1WJMA

Solution structure of pleckstrin homology domain of human beta iii spectrin.
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
123
structure length
123
Chain Sequence
GSSGSSGEQMEGMLCRKQEMEAFGKKAANRSWQNVYCVLRRGSLGFYKDAKAASAGVPYHGEVPVSLARAQGSVAFDYRKRKHVFKLGLQDGKEYLFQAKDEAEMSSWLRVVNAAIASGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords beta-spectrin III
publication title Solution structure of pleckstrin homology domain of human beta III spectrin
rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 17
structure length 123
sequence length 123
ec nomenclature
pdb deposition date 2004-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF15410 PH_9 Pleckstrin homology domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1wjmA00
1UPQA 5DH9B 4YL8A 1WGUA 5D3XA 5C5BB 2LULA 5HE0A 4F7UP 3FEHA 1X1GA 2YS1A 5HE1A 2V76A 2UZRA 2RGNB 5HE3A 2YT1A 2COAA 1H4RA 2DHJA 2K00A 4HAWB 2W2WA 2VKIA 2D9VA 3VIAA 2IYBA 2NMBA 2LG1A 1RRPB 4EMOA 5L81A 2I5CA 1K5GB 1UNRA 4KAXB 3CIKA 3RCPA 5JLJB 4K2PA 3HW2B 4ZRIA 3ULBA 2YSZA 1KZ7A 5J3QA 2L2IA 4GN1A 1IRSA 1XX0A 1UNQA 2AEHA 3ODOA 1Z87A 5DIFB 1FAOA 2QKMA 2R0DA 2KCJA 1RJ2A 1XKEA 4XWXA 2OQBA 4HAYB 2MDXA 1P6SA 2I1KA 3A98B 5J3TA 1OMWA 3ODWA 1WVHA 3MDBC 1OQNA 3PSCA 5LOPB 5DHAB 2RVBB 5C6RA 1QQGA 1TQZA 5D3VA 2J0JA 3DXCA 4HB2B 2HTHB 2YVCA 2Q13A 1V5MA 4GMXB 2Y7BA 3AU5A 3SYXA 1ZC3B 5CLLB 2GCJA 1TXDA 1U2BA 2DA0A 2VSZA 1WG7A 1KI1B 1ZSQA 3TW1A 1FB8A 1MIXA 1MIZB 4DX90 3FSSA 5EFXA 2UVMA 2AL6A 3PVUA 4K17A 1M7RA 1N3HA 1P5TA 3N7CA 1XODA 2RNRB 3BINA 1V61A 2MKRA 4Y94A 2KGXB 1NTYA 1X05A 2Z0QA 4C0AA 4CHJA 2CY5A 5JHGA 2CRFA 1B55A 4TYZA 2Y8GA 3V5WA 5C16A 2Z0PA 2RUKB 4KHAA 2J0MA 1J19A 2PZ1A 2CODA 2GJYA 2DHIA 4KHOA 2P8VA 2LOZA 5D3WA 1W1GA 3MPXA 1FHWA 3ZVRA 1TJ6A 4A6HA 1BTNA 3TFMA 1EVHA 3GYPA 2D9ZA 1XCGA 2UZSA 3QBVB 4MY6A 4BBKA 4EKUA 2YRYA 1OY2A 4K81A 2ADZA 2P0FA 1KZGA 2DLWA 1MKEA 3O96A 2EJ8A 1FGYA 1ZC4B 4NSWA 2RSGA 2LYDA 1DDWA 4D0NB 1ZM0A 3AJ4A 3SV1A 3PVLA 2ROVA 4H8SA 2D9XA 3G9WA 3M1IB 2ZPYA 5D27A 2P0DA 2HE7A 1EGXA 1GC6A 3A8PA 1UNPA 1X86A 2EMTA 2H7EA 2DN6A 4GXBA 4IFSA 1U29A 4PQ0A 5JP4A 2CAYA 2D9YA 1V88A 2JP2A 4EJNA 3HQCA 4IOYX 1UEFA 2EC1A 3TO1A 1WGQA 1DYNA 3T06A 1NTVA 2DYQA 2I1JA 3GYOA 1UPRA 4GZUA 2Y8FA 5CLQB 2J59M 3PVWA 2BCJA 3KRWA 1X1FA 2DHKA 1BAKA 5GOWB 2CY4A 1SGHA 4WVFB 1AQCA 4A6FA 4DBBA 4HB3B 2R09A 4HDOA 2YS5A 2K2JA 2DX5A 2YF0A 2QKLA 1WJ1A 1M7EA 3KZ1A 1MK7B 3PP2A 2YT0A 5LONB 3KSYA 5DI9B 2L1CA 3D8FA 3WYFB 1PMSA 4L6EA 1P3RA 3VOQA 4Z2NA 5KCVA 1FHOA 2RLOA 4F7GA 1U5EA 4Z2MB 2Z0OA 4F7HA 1V89A 2D10A 4HAVB 3LJUX 1BWNA 4HB0B 2DFKA 3ZDTA 5C5BA 4A6FB 1WI1A 1Y5OA 2K2UA 1ISNA 2DKPA 3CXBB 2VRWB 3PG7A 3SNHA 1DDVA 4GPTB 4PNKA 3UZTA 1EAZA 2DYNA 3KRXA 3ULCA 1Q67A 1E5WA 1FGZA 1H10A 3F0WA 4DXAB 1EF1A 1V5PA 3PZDA 3QIJA 2D2QA 2FJLA 4A5KA 4HHVA 1U5FA 4A6KA 1X11A 3P6AA 4DX8A 3QWMA 2DTCA 1MAIA 2MFQA 3TVVA 4CYEA 3D8DA 1XD4A 4HB4B 1BTKA 4P7IA 2ROZB 1V5UA 4MT7A 2DKQA 5KQ1A 2XQNM 