1DYNA

Crystal structure at 2.2 angstroms resolution of the pleckstrin homology domain from human dynamin
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
113
structure length
113
Chain Sequence
ILVIRKGWLTINNIGIMKGGSKEYWFVLTAENLSWYKDDEEKEKKYMLSVDNLKLRDVEKGFMSSKHIFALFNTEQRNVYKDYRQLELACETQEEVDSWKASFLRAGVYPERV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DYNAMIN
publication title Crystal structure at 2.2 A resolution of the pleckstrin homology domain from human dynamin.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signal transduction protein
total genus 26
structure length 113
sequence length 113
chains with identical sequence B
ec nomenclature ec 3.6.5.5: Dynamin GTPase.
pdb deposition date 1994-12-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00169 PH PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1dynA00
2CRFA 1BTNA 1SHCA 1V89A 3PEGA 4EJNA 1X1GA 3PG7A 3SO6A 1GG3A 2D4QA 3CIKA 4GMVA 4WVFB 5D3WA 1FHOA 2DA0A 4F7GA 4HB0B 4A6FB 4ZRKA 3FM8C 5C16A 5EFXA 5DIFB 3VOQA 2J0JA 4PNKA 1EF1A 3FSSA 2D11A 5D3XA 2DHIA 2EMTA 4HAZB 3ULCA 1MK7B 1MKEA 2MWNB 1U29A 3ML4A 1P6SA 1U5EA 1DDWA 2I1KA 3AJ4A 2DTCA 2YVCA 1NI2A 2YRYA 1XCGA 2D9ZA 1FGYA 3U8ZA 2KUPA 3PP2A 1KZ7A 2UZRA 3KRWA 1WGUA 1TJ6A 2PZ1A 4HHVA 1FHWA 1ZVRA 5HE1A 1EAZA 1DDMA 2CY5A 5CLLB 3PSCA 3QWMA 2MKRA 2KCJA 3P6AA 5C6RA 2J59M 2AL6A 3ODWA 4K2PA 2DHKA 5HE2A 2BCJA 2XQNM 1BAKA 3LJUX 4NSWA 1I2HA 2GS0A 3DXEA 4C0AA 1I7AA 2ROZB 2GCJA 5D3VA 3TO1A 5FI0A 3NSUA 3IVFA 3ULBA 1BWNA 3TW1A 2RUKB 1Z87A 1AWEA 2NZ8B 1E5WA 2VRWB 2H7EA 2W2XC 1DDVA 1X86A 1UPRA 2COCA 4CYEA 4EKUA 1XX0A 1DBHA 2W2XD 2DYQA 1OY2A 1RJ2A 5LONB 2Y8GA 3TVVA 2DX5A 3AU5A 2OQBA 5C5BA 4HAYB 2LOXA 3T06A 3DXDA 1UNQA 2J0KA 3CXBB 2L1CA 5LOPB 4GZUA 4P7IA 2OTXA 2EC1A 2RNRB 3HK0A 1V61A 2H7DA 4K81A 1W1DA 4A5KA 4CHMA 2P0DA 1J0WA 1ISNA 4DXAB 2CODA 5J3QA 2I1JA 2P8VA 1IRSA 4GN1A 2I5CA 1LW3A 3PVWA 4HATB 5DH9B 1V5PA 1P3RA 2EMSA 2YS3A 1BTKA 2HTHB 1ZC4B 3SUZA 1V88A 1XR0B 1K5GB 1ZM0A 1V5UA 2YSZA 4GPTB 1FB8A 4DX90 3D8FA 4A6KA 4DX8A 1MK9B 1N3HA 1TXDA 3BJIA 1UNRA 4EMOA 1XODA 2NMBA 2RVBB 1P5TA 1MPHA 1KI1B 3QIJA 4GXBA 1NTYA 2IYBA 3P7ZA 4YONA 1U27A 2ELAA 2Y7BA 1AQCA 2D10A 2D9WA 2UZSA 4WJ7A 1W1HA 2RSGA 1WGQA 2D9VA 2DKQA 1MIZB 5J3YA 1Y5OA 4D0NB 2P0FA 4Z2MB 1WJ1A 2K2JA 5J3TA 2HE7A 5KQ4A 4CHJA 4KAXB 4HAUB 3X23A 3GYOA 5JHGA 3F5RA 5KCVA 3BINA 2IFSA 2L2IA 2P0HA 1WI1A 5DHAB 1WG7A 4TYZA 5FI1A 1KZGA 2D9XA 1H4RA 2FJLA 1SGHA 5DI9B 2LG1A 1NU2A 1LB1A 1U5DA 3HW2B 3KZ1A 3MPXA 1XD4A 2KGXB 2GJYA 3MDBC 4A6HA 4F7UP 4H8SA 3SV1A 2ROVA 4TKNA 2Q13A 2UVMA 1M7RA 4GMXB 4BBKA 3A98B 3GYPA 3KRXA 2K2UA 3ODOA 3UZTA 1FAOA 1OMWA 2YT0A 3WA0A 1Q67A 2EJ8A 4HB4B 2LYDA 1PMSA 1UNPA 1WJMA 1U5FA 4KHOA 2N23A 2CAYA 3AU4A 4WSFA 2DHJA 1X1FA 2YT1A 2DYNA 2YF0A 2RGNB 4ZRJA 3VIAA 3D8DA 4MT7A 1EGXA 3RCPA 1UPQA 1XKEA 1X11A 2LKOA 5L81A 1MAIA 1FGZA 2RLOA 2ZPYA 4Z2NA 2CY4A 3FEHA 1H10A 1J19A 3OANA 5JHHA 1ZC3B 2YS5A 2J0MA 1GC6A 2G35A 4IFSA 