1DYNA

Crystal structure at 2.2 angstroms resolution of the pleckstrin homology domain from human dynamin
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
113
structure length
113
Chain Sequence
ILVIRKGWLTINNIGIMKGGSKEYWFVLTAENLSWYKDDEEKEKKYMLSVDNLKLRDVEKGFMSSKHIFALFNTEQRNVYKDYRQLELACETQEEVDSWKASFLRAGVYPERV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signal transduction protein
molecule keywords DYNAMIN
publication title Crystal structure at 2.2 A resolution of the pleckstrin homology domain from human dynamin.
pubmed doi rcsb
source organism Homo sapiens
total genus 26
structure length 113
sequence length 113
chains with identical sequence B
ec nomenclature ec 3.6.5.5: Dynamin GTPase.
pdb deposition date 1994-12-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00169 PH PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1dynA00
2V76A 2OTXA 3A8QA 5DHFB 2QKMA 2BCJA 2CRFA 1SGHA 2LOZA 2J0MA 2KGXB 5C16A 4KHAA 1GC7A 1U5FA 2K00A 1OQNA 3UZTA 1AQCA 1XODA 3A8PA 5D3VA 2Z0QA 1UEFA 2VKIA 4MY6A 2KUPA 1X1GA 1BTNA 4EJNA 1V89A 1W1HA 3ML4A 4C0AA 3LJUX 5CLQB 5KQ1A 3KZ1A 1U5DA 3PP2A 4A6FB 2DTCA 2LG1A 1FOEA 5JHGA 3FEHA 2LOXA 2CODA 4HB2B 4TYZA 4IOYX 1U2BA 4A6FA 4F7UP 1U27A 3VOQA 1GG3A 1I2HA 1MKEA 3HW2B 5L81A 3ZDTA 3U7DA 2VSZA 1N3HA 4B6HA 1W1DA 4D0NB 3D8EA 4MK0A 1WJMA 3F0WA 1X1FA 3V5WA 5JP4A 1PFJA 2RGNB 4HB3B 2AEHA 4P7IA 5HE0A 1X05A 5C79A 3A98B 2DHIA 2Z0OA 1FAOA 3F5RA 5KQ4A 2H7DA 4A6KA 4XWXA 4KAXB 3U8ZA 1Q67A 1M7RA 1Y19B 4GN1A 1MK7B 1KZGA 3NSUA 5D3WA 3AJ4A 2W2XC 4F7GA 4F7HA 2EMSA 1H4RA 1DDVA 4WVFB 2UZSA 2D9ZA 2L1CA 3BINA 4HB4B 1TXDA 1WI1A 3CIKA 1MAIA 1ZVRA 2N23A 1ZSQA 3PVLA 3SV1A 1P6SA 1QC6A 2DN6A 2D9YA 3ODWA 1EVHA 1XR0B 4KHBB 4GPTB 1DDWA 4GZUA 1RJ2A 5EFXA 3QBVB 2ZPYA 1BTKA 2COFA 1LW3A 3TVVA 4GMXB 2IYBA 2YS5A 1NTVA 2EJ8A 3SUZA 2J0KA 1P3RA 2JP2A 1LB1A 2ROZB 1UPRA 2X18A 5DIFB 4HAVB 3PVWA 3QWMA 1QQGA 2EC1A 5HE2A 1XX0A 3TO1A 2QKLA 4WSFA 3DXEA 1ZC3B 2OQBA 5CLLB 3BJIA 5LONB 1NI2A 2FJLA 2YS3A 4H8SA 4HB0B 5DHAB 1WGQA 2MFQA 4Y94A 4PNKA 1KI1B 5FI0A 1DYNA 1DDMA 1K5DB 2DKPA 2DA0A 4GMVA 2XQNM 2I1KA 5J3TA 2UVMA 4HDOA 1ZC4B 1UNQA 3ULBA 3KY9A 4GXBA 4HHVA 2K2UA 4HDQA 3T06A 5KCVA 2NMBA 2YVCA 4CHJA 2Z0PA 2AL6A 2DYNA 4K2OA 5DH9B 5HE1A 3N7CA 1XKEA 2COAA 1V61A 2MWNB 1MK9B 2W2XD 2PZ1A 2IFSA 1XD4A 3PSCA 3O96A 2Y7BA 3TCAA 4KVGB 3SNHA 1TJ6A 1V5PA 3SO6A 2YT0A 2M14A 1V5MA 5D3YA 4YL8A 1TQZA 2J59M 2E2XA 2HE7A 4TKNA 3KSYA 5DI9B 3MDBC 1Y5OA 1EGXA 2YRYA 3PVUA 5JHHA 4K2PA 4BBKA 4EKUA 5D27A 1ISNA 2YF0A 1BWNA 3AU4A 2D9XA 1UNPA 2EMTA 3FM8C 4A5KA 1RRPB 1WGUA 1FHXA 1FGZA 1PLSA 4CYEA 1K5GB 3WA0A 5J3QA 3KRWA 1W1GA 2UZRA 3PZDA 2W2WA 2J0JA 2GCJA 2G35A 3KRXA 3P6AA 2LULA 3G9WA 3PG7A 2DX1A 1MIZB 3PEGA 4K17A 1I7AA 2LKOA 1XCGA 5GOWB 2K2JA 3DXCA 2R0DA 4KHOA 2Y8FA 4HAZB 2D2QA 1SHCA 4HAYB 5JLJB 2MKRA 1J19A 1GC6A 1EAZA 2DHJA 2I5FA 4NY0A 3RCPA 1KZ7A 2DKQA 2GS0A 1ZM0A 1H10A 4HAXB 4ZRIA 4NSWA 3ODOA 1OY2A 1DROA 2YS1A 2P8VA 2D9VA 1P5TA 