1WJMA

Solution structure of pleckstrin homology domain of human beta iii spectrin.
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
123
structure length
123
Chain Sequence
GSSGSSGEQMEGMLCRKQEMEAFGKKAANRSWQNVYCVLRRGSLGFYKDAKAASAGVPYHGEVPVSLARAQGSVAFDYRKRKHVFKLGLQDGKEYLFQAKDEAEMSSWLRVVNAAIASGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords beta-spectrin III
publication title Solution structure of pleckstrin homology domain of human beta III spectrin
rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 17
structure length 123
sequence length 123
ec nomenclature
pdb deposition date 2004-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF15410 PH_9 Pleckstrin homology domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1wjmA00
3ZVRA 4HDQA 3DXDA 1U5DA 3PVUA 1XD4A 4HAUB 4Y94A 1Y5OA 4K2PA 2BCJA 3GYPA 1AQCA 2K00A 4NY0A 2GCJA 2LYDA 2IYBA 1W1DA 4K2OA 3PVWA 3ODXA 5KQ4A 3AU4A 5JLJB 2VRWB 1WVHA 1X11A 2YVCA 2DKQA 2J0MA 2CY4A 2ELAA 1FOEA 1ZVRA 4GMXB 2D9YA 5D3WA 3P6AA 2COFA 3PEGA 2LOZA 4A6KA 1ZSQA 2DX5A 3QBVB 2D2QA 2P0HA 2P8VA 2AL6A 4TYZA 4PNKA 4D0NB 1LW3A 3HW2B 1FGZA 3D8DA 3ODOA 2Q13A 3TO1A 4HDOA 2GS0A 1QQGA 3UZTA 2JP2A 1MIXA 3CXBB 1XX0A 2XQNM 3BINA 2NZ8B 1U5EA 1DYNA 4HAYB 2Y7BA 4GN1A 3ODWA 1N3HA 3MPXA 2KUPA 3D8EA 5FI0A 2J59M 2CY5A 3NSUA 1I2HA 2DA0A 1V89A 2LG1A 2DHKA 5L81A 4KHBB 2EMSA 1H4RA 4HAWB 2D11A 1MKEA 1I7AA 1ZC4B 3CIKA 3HK0A 1GC7A 2R09A 1PMSA 3O96A 2DLWA 1ISNA 2I1KA 2VKIA 2W2XD 5D3VA 2Y8GA 1P6SA 2J0JA 2AEHA 1Y19B 2W2XC 4EKUA 2LKOA 5GOWB 3FSSA 3M1IB 1TQZA 3GYOA 1OMWA 1V5MA 1WJMA 1UPQA 3QWMA 2RUKB 2ZPYA 1WJ1A 2D9ZA 1DDVA 1QC6A 4GXBA 1WI1A 2V76A 3P7ZA 1WGQA 3KY9A 1X86A 4HB3B 2DYNA 1AWEA 2QKMA 1TXDA 3MDBC 5DH9B 1WG7A 3AJ4A 4HAZB 1V61A 5JHGA 2COCA 1U27A 4BBKA 3SO6A 4K81A 3A8PA 3KZ1A 4KVGB 2Z0QA 4ZRKA 4HB0B 4DXAB 5LOPB 1EGXA 3PG7A 2CRFA 2KGXB 1EVHA 2UVMA 1K5GB 1Q67A 1X05A 1ZC3B 2RGNB 3D8FA 4GZUA 5CLLB 3TVVA 5JP4A 5J3QA 1GG3A 3G9WA 1DDWA 1UPRA 2RNRB 1W1HA 1UNRA 4YL8A 1KZ7A 1ZM0A 4DBBA 2W2WA 2HE7A 2L2IA 4IAPA 3U8ZA 2IFSA 1DDMA 2Y8FA 1XCGA 4A5KA 1U5FA 2D9XA 4C0AA 2I5FA 2DX1A 2N23A 3TCAA 1RRPB 3LJUX 2YSZA 2PZ1A 1FB8A 1M7RA 5DHFB 1OY2A 4KAXB 4TKNA 3A8QA 2Z0OA 1V5PA 3PSCA 5KCVA 2YS3A 1B55A 4PQ0A 1UEFA 2RSGA 1PFJA 1P5TA 4DX90 4F7UP 1TJ6A 2YS1A 1IRSA 2YRYA 1NU2A 5KQ1A 1BTKA 3SYXA 5DI9B 1U29A 2L1CA 3TW1A 2CODA 4DX8A 1XR0B 1M7EA 2DHIA 