3DXCA 2V76A 5HE3A 2COFA 3ZVRA 3PVUA 4IAPA 1M7EA 2W2WA 2D9YA 2JP2A 3PVLA 4ZRIA 2VKIA 1V5MA 4K17A 4KHAA 1K5DB 4A6FA 1ZSQA 3A8QA 2QKMA 1FOEA 1QQGA 3SNHA 2DFKA 2N0YA 2DN6A 4KHBB 1QC6A 2R09A 2Z0OA 1NTVA 5JP4A 4PQ0A 1FHXA 2Y8FA 1DYNA 5JLJB 3O96A 2COAA 4XWXA 5CLQB 3U7DA 4B6HA 1B55A 3ZDTA 4DBBA 3HQCA 3M1IB 3SYXA 1EVHA 1X05A 2MFQA 4K2OA 2M38A 3QBVB 4HDQA 2AEHA 3KSYA 3WYFB 2DLWA 1GC7A 1U5GA 2R0DA 4L6EA 2DX1A 2MDXA 5DHFB 3N7CA 2X18A 4IOYX 2E2XA 5D27A 4KVGB 4F7HA 2QKLA 4HB2B 1U2BA 1DROA 2I5FA 2M14A 5C5BB 3TFMA 5HE0A 2LOZA 4YL8A 2VSZA 4Y94A 2YS1A 3PZDA 4HAXB 4NY0A 4HAVB 2GCLA 4MY6A 5GOWB 4HB3B 1TQZA 2ELBA 1Y19B 1OQNA 2Z0QA 1MIXA 4HAWB 1PLSA 3V5WA 3KY9A 3TCAA 1W1GA 2Z0PA 1RRPB 3G9WA 3F0WA 2LULA 2K00A 1PFJA 5KQ1A 1UEFA 3D8EA 2DKPA 2ADZA 3ODXA 4HDOA 5C79A 3A8PA 5D3YA 2D2QA 4MK0A 1WVHA
chains in the Genus database with same CATH superfamily
2CRFA 1BTNA 1SHCA 1V89A 3PEGA 4EJNA 4HSIA 1X1GA 3PG7A 3SO6A 1GG3A 2D4QA 3CIKA 4GMVA 4WVFB 3OHMB 5D3WA 1FHOA 2DA0A 4F7GA 4HB0B 4A6FB 4ZRKA 3FM8C 5C16A 5EFXA 5DIFB 3VOQA 2J0JA 4PNKA 1EF1A 2RRFA 3FSSA 2D11A 5D3XA 2DHIA 2EMTA 4HAZB 3ULCA 1MK7B 1MKEA 2MWNB 1U29A 3ML4A 1P6SA 1U5EA 1DDWA 2I1KA 3AJ4A 2DTCA 3NWDA 2YVCA 1NI2A 2YRYA 1XCGA 2D9ZA 1FGYA 3U8ZA 2KUPA 3PP2A 1KZ7A 3U12A 2UZRA 3KRWA 1WGUA 1TJ6A 2PZ1A 4HHVA 3B77A 1FHWA 1ZVRA 5HE1A 1EAZA 1DDMA 2CY5A 5CLLB 3PSCA 3QWMA 2MKRA 2KCJA 3P6AA 5C6RA 2J59M 2AL6A 3ODWA 4K2PA 2DHKA 2K49A 5HE2A 2ZKMX 2BCJA 2XQNM 1BAKA 3LJUX 4NSWA 1I2HA 2GS0A 3DXEA 2KR0A 4C0AA 1I7AA 2ROZB 2GCJA 5D3VA 3TO1A 5FI0A 3NSUA 3IVFA 4GOUA 2KIGA 3ULBA 1BWNA 2KIEA 3TW1A 2RUKB 1Z87A 1AWEA 2NZ8B 4CSQA 1E5WA 2VRWB 1ZYIA 2H7EA 2W2XC 1DDVA 1X86A 1UPRA 2COCA 4CYEA 4EKUA 1XX0A 1DBHA 2W2XD 3DCXA 2DYQA 1OY2A 1RJ2A 5LONB 2Y8GA 3TVVA 2DX5A 3AU5A 2OQBA 5C5BA 4HAYB 2LOXA 3T06A 3DXDA 1UNQA 2J0KA 3CXBB 2L1CA 4QJ4B 5LOPB 4GZUA 4P7IA 2OTXA 4QJ3B 2EC1A 2RNRB 3HK0A 4OT1A 1V61A 2H7DA 4K81A 1W1DA 2R2YA 4A5KA 2P0DA 3FVCA 1J0WA 1ISNA 4DXAB 2CODA 4CHMA 5J3QA 2I1JA 2P8VA 1IRSA 4GN1A 2I5CA 1LW3A 3PVWA 4HATB 5DH9B 1V5PA 1P3RA 2EMSA 5I2SA 2YS3A 1BTKA 2HTHB 2KUQA 1ZC4B 3SUZA 1V88A 1XR0B 1K5GB 1ZM0A 1V5UA 2YSZA 2YT2A 4GPTB 1FB8A 4DX90 3D8FA 4A6KA 4DX8A 1MK9B 1N3HA 1TXDA 5I2MA 3BJIA 1UNRA 4EMOA 3A58A 1XODA 4DIXA 2NMBA 2RVBB 1P5TA 1MPHA 1KI1B 3HSAA 3QIJA 4GXBA 1NTYA 2IYBA 3P7ZA 4YONA 1U27A 2ELAA 2Y7BA 1AQCA 2D10A 2D9WA 2UZSA 4WJ7A 1W1HA 2RSGA 1WGQA 2D9VA 2DKQA 1MIZB 5J3YA 1Y5OA 4D0NB 2P0FA 2Z4DA 4Z2MB 1WJ1A 2K2JA 5J3TA 2HE7A 5KQ4A 4CHJA 4KAXB 4HAUB 3X23A 3GYOA 4KHBA 5JHGA 3F5RA 1T77A 5KCVA 3BINA 2IFSA 2L2IA 2P0HA 1WI1A 5DHAB 1WG7A 4TYZA 5FI1A 1KZGA 5IRSA 2D9XA 5M4YB 1H4RA 2FJLA 1SGHA 2NBVA 5DI9B 2LG1A 1NU2A 1LB1A 2Z14A 1U5DA 3HW2B 3KZ1A 3MPXA 1XD4A 2KGXB 2GJYA 4QXAB 4L1RA 3MDBC 4A6HA 4F7UP 4H8SA 3SV1A 2ROVA 4TKNA 2Q13A 2UVMA 1M7RA 4GMXB 4BBKA 3A98B 3GYPA 3KRXA 2K2UA 3ODOA 3UZTA 1FAOA 3NWAA 1OMWA 2YT0A 3WA0A 1Q67A 2EJ8A 4HB4B 2LYDA 1PMSA 1UNPA 1WJMA 1U5FA 4KHOA 2N23A 2CAYA 3AU4A 