4L6EA 1DBHA 5C6RA 1AWEA 2I1JA 1NU2A 2CY5A 3GYOA 3D8FA 1FHWA 3FSSA 2YT1A 4EMOA 4ZRKA 2RNRB 3VIAA 2L2IA 2HTHB 2RLOA 2P0FA 3TFMA 1E5WA 2P0HA 1UNRA 1WVHA 1X11A 1V88A 1OMWA 2H7EA 5FI1A 2Q13A 3ULCA 3DXDA 1V5UA 3M1IB 3X23A 4A6HA 2M38A 3P7ZA 2MDXA 4Z2NA 3OANA 2RUKB 2COCA 1J0WA 3GYPA 2CY4A 3AU5A 5C5BB 1WJ1A 3ODXA 2D9WA 2DX5A 2ELBA 2RSGA 4DBBA 2D4QA 4ZRJA 3ZVRA 4K81A 2D11A 1IRSA 4Z2MB 5C5BA 4WJ7A 1EF1A 1Z87A 5D3XA 1U5EA 4DXAB 1FHOA 2DYQA 2ADZA 1WG7A 5HE3A 5J3YA 3QIJA 2ROVA 1B55A 5LOPB 4DX8A 3HK0A 2GJYA 1PMSA 4DX90 3SYXA 1MIXA 2DHKA 1UPQA 1FB8A 2DLWA 1NTYA 2YSZA 2P0DA 4HAWB 4HATB 2Y8GA 2I5CA 2N0YA 2NZ8B 4HAUB 4YONA 3IVFA 4PQ0A 1U5GA 2GCLA 3WYFB 3TW1A 2VRWB 2KCJA 1X86A 2R09A 3D8DA 4IFSA 1U29A 1MPHA 2ELAA 4CHMA 2CAYA 1M7EA 3HQCA 1FGYA 2D10A 2RVBB 4MT7A 2DFKA 3MPXA 4IAPA 1BAKA 2LYDA 3CXBB
chains in the Genus database with same CATH superfamily
2V76A 3OHMB 2OTXA 3A8QA 5DHFB 2QKMA 2BCJA 2CRFA 1SGHA 2Z13A 4D6WA 2GUMA 2LOZA 5LG4B 2J0MA 2KGXB 5C16A 4KHAA 1GC7A 1U5FA 2K00A 1ZYIA 1OQNA 3UZTA 1AQCA 1XODA 3A8PA 5D3VA 2Z0QA 1UEFA 2VKIA 4MY6A 2KUPA 1X1GA 1BTNA 4EJNA 1V89A 1W1HA 3ML4A 4C0AA 3LJUX 5CLQB 5KQ1A 3KZ1A 1U5DA 3PP2A 4A6FB 2DTCA 4QJ5B 2LG1A 1FOEA 5JHGA 3FEHA 2LOXA 2CODA 4HB2B 4DIXA 4TYZA 4IOYX 2KR0A 1U2BA 4A6FA 4F7UP 1U27A 3VOQA 1GG3A 1I2HA 1MKEA 3HW2B 5L81A 3ZDTA 3U7DA 2VSZA 1N3HA 4B6HA 1W1DA 4D0NB 3D8EA 4MK0A 3FVCA 1WJMA 3F0WA 1X1FA 3V5WA 5JP4A 1PFJA 2RGNB 4HB3B 2AEHA 2K8EA 4P7IA 5HE0A 1X05A 5C79A 3A98B 2DHIA 2Z0OA 1FAOA 3F5RA 5KQ4A 2H7DA 4A6KA 4XWXA 4KAXB 3U8ZA 1Q67A 1M7RA 1Y19B 4GN1A 1MK7B 1KZGA 3NSUA 5D3WA 3AJ4A 2W2XC 4F7GA 4F7HA 2EMSA 1H4RA 1DDVA 4WVFB 2UZSA 2D9ZA 2L1CA 3BINA 4HB4B 1TXDA 1WI1A 3CIKA 1MAIA 1ZVRA 2N23A 5I2MA 1ZSQA 3PVLA 3SV1A 1P6SA 1QC6A 2DN6A 2D9YA 3ODWA 1EVHA 1T77A 1XR0B 4KHBB 4GPTB 1DDWA 4GZUA 1RJ2A 5EFXA 3QBVB 2ZPYA 1BTKA 2COFA 3DCXA 1LW3A 3TVVA 4GMXB 2IYBA 4KHBA 2YS5A 1NTVA 2EJ8A 3SUZA 2J0KA 1P3RA 2JP2A 1LB1A 2R2YA 2ROZB 1UPRA 2X18A 5DIFB 4HAVB 3PVWA 3QWMA 1QQGA 2EC1A 5HE2A 1XX0A 3TO1A 2QKLA 4WSFA 3DXEA 1ZC3B 2RRFA 2OQBA 5CLLB 3BJIA 5LONB 1NI2A 2FJLA 3B77A 2YS3A 4H8SA 4HB0B 5DHAB 1WGQA 2MFQA 2NBVA 4Y94A 4PNKA 1KI1B 5FI0A 1DYNA 1DDMA 1K5DB 4OT1A 2DKPA 2DA0A 4GMVA 2XQNM 2I1KA 5J3TA 2ZKMX 2UVMA 4HDOA 1ZC4B 1UNQA 3ULBA 3KY9A 4GXBA 4HHVA 2K2UA 4HDQA 3T06A 5KCVA 2NMBA 2YVCA 4CHJA 2Z0PA 2KUQA 2AL6A 2DYNA 4K2OA 5DH9B 4L1RA 4QXAB 3N7CA 5HE1A 1XKEA 2COAA 1V61A 2MWNB 1MK9B 2W2XD 2PZ1A 2IFSA 1XD4A 3PSCA 3O96A 2Y7BA 3TCAA 4KVGB 5IRSA 3SNHA 1TJ6A 1V5PA 3SO6A 2YT0A 2Z14A 2M14A 1V5MA 2K49A 5D3YA 4YL8A 1TQZA 2J59M 2E2XA 2HE7A 4TKNA 3KSYA 5DI9B 3MDBC 1Y5OA 1EGXA 3NW8A 2YRYA 3PVUA 5JHHA 4K2PA 4BBKA 4EKUA 5D27A 1ISNA 2YF0A 1BWNA 3AU4A 2D9XA 1UNPA 2EMTA 3FM8C 2Z4DA 4A5KA 1RRPB 1WGUA 1FHXA 1FGZA 4OSNA 1PLSA 3NWDA 4CYEA 1K5GB 5I2SA 3WA0A 5J3QA 3KRWA 1W1GA 2UZRA 3PZDA 2W2WA 2J0JA 2GCJA 2G35A 3KRXA 1MI1A 3P6AA 2LULA 3G9WA 3PG7A 2DX1A 1MIZB 3PEGA 4CSQA 4K17A 1I7AA 2LKOA 1XCGA 5GOWB 2KIEA 