1DYNA

Crystal structure at 2.2 angstroms resolution of the pleckstrin homology domain from human dynamin
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
113
structure length
113
Chain Sequence
ILVIRKGWLTINNIGIMKGGSKEYWFVLTAENLSWYKDDEEKEKKYMLSVDNLKLRDVEKGFMSSKHIFALFNTEQRNVYKDYRQLELACETQEEVDSWKASFLRAGVYPERV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure at 2.2 A resolution of the pleckstrin homology domain from human dynamin.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signal transduction protein
molecule keywords DYNAMIN
total genus 26
structure length 113
sequence length 113
chains with identical sequence B
ec nomenclature ec 3.6.5.5: Dynamin GTPase.
pdb deposition date 1994-12-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00169 PH PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1dynA00
1I2HA 1TXDA 2NMBA 3P6AA 4GXBA 2AL6A 4K81A 1MAIA 3CXBB 1UEFA 5D3VA 4H8SA 1U29A 5HE3A 2I5CA 1U27A 5JP4A 1U5DA 4A6FA 1XX0A 2V76A 1WJMA 3KZ1A 2LYDA 2KCJA 4A6FB 3HW2B 2J0JA 2UZRA 5D3WA 3X23A 5C16A 4GPTB 1Y19B 1ISNA 3KSYA 4NY0A 3VIAA 4DX90 5LONB 1FHOA 1GC7A 4A6HA 2RGNB 1UNPA 2EJ8A 1Y5OA 1GG3A 4ZRKA 1BAKA 4BBKA 1H4RA 1XR0B 2FJLA 4HAUB 4HAZB 5GOWB 4L6EA 1WGUA 5J3TA 2YF0A 3PEGA 5D27A 4TKNA 2P8VA 2N23A 2ZPYA 4K2OA 1V5UA 3A8PA 3LJUX 3GYPA 1EF1A 3PVUA 2P0DA 3D8FA 5HE1A 3ULCA 2YSZA 1FB8A 1ZSQA 1PFJA 4KHAA 3CIKA 4KHBB 3D8EA 4ZRJA 2YS5A 4P7IA 4HDOA 1UPRA 2K2UA 4WSFA 2DHJA 5JLJB 5DIFB 1X05A 2MKRA 1W1HA 3NSUA 2QKLA 3WA0A 2J59M 3TO1A 4B6HA 1U5FA 3ODOA 1NTYA 3A98B 3ML4A 2EC1A 2UZSA 1W1DA 5LOPB 1OY2A 1V88A 1N3HA 1XCGA 1OQNA 2ELAA 1MIZB 4HB4B 1NI2A 1MK7B 4YL8A 1SGHA 2LG1A 3DXCA 2DKPA 1PMSA 1X1FA 1MK9B 1PLSA 5DI9B 4CHMA 3QIJA 5FI0A 2K2JA 3OANA 3TFMA 3BJIA 3AU5A 4D0NB 1EVHA 4DX8A 2DYNA 2N0YA 4WJ7A 2IYBA 2MFQA 4HB0B 3M1IB 1BWNA 3F0WA 5L81A 3BINA 1AQCA 2H7EA 4F7HA 2W2WA 3IVFA 3O96A 2P0HA 2R0DA 2DA0A 2CRFA 3PVLA 5DH9B 3U8ZA 1ZVRA 3FEHA 4F7GA 3HQCA 2Z0PA 4CHJA 5HE0A 2COFA 3SO6A 2D9XA 3U7DA 2DX1A 2AEHA 5J3YA 2Z0QA 2YS1A 5C6RA 3T06A 2CODA 1E5WA 3PP2A 2HE7A 2E2XA 2Y8FA 1FHWA 1Q67A 4IAPA 5FI1A 1M7EA 2RSGA 4A6KA 2J0MA 1TJ6A 2DX5A 1NTVA 1BTKA 1X11A 2XQNM 3MPXA 1U5GA 3AU4A 4GZUA 5C79A 1MIXA 3QBVB 2G35A 1V89A 2GCLA 1MPHA 3AJ4A 1U2BA 1IRSA 4HB2B 4NSWA 3UZTA 1EAZA 2L1CA 2K00A 4Z2NA 3QWMA 3DXEA 1FGYA 4GN1A 2IFSA 2VSZA 3ODWA 2L2IA 1UNRA 2Y7BA 4WVFB 4A5KA 3VOQA 4HATB 4CYEA 4K17A 2Q13A 1DYNA 1UPQA 4HDQA 1WI1A 2YT1A 2OTXA 2KUPA 2RUKB 4DXAB 1V5MA 5KQ4A 2W2XC 1KZ7A 1V5PA 3SUZA 3ODXA 2BCJA 2D2QA 1DROA 1DBHA 4HAVB 3SNHA 3PSCA 1UNQA 1X1GA 2DFKA 4MK0A 4MY6A 2RNRB 3PVWA 5CLLB 2J0KA 2W2XD 2GJYA 1QQGA 1J0WA 1FAOA 4IFSA 5DHFB 1M7RA 2CAYA 2VKIA 5HE2A 3PZDA 4EKUA 1K5GB 4K2PA 3ZDTA 1DDWA 4EJNA 5JHHA 1KI1B 4PNKA 4TYZA 3D8DA 4DBBA 3FM8C 2ROVA 3KRXA 2CY5A 2HTHB 2I1KA 1WGQA 2ADZA 3TCAA 2LOXA 2RVBB 4HAYB 2QKMA 2DHKA 4YONA 2KGXB 3WYFB 2DYQA 1P6SA 2YT0A 1U5EA 2COCA 2LOZA 2D9WA 1P3RA 1XKEA 3SV1A 2PZ1A 1B55A 2D9YA 