4WSFA 2DHJA 1X1FA 2YT1A 2DYNA 2YF0A 2Z13A 2RGNB 4ZRJA 2GUMA 2FJUB 3D8DA 3VIAA 4MT7A 1EGXA 3RCPA 1UPQA 1XKEA 1X11A 2LKOA 5L81A 1MAIA 1FGZA 2RLOA 2ZPYA 4Z2NA 2CY4A 5LG4B 3FEHA 1H10A 1J19A 3OANA 5JHHA 1ZC3B 2YS5A 2J0MA 1GC6A 2G35A 4IFSA 3DXCA 4OSNA 2V76A 5HE3A 2COFA 3ZVRA 3PVUA 4IAPA 1M7EA 2W2WA 2D9YA 3NWFA 2JP2A 3PVLA 4ZRIA 2VKIA 1V5MA 4K17A 4KHAA 1K5DB 2K8EA 1ZSQA 4A6FA 3A8QA 2QKMA 1FOEA 1QQGA 3SNHA 3NW8A 2DFKA 2N0YA 2DN6A 4KHBB 1QC6A 4QJ5B 2R09A 2Z0OA 1NTVA 5JP4A 4PQ0A 1FHXA 2Y8FA 1DYNA 5JLJB 3O96A 2COAA 4XWXA 5CLQB 3U7DA 4B6HA 1B55A 3ZDTA 4DBBA 3HQCA 3M1IB 3SYXA 1EVHA 1X05A 2MFQA 2Z59A 4K2OA 2M38A 3QBVB 4HDQA 2AEHA 3KSYA 3WYFB 2DLWA 1GC7A 1U5GA 2R0DA 4L6EA 2DX1A 2MDXA 5DHFB 3N7CA 2X18A 4IOYX 2E2XA 5D27A 4KVGB 4F7HA 2QKLA 4HB2B 1U2BA 1DROA 2I5FA 2M14A 3HIEA 5C5BB 4D6WA 3TFMA 5HE0A 2LOZA 4YL8A 2VSZA 4Y94A 2YS1A 3PZDA 4HAXB 4NY0A 4HAVB 2GCLA 4MY6A 5GOWB 4HB3B 1TQZA 2ELBA 1Y19B 1OQNA 2Z0QA 1MIXA 4HAWB 1PLSA 4GNKB 3V5WA 3KY9A 3TCAA 1W1GA 1MI1A 2Z0PA 1RRPB 3G9WA 3F0WA 2LULA 2K00A 1PFJA 5KQ1A 1UEFA 3D8EA 2DKPA 2ADZA 3ODXA 4HDOA 5C79A 3A8PA 5D3YA 2D2QA 4MK0A 1WVHA
chains in the Genus database with same CATH topology
2CRFA 1BTNA 1SHCA 1V89A 3PEGA 4EJNA 1X1GA 3PG7A 3SO6A 1GG3A 2D4QA 3CIKA 4GMVA 4WVFB 5D3WA 1FHOA 2DA0A 4F7GA 4HB0B 4A6FB 4ZRKA 3FM8C 5C16A 5EFXA 5DIFB 3VOQA 2J0JA 4PNKA 1EF1A 3FSSA 2D11A 5D3XA 2DHIA 2EMTA 4HAZB 3ULCA 1MK7B 1MKEA 2MWNB 1U29A 3ML4A 1P6SA 1U5EA 1DDWA 2I1KA 3AJ4A 2DTCA 2YVCA 1NI2A 2YRYA 1XCGA 2D9ZA 1FGYA 3U8ZA 2KUPA 3PP2A 1KZ7A 2UZRA 3KRWA 1WGUA 1TJ6A 2PZ1A 4HHVA 1FHWA 1ZVRA 5HE1A 1EAZA 1DDMA 2CY5A 5CLLB 3PSCA 3QWMA 2MKRA 2KCJA 3P6AA 5C6RA 2J59M 2AL6A 3ODWA 4K2PA 2DHKA 5HE2A 2BCJA 2XQNM 1BAKA 3LJUX 4NSWA 1I2HA 2GS0A 3DXEA 4C0AA 1I7AA 2ROZB 2GCJA 5D3VA 3TO1A 5FI0A 3NSUA 3IVFA 3ULBA 1BWNA 3TW1A 2RUKB 1Z87A 1AWEA 2NZ8B 1E5WA 2VRWB 2H7EA 2W2XC 1DDVA 1X86A 1UPRA 2COCA 4CYEA 4EKUA 1XX0A 1DBHA 2W2XD 2DYQA 1OY2A 1RJ2A 5LONB 2Y8GA 3TVVA 2DX5A 3AU5A 2OQBA 5C5BA 4HAYB 2LOXA 3T06A 3DXDA 1UNQA 2J0KA 3CXBB 2L1CA 5LOPB 4GZUA 4P7IA 2OTXA 2EC1A 2RNRB 3HK0A 1V61A 2H7DA 4K81A 1W1DA 4A5KA 4CHMA 2P0DA 1J0WA 1ISNA 4DXAB 2CODA 5J3QA 2I1JA 2P8VA 1IRSA 4GN1A 2I5CA 1LW3A 3PVWA 4HATB 5DH9B 1V5PA 1P3RA 2EMSA 2YS3A 1BTKA 2HTHB 1ZC4B 3SUZA 1V88A 1XR0B 1K5GB 1ZM0A 1V5UA 2YSZA 4GPTB 1FB8A 4DX90 3D8FA 4A6KA 4DX8A 1MK9B 1N3HA 1TXDA 3BJIA 1UNRA 4EMOA 1XODA 2NMBA 2RVBB 1P5TA 1MPHA 1KI1B 3QIJA 4GXBA 1NTYA 2IYBA 3P7ZA 4YONA 1U27A 2ELAA 2Y7BA 1AQCA 2D10A 2D9WA 2UZSA 4WJ7A 1W1HA 2RSGA 1WGQA 2D9VA 2DKQA 1MIZB 5J3YA 1Y5OA 4D0NB 2P0FA 4Z2MB 1WJ1A 2K2JA 5J3TA 2HE7A 5KQ4A 4CHJA 4KAXB 4HAUB 3X23A 3GYOA 5JHGA 3F5RA 5KCVA 3BINA 2IFSA 2L2IA 2P0HA 1WI1A 5DHAB 1WG7A 4TYZA 5FI1A 1KZGA 2D9XA 1H4RA 2FJLA 1SGHA 5DI9B 2LG1A 1NU2A 1LB1A 1U5DA 3HW2B 3KZ1A 3MPXA 1XD4A 2KGXB 2GJYA 3MDBC 4A6HA 4F7UP 4H8SA 3SV1A 2ROVA 4TKNA 2Q13A 2UVMA 1M7RA 4GMXB 4BBKA 3A98B 3GYPA 3KRXA 2K2UA 3ODOA 3UZTA 1FAOA 1OMWA 2YT0A 3WA0A 1Q67A 