2KUPA 1LB1A 4CHMA 2DX1A 1WJMA 2D4QA 2IFSA 1ZVRA 2GS0A 2ELBA 1SHCA 3NSUA 4MK0A 2YS3A 4NY0A 2D9WA 2P0HA 4ZRJA 4ZRKA 1U5GA 1PFJA 2M38A 1Y19B 1I7AA 2N0YA 3TCAA 3U8ZA 2E2XA 3FM8C 4TKNA 1AWEA 1U5DA 1K5DB 3ML4A 2LOXA 3KY9A 5FI1A 2J0KA 3AU4A 4HAXB 5J3YA 5KQ4A 2ELAA 1J0WA 2W2XD 4IAPA 2G35A 2W2XC 4YONA 4KHBB 3SO6A 5HE2A 2H7DA 4HAZB 5FI0A 2COFA 2N23A 1FHXA 3A8QA 1XR0B 2X18A 1GC7A 2COCA 4GMVA 2MWNB 1NI2A 3D8EA 3WA0A 1PLSA 2NZ8B 3DXDA 2M14A 1DROA 3SUZA 3U7DA 3F5RA 4WJ7A 4WSFA 3ODXA 3P7ZA 1QC6A 5C79A 3OANA 4K2OA 5JHHA 1LW3A 3HK0A 1I2HA 1W1DA 3DXEA 1W1HA 1GG3A 1DDMA 4HAUB 2OTXA 2LKOA 1FOEA 1DBHA 2I5FA 1U27A 2GCLA 2EMSA 5DHFB 3PEGA 4HATB 1NU2A 3X23A 2D11A 4B6HA 3BJIA 1MPHA 3IVFA 4KVGB 4HDQA 5D3YA 1MK9B
chains in the Genus database with same CATH superfamily
1UPQA 5DH9B 5I2SA 4YL8A 1WGUA 5D3XA 2Z59A 5C5BB 2LULA 5HE0A 4F7UP 3FEHA 1X1GA 2YS1A 5HE1A 2V76A 2UZRA 2RGNB 5HE3A 2YT1A 2COAA 1H4RA 2DHJA 2K00A 4CSQA 4HAWB 2W2WA 2VKIA 2D9VA 3VIAA 2IYBA 2K49A 2NMBA 2LG1A 1RRPB 3FVCA 4EMOA 5L81A 2I5CA 1K5GB 1T77A 1UNRA 4KAXB 3CIKA 3RCPA 5JLJB 4K2PA 3HW2B 2K8EA 4ZRIA 3ULBA 2YSZA 1KZ7A 5J3QA 2L2IA 4GN1A 1IRSA 1XX0A 1UNQA 2AEHA 3ODOA 1Z87A 5DIFB 1FAOA 2QKMA 2R0DA 2KCJA 1RJ2A 1XKEA 4XWXA 2OQBA 4HAYB 2MDXA 4GOUA 1P6SA 2I1KA 3A98B 5J3TA 1OMWA 3ODWA 1WVHA 3MDBC 1OQNA 3PSCA 5LOPB 5DHAB 2RVBB 5C6RA 1QQGA 1TQZA 5M4YB 5D3VA 2J0JA 3DXCA 4HB2B 2HTHB 2YVCA 2Q13A 1V5MA 4GMXB 2Y7BA 3AU5A 3SYXA 1ZC3B 5CLLB 2GCJA 1TXDA 1U2BA 2DA0A 2VSZA 1WG7A 1KI1B 1ZSQA 3TW1A 1FB8A 1MIXA 1MIZB 4DX90 4OT1A 3FSSA 5EFXA 2UVMA 2AL6A 3PVUA 3NW8A 4K17A 1M7RA 2YT2A 3U12A 1N3HA 3NWFA 1ZYIA 1P5TA 3N7CA 1XODA 2RNRB 3BINA 1V61A 2MKRA 4Y94A 2KGXB 1NTYA 1X05A 2Z0QA 4C0AA 4CHJA 2CY5A 5JHGA 4QXAB 2CRFA 1B55A 4TYZA 2Y8GA 3V5WA 5IRSA 5C16A 2Z0PA 2RUKB 4KHAA 2J0MA 1J19A 2PZ1A 2CODA 2GJYA 2DHIA 4KHOA 2P8VA 2LOZA 5D3WA 1W1GA 3MPXA 1FHWA 3ZVRA 1TJ6A 4A6HA 2R2YA 1BTNA 3TFMA 2NBVA 1EVHA 3GYPA 2D9ZA 1XCGA 2UZSA 3QBVB 4MY6A 4BBKA 4EKUA 2KR0A 2YRYA 1OY2A 4K81A 2ADZA 2P0FA 1KZGA 2DLWA 1MKEA 4L1RA 3O96A 2EJ8A 1FGYA 1ZC4B 4NSWA 2Z4DA 2RSGA 3NWAA 2LYDA 1DDWA 4D0NB 1ZM0A 3AJ4A 3HIEA 3SV1A 3PVLA 2ROVA 4H8SA 2D9XA 3G9WA 3M1IB 2ZPYA 5D27A 2P0DA 4QJ4B 2HE7A 2Z13A 1EGXA 1GC6A 3A8PA 1UNPA 1X86A 2EMTA 2H7EA 2DN6A 4GXBA 4IFSA 1U29A 4PQ0A 5JP4A 2CAYA 2D9YA 1V88A 2Z14A 2JP2A 4EJNA 3HQCA 4IOYX 1UEFA 2EC1A 3TO1A 2RRFA 1WGQA 1DYNA 3T06A 1NTVA 2DYQA 2I1JA 3GYOA 1UPRA 4GZUA 2Y8FA 5CLQB 2J59M 3PVWA 2BCJA 3KRWA 1X1FA 2DHKA 1BAKA 5GOWB 2CY4A 2KIGA 1SGHA 4WVFB 1AQCA 3HSAA 4A6FA 4DBBA 4HB3B 2R09A 4OSNA 4HDOA 2YS5A 2K2JA 2DX5A 2YF0A 2QKLA 1WJ1A 1M7EA 3KZ1A 1MK7B 3PP2A 2YT0A 5LONB 3KSYA 5DI9B 2L1CA 3D8FA 3WYFB 1PMSA 4L6EA 1P3RA 3VOQA 4Z2NA 5KCVA 1FHOA 2RLOA 4F7GA 4QJ3B 1U5EA 4Z2MB 2Z0OA 4F7HA 1V89A 4DIXA 2D10A 4HAVB 3LJUX 1BWNA 4HB0B 2DFKA 3ZDTA 3B77A 5C5BA 4A6FB 1WI1A 1Y5OA 2K2UA 1ISNA 2DKPA 3CXBB 2VRWB 3PG7A 3SNHA 1DDVA 4GPTB 4PNKA 4HSIA 3UZTA 1EAZA 2DYNA 3KRXA 3ULCA 1Q67A 