2H7DA 1WG7A 2EMTA 4GMXB 2DTCA 1X86A 5D3YA 2LULA 2Z0OA 3SYXA 5KQ1A 1XODA 1LW3A 2MDXA 1RRPB 2YS3A 1Z87A 1TQZA 1RJ2A 1FHXA 1P5TA 2D10A 1FOEA 4EMOA 4KAXB 3RCPA 3N7CA 4HAXB 3V5WA 2ELBA 1XD4A 2ROZB 2UVMA 2D11A 2GS0A 1I7AA 4Z2MB 2GCJA 4GMVA 4KHOA 2D9VA 2DHIA 4ZRIA 3F5RA 1ZC4B 2MWNB 5JHGA 4F7UP 1K5DB 2I1JA 4HHVA 3A8QA 5C5BA 4Y94A 1J19A 1DDMA 1FGZA 2CY4A 1MKEA 2I5FA 3HK0A 5KCVA 2Y8GA 2RLOA 3ULBA 2YRYA 4HB3B 1KZGA 2NZ8B 3TW1A 2LKOA 1H10A 3KY9A 5J3QA 3MDBC 1NU2A 2D4QA 4MT7A 4PQ0A 1GC6A 3KRWA 1WVHA 3GYOA 5CLQB 1ZM0A 5D3XA 3P7ZA 4XWXA 1ZC3B 2D9ZA 2EMSA 2DKQA 4HAWB 2X18A 2M38A 1AWEA 2R09A 3TVVA 3ZVRA 1QC6A 3FSSA 2VRWB 1V61A 2OQBA 1EGXA 2YVCA 5DHAB 3G9WA 2M14A 3PG7A 4IOYX 5C5BB 1W1GA 4C0AA 1WJ1A 1DDVA 2DN6A 2P0FA 1OMWA 1SHCA 2DLWA 1LB1A 5EFXA 2COAA 2JP2A 3DXDA 4KVGB 1BTNA
chains in the Genus database with same CATH superfamily
5IRSA 1I2HA 1TXDA 2NMBA 2RRFA 3P6AA 4GXBA 2AL6A 4K81A 1MAIA 3CXBB 1UEFA 5D3VA 3NW8A 4H8SA 1U29A 5HE3A 3NWFA 2I5CA 1U27A 5JP4A 1U5DA 4A6FA 1XX0A 2R2YA 2V76A 1WJMA 3KZ1A 2LYDA 2KCJA 4A6FB 3HW2B 2J0JA 2UZRA 5D3WA 3X23A 5C16A 4GPTB 1Y19B 1ISNA 3KSYA 4NY0A 5M4YB 3VIAA 4DX90 4HSIA 5LONB 1FHOA 1GC7A 4A6HA 2RGNB 3A58A 1UNPA 2EJ8A 1Y5OA 1GG3A 4ZRKA 1BAKA 4BBKA 1H4RA 4D6WA 1XR0B 3DCXA 2FJLA 4HAUB 4HAZB 5GOWB 4L6EA 1WGUA 5J3TA 2YF0A 3PEGA 5D27A 4TKNA 2P8VA 2N23A 2ZPYA 4K2OA 1V5UA 3A8PA 3LJUX 3GYPA 1EF1A 3PVUA 2P0DA 3D8FA 5HE1A 3ULCA 2YSZA 1FB8A 1ZSQA 1PFJA 5I2MA 4KHAA 3CIKA 4KHBB 3D8EA 4ZRJA 2YS5A 4P7IA 4HDOA 1UPRA 2K2UA 4WSFA 2DHJA 5JLJB 5DIFB 1X05A 2MKRA 1W1HA 3NSUA 2QKLA 3WA0A 3NWDA 2J59M 3TO1A 4B6HA 1U5FA 3ODOA 1NTYA 3A98B 3ML4A 2EC1A 2UZSA 4QJ5B 1W1DA 5LOPB 1OY2A 1V88A 1N3HA 3NWAA 1XCGA 1OQNA 2ELAA 2Z13A 1MIZB 4HB4B 1NI2A 1MK7B 4YL8A 1SGHA 2ZKMX 2LG1A 3DXCA 2DKPA 1PMSA 4QJ3B 1X1FA 1MK9B 1PLSA 5DI9B 4CHMA 3QIJA 5FI0A 2K2JA 3OANA 3TFMA 3BJIA 3AU5A 4D0NB 2KIGA 1EVHA 4DX8A 2DYNA 2N0YA 4WJ7A 2IYBA 2MFQA 4HB0B 3M1IB 1BWNA 3F0WA 5L81A 3BINA 1AQCA 2H7EA 4F7HA 2W2WA 4KHBA 5I2SA 3IVFA 3O96A 2P0HA 2R0DA 4OT1A 4QJ4B 2DA0A 2CRFA 3PVLA 5DH9B 3U8ZA 1ZVRA 3FEHA 3FVCA 4F7GA 3HQCA 2Z0PA 4CHJA 5HE0A 2COFA 3SO6A 2D9XA 4GOUA 3U7DA 2DX1A 2AEHA 5J3YA 2Z0QA 2YS1A 5C6RA 3T06A 2CODA 1E5WA 3PP2A 2HE7A 2E2XA 2Y8FA 1FHWA 1Q67A 4IAPA 5FI1A 3U12A 1M7EA 2RSGA 4A6KA 2J0MA 2Z59A 1TJ6A 2DX5A 1NTVA 1BTKA 1X11A 2XQNM 3MPXA 1U5GA 2GUMA 3AU4A 4GZUA 1MIXA 3QBVB 2G35A 5C79A 1V89A 2GCLA 1MPHA 3AJ4A 1U2BA 1IRSA 4HB2B 4NSWA 3UZTA 1EAZA 2L1CA 2K00A 4Z2NA 3QWMA 3DXEA 4L1RA 1FGYA 1ZYIA 4GN1A 2IFSA 2VSZA 4OSNA 3ODWA 2L2IA 1UNRA 2Y7BA 4WVFB 4A5KA 3HIEA 4HATB 3VOQA 4CYEA 4K17A 2Q13A 3HSAA 1DYNA 1UPQA 4HDQA 1WI1A 2YT1A 1MI1A 2FJUB 2OTXA 2KUPA 2RUKB 4DXAB 1V5MA 5KQ4A 2NBVA 2W2XC 1KZ7A 1V5PA 3SUZA 3ODXA 2BCJA 2D2QA 1DROA 1DBHA 4HAVB 3SNHA 1T77A 3PSCA 1UNQA 1X1GA 2DFKA 4MK0A 4MY6A 2RNRB 3PVWA 5CLLB 2J0KA 2W2XD 2GJYA 1QQGA 1J0WA 1FAOA 4IFSA 5DHFB 1M7RA 2CAYA 2VKIA 5HE2A 3PZDA 4EKUA 1K5GB 4GNKB 4K2PA 3ZDTA 1DDWA 4EJNA 5JHHA 