2EJ8A 4HB4B 2LYDA 1PMSA 1UNPA 1WJMA 1U5FA 4KHOA 2N23A 2CAYA 3AU4A 4WSFA 2DHJA 1X1FA 2YT1A 2DYNA 2YF0A 2RGNB 4ZRJA 3VIAA 3D8DA 4MT7A 1EGXA 3RCPA 1UPQA 1XKEA 1X11A 2LKOA 5L81A 1MAIA 1FGZA 2RLOA 2ZPYA 4Z2NA 2CY4A 3FEHA 1H10A 1J19A 3OANA 5JHHA 1ZC3B 2YS5A 2J0MA 1GC6A 2G35A 4IFSA 3DXCA 2V76A 5HE3A 2COFA 3ZVRA 3PVUA 4IAPA 1M7EA 2W2WA 2D9YA 2JP2A 3PVLA 4ZRIA 2VKIA 1V5MA 4K17A 4KHAA 1K5DB 4A6FA 1ZSQA 3A8QA 2QKMA 1FOEA 1QQGA 3SNHA 2DFKA 2N0YA 2DN6A 4KHBB 1QC6A 2R09A 2Z0OA 1NTVA 5JP4A 4PQ0A 1FHXA 2Y8FA 1DYNA 5JLJB 3O96A 2COAA 4XWXA 5CLQB 3U7DA 4B6HA 1B55A 3ZDTA 4DBBA 3HQCA 3M1IB 3SYXA 1EVHA 1X05A 2MFQA 4K2OA 2M38A 3QBVB 4HDQA 2AEHA 3KSYA 3WYFB 2DLWA 1GC7A 1U5GA 2R0DA 4L6EA 2DX1A 2MDXA 5DHFB 3N7CA 2X18A 4IOYX 2E2XA 5D27A 4KVGB 4F7HA 2QKLA 4HB2B 1U2BA 1DROA 2I5FA 2M14A 5C5BB 3TFMA 5HE0A 2LOZA 4YL8A 2VSZA 4Y94A 2YS1A 3PZDA 4HAXB 4NY0A 4HAVB 2GCLA 4MY6A 5GOWB 4HB3B 1TQZA 2ELBA 1Y19B 1OQNA 2Z0QA 1MIXA 4HAWB 1PLSA 3V5WA 3KY9A 3TCAA 1W1GA 2Z0PA 1RRPB 3G9WA 3F0WA 2LULA 2K00A 1PFJA 5KQ1A 1UEFA 3D8EA 2DKPA 2ADZA 3ODXA 4HDOA 5C79A 3A8PA 5D3YA 2D2QA 4MK0A 1WVHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CRF A;  1BTN A;  1SHC A;  1V89 A;  3PEG A;  4EJN A;  1X1G A;  3PG7 A;  3SO6 A;  1GG3 A;  2D4Q A;  3CIK A;  4GMV A;  4WVF B;  5D3W A;  1FHO A;  2DA0 A;  4F7G A;  4HB0 B;  4A6F B;  4ZRK A;  3FM8 C;  5C16 A;  5EFX A;  5DIF B;  3VOQ A;  2J0J A;  4PNK A;  1EF1 A;  3FSS A;  2D11 A;  5D3X A;  2DHI A;  2EMT A;  4HAZ B;  3ULC A;  1MK7 B;  1MKE A;  2MWN B;  1U29 A;  3ML4 A;  1P6S A;  1U5E A;  1DDW A;  2I1K A;  3AJ4 A;  2DTC A;  2YVC A;  1NI2 A;  2YRY A;  1XCG A;  2D9Z A;  1FGY A;  3U8Z A;  2KUP A;  3PP2 A;  1KZ7 A;  2UZR A;  3KRW A;  1WGU A;  1TJ6 A;  2PZ1 A;  4HHV A;  1FHW A;  1ZVR A;  5HE1 A;  1EAZ A;  1DDM A;  2CY5 A;  5CLL B;  3PSC A;  3QWM A;  2MKR A;  2KCJ A;  3P6A A;  5C6R A;  2J59 M;  2AL6 A;  3ODW A;  4K2P A;  2DHK A;  5HE2 A;  2BCJ A;  2XQN M;  1BAK A;  3LJU X;  4NSW A;  1I2H A;  2GS0 A;  3DXE A;  4C0A A;  1I7A A;  2ROZ B;  2GCJ A;  5D3V A;  3TO1 A;  5FI0 A;  3NSU A;  3IVF A;  3ULB A;  1BWN A;  3TW1 A;  2RUK B;  1Z87 A;  1AWE A;  2NZ8 B;  1E5W A;  2VRW B;  2H7E A;  2W2X C;  1DDV A;  1X86 A;  1UPR A;  2COC A;  4CYE A;  4EKU A;  1XX0 A;  1DBH A;  2W2X D;  2DYQ A;  1OY2 A;  1RJ2 A;  5LON B;  2Y8G A;  3TVV A;  2DX5 A;  3AU5 A;  2OQB A;  5C5B A;  4HAY B;  2LOX A;  3T06 A;  3DXD A;  1UNQ A;  2J0K A;  3CXB B;  2L1C A;  5LOP B;  4GZU A;  4P7I A;  2OTX A;  2EC1 A;  2RNR B;  3HK0 A;  1V61 A;  2H7D A;  4K81 A;  1W1D A;  4A5K A;  4CHM A;  2P0D A;  1J0W A;  1ISN A;  4DXA B;  2COD A;  5J3Q A;  2I1J A;  2P8V A;  1IRS A;  4GN1 A;  2I5C A;  1LW3 A;  3PVW A;  4HAT B;  5DH9 B;  1V5P A;  1P3R A;  2EMS A;  2YS3 A;  1BTK A;  2HTH B;  1ZC4 B;  3SUZ A;  1V88 A;  1XR0 B;  1K5G B;  1ZM0 A;  1V5U A;  2YSZ A;  4GPT B;  1FB8 A;  4DX9 0;  3D8F A;  4A6K A;  4DX8 A;  1MK9 B;  1N3H A;  1TXD A;  3BJI A;  1UNR A;  4EMO A;  