1E5WA 3NWDA 1FGZA 2ZKMX 1H10A 2KIEA 3F0WA 4DXAB 1EF1A 1V5PA 3PZDA 3DCXA 3QIJA 2D2QA 2FJLA 2FJUB 4A5KA 4HHVA 1U5FA 4QJ5B 4A6KA 1X11A 3P6AA 4DX8A 2KUQA 3QWMA 2DTCA 1MAIA 2MFQA 3TVVA 4CYEA 3D8DA 1XD4A 4HB4B 1BTKA 4P7IA 2ROZB 1V5UA 4MT7A 2DKQA 5KQ1A 2XQNM 2KUPA 1LB1A 4CHMA 2DX1A 1WJMA 2D4QA 4KHBA 2IFSA 1MI1A 1ZVRA 2GS0A 2ELBA 1SHCA 3NSUA 4MK0A 2YS3A 4NY0A 2D9WA 2P0HA 4ZRJA 3A58A 4ZRKA 1U5GA 1PFJA 2M38A 1Y19B 1I7AA 2N0YA 3TCAA 3U8ZA 2E2XA 3FM8C 4TKNA 1AWEA 1U5DA 1K5DB 3ML4A 2LOXA 3KY9A 5FI1A 2J0KA 3AU4A 4HAXB 5J3YA 5KQ4A 2ELAA 1J0WA 2W2XD 4IAPA 2G35A 2W2XC 4GNKB 4YONA 4KHBB 3SO6A 5HE2A 2H7DA 4HAZB 5FI0A 2COFA 2N23A 1FHXA 3A8QA 1XR0B 2X18A 1GC7A 2COCA 4GMVA 2MWNB 1NI2A 3D8EA 3WA0A 1PLSA 2NZ8B 3DXDA 2M14A 5I2MA 1DROA 3SUZA 3U7DA 3F5RA 4WJ7A 4WSFA 3ODXA 3P7ZA 1QC6A 4D6WA 5C79A 3OANA 4K2OA 5JHHA 1LW3A 3HK0A 1I2HA 1W1DA 3DXEA 1W1HA 1GG3A 1DDMA 4HAUB 2OTXA 2LKOA 1FOEA 1DBHA 2I5FA 5LG4B 1U27A 2GCLA 2EMSA 5DHFB 3PEGA 4HATB 1NU2A 3X23A 2D11A 3OHMB 4B6HA 3BJIA 1MPHA 3IVFA 4KVGB 4HDQA 5D3YA 2GUMA 1MK9B
chains in the Genus database with same CATH topology
1UPQA 5DH9B 4YL8A 1WGUA 5D3XA 5C5BB 2LULA 5HE0A 4F7UP 3FEHA 1X1GA 2YS1A 5HE1A 2V76A 2UZRA 2RGNB 5HE3A 2YT1A 2COAA 1H4RA 2DHJA 2K00A 4HAWB 2W2WA 2VKIA 2D9VA 3VIAA 2IYBA 2NMBA 2LG1A 1RRPB 4EMOA 5L81A 2I5CA 1K5GB 1UNRA 4KAXB 3CIKA 3RCPA 5JLJB 4K2PA 3HW2B 4ZRIA 3ULBA 2YSZA 1KZ7A 5J3QA 2L2IA 4GN1A 1IRSA 1XX0A 1UNQA 2AEHA 3ODOA 1Z87A 5DIFB 1FAOA 2QKMA 2R0DA 2KCJA 1RJ2A 1XKEA 4XWXA 2OQBA 4HAYB 2MDXA 1P6SA 2I1KA 3A98B 5J3TA 1OMWA 3ODWA 1WVHA 3MDBC 1OQNA 3PSCA 5LOPB 5DHAB 2RVBB 5C6RA 1QQGA 1TQZA 5D3VA 2J0JA 3DXCA 4HB2B 2HTHB 2YVCA 2Q13A 1V5MA 4GMXB 2Y7BA 3AU5A 3SYXA 1ZC3B 5CLLB 2GCJA 1TXDA 1U2BA 2DA0A 2VSZA 1WG7A 1KI1B 1ZSQA 3TW1A 1FB8A 1MIXA 1MIZB 4DX90 3FSSA 5EFXA 2UVMA 2AL6A 3PVUA 4K17A 1M7RA 1N3HA 1P5TA 3N7CA 1XODA 2RNRB 3BINA 1V61A 2MKRA 4Y94A 2KGXB 1NTYA 1X05A 2Z0QA 4C0AA 4CHJA 2CY5A 5JHGA 2CRFA 1B55A 4TYZA 2Y8GA 3V5WA 5C16A 2Z0PA 2RUKB 4KHAA 2J0MA 1J19A 2PZ1A 2CODA 2GJYA 2DHIA 4KHOA 2P8VA 2LOZA 5D3WA 1W1GA 3MPXA 1FHWA 3ZVRA 1TJ6A 4A6HA 1BTNA 3TFMA 1EVHA 3GYPA 2D9ZA 1XCGA 2UZSA 3QBVB 4MY6A 4BBKA 4EKUA 2YRYA 1OY2A 4K81A 2ADZA 2P0FA 1KZGA 2DLWA 1MKEA 3O96A 2EJ8A 1FGYA 1ZC4B 4NSWA 2RSGA 2LYDA 1DDWA 4D0NB 1ZM0A 3AJ4A 3SV1A 3PVLA 2ROVA 4H8SA 2D9XA 3G9WA 3M1IB 2ZPYA 5D27A 2P0DA 2HE7A 1EGXA 1GC6A 3A8PA 1UNPA 1X86A 2EMTA 2H7EA 2DN6A 4GXBA 4IFSA 1U29A 4PQ0A 5JP4A 2CAYA 2D9YA 1V88A 2JP2A 4EJNA 3HQCA 4IOYX 1UEFA 2EC1A 3TO1A 1WGQA 1DYNA 3T06A 1NTVA 2DYQA 2I1JA 3GYOA 1UPRA 4GZUA 2Y8FA 5CLQB 2J59M 3PVWA 2BCJA 3KRWA 1X1FA 2DHKA 1BAKA 5GOWB 2CY4A 1SGHA 4WVFB 1AQCA 4A6FA 4DBBA 4HB3B 2R09A 4HDOA 2YS5A 2K2JA 2DX5A 2YF0A 2QKLA 1WJ1A 1M7EA 3KZ1A 1MK7B 3PP2A 2YT0A 5LONB 3KSYA 5DI9B 2L1CA 3D8FA 3WYFB 1PMSA 4L6EA 1P3RA 3VOQA 4Z2NA 5KCVA 1FHOA 2RLOA 4F7GA 1U5EA 4Z2MB 2Z0OA 4F7HA 1V89A 2D10A 4HAVB 3LJUX 1BWNA 4HB0B 2DFKA 3ZDTA 5C5BA 4A6FB 1WI1A 1Y5OA 2K2UA 