1KI1B 4PNKA 4TYZA 3D8DA 4DBBA 3OHMB 3FM8C 2ROVA 3KRXA 2CY5A 4DIXA 3B77A 2HTHB 2I1KA 1WGQA 2ADZA 3TCAA 2LOXA 2RVBB 4HAYB 2QKMA 2DHKA 4YONA 2KGXB 3WYFB 2DYQA 1P6SA 2YT0A 1U5EA 2COCA 2Z4DA 2LOZA 2D9WA 1P3RA 1XKEA 3SV1A 2PZ1A 1B55A 2D9YA 2H7DA 1WG7A 2EMTA 2DTCA 4GMXB 1X86A 5D3YA 2LULA 2Z0OA 3SYXA 5KQ1A 1XODA 1LW3A 2MDXA 1RRPB 2YS3A 1Z87A 1TQZA 1RJ2A 1FHXA 1P5TA 2D10A 1FOEA 2KUQA 4EMOA 4KAXB 3RCPA 3N7CA 4HAXB 3V5WA 2ELBA 1XD4A 2KIEA 2ROZB 2D11A 2UVMA 2GS0A 1I7AA 4Z2MB 2GCJA 4GMVA 4KHOA 2K49A 2D9VA 2DHIA 4ZRIA 3F5RA 1ZC4B 2MWNB 5JHGA 4F7UP 1K5DB 2I1JA 2K8EA 4HHVA 3A8QA 5C5BA 4QXAB 4Y94A 1J19A 1DDMA 1FGZA 2CY4A 1MKEA 2KR0A 2I5FA 3HK0A 5KCVA 2Y8GA 2RLOA 3ULBA 2YRYA 4HB3B 1KZGA 2NZ8B 3TW1A 2LKOA 1H10A 3KY9A 5J3QA 3MDBC 1NU2A 2D4QA 4MT7A 4PQ0A 1GC6A 3KRWA 1WVHA 3GYOA 5CLQB 1ZM0A 5D3XA 3P7ZA 4XWXA 1ZC3B 2D9ZA 2EMSA 2DKQA 4HAWB 5LG4B 2X18A 2M38A 1AWEA 2R09A 3TVVA 3ZVRA 2Z14A 1QC6A 3FSSA 2VRWB 1V61A 2OQBA 1EGXA 2YVCA 5DHAB 4CSQA 3G9WA 2M14A 3PG7A 4IOYX 2YT2A 5C5BB 1W1GA 4C0AA 1WJ1A 1DDVA 2DN6A 2P0FA 1OMWA 1SHCA 2DLWA 1LB1A 5EFXA 2COAA 2JP2A 3DXDA 4KVGB 1BTNA
chains in the Genus database with same CATH topology
1I2HA 1TXDA 2NMBA 3P6AA 4GXBA 2AL6A 4K81A 1MAIA 3CXBB 1UEFA 5D3VA 4H8SA 1U29A 5HE3A 2I5CA 1U27A 5JP4A 1U5DA 4A6FA 1XX0A 2V76A 1WJMA 3KZ1A 2LYDA 2KCJA 4A6FB 3HW2B 2J0JA 2UZRA 5D3WA 3X23A 5C16A 4GPTB 1Y19B 1ISNA 3KSYA 4NY0A 3VIAA 4DX90 5LONB 1FHOA 1GC7A 4A6HA 2RGNB 1UNPA 2EJ8A 1Y5OA 1GG3A 4ZRKA 1BAKA 4BBKA 1H4RA 1XR0B 2FJLA 4HAUB 4HAZB 5GOWB 4L6EA 1WGUA 5J3TA 2YF0A 3PEGA 5D27A 4TKNA 2P8VA 2N23A 2ZPYA 4K2OA 1V5UA 3A8PA 3LJUX 3GYPA 1EF1A 3PVUA 2P0DA 3D8FA 5HE1A 3ULCA 2YSZA 1FB8A 1ZSQA 1PFJA 4KHAA 3CIKA 4KHBB 3D8EA 4ZRJA 2YS5A 4P7IA 4HDOA 1UPRA 2K2UA 4WSFA 2DHJA 5JLJB 5DIFB 1X05A 2MKRA 1W1HA 3NSUA 2QKLA 3WA0A 2J59M 3TO1A 4B6HA 1U5FA 3ODOA 1NTYA 3A98B 3ML4A 2EC1A 2UZSA 1W1DA 5LOPB 1OY2A 1V88A 1N3HA 1XCGA 1OQNA 2ELAA 1MIZB 4HB4B 1NI2A 1MK7B 4YL8A 1SGHA 2LG1A 3DXCA 2DKPA 1PMSA 1X1FA 1MK9B 1PLSA 5DI9B 4CHMA 3QIJA 5FI0A 2K2JA 3OANA 3TFMA 3BJIA 3AU5A 4D0NB 1EVHA 4DX8A 2DYNA 2N0YA 4WJ7A 2IYBA 2MFQA 4HB0B 3M1IB 1BWNA 3F0WA 5L81A 3BINA 1AQCA 2H7EA 4F7HA 2W2WA 3IVFA 3O96A 2P0HA 2R0DA 2DA0A 2CRFA 3PVLA 5DH9B 3U8ZA 1ZVRA 3FEHA 4F7GA 3HQCA 2Z0PA 4CHJA 5HE0A 2COFA 3SO6A 2D9XA 3U7DA 2DX1A 2AEHA 5J3YA 2Z0QA 2YS1A 5C6RA 3T06A 2CODA 1E5WA 3PP2A 2HE7A 2E2XA 2Y8FA 1FHWA 1Q67A 4IAPA 5FI1A 1M7EA 2RSGA 4A6KA 2J0MA 1TJ6A 2DX5A 1NTVA 1BTKA 1X11A 2XQNM 3MPXA 1U5GA 3AU4A 4GZUA 5C79A 1MIXA 3QBVB 2G35A 1V89A 2GCLA 1MPHA 3AJ4A 1U2BA 1IRSA 4HB2B 4NSWA 3UZTA 1EAZA 2L1CA 2K00A 4Z2NA 3QWMA 3DXEA 1FGYA 4GN1A 2IFSA 2VSZA 3ODWA 2L2IA 1UNRA 2Y7BA 4WVFB 4A5KA 3VOQA 4HATB 4CYEA 4K17A 2Q13A 1DYNA 1UPQA 4HDQA 1WI1A 2YT1A 2OTXA 2KUPA 2RUKB 4DXAB 1V5MA 5KQ4A 2W2XC 1KZ7A 1V5PA 3SUZA 3ODXA 2BCJA 2D2QA 1DROA 1DBHA 4HAVB 3SNHA 3PSCA 1UNQA 1X1GA 2DFKA 4MK0A 4MY6A 2RNRB 3PVWA 5CLLB 2J0KA 2W2XD 2GJYA 1QQGA 1J0WA 1FAOA 4IFSA 5DHFB 1M7RA 2CAYA 2VKIA 5HE2A 3PZDA 4EKUA 1K5GB 4K2PA 3ZDTA 1DDWA 4EJNA 5JHHA 1KI1B 4PNKA 4TYZA 3D8DA 4DBBA 3FM8C 2ROVA 3KRXA 2CY5A 2HTHB 2I1KA 1WGQA 2ADZA 3TCAA 2LOXA 2RVBB 4HAYB 2QKMA 2DHKA 4YONA 2KGXB 3WYFB 2DYQA 1P6SA 2YT0A 1U5EA 2COCA 2LOZA 2D9WA 1P3RA 1XKEA 3SV1A 2PZ1A 1B55A 2D9YA 2H7DA 1WG7A 2EMTA 4GMXB 2DTCA 1X86A 5D3YA 2LULA 2Z0OA 3SYXA 5KQ1A 1XODA 1LW3A 2MDXA 1RRPB 2YS3A 1Z87A 1TQZA 1RJ2A 1FHXA 1P5TA 2D10A 1FOEA 4EMOA 4KAXB 3RCPA 3N7CA 4HAXB 3V5WA 2ELBA 1XD4A 2ROZB 2UVMA 2D11A 2GS0A 1I7AA 4Z2MB 2GCJA 4GMVA 4KHOA 2D9VA 2DHIA 4ZRIA 3F5RA 1ZC4B 2MWNB 5JHGA 4F7UP 1K5DB 2I1JA 4HHVA 3A8QA 5C5BA 4Y94A 1J19A 1DDMA 1FGZA 2CY4A 1MKEA 2I5FA 3HK0A 5KCVA 2Y8GA 2RLOA 3ULBA 2YRYA 4HB3B 1KZGA 2NZ8B 3TW1A 2LKOA 1H10A 3KY9A 5J3QA 3MDBC 1NU2A 2D4QA 4MT7A 4PQ0A 1GC6A 3KRWA 1WVHA 3GYOA 5CLQB 1ZM0A 5D3XA 3P7ZA 4XWXA 1ZC3B 2D9ZA 2EMSA 2DKQA 4HAWB 2X18A 2M38A 1AWEA 2R09A 3TVVA 3ZVRA 1QC6A 3FSSA 2VRWB 1V61A 2OQBA 1EGXA 2YVCA 5DHAB 3G9WA 2M14A 3PG7A 4IOYX 5C5BB 1W1GA 4C0AA 1WJ1A 1DDVA 2DN6A 2P0FA 1OMWA 1SHCA 2DLWA 1LB1A 5EFXA 2COAA 2JP2A 3DXDA 4KVGB 1BTNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1I2H A;  1TXD A;  2NMB A;  3P6A A;  4GXB A;  2AL6 A;  4K81 A;  1MAI A;  3CXB B;  1UEF A;  5D3V A;  4H8S A;  1U29 A;  5HE3 A;  2I5C A;  1U27 A;  5JP4 A;  1U5D A;  4A6F A;  1XX0 A;  2V76 A;  1WJM A;  3KZ1 A;  2LYD A;  2KCJ A;  4A6F B;  3HW2 B;  2J0J A;  2UZR A;  5D3W A;  3X23 A;  5C16 A;  4GPT B;  1Y19 B;  1ISN A;  3KSY A;  4NY0 A;  3VIA A;  4DX9 0;  5LON B;  1FHO A;  1GC7 A;  4A6H A;  2RGN B;  1UNP A;  2EJ8 A;  1Y5O A;  1GG3 A;  4ZRK A;  1BAK A;  4BBK A;  1H4R A;  1XR0 B;  2FJL A;  4HAU B;  4HAZ B;  5GOW B;  4L6E A;  1WGU A;  5J3T A;  2YF0 A;  3PEG A;  5D27 A;  4TKN A;  2P8V A;  2N23 A;  2ZPY A;  4K2O A;  1V5U A;  3A8P A;  3LJU X;  3GYP A;  1EF1 A;  3PVU A;  2P0D A;  3D8F A;  5HE1 A;  3ULC A;  2YSZ A;  1FB8 A;  1ZSQ A;  1PFJ A;  4KHA A;  3CIK A;  4KHB B;  3D8E A;  4ZRJ A;  2YS5 A;  4P7I A;  4HDO A;  1UPR A;  2K2U A;  4WSF A;  2DHJ A;  5JLJ B;  5DIF B;  1X05 A;  2MKR A;  1W1H A;  3NSU A;  2QKL A;  3WA0 A;  2J59 M;  3TO1 A;  4B6H A;  1U5F A;  3ODO A;  1NTY A;  3A98 B;  3ML4 A;  2EC1 A;  2UZS A;  1W1D A;  5LOP B;  1OY2 A;  1V88 A;  1N3H A;  1XCG A;  1OQN A;  2ELA A;  1MIZ B;  4HB4 B;  1NI2 A;  1MK7 B;  4YL8 A;  1SGH A;  2LG1 A;  3DXC A;  2DKP A;  1PMS A;  1X1F A;  1MK9 B;  1PLS A;  5DI9 B;  4CHM A;  3QIJ A;  5FI0 A;  2K2J A;  3OAN A;  3TFM A;  3BJI A;  3AU5 A;  4D0N B;  1EVH A;  4DX8 A;  2DYN A;  2N0Y A;  4WJ7 A;  2IYB A;  2MFQ A;  4HB0 B;  3M1I B;  1BWN A;  3F0W A;  5L81 A;  3BIN A;  1AQC A;  2H7E A;  4F7H A;  2W2W A;  3IVF A;  3O96 A;  2P0H A;  2R0D A;  2DA0 A;  2CRF A;  3PVL A;  5DH9 B;  3U8Z A;  1ZVR A;  3FEH A;  4F7G A;  3HQC A;  2Z0P A;  4CHJ A;  5HE0 A;  2COF A;  3SO6 A;  2D9X A;  3U7D A;  2DX1 A;  2AEH A;  5J3Y A;  2Z0Q A;  2YS1 A;  5C6R A;  3T06 A;  2COD A;  1E5W A;  3PP2 A;  2HE7 A;  2E2X