2K2JA 3DXCA 2R0DA 4KHOA 2Y8FA 4HAZB 2D2QA 1SHCA 4HAYB 5JLJB 2MKRA 3NWAA 1J19A 1GC6A 1EAZA 2DHJA 2I5FA 3HSAA 4NY0A 3RCPA 1KZ7A 2DKQA 2GS0A 1ZM0A 1H10A 4HAXB 4ZRIA 4NSWA 3ODOA 1OY2A 1DROA 2YS1A 2P8VA 2D9VA 1P5TA 4L6EA 1DBHA 5C6RA 1AWEA 2I1JA 1NU2A 2CY5A 3GYOA 3D8FA 1FHWA 3FSSA 2YT1A 4EMOA 4ZRKA 2RNRB 3VIAA 2L2IA 2HTHB 2RLOA 2P0FA 4HSIA 3TFMA 1E5WA 2P0HA 1UNRA 1WVHA 2FJUB 1X11A 1V88A 1OMWA 4QJ3B 2H7EA 5FI1A 2Q13A 3ULCA 3DXDA 1V5UA 3M1IB 3X23A 4A6HA 2M38A 3P7ZA 2MDXA 3U12A 4Z2NA 3OANA 2RUKB 2COCA 1J0WA 3GYPA 2CY4A 3AU5A 3A58A 5C5BB 1WJ1A 3ODXA 2D9WA 2DX5A 2ELBA 2RSGA 4DBBA 2D4QA 4ZRJA 3HIEA 3ZVRA 2Z59A 4K81A 2D11A 1IRSA 4Z2MB 5C5BA 4WJ7A 4GOUA 1EF1A 1Z87A 5D3XA 1U5EA 4DXAB 1FHOA 2DYQA 2ADZA 1WG7A 5HE3A 5J3YA 3QIJA 2ROVA 1B55A 5LOPB 4DX8A 3HK0A 2GJYA 1PMSA 5M4YB 4DX90 3SYXA 1MIXA 2DHKA 1UPQA 1FB8A 2DLWA 4QJ4B 1NTYA 2YSZA 2P0DA 4HAWB 4HATB 3NWFA 2Y8GA 2I5CA 2N0YA 2YT2A 2NZ8B 4HAUB 4YONA 3IVFA 4PQ0A 1U5GA 2GCLA 3WYFB 3TW1A 2VRWB 2KCJA 1X86A 2R09A 3D8DA 4IFSA 1U29A 1MPHA 2ELAA 4CHMA 4GNKB 2CAYA 1M7EA 3HQCA 1FGYA 2D10A 2RVBB 4MT7A 2DFKA 3MPXA 4IAPA 1BAKA 2LYDA 3CXBB 2KIGA
chains in the Genus database with same CATH topology
2V76A 2OTXA 3A8QA 5DHFB 2QKMA 2BCJA 2CRFA 1SGHA 2LOZA 2J0MA 2KGXB 5C16A 4KHAA 1GC7A 1U5FA 2K00A 1OQNA 3UZTA 1AQCA 1XODA 3A8PA 5D3VA 2Z0QA 1UEFA 2VKIA 4MY6A 2KUPA 1X1GA 1BTNA 4EJNA 1V89A 1W1HA 3ML4A 4C0AA 3LJUX 5CLQB 5KQ1A 3KZ1A 1U5DA 3PP2A 4A6FB 2DTCA 2LG1A 1FOEA 5JHGA 3FEHA 2LOXA 2CODA 4HB2B 4TYZA 4IOYX 1U2BA 4A6FA 4F7UP 1U27A 3VOQA 1GG3A 1I2HA 1MKEA 3HW2B 5L81A 3ZDTA 3U7DA 2VSZA 1N3HA 4B6HA 1W1DA 4D0NB 3D8EA 4MK0A 1WJMA 3F0WA 1X1FA 3V5WA 5JP4A 1PFJA 2RGNB 4HB3B 2AEHA 4P7IA 5HE0A 1X05A 5C79A 3A98B 2DHIA 2Z0OA 1FAOA 3F5RA 5KQ4A 2H7DA 4A6KA 4XWXA 4KAXB 3U8ZA 1Q67A 1M7RA 1Y19B 4GN1A 1MK7B 1KZGA 3NSUA 5D3WA 3AJ4A 2W2XC 4F7GA 4F7HA 2EMSA 1H4RA 1DDVA 4WVFB 2UZSA 2D9ZA 2L1CA 3BINA 4HB4B 1TXDA 1WI1A 3CIKA 1MAIA 1ZVRA 2N23A 1ZSQA 3PVLA 3SV1A 1P6SA 1QC6A 2DN6A 2D9YA 3ODWA 1EVHA 1XR0B 4KHBB 4GPTB 1DDWA 4GZUA 1RJ2A 5EFXA 3QBVB 2ZPYA 1BTKA 2COFA 1LW3A 3TVVA 4GMXB 2IYBA 2YS5A 1NTVA 2EJ8A 3SUZA 2J0KA 1P3RA 2JP2A 1LB1A 2ROZB 1UPRA 2X18A 5DIFB 4HAVB 3PVWA 3QWMA 1QQGA 2EC1A 5HE2A 1XX0A 3TO1A 2QKLA 4WSFA 3DXEA 1ZC3B 2OQBA 5CLLB 3BJIA 5LONB 1NI2A 2FJLA 2YS3A 4H8SA 4HB0B 5DHAB 1WGQA 2MFQA 4Y94A 4PNKA 1KI1B 5FI0A 1DYNA 1DDMA 1K5DB 2DKPA 2DA0A 4GMVA 2XQNM 2I1KA 5J3TA 2UVMA 4HDOA 1ZC4B 1UNQA 3ULBA 3KY9A 4GXBA 4HHVA 2K2UA 4HDQA 3T06A 5KCVA 2NMBA 2YVCA 4CHJA 2Z0PA 2AL6A 2DYNA 4K2OA 5DH9B 5HE1A 3N7CA 1XKEA 2COAA 1V61A 2MWNB 1MK9B 2W2XD 2PZ1A 2IFSA 1XD4A 3PSCA 3O96A 2Y7BA 3TCAA 4KVGB 3SNHA 1TJ6A 1V5PA 3SO6A 2YT0A 2M14A 1V5MA 5D3YA 4YL8A 1TQZA 2J59M 2E2XA 2HE7A 4TKNA 3KSYA 5DI9B 3MDBC 1Y5OA 1EGXA 2YRYA 3PVUA 5JHHA 4K2PA 4BBKA 4EKUA 5D27A 1ISNA 2YF0A 1BWNA 3AU4A 2D9XA 1UNPA 2EMTA 3FM8C 4A5KA 1RRPB 1WGUA 1FHXA 1FGZA 1PLSA 4CYEA 1K5GB 3WA0A 5J3QA 3KRWA 1W1GA 2UZRA 3PZDA 2W2WA 2J0JA 2GCJA 2G35A 