1XOD A;  2NMB A;  2RVB B;  1P5T A;  1MPH A;  1KI1 B;  3QIJ A;  4GXB A;  1NTY A;  2IYB A;  3P7Z A;  4YON A;  1U27 A;  2ELA A;  2Y7B A;  1AQC A;  2D10 A;  2D9W A;  2UZS A;  4WJ7 A;  1W1H A;  2RSG A;  1WGQ A;  2D9V A;  2DKQ A;  1MIZ B;  5J3Y A;  1Y5O A;  4D0N B;  2P0F A;  4Z2M B;  1WJ1 A;  2K2J A;  5J3T A;  2HE7 A;  5KQ4 A;  4CHJ A;  4KAX B;  4HAU B;  3X23 A;  3GYO A;  5JHG A;  3F5R A;  5KCV A;  3BIN A;  2IFS A;  2L2I A;  2P0H A;  1WI1 A;  5DHA B;  1WG7 A;  4TYZ A;  5FI1 A;  1KZG A;  2D9X A;  1H4R A;  2FJL A;  1SGH A;  5DI9 B;  2LG1 A;  1NU2 A;  1LB1 A;  1U5D A;  3HW2 B;  3KZ1 A;  3MPX A;  1XD4 A;  2KGX B;  2GJY A;  3MDB C;  4A6H A;  4F7U P;  4H8S A;  3SV1 A;  2ROV A;  4TKN A;  2Q13 A;  2UVM A;  1M7R A;  4GMX B;  4BBK A;  3A98 B;  3GYP A;  3KRX A;  2K2U A;  3ODO A;  3UZT A;  1FAO A;  1OMW A;  2YT0 A;  3WA0 A;  1Q67 A;  2EJ8 A;  4HB4 B;  2LYD A;  1PMS A;  1UNP A;  1WJM A;  1U5F A;  4KHO A;  2N23 A;  2CAY A;  3AU4 A;  4WSF A;  2DHJ A;  1X1F A;  2YT1 A;  2DYN A;  2YF0 A;  2RGN B;  4ZRJ A;  3VIA A;  3D8D A;  4MT7 A;  1EGX A;  3RCP A;  1UPQ A;  1XKE A;  1X11 A;  2LKO A;  5L81 A;  1MAI A;  1FGZ A;  2RLO A;  2ZPY A;  4Z2N A;  2CY4 A;  3FEH A;  1H10 A;  1J19 A;  3OAN A;  5JHH A;  1ZC3 B;  2YS5 A;  2J0M A;  1GC6 A;  2G35 A;  4IFS A;  3DXC A;  2V76 A;  5HE3 A;  2COF A;  3ZVR A;  3PVU A;  4IAP A;  1M7E A;  2W2W A;  2D9Y A;  2JP2 A;  3PVL A;  4ZRI A;  2VKI A;  1V5M A;  4K17 A;  4KHA A;  1K5D B;  4A6F A;  1ZSQ A;  3A8Q A;  2QKM A;  1FOE A;  1QQG A;  3SNH A;  2DFK A;  2N0Y A;  2DN6 A;  4KHB B;  1QC6 A;  2R09 A;  2Z0O A;  1NTV A;  5JP4 A;  4PQ0 A;  1FHX A;  2Y8F A;  1DYN A;  5JLJ B;  3O96 A;  2COA A;  4XWX A;  5CLQ B;  3U7D A;  4B6H A;  1B55 A;  3ZDT A;  4DBB A;  3HQC A;  3M1I B;  3SYX A;  1EVH A;  1X05 A;  2MFQ A;  4K2O A;  2M38 A;  3QBV B;  4HDQ A;  2AEH A;  3KSY A;  3WYF B;  2DLW A;  1GC7 A;  1U5G A;  2R0D A;  4L6E A;  2DX1 A;  2MDX A;  5DHF B;  3N7C A;  2X18 A;  4IOY X;  2E2X A;  5D27 A;  4KVG B;  4F7H A;  2QKL A;  4HB2 B;  1U2B A;  1DRO A;  2I5F A;  2M14 A;  5C5B B;  3TFM A;  5HE0 A;  2LOZ A;  4YL8 A;  2VSZ A;  4Y94 A;  2YS1 A;  3PZD A;  4HAX B;  4NY0 A;  4HAV B;  2GCL A;  4MY6 A;  5GOW B;  4HB3 B;  1TQZ A;  2ELB A;  1Y19 B;  1OQN A;  2Z0Q A;  1MIX A;  4HAW B;  1PLS A;  3V5W A;  3KY9 A;  3TCA A;  1W1G A;  2Z0P A;  1RRP B;  3G9W A;  3F0W A;  2LUL A;  2K00 A;  1PFJ A;  5KQ1 A;  1UEF A;  3D8E A;  2DKP A;  2ADZ A;  3ODX A;  4HDO A;  5C79 A;  3A8P A;  5D3Y A;  2D2Q A;  4MK0 A;  1WVH A; 
#chains in the Genus database with same CATH topology