A;  2Y8F A;  1FHW A;  1Q67 A;  4IAP A;  5FI1 A;  1M7E A;  2RSG A;  4A6K A;  2J0M A;  1TJ6 A;  2DX5 A;  1NTV A;  1BTK A;  1X11 A;  2XQN M;  3MPX A;  1U5G A;  3AU4 A;  4GZU A;  5C79 A;  1MIX A;  3QBV B;  2G35 A;  1V89 A;  2GCL A;  1MPH A;  3AJ4 A;  1U2B A;  1IRS A;  4HB2 B;  4NSW A;  3UZT A;  1EAZ A;  2L1C A;  2K00 A;  4Z2N A;  3QWM A;  3DXE A;  1FGY A;  4GN1 A;  2IFS A;  2VSZ A;  3ODW A;  2L2I A;  1UNR A;  2Y7B A;  4WVF B;  4A5K A;  3VOQ A;  4HAT B;  4CYE A;  4K17 A;  2Q13 A;  1DYN A;  1UPQ A;  4HDQ A;  1WI1 A;  2YT1 A;  2OTX A;  2KUP A;  2RUK B;  4DXA B;  1V5M A;  5KQ4 A;  2W2X C;  1KZ7 A;  1V5P A;  3SUZ A;  3ODX A;  2BCJ A;  2D2Q A;  1DRO A;  1DBH A;  4HAV B;  3SNH A;  3PSC A;  1UNQ A;  1X1G A;  2DFK A;  4MK0 A;  4MY6 A;  2RNR B;  3PVW A;  5CLL B;  2J0K A;  2W2X D;  2GJY A;  1QQG A;  1J0W A;  1FAO A;  4IFS A;  5DHF B;  1M7R A;  2CAY A;  2VKI A;  5HE2 A;  3PZD A;  4EKU A;  1K5G B;  4K2P A;  3ZDT A;  1DDW A;  4EJN A;  5JHH A;  1KI1 B;  4PNK A;  4TYZ A;  3D8D A;  4DBB A;  3FM8 C;  2ROV A;  3KRX A;  2CY5 A;  2HTH B;  2I1K A;  1WGQ A;  2ADZ A;  3TCA A;  2LOX A;  2RVB B;  4HAY B;  2QKM A;  2DHK A;  4YON A;  2KGX B;  3WYF B;  2DYQ A;  1P6S A;  2YT0 A;  1U5E A;  2COC A;  2LOZ A;  2D9W A;  1P3R A;  1XKE A;  3SV1 A;  2PZ1 A;  1B55 A;  2D9Y A;  2H7D A;  1WG7 A;  2EMT A;  4GMX B;  2DTC A;  1X86 A;  5D3Y A;  2LUL A;  2Z0O A;  3SYX A;  5KQ1 A;  1XOD A;  1LW3 A;  2MDX A;  1RRP B;  2YS3 A;  1Z87 A;  1TQZ A;  1RJ2 A;  1FHX A;  1P5T A;  2D10 A;  1FOE A;  4EMO A;  4KAX B;  3RCP A;  3N7C A;  4HAX B;  3V5W A;  2ELB A;  1XD4 A;  2ROZ B;  2UVM A;  2D11 A;  2GS0 A;  1I7A A;  4Z2M B;  2GCJ A;  4GMV A;  4KHO A;  2D9V A;  2DHI A;  4ZRI A;  3F5R A;  1ZC4 B;  2MWN B;  5JHG A;  4F7U P;  1K5D B;  2I1J A;  4HHV A;  3A8Q A;  5C5B A;  4Y94 A;  1J19 A;  1DDM A;  1FGZ A;  2CY4 A;  1MKE A;  2I5F A;  3HK0 A;  5KCV A;  2Y8G A;  2RLO A;  3ULB A;  2YRY A;  4HB3 B;  1KZG A;  2NZ8 B;  3TW1 A;  2LKO A;  1H10 A;  3KY9 A;  5J3Q A;  3MDB C;  1NU2 A;  2D4Q A;  4MT7 A;  4PQ0 A;  1GC6 A;  3KRW A;  1WVH A;  3GYO A;  5CLQ B;  1ZM0 A;  5D3X A;  3P7Z A;  4XWX A;  1ZC3 B;  2D9Z A;  2EMS A;  2DKQ A;  4HAW B;  2X18 A;  2M38 A;  1AWE A;  2R09 A;  3TVV A;  3ZVR A;  1QC6 A;  3FSS A;  2VRW B;  1V61 A;  2OQB A;  1EGX A;  2YVC A;  5DHA B;  3G9W A;  2M14 A;  3PG7 A;  4IOY X;  5C5B B;  1W1G A;  4C0A A;  1WJ1 A;  1DDV A;  2DN6 A;  2P0F A;  1OMW A;  1SHC A;  2DLW A;  1LB1 A;  5EFX A;  2COA A;  2JP2 A;  3DXD A;  4KVG B;  1BTN A; 
#chains in the Genus database with same CATH topology