1ISNA 2DKPA 3CXBB 2VRWB 3PG7A 3SNHA 1DDVA 4GPTB 4PNKA 3UZTA 1EAZA 2DYNA 3KRXA 3ULCA 1Q67A 1E5WA 1FGZA 1H10A 3F0WA 4DXAB 1EF1A 1V5PA 3PZDA 3QIJA 2D2QA 2FJLA 4A5KA 4HHVA 1U5FA 4A6KA 1X11A 3P6AA 4DX8A 3QWMA 2DTCA 1MAIA 2MFQA 3TVVA 4CYEA 3D8DA 1XD4A 4HB4B 1BTKA 4P7IA 2ROZB 1V5UA 4MT7A 2DKQA 5KQ1A 2XQNM 2KUPA 1LB1A 4CHMA 2DX1A 1WJMA 2D4QA 2IFSA 1ZVRA 2GS0A 2ELBA 1SHCA 3NSUA 4MK0A 2YS3A 4NY0A 2D9WA 2P0HA 4ZRJA 4ZRKA 1U5GA 1PFJA 2M38A 1Y19B 1I7AA 2N0YA 3TCAA 3U8ZA 2E2XA 3FM8C 4TKNA 1AWEA 1U5DA 1K5DB 3ML4A 2LOXA 3KY9A 5FI1A 2J0KA 3AU4A 4HAXB 5J3YA 5KQ4A 2ELAA 1J0WA 2W2XD 4IAPA 2G35A 2W2XC 4YONA 4KHBB 3SO6A 5HE2A 2H7DA 4HAZB 5FI0A 2COFA 2N23A 1FHXA 3A8QA 1XR0B 2X18A 1GC7A 2COCA 4GMVA 2MWNB 1NI2A 3D8EA 3WA0A 1PLSA 2NZ8B 3DXDA 2M14A 1DROA 3SUZA 3U7DA 3F5RA 4WJ7A 4WSFA 3ODXA 3P7ZA 1QC6A 5C79A 3OANA 4K2OA 5JHHA 1LW3A 3HK0A 1I2HA 1W1DA 3DXEA 1W1HA 1GG3A 1DDMA 4HAUB 2OTXA 2LKOA 1FOEA 1DBHA 2I5FA 1U27A 2GCLA 2EMSA 5DHFB 3PEGA 4HATB 1NU2A 3X23A 2D11A 4B6HA 3BJIA 1MPHA 3IVFA 4KVGB 4HDQA 5D3YA 1MK9B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UPQ A;  5DH9 B;  4YL8 A;  1WGU A;  5D3X A;  5C5B B;  2LUL A;  5HE0 A;  4F7U P;  3FEH A;  1X1G A;  2YS1 A;  5HE1 A;  2V76 A;  2UZR A;  2RGN B;  5HE3 A;  2YT1 A;  2COA A;  1H4R A;  2DHJ A;  2K00 A;  4HAW B;  2W2W A;  2VKI A;  2D9V A;  3VIA A;  2IYB A;  2NMB A;  2LG1 A;  1RRP B;  4EMO A;  5L81 A;  2I5C A;  1K5G B;  1UNR A;  4KAX B;  3CIK A;  3RCP A;  5JLJ B;  4K2P A;  3HW2 B;  4ZRI A;  3ULB A;  2YSZ A;  1KZ7 A;  5J3Q A;  2L2I A;  4GN1 A;  1IRS A;  1XX0 A;  1UNQ A;  2AEH A;  3ODO A;  1Z87 A;  5DIF B;  1FAO A;  2QKM A;  2R0D A;  2KCJ A;  1RJ2 A;  1XKE A;  4XWX A;  2OQB A;  4HAY B;  2MDX A;  1P6S A;  2I1K A;  3A98 B;  5J3T A;  1OMW A;  3ODW A;  1WVH A;  3MDB C;  1OQN A;  3PSC A;  5LOP B;  5DHA B;  2RVB B;  5C6R A;  1QQG A;  1TQZ A;  5D3V A;  2J0J A;  3DXC A;  4HB2 B;  2HTH B;  2YVC A;  2Q13 A;  1V5M A;  4GMX B;  2Y7B A;  3AU5 A;  3SYX A;  1ZC3 B;  5CLL B;  2GCJ A;  1TXD A;  1U2B A;  2DA0 A;  2VSZ A;  1WG7 A;  1KI1 B;  1ZSQ A;  3TW1 A;  1FB8 A;  1MIX A;  1MIZ B;  4DX9 0;  3FSS A;  5EFX A;  2UVM A;  2AL6 A;  3PVU A;  4K17 A;  1M7R A;  1N3H A;  1P5T A;  3N7C A;  1XOD A;  2RNR B;  3BIN A;  1V61 A;  2MKR A;  4Y94 A;  2KGX B;  1NTY A;  1X05 A;  2Z0Q A;  4C0A A;  4CHJ A;  2CY5 A;  5JHG A;  2CRF A;  1B55 A;  4TYZ A;  2Y8G A;  3V5W A;  5C16 A;  2Z0P A;  2RUK B;  4KHA A;  2J0M A;  1J19 A;  2PZ1 A;  2COD A;  2GJY A;  2DHI A;  4KHO A;  2P8V A;  2LOZ A;  5D3W A;  1W1G A;  3MPX A;  1FHW A;  3ZVR A;  1TJ6 A;  4A6H A;  1BTN A;  3TFM A;  1EVH A;  3GYP A;  2D9Z A;  1XCG A;  2UZS A;  3QBV B;  4MY6 A;  4BBK A;  4EKU A;  2YRY A;  1OY2 A;  4K81 A;  2ADZ A;  2P0F A;  1KZG A;  2DLW A;  1MKE A;  3O96 A;  2EJ8 A;  1FGY A;  1ZC4 B;  4NSW A;  2RSG A;  2LYD A;  1DDW A;  4D0N B;  1ZM0 A;  3AJ4 A;  3SV1 A;  3PVL A;  2ROV A;  4H8S A;  2D9X A;  3G9W A;  3M1I B;  2ZPY A;  