3KRXA 3P6AA 2LULA 3G9WA 3PG7A 2DX1A 1MIZB 3PEGA 4K17A 1I7AA 2LKOA 1XCGA 5GOWB 2K2JA 3DXCA 2R0DA 4KHOA 2Y8FA 4HAZB 2D2QA 1SHCA 4HAYB 5JLJB 2MKRA 1J19A 1GC6A 1EAZA 2DHJA 2I5FA 4NY0A 3RCPA 1KZ7A 2DKQA 2GS0A 1ZM0A 1H10A 4HAXB 4ZRIA 4NSWA 3ODOA 1OY2A 1DROA 2YS1A 2P8VA 2D9VA 1P5TA 4L6EA 1DBHA 5C6RA 1AWEA 2I1JA 1NU2A 2CY5A 3GYOA 3D8FA 1FHWA 3FSSA 2YT1A 4EMOA 4ZRKA 2RNRB 3VIAA 2L2IA 2HTHB 2RLOA 2P0FA 3TFMA 1E5WA 2P0HA 1UNRA 1WVHA 1X11A 1V88A 1OMWA 2H7EA 5FI1A 2Q13A 3ULCA 3DXDA 1V5UA 3M1IB 3X23A 4A6HA 2M38A 3P7ZA 2MDXA 4Z2NA 3OANA 2RUKB 2COCA 1J0WA 3GYPA 2CY4A 3AU5A 5C5BB 1WJ1A 3ODXA 2D9WA 2DX5A 2ELBA 2RSGA 4DBBA 2D4QA 4ZRJA 3ZVRA 4K81A 2D11A 1IRSA 4Z2MB 5C5BA 4WJ7A 1EF1A 1Z87A 5D3XA 1U5EA 4DXAB 1FHOA 2DYQA 2ADZA 1WG7A 5HE3A 5J3YA 3QIJA 2ROVA 1B55A 5LOPB 4DX8A 3HK0A 2GJYA 1PMSA 4DX90 3SYXA 1MIXA 2DHKA 1UPQA 1FB8A 2DLWA 1NTYA 2YSZA 2P0DA 4HAWB 4HATB 2Y8GA 2I5CA 2N0YA 2NZ8B 4HAUB 4YONA 3IVFA 4PQ0A 1U5GA 2GCLA 3WYFB 3TW1A 2VRWB 2KCJA 1X86A 2R09A 3D8DA 4IFSA 1U29A 1MPHA 2ELAA 4CHMA 2CAYA 1M7EA 3HQCA 1FGYA 2D10A 2RVBB 4MT7A 2DFKA 3MPXA 4IAPA 1BAKA 2LYDA 3CXBB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2V76 A;  2OTX A;  3A8Q A;  5DHF B;  2QKM A;  2BCJ A;  2CRF A;  1SGH A;  2LOZ A;  2J0M A;  2KGX B;  5C16 A;  4KHA A;  1GC7 A;  1U5F A;  2K00 A;  1OQN A;  3UZT A;  1AQC A;  1XOD A;  3A8P A;  5D3V A;  2Z0Q A;  1UEF A;  2VKI A;  4MY6 A;  2KUP A;  1X1G A;  1BTN A;  4EJN A;  1V89 A;  1W1H A;  3ML4 A;  4C0A A;  3LJU X;  5CLQ B;  5KQ1 A;  3KZ1 A;  1U5D A;  3PP2 A;  4A6F B;  2DTC A;  2LG1 A;  1FOE A;  5JHG A;  3FEH A;  2LOX A;  2COD A;  4HB2 B;  4TYZ A;  4IOY X;  1U2B A;  4A6F A;  4F7U P;  1U27 A;  3VOQ A;  1GG3 A;  1I2H A;  1MKE A;  3HW2 B;  5L81 A;  3ZDT A;  3U7D A;  2VSZ A;  1N3H A;  4B6H A;  1W1D A;  4D0N B;  3D8E A;  4MK0 A;  1WJM A;  3F0W A;  1X1F A;  3V5W A;  5JP4 A;  1PFJ A;  2RGN B;  4HB3 B;  2AEH A;  4P7I A;  5HE0 A;  1X05 A;  5C79 A;  3A98 B;  2DHI A;  2Z0O A;  1FAO A;  3F5R A;  5KQ4 A;  2H7D A;  4A6K A;  4XWX A;  4KAX B;  3U8Z A;  1Q67 A;  1M7R A;  1Y19 B;  4GN1 A;  1MK7 B;  1KZG A;  3NSU A;  5D3W A;  3AJ4 A;  2W2X C;  4F7G A;  4F7H A;  2EMS A;  1H4R A;  1DDV A;  4WVF B;  2UZS A;  2D9Z A;  2L1C A;  3BIN A;  4HB4 B;  1TXD A;  1WI1 A;  3CIK A;  1MAI A;  1ZVR A;  2N23 A;  1ZSQ A;  3PVL A;  3SV1 A;  1P6S A;  1QC6 A;  2DN6 A;  2D9Y A;  3ODW A;  1EVH A;  1XR0 B;  4KHB B;  4GPT B;  1DDW A;  4GZU A;  1RJ2 A;  5EFX A;  3QBV B;  2ZPY A;  1BTK A;  2COF A;  1LW3 A;  3TVV A;  4GMX B;  2IYB A;  2YS5 A;  1NTV A;  2EJ8 A;  3SUZ A;  2J0K A;  1P3R A;  2JP2 A;  1LB1 A;  2ROZ B;  1UPR A;  2X18 A;  5DIF B;  4HAV B;  3PVW A;  3QWM A;  1QQG A;  2EC1 A;  5HE2 A;  1XX0 A;  3TO1 A;  2QKL A;  4WSF A;  3DXE A;  1ZC3 B;  2OQB A;  5CLL B;  3BJI A;  5LON B;  1NI2 A;  2FJL A;  2YS3 A;  4H8S A;  4HB0 B;  5DHA B;  1WGQ A;  2MFQ A;  4Y94 A;  4PNK A;  1KI1 B;  5FI0 A;  1DYN A;  1DDM A;  1K5D B;  2DKP A;  2DA0 A;  4GMV