 5IRS A;  1I2H A;  1TXD A;  2NMB A;  2RRF A;  3P6A A;  4GXB A;  2AL6 A;  4K81 A;  1MAI A;  3CXB B;  1UEF A;  5D3V A;  3NW8 A;  4H8S A;  1U29 A;  5HE3 A;  3NWF A;  2I5C A;  1U27 A;  5JP4 A;  1U5D A;  4A6F A;  1XX0 A;  2R2Y A;  2V76 A;  1WJM A;  3KZ1 A;  2LYD A;  2KCJ A;  4A6F B;  3HW2 B;  2J0J A;  2UZR A;  5D3W A;  3X23 A;  5C16 A;  4GPT B;  1Y19 B;  1ISN A;  3KSY A;  4NY0 A;  5M4Y B;  3VIA A;  4DX9 0;  4HSI A;  5LON B;  1FHO A;  1GC7 A;  4A6H A;  2RGN B;  3A58 A;  1UNP A;  2EJ8 A;  1Y5O A;  1GG3 A;  4ZRK A;  1BAK A;  4BBK A;  1H4R A;  4D6W A;  1XR0 B;  3DCX A;  2FJL A;  4HAU B;  4HAZ B;  5GOW B;  4L6E A;  1WGU A;  5J3T A;  2YF0 A;  3PEG A;  5D27 A;  4TKN A;  2P8V A;  2N23 A;  2ZPY A;  4K2O A;  1V5U A;  3A8P A;  3LJU X;  3GYP A;  1EF1 A;  3PVU A;  2P0D A;  3D8F A;  5HE1 A;  3ULC A;  2YSZ A;  1FB8 A;  1ZSQ A;  1PFJ A;  5I2M A;  4KHA A;  3CIK A;  4KHB B;  3D8E A;  4ZRJ A;  2YS5 A;  4P7I A;  4HDO A;  1UPR A;  2K2U A;  4WSF A;  2DHJ A;  5JLJ B;  5DIF B;  1X05 A;  2MKR A;  1W1H A;  3NSU A;  2QKL A;  3WA0 A;  3NWD A;  2J59 M;  3TO1 A;  4B6H A;  1U5F A;  3ODO A;  1NTY A;  3A98 B;  3ML4 A;  2EC1 A;  2UZS A;  4QJ5 B;  1W1D A;  5LOP B;  1OY2 A;  1V88 A;  1N3H A;  3NWA A;  1XCG A;  1OQN A;  2ELA A;  2Z13 A;  1MIZ B;  4HB4 B;  1NI2 A;  1MK7 B;  4YL8 A;  1SGH A;  2ZKM X;  2LG1 A;  3DXC A;  2DKP A;  1PMS A;  4QJ3 B;  1X1F A;  1MK9 B;  1PLS A;  5DI9 B;  4CHM A;  3QIJ A;  5FI0 A;  2K2J A;  3OAN A;  3TFM A;  3BJI A;  3AU5 A;  4D0N B;  2KIG A;  1EVH A;  4DX8 A;  2DYN A;  2N0Y A;  4WJ7 A;  2IYB A;  2MFQ A;  4HB0 B;  3M1I B;  1BWN A;  3F0W A;  5L81 A;  3BIN A;  1AQC A;  2H7E A;  4F7H A;  2W2W A;  4KHB A;  5I2S A;  3IVF A;  3O96 A;  2P0H A;  2R0D A;  4OT1 A;  4QJ4 B;  2DA0 A;  2CRF A;  3PVL A;  5DH9 B;  3U8Z A;  1ZVR A;  3FEH A;  3FVC A;  4F7G A;  3HQC A;  2Z0P A;  4CHJ A;  5HE0 A;  2COF A;  3SO6 A;  2D9X A;  4GOU A;  3U7D A;  2DX1 A;  2AEH A;  5J3Y A;  2Z0Q A;  2YS1 A;  5C6R A;  3T06 A;  2COD A;  1E5W A;  3PP2 A;  2HE7 A;  2E2X A;  2Y8F A;  1FHW A;  1Q67 A;  4IAP A;  5FI1 A;  3U12 A;  1M7E A;  2RSG A;  4A6K A;  2J0M A;  2Z59 A;  1TJ6 A;  2DX5 A;  1NTV A;  1BTK A;  1X11 A;  2XQN M;  3MPX A;  1U5G A;  2GUM A;  3AU4 A;  4GZU A;  1MIX A;  3QBV B;  2G35 A;  5C79 A;  1V89 A;  2GCL A;  1MPH A;  3AJ4 A;  1U2B A;  1IRS A;  4HB2 B;  4NSW A;  3UZT A;  1EAZ A;  2L1C A;  2K00 A;  4Z2N A;  3QWM A;  3DXE A;  4L1R A;  1FGY A;  1ZYI A;  4GN1 A;  2IFS A;  2VSZ A;  4OSN A;  3ODW A;  2L2I A;  1UNR A;  2Y7B A;  4WVF B;  4A5K A;  3HIE A;  4HAT B;  3VOQ A;  4CYE A;  4K17 A;  2Q13 A;  3HSA A;  1DYN A;  1UPQ A;  4HDQ A;  1WI1 A;  2YT1 A;  1MI1 A;  2FJU B;  2OTX A;  2KUP A;  2RUK B;  4DXA B;  1V5M A;  5KQ4 A;  2NBV A;  2W2X C;  1KZ7 A;  1V5P A;  3SUZ A;  3ODX A;  2BCJ A;  2D2Q A;  1DRO A;  1DBH A;  4HAV B;  3SNH A;  1T77 A;  3PSC A;  1UNQ A;  1X1G A;  2DFK A;  4MK0 A;  4MY6 A;  2RNR B;  3PVW A;  5CLL B;  2J0K A;  2W2X D;  2GJY A;  1QQG A;  1J0W A;  1FAO A;  4IFS A;  5DHF B;  1M7R A;  2CAY A;  2VKI A;  5HE2 A;  3PZD A;  4EKU A;  1K5G B;  4GNK B;  4K2P A;  3ZDT A;  1DDW A;  4EJN A;  5JHH A;  1KI1 B;  4PNK A;  4TYZ A;  3D8D A;  4DBB A;  3OHM B;  3FM8 C;  2ROV A;  3KRX A;  2CY5 A;  4DIX A;  3B77 A;  2HTH B;  2I1K A;  1WGQ A;  2ADZ A;  3TCA A;  2LOX A;  2RVB B;  4HAY B;  2QKM