5D27 A;  2P0D A;  2HE7 A;  1EGX A;  1GC6 A;  3A8P A;  1UNP A;  1X86 A;  2EMT A;  2H7E A;  2DN6 A;  4GXB A;  4IFS A;  1U29 A;  4PQ0 A;  5JP4 A;  2CAY A;  2D9Y A;  1V88 A;  2JP2 A;  4EJN A;  3HQC A;  4IOY X;  1UEF A;  2EC1 A;  3TO1 A;  1WGQ A;  1DYN A;  3T06 A;  1NTV A;  2DYQ A;  2I1J A;  3GYO A;  1UPR A;  4GZU A;  2Y8F A;  5CLQ B;  2J59 M;  3PVW A;  2BCJ A;  3KRW A;  1X1F A;  2DHK A;  1BAK A;  5GOW B;  2CY4 A;  1SGH A;  4WVF B;  1AQC A;  4A6F A;  4DBB A;  4HB3 B;  2R09 A;  4HDO A;  2YS5 A;  2K2J A;  2DX5 A;  2YF0 A;  2QKL A;  1WJ1 A;  1M7E A;  3KZ1 A;  1MK7 B;  3PP2 A;  2YT0 A;  5LON B;  3KSY A;  5DI9 B;  2L1C A;  3D8F A;  3WYF B;  1PMS A;  4L6E A;  1P3R A;  3VOQ A;  4Z2N A;  5KCV A;  1FHO A;  2RLO A;  4F7G A;  1U5E A;  4Z2M B;  2Z0O A;  4F7H A;  1V89 A;  2D10 A;  4HAV B;  3LJU X;  1BWN A;  4HB0 B;  2DFK A;  3ZDT A;  5C5B A;  4A6F B;  1WI1 A;  1Y5O A;  2K2U A;  1ISN A;  2DKP A;  3CXB B;  2VRW B;  3PG7 A;  3SNH A;  1DDV A;  4GPT B;  4PNK A;  3UZT A;  1EAZ A;  2DYN A;  3KRX A;  3ULC A;  1Q67 A;  1E5W A;  1FGZ A;  1H10 A;  3F0W A;  4DXA B;  1EF1 A;  1V5P A;  3PZD A;  3QIJ A;  2D2Q A;  2FJL A;  4A5K A;  4HHV A;  1U5F A;  4A6K A;  1X11 A;  3P6A A;  4DX8 A;  3QWM A;  2DTC A;  1MAI A;  2MFQ A;  3TVV A;  4CYE A;  3D8D A;  1XD4 A;  4HB4 B;  1BTK A;  4P7I A;  2ROZ B;  1V5U A;  4MT7 A;  2DKQ A;  5KQ1 A;  2XQN M;  2KUP A;  1LB1 A;  4CHM A;  2DX1 A;  1WJM A;  2D4Q A;  2IFS A;  1ZVR A;  2GS0 A;  2ELB A;  1SHC A;  3NSU A;  4MK0 A;  2YS3 A;  4NY0 A;  2D9W A;  2P0H A;  4ZRJ A;  4ZRK A;  1U5G A;  1PFJ A;  2M38 A;  1Y19 B;  1I7A A;  2N0Y A;  3TCA A;  3U8Z A;  2E2X A;  3FM8 C;  4TKN A;  1AWE A;  1U5D A;  1K5D B;  3ML4 A;  2LOX A;  3KY9 A;  5FI1 A;  2J0K A;  3AU4 A;  4HAX B;  5J3Y A;  5KQ4 A;  2ELA A;  1J0W A;  2W2X D;  4IAP A;  2G35 A;  2W2X C;  4YON A;  4KHB B;  3SO6 A;  5HE2 A;  2H7D A;  4HAZ B;  5FI0 A;  2COF A;  2N23 A;  1FHX A;  3A8Q A;  1XR0 B;  2X18 A;  1GC7 A;  2COC A;  4GMV A;  2MWN B;  1NI2 A;  3D8E A;  3WA0 A;  1PLS A;  2NZ8 B;  3DXD A;  2M14 A;  1DRO A;  3SUZ A;  3U7D A;  3F5R A;  4WJ7 A;  4WSF A;  3ODX A;  3P7Z A;  1QC6 A;  5C79 A;  3OAN A;  4K2O A;  5JHH A;  1LW3 A;  3HK0 A;  1I2H A;  1W1D A;  3DXE A;  1W1H A;  1GG3 A;  1DDM A;  4HAU B;  2OTX A;  2LKO A;  1FOE A;  1DBH A;  2I5F A;  1U27 A;  2GCL A;  2EMS A;  5DHF B;  3PEG A;  4HAT B;  1NU2 A;  3X23 A;  2D11 A;  4B6H A;  3BJI A;  1MPH A;  3IVF A;  4KVG B;  4HDQ A;  5D3Y A;  1MK9 B; 
#chains in the Genus database with same CATH topology