A;  2XQN M;  2I1K A;  5J3T A;  2UVM A;  4HDO A;  1ZC4 B;  1UNQ A;  3ULB A;  3KY9 A;  4GXB A;  4HHV A;  2K2U A;  4HDQ A;  3T06 A;  5KCV A;  2NMB A;  2YVC A;  4CHJ A;  2Z0P A;  2AL6 A;  2DYN A;  4K2O A;  5DH9 B;  5HE1 A;  3N7C A;  1XKE A;  2COA A;  1V61 A;  2MWN B;  1MK9 B;  2W2X D;  2PZ1 A;  2IFS A;  1XD4 A;  3PSC A;  3O96 A;  2Y7B A;  3TCA A;  4KVG B;  3SNH A;  1TJ6 A;  1V5P A;  3SO6 A;  2YT0 A;  2M14 A;  1V5M A;  5D3Y A;  4YL8 A;  1TQZ A;  2J59 M;  2E2X A;  2HE7 A;  4TKN A;  3KSY A;  5DI9 B;  3MDB C;  1Y5O A;  1EGX A;  2YRY A;  3PVU A;  5JHH A;  4K2P A;  4BBK A;  4EKU A;  5D27 A;  1ISN A;  2YF0 A;  1BWN A;  3AU4 A;  2D9X A;  1UNP A;  2EMT A;  3FM8 C;  4A5K A;  1RRP B;  1WGU A;  1FHX A;  1FGZ A;  1PLS A;  4CYE A;  1K5G B;  3WA0 A;  5J3Q A;  3KRW A;  1W1G A;  2UZR A;  3PZD A;  2W2W A;  2J0J A;  2GCJ A;  2G35 A;  3KRX A;  3P6A A;  2LUL A;  3G9W A;  3PG7 A;  2DX1 A;  1MIZ B;  3PEG A;  4K17 A;  1I7A A;  2LKO A;  1XCG A;  5GOW B;  2K2J A;  3DXC A;  2R0D A;  4KHO A;  2Y8F A;  4HAZ B;  2D2Q A;  1SHC A;  4HAY B;  5JLJ B;  2MKR A;  1J19 A;  1GC6 A;  1EAZ A;  2DHJ A;  2I5F A;  4NY0 A;  3RCP A;  1KZ7 A;  2DKQ A;  2GS0 A;  1ZM0 A;  1H10 A;  4HAX B;  4ZRI A;  4NSW A;  3ODO A;  1OY2 A;  1DRO A;  2YS1 A;  2P8V A;  2D9V A;  1P5T A;  4L6E A;  1DBH A;  5C6R A;  1AWE A;  2I1J A;  1NU2 A;  2CY5 A;  3GYO A;  3D8F A;  1FHW A;  3FSS A;  2YT1 A;  4EMO A;  4ZRK A;  2RNR B;  3VIA A;  2L2I A;  2HTH B;  2RLO A;  2P0F A;  3TFM A;  1E5W A;  2P0H A;  1UNR A;  1WVH A;  1X11 A;  1V88 A;  1OMW A;  2H7E A;  5FI1 A;  2Q13 A;  3ULC A;  3DXD A;  1V5U A;  3M1I B;  3X23 A;  4A6H A;  2M38 A;  3P7Z A;  2MDX A;  4Z2N A;  3OAN A;  2RUK B;  2COC A;  1J0W A;  3GYP A;  2CY4 A;  3AU5 A;  5C5B B;  1WJ1 A;  3ODX A;  2D9W A;  2DX5 A;  2ELB A;  2RSG A;  4DBB A;  2D4Q A;  4ZRJ A;  3ZVR A;  4K81 A;  2D11 A;  1IRS A;  4Z2M B;  5C5B A;  4WJ7 A;  1EF1 A;  1Z87 A;  5D3X A;  1U5E A;  4DXA B;  1FHO A;  2DYQ A;  2ADZ A;  1WG7 A;  5HE3 A;  5J3Y A;  3QIJ A;  2ROV A;  1B55 A;  5LOP B;  4DX8 A;  3HK0 A;  2GJY A;  1PMS A;  4DX9 0;  3SYX A;  1MIX A;  2DHK A;  1UPQ A;  1FB8 A;  2DLW A;  1NTY A;  2YSZ A;  2P0D A;  4HAW B;  4HAT B;  2Y8G A;  2I5C A;  2N0Y A;  2NZ8 B;  4HAU B;  4YON A;  3IVF A;  4PQ0 A;  1U5G A;  2GCL A;  3WYF B;  3TW1 A;  2VRW B;  2KCJ A;  1X86 A;  2R09 A;  3D8D A;  4IFS A;  1U29 A;  1MPH A;  2ELA A;  4CHM A;  2CAY A;  1M7E A;  3HQC A;  1FGY A;  2D10 A;  2RVB B;  4MT7 A;  2DFK A;  3MPX A;  4IAP A;  1BAK A;  2LYD A;  3CXB B; 
#chains in the Genus database with same CATH topology