A;  2DHK A;  4YON A;  2KGX B;  3WYF B;  2DYQ A;  1P6S A;  2YT0 A;  1U5E A;  2COC A;  2Z4D A;  2LOZ A;  2D9W A;  1P3R A;  1XKE A;  3SV1 A;  2PZ1 A;  1B55 A;  2D9Y A;  2H7D A;  1WG7 A;  2EMT A;  2DTC A;  4GMX B;  1X86 A;  5D3Y A;  2LUL A;  2Z0O A;  3SYX A;  5KQ1 A;  1XOD A;  1LW3 A;  2MDX A;  1RRP B;  2YS3 A;  1Z87 A;  1TQZ A;  1RJ2 A;  1FHX A;  1P5T A;  2D10 A;  1FOE A;  2KUQ A;  4EMO A;  4KAX B;  3RCP A;  3N7C A;  4HAX B;  3V5W A;  2ELB A;  1XD4 A;  2KIE A;  2ROZ B;  2D11 A;  2UVM A;  2GS0 A;  1I7A A;  4Z2M B;  2GCJ A;  4GMV A;  4KHO A;  2K49 A;  2D9V A;  2DHI A;  4ZRI A;  3F5R A;  1ZC4 B;  2MWN B;  5JHG A;  4F7U P;  1K5D B;  2I1J A;  2K8E A;  4HHV A;  3A8Q A;  5C5B A;  4QXA B;  4Y94 A;  1J19 A;  1DDM A;  1FGZ A;  2CY4 A;  1MKE A;  2KR0 A;  2I5F A;  3HK0 A;  5KCV A;  2Y8G A;  2RLO A;  3ULB A;  2YRY A;  4HB3 B;  1KZG A;  2NZ8 B;  3TW1 A;  2LKO A;  1H10 A;  3KY9 A;  5J3Q A;  3MDB C;  1NU2 A;  2D4Q A;  4MT7 A;  4PQ0 A;  1GC6 A;  3KRW A;  1WVH A;  3GYO A;  5CLQ B;  1ZM0 A;  5D3X A;  3P7Z A;  4XWX A;  1ZC3 B;  2D9Z A;  2EMS A;  2DKQ A;  4HAW B;  5LG4 B;  2X18 A;  2M38 A;  1AWE A;  2R09 A;  3TVV A;  3ZVR A;  2Z14 A;  1QC6 A;  3FSS A;  2VRW B;  1V61 A;  2OQB A;  1EGX A;  2YVC A;  5DHA B;  4CSQ A;  3G9W A;  2M14 A;  3PG7 A;  4IOY X;  2YT2 A;  5C5B B;  1W1G A;  4C0A A;  1WJ1 A;  1DDV A;  2DN6 A;  2P0F A;  1OMW A;  1SHC A;  2DLW A;  1LB1 A;  5EFX A;  2COA A;  2JP2 A;  3DXD A;  4KVG B;  1BTN A; 
#chains in the Genus database with same CATH homology
 1I2H A;  1TXD A;  2NMB A;  3P6A A;  4GXB A;  2AL6 A;  4K81 A;  1MAI A;  3CXB B;  1UEF A;  5D3V A;  4H8S A;  1U29 A;  5HE3 A;  2I5C A;  1U27 A;  5JP4 A;  1U5D A;  4A6F A;  1XX0 A;  2V76 A;  1WJM A;  3KZ1 A;  2LYD A;  2KCJ A;  4A6F B;  3HW2 B;  2J0J A;  2UZR A;  5D3W A;  3X23 A;  5C16 A;  4GPT B;  1Y19 B;  1ISN A;  3KSY A;  4NY0 A;  3VIA A;  4DX9 0;  5LON B;  1FHO A;  1GC7 A;  4A6H A;  2RGN B;  1UNP A;  2EJ8 A;  1Y5O A;  1GG3 A;  4ZRK A;  1BAK A;  4BBK A;  1H4R A;  1XR0 B;  2FJL A;  4HAU B;  4HAZ B;  5GOW B;  4L6E A;  1WGU A;  5J3T A;  2YF0 A;  3PEG A;  5D27 A;  4TKN A;  2P8V A;  2N23 A;  2ZPY A;  4K2O A;  1V5U A;  3A8P A;  3LJU X;  3GYP A;  1EF1 A;  3PVU A;  2P0D A;  3D8F A;  5HE1 A;  3ULC A;  2YSZ A;  1FB8 A;  1ZSQ A;  1PFJ A;  4KHA A;  3CIK A;  4KHB B;  3D8E A;  4ZRJ A;  2YS5 A;  4P7I A;  4HDO A;  1UPR A;  2K2U A;  4WSF A;  2DHJ A;  5JLJ B;  5DIF B;  1X05 A;  2MKR A;  1W1H A;  3NSU A;  2QKL A;  3WA0 A;  2J59 M;  3TO1 A;  4B6H A;  1U5F A;  3ODO A;  1NTY A;  3A98 B;  3ML4 A;  2EC1 A;  2UZS A;  1W1D A;  5LOP B;  1OY2 A;  1V88 A;  1N3H A;  1XCG A;  1OQN A;  2ELA A;  1MIZ B;  4HB4 B;  1NI2 A;  1MK7 B;  4YL8 A;  1SGH A;  2LG1 A;  3DXC A;  2DKP A;  1PMS A;  1X1F A;  1MK9 B;  1PLS A;  5DI9 B;  4CHM A;  3QIJ A;  5FI0 A;  2K2J A;  3OAN A;  3TFM A;  3BJI A;  3AU5 A;  4D0N B;  1EVH A;  4DX8 A;  2DYN A;  2N0Y A;  4WJ7 A;  2IYB A;  2MFQ A;  4HB0 B;  