 1UPQ A;  5DH9 B;  5I2S A;  4YL8 A;  1WGU A;  5D3X A;  2Z59 A;  5C5B B;  2LUL A;  5HE0 A;  4F7U P;  3FEH A;  1X1G A;  2YS1 A;  5HE1 A;  2V76 A;  2UZR A;  2RGN B;  5HE3 A;  2YT1 A;  2COA A;  1H4R A;  2DHJ A;  2K00 A;  4CSQ A;  4HAW B;  2W2W A;  2VKI A;  2D9V A;  3VIA A;  2IYB A;  2K49 A;  2NMB A;  2LG1 A;  1RRP B;  3FVC A;  4EMO A;  5L81 A;  2I5C A;  1K5G B;  1T77 A;  1UNR A;  4KAX B;  3CIK A;  3RCP A;  5JLJ B;  4K2P A;  3HW2 B;  2K8E A;  4ZRI A;  3ULB A;  2YSZ A;  1KZ7 A;  5J3Q A;  2L2I A;  4GN1 A;  1IRS A;  1XX0 A;  1UNQ A;  2AEH A;  3ODO A;  1Z87 A;  5DIF B;  1FAO A;  2QKM A;  2R0D A;  2KCJ A;  1RJ2 A;  1XKE A;  4XWX A;  2OQB A;  4HAY B;  2MDX A;  4GOU A;  1P6S A;  2I1K A;  3A98 B;  5J3T A;  1OMW A;  3ODW A;  1WVH A;  3MDB C;  1OQN A;  3PSC A;  5LOP B;  5DHA B;  2RVB B;  5C6R A;  1QQG A;  1TQZ A;  5M4Y B;  5D3V A;  2J0J A;  3DXC A;  4HB2 B;  2HTH B;  2YVC A;  2Q13 A;  1V5M A;  4GMX B;  2Y7B A;  3AU5 A;  3SYX A;  1ZC3 B;  5CLL B;  2GCJ A;  1TXD A;  1U2B A;  2DA0 A;  2VSZ A;  1WG7 A;  1KI1 B;  1ZSQ A;  3TW1 A;  1FB8 A;  1MIX A;  1MIZ B;  4DX9 0;  4OT1 A;  3FSS A;  5EFX A;  2UVM A;  2AL6 A;  3PVU A;  3NW8 A;  4K17 A;  1M7R A;  2YT2 A;  3U12 A;  1N3H A;  3NWF A;  1ZYI A;  1P5T A;  3N7C A;  1XOD A;  2RNR B;  3BIN A;  1V61 A;  2MKR A;  4Y94 A;  2KGX B;  1NTY A;  1X05 A;  2Z0Q A;  4C0A A;  4CHJ A;  2CY5 A;  5JHG A;  4QXA B;  2CRF A;  1B55 A;  4TYZ A;  2Y8G A;  3V5W A;  5IRS A;  5C16 A;  2Z0P A;  2RUK B;  4KHA A;  2J0M A;  1J19 A;  2PZ1 A;  2COD A;  2GJY A;  2DHI A;  4KHO A;  2P8V A;  2LOZ A;  5D3W A;  1W1G A;  3MPX A;  1FHW A;  3ZVR A;  1TJ6 A;  4A6H A;  2R2Y A;  1BTN A;  3TFM A;  2NBV A;  1EVH A;  3GYP A;  2D9Z A;  1XCG A;  2UZS A;  3QBV B;  4MY6 A;  4BBK A;  4EKU A;  2KR0 A;  2YRY A;  1OY2 A;  4K81 A;  2ADZ A;  2P0F A;  1KZG A;  2DLW A;  1MKE A;  4L1R A;  3O96 A;  2EJ8 A;  1FGY A;  1ZC4 B;  4NSW A;  2Z4D A;  2RSG A;  3NWA A;  2LYD A;  1DDW A;  4D0N B;  1ZM0 A;  3AJ4 A;  3HIE A;  3SV1 A;  3PVL A;  2ROV A;  4H8S A;  2D9X A;  3G9W A;  3M1I B;  2ZPY A;  5D27 A;  2P0D A;  4QJ4 B;  2HE7 A;  2Z13 A;  1EGX A;  1GC6 A;  3A8P A;  1UNP A;  1X86 A;  2EMT A;  2H7E A;  2DN6 A;  4GXB A;  4IFS A;  1U29 A;  4PQ0 A;  5JP4 A;  2CAY A;  2D9Y A;  1V88 A;  2Z14 A;  2JP2 A;  4EJN A;  3HQC A;  4IOY X;  1UEF A;  2EC1 A;  3TO1 A;  2RRF A;  1WGQ A;  1DYN A;  3T06 A;  1NTV A;  2DYQ A;  2I1J A;  3GYO A;  1UPR A;  4GZU A;  2Y8F A;  5CLQ B;  2J59 M;  3PVW A;  2BCJ A;  3KRW A;  1X1F A;  2DHK A;  1BAK A;  5GOW B;  2CY4 A;  2KIG A;  1SGH A;  4WVF B;  1AQC A;  3HSA A;  4A6F A;  4DBB A;  4HB3 B;  2R09 A;  4OSN A;  4HDO A;  2YS5 A;  2K2J A;  2DX5 A;  2YF0 A;  2QKL A;  1WJ1 A;  1M7E A;  3KZ1 A;  1MK7 B;  3PP2 A;  2YT0 A;  5LON B;  3KSY A;  5DI9 B;  2L1C A;  3D8F A;  3WYF B;  1PMS A;  4L6E A;  1P3R A;  3VOQ A;  4Z2N A;  5KCV A;  1FHO A;  2RLO A;  4F7G A;  4QJ3 B;  1U5E A;  4Z2M B;  2Z0O A;  4F7H A;  1V89 A;  4DIX A;  2D10 A;  4HAV B;  3LJU X;  1BWN A;  4HB0 B;  2DFK A;  3ZDT A;  3B77 A;  5C5B A;  4A6F B;  1WI1 A;  1Y5O A;  2K2U A;  1ISN A;  2DKP A;  3CXB B;  2VRW B;  3PG7 A;  3SNH A;  1DDV A;  4GPT B;  4PNK A;  4HSI A;  3UZT A;  1EAZ A;  2DYN A;  3KRX A;  3ULC A;  1Q67 A;  1E5W A;  3NWD A;  1FGZ A;  2ZKM X;  1H10 A;  2KIE A;  3F0W A;  4DXA B;  1EF1 A;  1V5P A;  3PZD A;  3DCX A;  3QIJ A;  