 2V76 A;  3OHM B;  2OTX A;  3A8Q A;  5DHF B;  2QKM A;  2BCJ A;  2CRF A;  1SGH A;  2Z13 A;  4D6W A;  2GUM A;  2LOZ A;  5LG4 B;  2J0M A;  2KGX B;  5C16 A;  4KHA A;  1GC7 A;  1U5F A;  2K00 A;  1ZYI A;  1OQN A;  3UZT A;  1AQC A;  1XOD A;  3A8P A;  5D3V A;  2Z0Q A;  1UEF A;  2VKI A;  4MY6 A;  2KUP A;  1X1G A;  1BTN A;  4EJN A;  1V89 A;  1W1H A;  3ML4 A;  4C0A A;  3LJU X;  5CLQ B;  5KQ1 A;  3KZ1 A;  1U5D A;  3PP2 A;  4A6F B;  2DTC A;  4QJ5 B;  2LG1 A;  1FOE A;  5JHG A;  3FEH A;  2LOX A;  2COD A;  4HB2 B;  4DIX A;  4TYZ A;  4IOY X;  2KR0 A;  1U2B A;  4A6F A;  4F7U P;  1U27 A;  3VOQ A;  1GG3 A;  1I2H A;  1MKE A;  3HW2 B;  5L81 A;  3ZDT A;  3U7D A;  2VSZ A;  1N3H A;  4B6H A;  1W1D A;  4D0N B;  3D8E A;  4MK0 A;  3FVC A;  1WJM A;  3F0W A;  1X1F A;  3V5W A;  5JP4 A;  1PFJ A;  2RGN B;  4HB3 B;  2AEH A;  2K8E A;  4P7I A;  5HE0 A;  1X05 A;  5C79 A;  3A98 B;  2DHI A;  2Z0O A;  1FAO A;  3F5R A;  5KQ4 A;  2H7D A;  4A6K A;  4XWX A;  4KAX B;  3U8Z A;  1Q67 A;  1M7R A;  1Y19 B;  4GN1 A;  1MK7 B;  1KZG A;  3NSU A;  5D3W A;  3AJ4 A;  2W2X C;  4F7G A;  4F7H A;  2EMS A;  1H4R A;  1DDV A;  4WVF B;  2UZS A;  2D9Z A;  2L1C A;  3BIN A;  4HB4 B;  1TXD A;  1WI1 A;  3CIK A;  1MAI A;  1ZVR A;  2N23 A;  5I2M A;  1ZSQ A;  3PVL A;  3SV1 A;  1P6S A;  1QC6 A;  2DN6 A;  2D9Y A;  3ODW A;  1EVH A;  1T77 A;  1XR0 B;  4KHB B;  4GPT B;  1DDW A;  4GZU A;  1RJ2 A;  5EFX A;  3QBV B;  2ZPY A;  1BTK A;  2COF A;  3DCX A;  1LW3 A;  3TVV A;  4GMX B;  2IYB A;  4KHB A;  2YS5 A;  1NTV A;  2EJ8 A;  3SUZ A;  2J0K A;  1P3R A;  2JP2 A;  1LB1 A;  2R2Y A;  2ROZ B;  1UPR A;  2X18 A;  5DIF B;  4HAV B;  3PVW A;  3QWM A;  1QQG A;  2EC1 A;  5HE2 A;  1XX0 A;  3TO1 A;  2QKL A;  4WSF A;  3DXE A;  1ZC3 B;  2RRF A;  2OQB A;  5CLL B;  3BJI A;  5LON B;  1NI2 A;  2FJL A;  3B77 A;  2YS3 A;  4H8S A;  4HB0 B;  5DHA B;  1WGQ A;  2MFQ A;  2NBV A;  4Y94 A;  4PNK A;  1KI1 B;  5FI0 A;  1DYN A;  1DDM A;  1K5D B;  4OT1 A;  2DKP A;  2DA0 A;  4GMV A;  2XQN M;  2I1K A;  5J3T A;  2ZKM X;  2UVM A;  4HDO A;  1ZC4 B;  1UNQ A;  3ULB A;  3KY9 A;  4GXB A;  4HHV A;  2K2U A;  4HDQ A;  3T06 A;  5KCV A;  2NMB A;  2YVC A;  4CHJ A;  2Z0P A;  2KUQ A;  2AL6 A;  2DYN A;  4K2O A;  5DH9 B;  4L1R A;  4QXA B;  3N7C A;  5HE1 A;  1XKE A;  2COA A;  1V61 A;  2MWN B;  1MK9 B;  2W2X D;  2PZ1 A;  2IFS A;  1XD4 A;  3PSC A;  3O96 A;  2Y7B A;  3TCA A;  4KVG B;  5IRS A;  3SNH A;  1TJ6 A;  1V5P A;  3SO6 A;  2YT0 A;  2Z14 A;  2M14 A;  1V5M A;  2K49 A;  5D3Y A;  4YL8 A;  1TQZ A;  2J59 M;  2E2X A;  2HE7 A;  4TKN A;  3KSY A;  5DI9 B;  3MDB C;  1Y5O A;  1EGX A;  3NW8 A;  2YRY A;  3PVU A;  5JHH A;  4K2P A;  4BBK A;  4EKU A;  5D27 A;  1ISN A;  2YF0 A;  1BWN A;  3AU4 A;  2D9X A;  1UNP A;  2EMT A;  3FM8 C;  2Z4D A;  4A5K A;  1RRP B;  1WGU A;  1FHX A;  1FGZ A;  4OSN A;  1PLS A;  3NWD A;  4CYE A;  1K5G B;  5I2S A;  3WA0 A;  5J3Q A;  3KRW A;  1W1G A;  2UZR A;  3PZD A;  2W2W A;  2J0J A;  2GCJ A;  2G35 A;  3KRX A;  1MI1 A;  3P6A A;  2LUL A;  3G9W A;  3PG7 A;  2DX1 A;  1MIZ B;  3PEG A;  4CSQ A;  4K17 A;  1I7A A;  2LKO A;  1XCG A;  5GOW B;  2KIE A;  2K2J A;  3DXC A;  2R0D A;  4KHO A;  2Y8F A;  4HAZ B;  2D2Q A;  1SHC A;  4HAY B;  5JLJ B;  2MKR A;  3NWA A;  1J19 A;  1GC6 A;  1EAZ A;  2DHJ A;  2I5F A;  3HSA A;  4NY0 A;  3RCP A;  1KZ7 A;  2DKQ A;  2GS0 A;  