 2CRF A;  1BTN A;  1SHC A;  1V89 A;  3PEG A;  4EJN A;  4HSI A;  1X1G A;  3PG7 A;  3SO6 A;  1GG3 A;  2D4Q A;  3CIK A;  4GMV A;  4WVF B;  3OHM B;  5D3W A;  1FHO A;  2DA0 A;  4F7G A;  4HB0 B;  4A6F B;  4ZRK A;  3FM8 C;  5C16 A;  5EFX A;  5DIF B;  3VOQ A;  2J0J A;  4PNK A;  1EF1 A;  2RRF A;  3FSS A;  2D11 A;  5D3X A;  2DHI A;  2EMT A;  4HAZ B;  3ULC A;  1MK7 B;  1MKE A;  2MWN B;  1U29 A;  3ML4 A;  1P6S A;  1U5E A;  1DDW A;  2I1K A;  3AJ4 A;  2DTC A;  3NWD A;  2YVC A;  1NI2 A;  2YRY A;  1XCG A;  2D9Z A;  1FGY A;  3U8Z A;  2KUP A;  3PP2 A;  1KZ7 A;  3U12 A;  2UZR A;  3KRW A;  1WGU A;  1TJ6 A;  2PZ1 A;  4HHV A;  3B77 A;  1FHW A;  1ZVR A;  5HE1 A;  1EAZ A;  1DDM A;  2CY5 A;  5CLL B;  3PSC A;  3QWM A;  2MKR A;  2KCJ A;  3P6A A;  5C6R A;  2J59 M;  2AL6 A;  3ODW A;  4K2P A;  2DHK A;  2K49 A;  5HE2 A;  2ZKM X;  2BCJ A;  2XQN M;  1BAK A;  3LJU X;  4NSW A;  1I2H A;  2GS0 A;  3DXE A;  2KR0 A;  4C0A A;  1I7A A;  2ROZ B;  2GCJ A;  5D3V A;  3TO1 A;  5FI0 A;  3NSU A;  3IVF A;  4GOU A;  2KIG A;  3ULB A;  1BWN A;  2KIE A;  3TW1 A;  2RUK B;  1Z87 A;  1AWE A;  2NZ8 B;  4CSQ A;  1E5W A;  2VRW B;  1ZYI A;  2H7E A;  2W2X C;  1DDV A;  1X86 A;  1UPR A;  2COC A;  4CYE A;  4EKU A;  1XX0 A;  1DBH A;  2W2X D;  3DCX A;  2DYQ A;  1OY2 A;  1RJ2 A;  5LON B;  2Y8G A;  3TVV A;  2DX5 A;  3AU5 A;  2OQB A;  5C5B A;  4HAY B;  2LOX A;  3T06 A;  3DXD A;  1UNQ A;  2J0K A;  3CXB B;  2L1C A;  4QJ4 B;  5LOP B;  4GZU A;  4P7I A;  2OTX A;  4QJ3 B;  2EC1 A;  2RNR B;  3HK0 A;  4OT1 A;  1V61 A;  2H7D A;  4K81 A;  1W1D A;  2R2Y A;  4A5K A;  2P0D A;  3FVC A;  1J0W A;  1ISN A;  4DXA B;  2COD A;  4CHM A;  5J3Q A;  2I1J A;  2P8V A;  1IRS A;  4GN1 A;  2I5C A;  1LW3 A;  3PVW A;  4HAT B;  5DH9 B;  1V5P A;  1P3R A;  2EMS A;  5I2S A;  2YS3 A;  1BTK A;  2HTH B;  2KUQ A;  1ZC4 B;  3SUZ A;  1V88 A;  1XR0 B;  1K5G B;  1ZM0 A;  1V5U A;  2YSZ A;  2YT2 A;  4GPT B;  1FB8 A;  4DX9 0;  3D8F A;  4A6K A;  4DX8 A;  1MK9 B;  1N3H A;  1TXD A;  5I2M A;  3BJI A;  1UNR A;  4EMO A;  3A58 A;  1XOD A;  4DIX A;  2NMB A;  2RVB B;  1P5T A;  1MPH A;  1KI1 B;  3HSA A;  3QIJ A;  4GXB A;  1NTY A;  2IYB A;  3P7Z A;  4YON A;  1U27 A;  2ELA A;  2Y7B A;  1AQC A;  2D10 A;  2D9W A;  2UZS A;  4WJ7 A;  1W1H A;  2RSG A;  1WGQ A;  2D9V A;  2DKQ A;  1MIZ B;  5J3Y A;  1Y5O A;  4D0N B;  2P0F A;  2Z4D A;  4Z2M B;  1WJ1 A;  2K2J A;  5J3T A;  2HE7 A;  5KQ4 A;  4CHJ A;  4KAX B;  4HAU B;  3X23 A;  3GYO A;  4KHB A;  5JHG A;  3F5R A;  1T77 A;  5KCV A;  3BIN A;  2IFS A;  2L2I A;  2P0H A;  1WI1 A;  5DHA B;  1WG7 A;  4TYZ A;  5FI1 A;  1KZG A;  5IRS A;  2D9X A;  5M4Y B;  1H4R A;  2FJL A;  1SGH A;  2NBV A;  5DI9 B;  2LG1 A;  1NU2 A;  1LB1 A;  2Z14 A;  1U5D A;  3HW2 B;  3KZ1 A;  3MPX A;  1XD4 A;  2KGX B;  2GJY A;  4QXA B;  4L1R A;  3MDB C;  4A6H A;  4F7U P;  4H8S A;  3SV1 A;  2ROV A;  4TKN A;  2Q13 A;  2UVM A;  1M7R A;  4GMX B;  4BBK A;  3A98 B;  3GYP A;  3KRX A;  2K2U A;  3ODO A;  3UZT A;  1FAO A;  3NWA A;  1OMW A;  2YT0 A;  3WA0 A;  1Q67 A;  2EJ8 A;  4HB4 B;  2LYD A;  1PMS A;  1UNP A;  1WJM A;  1U5F A;  4KHO A;  2N23 A;  2CAY A;  3AU4 A;  4WSF A;  2DHJ A;  1X1F A;  2YT1 A;  2DYN A;  2YF0 A;  2Z13 A;  2RGN B;  4ZRJ A;  2GUM A;  2FJU B;  3D8D A;  3VIA A;  4MT7 A;  1EGX A;  3RCP A;  1UPQ A;  1XKE A;  1X11 A;  2LKO A;  5L81 A;  1MAI A;  1FGZ A;  2RLO A;  2ZPY A;  4Z2N A;  2CY4 A;  5LG4 B;  3FEH A;  1H10 A;  1J19 A;  3OAN A;  5JHH A;  1ZC3 B;  2YS5 A;  2J0M A;  1GC6 A;  2G35 A;  4IFS A;  3DXC A;  4OSN A;  2V76 A;  5HE3 A;  2COF A;  3ZVR A;  3PVU A;  4IAP A;  1M7E A;  2W2W A;  2D9Y A;  3NWF A;  2JP2 A;  3PVL A;  4ZRI A;  2VKI A;  1V5M A;  4K17 A;  4KHA A;  1K5D B;  2K8E A;  1ZSQ A;  4A6F A;  3A8Q A;  2QKM A;  1FOE A;  1QQG A;  3SNH A;  3NW8 A;  2DFK A;  2N0Y A;  2DN6 A;  4KHB B;  1QC6 A;  4QJ5 B;  2R09 A;  2Z0O A;  1NTV A;  5JP4 A;  4PQ0 A;  1FHX A;  2Y8F A;  1DYN A;  5JLJ B;  3O96 A;  2COA A;  4XWX A;  5CLQ B;  3U7D A;  4B6H A;  1B55 A;  3ZDT A;  4DBB A;  3HQC A;  3M1I B;  3SYX A;  1EVH A;  1X05 A;  2MFQ A;  2Z59 A;  4K2O A;  2M38 A;  3QBV B;  4HDQ A;  2AEH A;  3KSY A;  3WYF B;  2DLW A;  1GC7 A;  1U5G A;  2R0D A;  4L6E A;  2DX1 A;  2MDX A;  5DHF B;  3N7C A;  2X18 A;  4IOY X;  2E2X A;  5D27 A;  4KVG B;  4F7H A;  2QKL A;  4HB2 B;  1U2B A;  1DRO A;  2I5F A;  2M14 A;  3HIE A;  5C5B B;  4D6W A;  3TFM A;  5HE0 A;  2LOZ A;  4YL8 A;  2VSZ A;  4Y94 A;  2YS1 A;  3PZD A;  4HAX B;  4NY0 A;  4HAV B;  2GCL A;  4MY6 A;  5GOW B;  4HB3 B;  1TQZ A;  2ELB A;  1Y19 B;  1OQN A;  2Z0Q A;  1MIX A;  4HAW B;  1PLS A;  4GNK B;  3V5W A;  3KY9 A;  3TCA A;  1W1G A;  1MI1 A;  2Z0P A;  1RRP B;  3G9W A;  3F0W A;  2LUL A;  2K00 A;  1PFJ A;  5KQ1 A;  1UEF A;  3D8E A;  2DKP A;  2ADZ A;  3ODX A;  4HDO A;  5C79 A;  3A8P A;  5D3Y A;  2D2Q A;  4MK0 A;  1WVH A; 
#chains in the Genus database with same CATH homology
 2CRF A;  1BTN A;  1SHC A;  1V89 A;  3PEG A;  4EJN A;  1X1G A;  3PG7 A;  3SO6 A;  1GG3 A;  2D4Q A;  3CIK A;  4GMV A;  4WVF B;  5D3W A;  1FHO A;  2DA0 A;  4F7G A;  4HB0 B;  4A6F B;  4ZRK A;  3FM8 C;  5C16 A;  5EFX A;  5DIF B;  3VOQ A;  2J0J A;  4PNK A;  1EF1 A;  3FSS A;  2D11 A;  5D3X A;  2DHI A;  2EMT A;  4HAZ B;  3ULC A;  1MK7 B;  1MKE A;  2MWN B;  1U29 A;  3ML4 A;  1P6S A;  1U5E A;  1DDW A;  2I1K A;  3AJ4 A;  2DTC A;  2YVC A;  1NI2 A;  2YRY A;  1XCG A;  2D9Z A;  1FGY A;  3U8Z A;  2KUP A;  3PP2 A;  1KZ7 A;  2UZR A;  3KRW A;  1WGU A;  1TJ6 A;  2PZ1 A;  4HHV A;  1FHW A;  1ZVR A;  5HE1 A;  1EAZ A;  1DDM A;  2CY5 A;  5CLL B;  3PSC A;  3QWM A;  2MKR A;  2KCJ A;  3P6A A;  5C6R A;  2J59 M;  2AL6 A;  3ODW A;  4K2P A;  2DHK A;  5HE2 A;  2BCJ A;  2XQN M;  1BAK A;  3LJU X;  4NSW A;  1I2H A;  2GS0 A;  3DXE A;  4C0A A;  1I7A A;  2ROZ B;  2GCJ A;  5D3V A;  3TO1 A;  5FI0 A;  3NSU A;  3IVF A;  3ULB A;  1BWN A;  3TW1 A;  2RUK B;  1Z87 A;  1AWE A;  2NZ8 B;  1E5W A;  2VRW B;  2H7E A;  2W2X C;  1DDV A;  1X86 A;  1UPR A;  2COC A;  4CYE A;  4EKU A;  1XX0 A;  1DBH A;  2W2X D;  2DYQ A;  1OY2 A;  1RJ2 A;  5LON B;  2Y8G A;  3TVV A;  2DX5 A;  3AU5 A;  2OQB A;  5C5B A;  4HAY B;  2LOX A;  3T06 A;  3DXD A;  1UNQ A;  2J0K A;  3CXB B;  2L1C A;  5LOP B;  4GZU A;  4P7I A;  2OTX A;  2EC1 A;  2RNR B;  3HK0 A;  1V61 A;  2H7D A;  4K81 A;  1W1D A;  4A5K A;  4CHM A;  2P0D A;  