2D2Q A;  2FJL A;  2FJU B;  4A5K A;  4HHV A;  1U5F A;  4QJ5 B;  4A6K A;  1X11 A;  3P6A A;  4DX8 A;  2KUQ A;  3QWM A;  2DTC A;  1MAI A;  2MFQ A;  3TVV A;  4CYE A;  3D8D A;  1XD4 A;  4HB4 B;  1BTK A;  4P7I A;  2ROZ B;  1V5U A;  4MT7 A;  2DKQ A;  5KQ1 A;  2XQN M;  2KUP A;  1LB1 A;  4CHM A;  2DX1 A;  1WJM A;  2D4Q A;  4KHB A;  2IFS A;  1MI1 A;  1ZVR A;  2GS0 A;  2ELB A;  1SHC A;  3NSU A;  4MK0 A;  2YS3 A;  4NY0 A;  2D9W A;  2P0H A;  4ZRJ A;  3A58 A;  4ZRK A;  1U5G A;  1PFJ A;  2M38 A;  1Y19 B;  1I7A A;  2N0Y A;  3TCA A;  3U8Z A;  2E2X A;  3FM8 C;  4TKN A;  1AWE A;  1U5D A;  1K5D B;  3ML4 A;  2LOX A;  3KY9 A;  5FI1 A;  2J0K A;  3AU4 A;  4HAX B;  5J3Y A;  5KQ4 A;  2ELA A;  1J0W A;  2W2X D;  4IAP A;  2G35 A;  2W2X C;  4GNK B;  4YON A;  4KHB B;  3SO6 A;  5HE2 A;  2H7D A;  4HAZ B;  5FI0 A;  2COF A;  2N23 A;  1FHX A;  3A8Q A;  1XR0 B;  2X18 A;  1GC7 A;  2COC A;  4GMV A;  2MWN B;  1NI2 A;  3D8E A;  3WA0 A;  1PLS A;  2NZ8 B;  3DXD A;  2M14 A;  5I2M A;  1DRO A;  3SUZ A;  3U7D A;  3F5R A;  4WJ7 A;  4WSF A;  3ODX A;  3P7Z A;  1QC6 A;  4D6W A;  5C79 A;  3OAN A;  4K2O A;  5JHH A;  1LW3 A;  3HK0 A;  1I2H A;  1W1D A;  3DXE A;  1W1H A;  1GG3 A;  1DDM A;  4HAU B;  2OTX A;  2LKO A;  1FOE A;  1DBH A;  2I5F A;  5LG4 B;  1U27 A;  2GCL A;  2EMS A;  5DHF B;  3PEG A;  4HAT B;  1NU2 A;  3X23 A;  2D11 A;  3OHM B;  4B6H A;  3BJI A;  1MPH A;  3IVF A;  4KVG B;  4HDQ A;  5D3Y A;  2GUM A;  1MK9 B; 
#chains in the Genus database with same CATH homology
 1UPQ A;  5DH9 B;  4YL8 A;  1WGU A;  5D3X A;  5C5B B;  2LUL A;  5HE0 A;  4F7U P;  3FEH A;  1X1G A;  2YS1 A;  5HE1 A;  2V76 A;  2UZR A;  2RGN B;  5HE3 A;  2YT1 A;  2COA A;  1H4R A;  2DHJ A;  2K00 A;  4HAW B;  2W2W A;  2VKI A;  2D9V A;  3VIA A;  2IYB A;  2NMB A;  2LG1 A;  1RRP B;  4EMO A;  5L81 A;  2I5C A;  1K5G B;  1UNR A;  4KAX B;  3CIK A;  3RCP A;  5JLJ B;  4K2P A;  3HW2 B;  4ZRI A;  3ULB A;  2YSZ A;  1KZ7 A;  5J3Q A;  2L2I A;  4GN1 A;  1IRS A;  1XX0 A;  1UNQ A;  2AEH A;  3ODO A;  1Z87 A;  5DIF B;  1FAO A;  2QKM A;  2R0D A;  2KCJ A;  1RJ2 A;  1XKE A;  4XWX A;  2OQB A;  4HAY B;  2MDX A;  1P6S A;  2I1K A;  3A98 B;  5J3T A;  1OMW A;  3ODW A;  1WVH A;  3MDB C;  1OQN A;  3PSC A;  5LOP B;  5DHA B;  2RVB B;  5C6R A;  1QQG A;  1TQZ A;  5D3V A;  2J0J A;  3DXC A;  4HB2 B;  2HTH B;  2YVC A;  2Q13 A;  1V5M A;  4GMX B;  2Y7B A;  3AU5 A;  3SYX A;  1ZC3 B;  5CLL B;  2GCJ A;  1TXD A;  1U2B A;  2DA0 A;  2VSZ A;  1WG7 A;  1KI1 B;  1ZSQ A;  3TW1 A;  1FB8 A;  1MIX A;  1MIZ B;  4DX9 0;  3FSS A;  5EFX A;  2UVM A;  2AL6 A;  3PVU A;  4K17 A;  1M7R A;  1N3H A;  1P5T A;  3N7C A;  1XOD A;  2RNR B;  3BIN A;  1V61 A;  2MKR A;  4Y94 A;  2KGX B;  1NTY A;  1X05 A;  2Z0Q A;  4C0A A;  4CHJ A;  2CY5 A;  5JHG A;  2CRF A;  1B55 A;  4TYZ A;  2Y8G A;  3V5W A;  5C16 A;  2Z0P A;  2RUK B;  4KHA A;  2J0M A;  1J19 A;  2PZ1 A;  2COD A;  2GJY A;  2DHI A;  4KHO A;  2P8V A;  2LOZ A;  5D3W A;  1W1G