1ZM0 A;  1H10 A;  4HAX B;  4ZRI A;  4NSW A;  3ODO A;  1OY2 A;  1DRO A;  2YS1 A;  2P8V A;  2D9V A;  1P5T A;  4L6E A;  1DBH A;  5C6R A;  1AWE A;  2I1J A;  1NU2 A;  2CY5 A;  3GYO A;  3D8F A;  1FHW A;  3FSS A;  2YT1 A;  4EMO A;  4ZRK A;  2RNR B;  3VIA A;  2L2I A;  2HTH B;  2RLO A;  2P0F A;  4HSI A;  3TFM A;  1E5W A;  2P0H A;  1UNR A;  1WVH A;  2FJU B;  1X11 A;  1V88 A;  1OMW A;  4QJ3 B;  2H7E A;  5FI1 A;  2Q13 A;  3ULC A;  3DXD A;  1V5U A;  3M1I B;  3X23 A;  4A6H A;  2M38 A;  3P7Z A;  2MDX A;  3U12 A;  4Z2N A;  3OAN A;  2RUK B;  2COC A;  1J0W A;  3GYP A;  2CY4 A;  3AU5 A;  3A58 A;  5C5B B;  1WJ1 A;  3ODX A;  2D9W A;  2DX5 A;  2ELB A;  2RSG A;  4DBB A;  2D4Q A;  4ZRJ A;  3HIE A;  3ZVR A;  2Z59 A;  4K81 A;  2D11 A;  1IRS A;  4Z2M B;  5C5B A;  4WJ7 A;  4GOU A;  1EF1 A;  1Z87 A;  5D3X A;  1U5E A;  4DXA B;  1FHO A;  2DYQ A;  2ADZ A;  1WG7 A;  5HE3 A;  5J3Y A;  3QIJ A;  2ROV A;  1B55 A;  5LOP B;  4DX8 A;  3HK0 A;  2GJY A;  1PMS A;  5M4Y B;  4DX9 0;  3SYX A;  1MIX A;  2DHK A;  1UPQ A;  1FB8 A;  2DLW A;  4QJ4 B;  1NTY A;  2YSZ A;  2P0D A;  4HAW B;  4HAT B;  3NWF A;  2Y8G A;  2I5C A;  2N0Y A;  2YT2 A;  2NZ8 B;  4HAU B;  4YON A;  3IVF A;  4PQ0 A;  1U5G A;  2GCL A;  3WYF B;  3TW1 A;  2VRW B;  2KCJ A;  1X86 A;  2R09 A;  3D8D A;  4IFS A;  1U29 A;  1MPH A;  2ELA A;  4CHM A;  4GNK B;  2CAY A;  1M7E A;  3HQC A;  1FGY A;  2D10 A;  2RVB B;  4MT7 A;  2DFK A;  3MPX A;  4IAP A;  1BAK A;  2LYD A;  3CXB B;  2KIG A; 
#chains in the Genus database with same CATH homology
 2V76 A;  2OTX A;  3A8Q A;  5DHF B;  2QKM A;  2BCJ A;  2CRF A;  1SGH A;  2LOZ A;  2J0M A;  2KGX B;  5C16 A;  4KHA A;  1GC7 A;  1U5F A;  2K00 A;  1OQN A;  3UZT A;  1AQC A;  1XOD A;  3A8P A;  5D3V A;  2Z0Q A;  1UEF A;  2VKI A;  4MY6 A;  2KUP A;  1X1G A;  1BTN A;  4EJN A;  1V89 A;  1W1H A;  3ML4 A;  4C0A A;  3LJU X;  5CLQ B;  5KQ1 A;  3KZ1 A;  1U5D A;  3PP2 A;  4A6F B;  2DTC A;  2LG1 A;  1FOE A;  5JHG A;  3FEH A;  2LOX A;  2COD A;  4HB2 B;  4TYZ A;  4IOY X;  1U2B A;  4A6F A;  4F7U P;  1U27 A;  3VOQ A;  1GG3 A;  1I2H A;  1MKE A;  3HW2 B;  5L81 A;  3ZDT A;  3U7D A;  2VSZ A;  1N3H A;  4B6H A;  1W1D A;  4D0N B;  3D8E A;  4MK0 A;  1WJM A;  3F0W A;  1X1F A;  3V5W A;  5JP4 A;  1PFJ A;  2RGN B;  4HB3 B;  2AEH A;  4P7I A;  5HE0 A;  1X05 A;  5C79 A;  3A98 B;  2DHI A;  2Z0O A;  1FAO A;  3F5R A;  5KQ4 A;  2H7D A;  4A6K A;  4XWX A;  4KAX B;  3U8Z A;  1Q67 A;  1M7R A;  1Y19 B;  4GN1 A;  1MK7 B;  1KZG A;  3NSU A;  5D3W A;  3AJ4 A;  2W2X C;  4F7G A;  4F7H A;  2EMS A;  1H4R A;  1DDV A;  4WVF B;  2UZS A;  2D9Z A;  2L1C A;  3BIN A;  4HB4 B;  1TXD A;  1WI1 A;  3CIK A;  1MAI A;  1ZVR A;  2N23 A;  1ZSQ A;  3PVL A;  3SV1 A;  1P6S A;  1QC6 A;  2DN6 A;  2D9Y A;  3ODW A;  1EVH A;  1XR0 B;  4KHB B;  4GPT B;  1DDW A;  4GZU A;  1RJ2 A;  5EFX A;  3QBV B;  2ZPY A;  1BTK A;  2COF A;  1LW3 A;  3TVV A;  4GMX B;  2IYB A;  2YS5 A;  1NTV A;  2EJ8 A;  3SUZ A;  2J0K A;  1P3R A;  