1J0W A;  1ISN A;  4DXA B;  2COD A;  5J3Q A;  2I1J A;  2P8V A;  1IRS A;  4GN1 A;  2I5C A;  1LW3 A;  3PVW A;  4HAT B;  5DH9 B;  1V5P A;  1P3R A;  2EMS A;  2YS3 A;  1BTK A;  2HTH B;  1ZC4 B;  3SUZ A;  1V88 A;  1XR0 B;  1K5G B;  1ZM0 A;  1V5U A;  2YSZ A;  4GPT B;  1FB8 A;  4DX9 0;  3D8F A;  4A6K A;  4DX8 A;  1MK9 B;  1N3H A;  1TXD A;  3BJI A;  1UNR A;  4EMO A;  1XOD A;  2NMB A;  2RVB B;  1P5T A;  1MPH A;  1KI1 B;  3QIJ A;  4GXB A;  1NTY A;  2IYB A;  3P7Z A;  4YON A;  1U27 A;  2ELA A;  2Y7B A;  1AQC A;  2D10 A;  2D9W A;  2UZS A;  4WJ7 A;  1W1H A;  2RSG A;  1WGQ A;  2D9V A;  2DKQ A;  1MIZ B;  5J3Y A;  1Y5O A;  4D0N B;  2P0F A;  4Z2M B;  1WJ1 A;  2K2J A;  5J3T A;  2HE7 A;  5KQ4 A;  4CHJ A;  4KAX B;  4HAU B;  3X23 A;  3GYO A;  5JHG A;  3F5R A;  5KCV A;  3BIN A;  2IFS A;  2L2I A;  2P0H A;  1WI1 A;  5DHA B;  1WG7 A;  4TYZ A;  5FI1 A;  1KZG A;  2D9X A;  1H4R A;  2FJL A;  1SGH A;  5DI9 B;  2LG1 A;  1NU2 A;  1LB1 A;  1U5D A;  3HW2 B;  3KZ1 A;  3MPX A;  1XD4 A;  2KGX B;  2GJY A;  3MDB C;  4A6H A;  4F7U P;  4H8S A;  3SV1 A;  2ROV A;  4TKN A;  2Q13 A;  2UVM A;  1M7R A;  4GMX B;  4BBK A;  3A98 B;  3GYP A;  3KRX A;  2K2U A;  3ODO A;  3UZT A;  1FAO A;  1OMW A;  2YT0 A;  3WA0 A;  1Q67 A;  2EJ8 A;  4HB4 B;  2LYD A;  1PMS A;  1UNP A;  1WJM A;  1U5F A;  4KHO A;  2N23 A;  2CAY A;  3AU4 A;  4WSF A;  2DHJ A;  1X1F A;  2YT1 A;  2DYN A;  2YF0 A;  2RGN B;  4ZRJ A;  3VIA A;  3D8D A;  4MT7 A;  1EGX A;  3RCP A;  1UPQ A;  1XKE A;  1X11 A;  2LKO A;  5L81 A;  1MAI A;  1FGZ A;  2RLO A;  2ZPY A;  4Z2N A;  2CY4 A;  3FEH A;  1H10 A;  1J19 A;  3OAN A;  5JHH A;  1ZC3 B;  2YS5 A;  2J0M A;  1GC6 A;  2G35 A;  4IFS A;  3DXC A;  2V76 A;  5HE3 A;  2COF A;  3ZVR A;  3PVU A;  4IAP A;  1M7E A;  2W2W A;  2D9Y A;  2JP2 A;  3PVL A;  4ZRI A;  2VKI A;  1V5M A;  4K17 A;  4KHA A;  1K5D B;  4A6F A;  1ZSQ A;  3A8Q A;  2QKM A;  1FOE A;  1QQG A;  3SNH A;  2DFK A;  2N0Y A;  2DN6 A;  4KHB B;  1QC6 A;  2R09 A;  2Z0O A;  1NTV A;  5JP4 A;  4PQ0 A;  1FHX A;  2Y8F A;  1DYN A;  5JLJ B;  3O96 A;  2COA A;  4XWX A;  5CLQ B;  3U7D A;  4B6H A;  1B55 A;  3ZDT A;  4DBB A;  3HQC A;  3M1I B;  3SYX A;  1EVH A;  1X05 A;  2MFQ A;  4K2O A;  2M38 A;  3QBV B;  4HDQ A;  2AEH A;  3KSY A;  3WYF B;  2DLW A;  1GC7 A;  1U5G A;  2R0D A;  4L6E A;  2DX1 A;  2MDX A;  5DHF B;  3N7C A;  2X18 A;  4IOY X;  2E2X A;  5D27 A;  4KVG B;  4F7H A;  2QKL A;  4HB2 B;  1U2B A;  1DRO A;  2I5F A;  2M14 A;  5C5B B;  3TFM A;  5HE0 A;  2LOZ A;  4YL8 A;  2VSZ A;  4Y94 A;  2YS1 A;  3PZD A;  4HAX B;  4NY0 A;  4HAV B;  2GCL A;  4MY6 A;  5GOW B;  4HB3 B;  1TQZ A;  2ELB A;  1Y19 B;  1OQN A;  2Z0Q A;  1MIX A;  4HAW B;  1PLS A;  3V5W A;  3KY9 A;  3TCA A;  1W1G A;  2Z0P A;  1RRP B;  3G9W A;  3F0W A;  2LUL A;  2K00 A;  1PFJ A;  5KQ1 A;  1UEF A;  3D8E A;  2DKP A;  2ADZ A;  3ODX A;  4HDO A;  5C79 A;  3A8P A;  5D3Y A;  2D2Q A;  4MK0 A;  1WVH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...