A;  3MPX A;  1FHW A;  3ZVR A;  1TJ6 A;  4A6H A;  1BTN A;  3TFM A;  1EVH A;  3GYP A;  2D9Z A;  1XCG A;  2UZS A;  3QBV B;  4MY6 A;  4BBK A;  4EKU A;  2YRY A;  1OY2 A;  4K81 A;  2ADZ A;  2P0F A;  1KZG A;  2DLW A;  1MKE A;  3O96 A;  2EJ8 A;  1FGY A;  1ZC4 B;  4NSW A;  2RSG A;  2LYD A;  1DDW A;  4D0N B;  1ZM0 A;  3AJ4 A;  3SV1 A;  3PVL A;  2ROV A;  4H8S A;  2D9X A;  3G9W A;  3M1I B;  2ZPY A;  5D27 A;  2P0D A;  2HE7 A;  1EGX A;  1GC6 A;  3A8P A;  1UNP A;  1X86 A;  2EMT A;  2H7E A;  2DN6 A;  4GXB A;  4IFS A;  1U29 A;  4PQ0 A;  5JP4 A;  2CAY A;  2D9Y A;  1V88 A;  2JP2 A;  4EJN A;  3HQC A;  4IOY X;  1UEF A;  2EC1 A;  3TO1 A;  1WGQ A;  1DYN A;  3T06 A;  1NTV A;  2DYQ A;  2I1J A;  3GYO A;  1UPR A;  4GZU A;  2Y8F A;  5CLQ B;  2J59 M;  3PVW A;  2BCJ A;  3KRW A;  1X1F A;  2DHK A;  1BAK A;  5GOW B;  2CY4 A;  1SGH A;  4WVF B;  1AQC A;  4A6F A;  4DBB A;  4HB3 B;  2R09 A;  4HDO A;  2YS5 A;  2K2J A;  2DX5 A;  2YF0 A;  2QKL A;  1WJ1 A;  1M7E A;  3KZ1 A;  1MK7 B;  3PP2 A;  2YT0 A;  5LON B;  3KSY A;  5DI9 B;  2L1C A;  3D8F A;  3WYF B;  1PMS A;  4L6E A;  1P3R A;  3VOQ A;  4Z2N A;  5KCV A;  1FHO A;  2RLO A;  4F7G A;  1U5E A;  4Z2M B;  2Z0O A;  4F7H A;  1V89 A;  2D10 A;  4HAV B;  3LJU X;  1BWN A;  4HB0 B;  2DFK A;  3ZDT A;  5C5B A;  4A6F B;  1WI1 A;  1Y5O A;  2K2U A;  1ISN A;  2DKP A;  3CXB B;  2VRW B;  3PG7 A;  3SNH A;  1DDV A;  4GPT B;  4PNK A;  3UZT A;  1EAZ A;  2DYN A;  3KRX A;  3ULC A;  1Q67 A;  1E5W A;  1FGZ A;  1H10 A;  3F0W A;  4DXA B;  1EF1 A;  1V5P A;  3PZD A;  3QIJ A;  2D2Q A;  2FJL A;  4A5K A;  4HHV A;  1U5F A;  4A6K A;  1X11 A;  3P6A A;  4DX8 A;  3QWM A;  2DTC A;  1MAI A;  2MFQ A;  3TVV A;  4CYE A;  3D8D A;  1XD4 A;  4HB4 B;  1BTK A;  4P7I A;  2ROZ B;  1V5U A;  4MT7 A;  2DKQ A;  5KQ1 A;  2XQN M;  2KUP A;  1LB1 A;  4CHM A;  2DX1 A;  1WJM A;  2D4Q A;  2IFS A;  1ZVR A;  2GS0 A;  2ELB A;  1SHC A;  3NSU A;  4MK0 A;  2YS3 A;  4NY0 A;  2D9W A;  2P0H A;  4ZRJ A;  4ZRK A;  1U5G A;  1PFJ A;  2M38 A;  1Y19 B;  1I7A A;  2N0Y A;  3TCA A;  3U8Z A;  2E2X A;  3FM8 C;  4TKN A;  1AWE A;  1U5D A;  1K5D B;  3ML4 A;  2LOX A;  3KY9 A;  5FI1 A;  2J0K A;  3AU4 A;  4HAX B;  5J3Y A;  5KQ4 A;  2ELA A;  1J0W A;  2W2X D;  4IAP A;  2G35 A;  2W2X C;  4YON A;  4KHB B;  3SO6 A;  5HE2 A;  2H7D A;  4HAZ B;  5FI0 A;  2COF A;  2N23 A;  1FHX A;  3A8Q A;  1XR0 B;  2X18 A;  1GC7 A;  2COC A;  4GMV A;  2MWN B;  1NI2 A;  3D8E A;  3WA0 A;  1PLS A;  2NZ8 B;  3DXD A;  2M14 A;  1DRO A;  3SUZ A;  3U7D A;  3F5R A;  4WJ7 A;  4WSF A;  3ODX A;  3P7Z A;  1QC6 A;  5C79 A;  3OAN A;  4K2O A;  5JHH A;  1LW3 A;  3HK0 A;  1I2H A;  1W1D A;  3DXE A;  1W1H A;  1GG3 A;  1DDM A;  4HAU B;  2OTX A;  2LKO A;  1FOE A;  1DBH A;  2I5F A;  1U27 A;  2GCL A;  2EMS A;  5DHF B;  3PEG A;  4HAT B;  1NU2 A;  3X23 A;  2D11 A;  4B6H A;  3BJI A;  1MPH A;  3IVF A;  4KVG B;  4HDQ A;  5D3Y A;  1MK9 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...