2JP2 A;  1LB1 A;  2ROZ B;  1UPR A;  2X18 A;  5DIF B;  4HAV B;  3PVW A;  3QWM A;  1QQG A;  2EC1 A;  5HE2 A;  1XX0 A;  3TO1 A;  2QKL A;  4WSF A;  3DXE A;  1ZC3 B;  2OQB A;  5CLL B;  3BJI A;  5LON B;  1NI2 A;  2FJL A;  2YS3 A;  4H8S A;  4HB0 B;  5DHA B;  1WGQ A;  2MFQ A;  4Y94 A;  4PNK A;  1KI1 B;  5FI0 A;  1DYN A;  1DDM A;  1K5D B;  2DKP A;  2DA0 A;  4GMV A;  2XQN M;  2I1K A;  5J3T A;  2UVM A;  4HDO A;  1ZC4 B;  1UNQ A;  3ULB A;  3KY9 A;  4GXB A;  4HHV A;  2K2U A;  4HDQ A;  3T06 A;  5KCV A;  2NMB A;  2YVC A;  4CHJ A;  2Z0P A;  2AL6 A;  2DYN A;  4K2O A;  5DH9 B;  5HE1 A;  3N7C A;  1XKE A;  2COA A;  1V61 A;  2MWN B;  1MK9 B;  2W2X D;  2PZ1 A;  2IFS A;  1XD4 A;  3PSC A;  3O96 A;  2Y7B A;  3TCA A;  4KVG B;  3SNH A;  1TJ6 A;  1V5P A;  3SO6 A;  2YT0 A;  2M14 A;  1V5M A;  5D3Y A;  4YL8 A;  1TQZ A;  2J59 M;  2E2X A;  2HE7 A;  4TKN A;  3KSY A;  5DI9 B;  3MDB C;  1Y5O A;  1EGX A;  2YRY A;  3PVU A;  5JHH A;  4K2P A;  4BBK A;  4EKU A;  5D27 A;  1ISN A;  2YF0 A;  1BWN A;  3AU4 A;  2D9X A;  1UNP A;  2EMT A;  3FM8 C;  4A5K A;  1RRP B;  1WGU A;  1FHX A;  1FGZ A;  1PLS A;  4CYE A;  1K5G B;  3WA0 A;  5J3Q A;  3KRW A;  1W1G A;  2UZR A;  3PZD A;  2W2W A;  2J0J A;  2GCJ A;  2G35 A;  3KRX A;  3P6A A;  2LUL A;  3G9W A;  3PG7 A;  2DX1 A;  1MIZ B;  3PEG A;  4K17 A;  1I7A A;  2LKO A;  1XCG A;  5GOW B;  2K2J A;  3DXC A;  2R0D A;  4KHO A;  2Y8F A;  4HAZ B;  2D2Q A;  1SHC A;  4HAY B;  5JLJ B;  2MKR A;  1J19 A;  1GC6 A;  1EAZ A;  2DHJ A;  2I5F A;  4NY0 A;  3RCP A;  1KZ7 A;  2DKQ A;  2GS0 A;  1ZM0 A;  1H10 A;  4HAX B;  4ZRI A;  4NSW A;  3ODO A;  1OY2 A;  1DRO A;  2YS1 A;  2P8V A;  2D9V A;  1P5T A;  4L6E A;  1DBH A;  5C6R A;  1AWE A;  2I1J A;  1NU2 A;  2CY5 A;  3GYO A;  3D8F A;  1FHW A;  3FSS A;  2YT1 A;  4EMO A;  4ZRK A;  2RNR B;  3VIA A;  2L2I A;  2HTH B;  2RLO A;  2P0F A;  3TFM A;  1E5W A;  2P0H A;  1UNR A;  1WVH A;  1X11 A;  1V88 A;  1OMW A;  2H7E A;  5FI1 A;  2Q13 A;  3ULC A;  3DXD A;  1V5U A;  3M1I B;  3X23 A;  4A6H A;  2M38 A;  3P7Z A;  2MDX A;  4Z2N A;  3OAN A;  2RUK B;  2COC A;  1J0W A;  3GYP A;  2CY4 A;  3AU5 A;  5C5B B;  1WJ1 A;  3ODX A;  2D9W A;  2DX5 A;  2ELB A;  2RSG A;  4DBB A;  2D4Q A;  4ZRJ A;  3ZVR A;  4K81 A;  2D11 A;  1IRS A;  4Z2M B;  5C5B A;  4WJ7 A;  1EF1 A;  1Z87 A;  5D3X A;  1U5E A;  4DXA B;  1FHO A;  2DYQ A;  2ADZ A;  1WG7 A;  5HE3 A;  5J3Y A;  3QIJ A;  2ROV A;  1B55 A;  5LOP B;  4DX8 A;  3HK0 A;  2GJY A;  1PMS A;  4DX9 0;  3SYX A;  1MIX A;  2DHK A;  1UPQ A;  1FB8 A;  2DLW A;  1NTY A;  2YSZ A;  2P0D A;  4HAW B;  4HAT B;  2Y8G A;  2I5C A;  2N0Y A;  2NZ8 B;  4HAU B;  4YON A;  3IVF A;  4PQ0 A;  1U5G A;  2GCL A;  3WYF B;  3TW1 A;  2VRW B;  2KCJ A;  1X86 A;  2R09 A;  3D8D A;  4IFS A;  1U29 A;  1MPH A;  2ELA A;  4CHM A;  2CAY A;  1M7E A;  3HQC A;  1FGY A;  2D10 A;  2RVB B;  4MT7 A;  2DFK A;  3MPX A;  4IAP A;  1BAK A;  2LYD A;  3CXB B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...