10 A;  5D3W A;  2MDX A;  4H8S A;  5GOW B;  1IRS A;  2COD A;  1B55 A;  1AWE A;  1UNR A;  3ODO A;  2Q13 A;  4NSW A;  2K00 A;  4D0N B;  5JHG A;  3X23 A;  2Z0O A;  1GG3 A;  5C79 A;  4GZU A;  2L1C A;  4CYE A;  1PLS A;  5C5B B;  2I5C A;  3CXB B;  2P0D A;  3T06 A;  3SYX A;  1BTK A;  2PZ1 A;  4EJN A;  2FJL A;  1XOD A;  3F5R A;  1Z87 A;  1QC6 A;  2UVM A;  1NI2 A;  1LW3 A;  5HE1 A;  2ELA A;  3HQC A;  2DHJ A;  2EMT A;  3TCA A;  4IAP A;  1U5F A;  1V61 A;  2J0J A;  3ZVR A;  2EC1 A;  2DFK A;  2D11 A;  1OMW A;  1EGX A;  1J0W A;  2D4Q A;  3CIK A;  4EMO A;  3F0W A;  1MPH A;  1I2H A;  3A8P A;  1MKE A;  1XD4 A;  1W1G A;  1MIZ B;  5DHF B;  1GC7 A;  3KSY A;  1PFJ A;  4A5K A;  4GMV A;  1DDW A;  5HE3 A;  1EF1 A;  3QIJ A;  2P0H A;  4K17 A;  1FHX A;  3HW2 B;  2AEH A;  1FHO A;  2DKQ A;  3SO6 A;  5L81 A;  4GN1 A;  1SGH A;  4CHJ A;  1FGZ A;  1ZSQ A;  1KZG A;  1WJM A;  2CY4 A;  2MKR A;  3ML4 A;  4L6E A;  5FI0 A;  4HAV B;  4F7H A;  2W2W A;  3P7Z A;  1KZ7 A;  4B6H A;  1WGU A;  2W2X C;  1DBH A;  2GJY A;  2COA A;  2XQN M;  4A6F A;  1UPR A;  1OQN A;  3HK0 A;  2DHK A;  2R09 A;  1ZM0 A;  4Y94 A;  1V89 A;  5DIF B;  2M38 A;  2D9X A;  1XR0 B;  2VRW B;  4K2P A;  3VIA A;  1Y5O A;  4KAX B;  4HAW B;  3PEG A;  1V5P A;  1FAO A;  4HAZ B;  1U5D A;  3ZDT A;  5DHA B;  4PNK A;  2ZPY A;  5KQ4 A;  5CLL B;  2ELB A;  2RUK B;  1J19 A;  4Z2N A;  2OTX A;  2D9Y A;  2IFS A;  2YS3 A;  3UZT A;  5C5B A;  1TXD A;  4TKN A;  3FM8 C;  2CRF A;  1UPQ A;  3PVL A;  1P5T A;  3TW1 A;  4ZRK A;  3IVF A;  1RRP B;  2D9Z A;  4K81 A;  5KCV A;  5J3T A;  1M7E A;  2I5F A;  1U29 A;  1N3H A;  2DHI A;  4P7I A;  1ISN A;  3PVU A;  1AQC A;  2DX5 A;  5JHH A;  1E5W A;  3NSU A;  2G35 A;  2J0M A;  1WGQ A;  1DYN A;  1V5M A;  2GCJ A;  4GMX B;  4HHV A;  2HTH B;  5D3V A;  3DXC A;  2CAY A;  1W1H A;  2YF0 A;  4ZRJ A;  1FGY A;  4BBK A;  4HB0 B;  3A8Q A;  5FI1 A;  2JP2 A;  2CY5 A;  2R0D A;  2LOZ A;  4DX8 A;  3PP2 A;  3U7D A;  3GYO A;  1NTY A;  4MY6 A;  3TVV A;  2D2Q A;  2GS0 A;  4HDO A;  2KUP A;  2J59 M;  2Y8F A;  2YSZ A;  4PQ0 A;  1NU2 A;  4ZRI A;  1X11 A;  2NZ8 B;  5D3X A;  2NMB A;  2RVB B;  1MIX A;  4HAX B;  2M14 A;  4A6K A;  2I1J A;  4HAT B;  4DX9 0;  3SV1 A;  1DDV A;  1FOE A;  3AU5 A;  3SUZ A;  4DBB A;  4GXB A;  2MFQ A;  3KRW A;  1BTN A;  1WI1 A;  2V76 A;  1P3R A;  5JP4 A;  3AJ4 A;  1P6S A;  2RSG A;  3AU4 A;  1U2B A;  2AL6 A;  3ULC A;  3VOQ A;  3M1I B;  4HAY B;  1MAI A;  3PVW A;  2K2J A;  1BAK A;  3OAN A;  1MK9 B;  1XX0 A;  2LG1 A;  1BWN A;  3QWM A;  1GC6 A;  1X1G A;  4IOY X;  1DDM A;  2DYN A;  1DRO A;  3KZ1 A;  2YT0 A;  3LJU X;  3A98 B;  5JLJ B;  2OQB A;  4WVF B;  4YON A;  2YVC A;  1I7A A;  5C16 A;  2RNR B;  1U27 A;  2L2I A;  2DLW A;  1V88 A;  2Y7B A;  2I1K A;  1WVH A;  2RLO A;  1WG7 A;  3P6A A;  5EFX A;  1ZC4 B;  2E2X A;  1H10 A;  2N23 A;  1K5G B;  3ODX A;  1ZVR A;  3KY9 A;  2LYD A;  3D8F A;  4MK0 A;  5CLQ B;  5DI9 B;  1K5D B;  1U5E A;  2EMS A;  2YRY A;  3QBV B;  2DYQ A;  3WYF B;  5C6R A;  2Z0P A;  2P8V A;  5J3Q A;  2X18 A;  2K2U A;  4YL8 A;  3PZD A;  1SHC A;  4K2O A;  1TJ6 A;  2ADZ A;  3G9W A;  4WJ7 A;  2LUL A;  2QKL A;  1WJ1 A;  3FSS A;  3FEH A;  2ROZ B;  4MT7 A;  1X86 A;  1X1F A;  2Z0Q A;  2H7D A;  4A6H A;  4KHO A;  1V5U A;  5D27 A;  1W1D A;  1TQZ A;  2COF A;  3D8D A;  3O96 A;  2COC A;  4HB3 B;  2UZS A;  2KCJ A;  2N0Y A;  2P0F A;  3BJI A;  1PMS A;  2YS1 A;  1FHW A;  1XKE A;  2DN6 A;  4CHM A;  2QKM A;  4XWX A;  1XCG A;  5DH9 B;  1M7R A;  2J0K A;  3ODW A;  1RJ2 A;  2RGN B;  2VKI A;  2Y8G A;  1ZC3 B;  3N7C A;  2UZR A;  5D3Y A;  4KHB B;  2D9W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...