3M1I B;  1BWN A;  3F0W A;  5L81 A;  3BIN A;  1AQC A;  2H7E A;  4F7H A;  2W2W A;  3IVF A;  3O96 A;  2P0H A;  2R0D A;  2DA0 A;  2CRF A;  3PVL A;  5DH9 B;  3U8Z A;  1ZVR A;  3FEH A;  4F7G A;  3HQC A;  2Z0P A;  4CHJ A;  5HE0 A;  2COF A;  3SO6 A;  2D9X A;  3U7D A;  2DX1 A;  2AEH A;  5J3Y A;  2Z0Q A;  2YS1 A;  5C6R A;  3T06 A;  2COD A;  1E5W A;  3PP2 A;  2HE7 A;  2E2X A;  2Y8F A;  1FHW A;  1Q67 A;  4IAP A;  5FI1 A;  1M7E A;  2RSG A;  4A6K A;  2J0M A;  1TJ6 A;  2DX5 A;  1NTV A;  1BTK A;  1X11 A;  2XQN M;  3MPX A;  1U5G A;  3AU4 A;  4GZU A;  5C79 A;  1MIX A;  3QBV B;  2G35 A;  1V89 A;  2GCL A;  1MPH A;  3AJ4 A;  1U2B A;  1IRS A;  4HB2 B;  4NSW A;  3UZT A;  1EAZ A;  2L1C A;  2K00 A;  4Z2N A;  3QWM A;  3DXE A;  1FGY A;  4GN1 A;  2IFS A;  2VSZ A;  3ODW A;  2L2I A;  1UNR A;  2Y7B A;  4WVF B;  4A5K A;  3VOQ A;  4HAT B;  4CYE A;  4K17 A;  2Q13 A;  1DYN A;  1UPQ A;  4HDQ A;  1WI1 A;  2YT1 A;  2OTX A;  2KUP A;  2RUK B;  4DXA B;  1V5M A;  5KQ4 A;  2W2X C;  1KZ7 A;  1V5P A;  3SUZ A;  3ODX A;  2BCJ A;  2D2Q A;  1DRO A;  1DBH A;  4HAV B;  3SNH A;  3PSC A;  1UNQ A;  1X1G A;  2DFK A;  4MK0 A;  4MY6 A;  2RNR B;  3PVW A;  5CLL B;  2J0K A;  2W2X D;  2GJY A;  1QQG A;  1J0W A;  1FAO A;  4IFS A;  5DHF B;  1M7R A;  2CAY A;  2VKI A;  5HE2 A;  3PZD A;  4EKU A;  1K5G B;  4K2P A;  3ZDT A;  1DDW A;  4EJN A;  5JHH A;  1KI1 B;  4PNK A;  4TYZ A;  3D8D A;  4DBB A;  3FM8 C;  2ROV A;  3KRX A;  2CY5 A;  2HTH B;  2I1K A;  1WGQ A;  2ADZ A;  3TCA A;  2LOX A;  2RVB B;  4HAY B;  2QKM A;  2DHK A;  4YON A;  2KGX B;  3WYF B;  2DYQ A;  1P6S A;  2YT0 A;  1U5E A;  2COC A;  2LOZ A;  2D9W A;  1P3R A;  1XKE A;  3SV1 A;  2PZ1 A;  1B55 A;  2D9Y A;  2H7D A;  1WG7 A;  2EMT A;  4GMX B;  2DTC A;  1X86 A;  5D3Y A;  2LUL A;  2Z0O A;  3SYX A;  5KQ1 A;  1XOD A;  1LW3 A;  2MDX A;  1RRP B;  2YS3 A;  1Z87 A;  1TQZ A;  1RJ2 A;  1FHX A;  1P5T A;  2D10 A;  1FOE A;  4EMO A;  4KAX B;  3RCP A;  3N7C A;  4HAX B;  3V5W A;  2ELB A;  1XD4 A;  2ROZ B;  2UVM A;  2D11 A;  2GS0 A;  1I7A A;  4Z2M B;  2GCJ A;  4GMV A;  4KHO A;  2D9V A;  2DHI A;  4ZRI A;  3F5R A;  1ZC4 B;  2MWN B;  5JHG A;  4F7U P;  1K5D B;  2I1J A;  4HHV A;  3A8Q A;  5C5B A;  4Y94 A;  1J19 A;  1DDM A;  1FGZ A;  2CY4 A;  1MKE A;  2I5F A;  3HK0 A;  5KCV A;  2Y8G A;  2RLO A;  3ULB A;  2YRY A;  4HB3 B;  1KZG A;  2NZ8 B;  3TW1 A;  2LKO A;  1H10 A;  3KY9 A;  5J3Q A;  3MDB C;  1NU2 A;  2D4Q A;  4MT7 A;  4PQ0 A;  1GC6 A;  3KRW A;  1WVH A;  3GYO A;  5CLQ B;  1ZM0 A;  5D3X A;  3P7Z A;  4XWX A;  1ZC3 B;  2D9Z A;  2EMS A;  2DKQ A;  4HAW B;  2X18 A;  2M38 A;  1AWE A;  2R09 A;  3TVV A;  3ZVR A;  1QC6 A;  3FSS A;  2VRW B;  1V61 A;  2OQB A;  1EGX A;  2YVC A;  5DHA B;  3G9W A;  2M14 A;  3PG7 A;  4IOY X;  5C5B B;  1W1G A;  4C0A A;  1WJ1 A;  1DDV A;  2DN6 A;  2P0F A;  1OMW A;  1SHC A;  2DLW A;  1LB1 A;  5EFX A;  2COA A;  2JP2 A;  3DXD A;  4KVG B;  1BTN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...