2KCJA 4KHOA 4L6EA 4K17A 5D3YA 3V5WA 2UZRA 5C16A 2EMTA 4HAVB 2H7DA 3IVFA 1MK7B 3ML4A 1EAZA 3QIJA 2EC1A 1WGUA 2OTXA 3VOQA 2DKPA 1E5WA 5HE3A 2P0FA 4NSWA 1U2BA 2K2JA 2Z0PA 5HE2A 2M38A 1H10A 4HATB 2D4QA 3TFMA 4IOYX 2J0KA 4HB2B 2MWNB 2R0DA 4WJ7A 1MIZB 2D9WA 4F7HA 4B6HA 2QKLA 5C5BA 2COAA 4P7IA 4ZRIA 5FI1A 1LB1A 1SHCA 4KHAA 2RVBB 2P0DA 5C79A 3DXEA 1BTNA 4GMVA 3F0WA 1XKEA 3PVLA 3PZDA 4ZRJA 3U7DA 1DBHA 4WSFA 2DN6A 4Z2NA 3F5RA 3SUZA 2G35A 2DTCA 2YF0A 1UNPA 3OANA 4CHMA 2OQBA 1KI1B 4A6HA 2LOXA 5D3XA 1SGHA 5HE0A 5J3YA 5C6RA 2DYQA 4MT7A 2YT1A 2ROVA 2MKRA 1V88A 2LULA 3VIAA 2H7EA 3RCPA 1BWNA 3ZDTA 2K2UA 3AU5A 5D27A 1MPHA 4A6FB 2ADZA 3X23A 1U5GA 2EJ8A 3SV1A 4YONA 3HQCA 2UZSA 2N0YA 1FHOA 3A98B 1X1GA 2YS5A 5DHAB 3KRWA 1XODA 4IFSA 4A6FA 2HTHB 2YT0A 3PP2A 2MDXA 5HE1A 4GPTB 2M14A 3DXCA 2DHJA 1W1GA 1FHXA 3KRXA 1FGYA 4H8SA 2FJLA 4HB4B 1NTVA 1MAIA 2I5CA 4MK0A 1FAOA 4HHVA 3FM8C 3WA0A 4CHJA 5JHHA 3WYFB 2DFKA 2ROZB 1EF1A 2CAYA 2ELBA 3SNHA 1GC6A 4MY6A 4F7GA 4XWXA 2RLOA 1J0WA 2GCLA 1PLSA 1NTYA 3N7CA 1FHWA 1BAKA 5C5BB 1P3RA 2E2XA 2GJYA 2VSZA 4EMOA 5DIFB 1K5DB 1V5UA 1J19A 1KZGA 2D9VA 4EJNA 2NMBA 2D10A 2MFQA 3BJIA 5J3TA 3ULCA 4HAXB 5EFXA 3KSYA 2I1JA 3FEHA 3ULBA 4WVFB 5LONB 3T06A 1X1FA 1MK9B 1OQNA 5CLQB 1UNQA 1NI2A 1DROA 1RJ2A 4CYEA 1Z87A 4Z2MB 2X18A
chains in the Genus database with same CATH superfamily
3ZVRA 4HDQA 3DXDA 1U5DA 3PVUA 1XD4A 4HAUB 4Y94A 1Y5OA 4K2PA 2BCJA 3GYPA 1AQCA 2K00A 3NWAA 4NY0A 2GCJA 2LYDA 4QJ4B 2IYBA 1W1DA 4K2OA 3PVWA 3ODXA 5KQ4A 3AU4A 5JLJB 2VRWB 1WVHA 1X11A 2YVCA 2DKQA 2J0MA 2CY4A 2ELAA 1FOEA 3B77A 1ZVRA 4GMXB 2D9YA 5D3WA 3P6AA 2COFA 2Z4DA 3PEGA 2LOZA 4A6KA 1ZSQA 2DX5A 3QBVB 3NWDA 2D2QA 2P0HA 2P8VA 2AL6A 4TYZA 4PNKA 4D0NB 1LW3A 3HW2B 1FGZA 3D8DA 3ODOA 2Q13A 3TO1A 4HDOA 2KIEA 4HSIA 2GS0A 1QQGA 3UZTA 2JP2A 1MIXA 3CXBB 1XX0A 2XQNM 3BINA 2NZ8B 1U5EA 1DYNA 4HAYB 2Y7BA 4GN1A 3ODWA 1N3HA 3MPXA 2KUPA 3D8EA 5FI0A 2J59M 2CY5A 3HSAA 3NSUA 1I2HA 2DA0A 1V89A 2LG1A 2DHKA 5L81A 4KHBB 2EMSA 1H4RA 4HAWB 2D11A 1MKEA 1I7AA 1ZC4B 3CIKA 3HK0A 1GC7A 2R09A 2KR0A 1PMSA 3O96A 2DLWA 1ISNA 2I1KA 2VKIA 2W2XD 3OHMB 4KHBA 5D3VA 2Y8GA 1P6SA 2J0JA 2AEHA 1Y19B 5M4YB 2W2XC 4EKUA 2LKOA 5GOWB 3FSSA 4DIXA 3M1IB 1TQZA 4CSQA 3GYOA 1OMWA 1V5MA 1WJMA 1UPQA 3QWMA 2RUKB 2ZPYA 1WJ1A 2D9ZA 1DDVA 1QC6A 4GXBA 1WI1A 4GNKB 2V76A 3P7ZA 1WGQA 3KY9A 1X86A 4HB3B 2DYNA 1AWEA 2QKMA 1TXDA 3MDBC 5DH9B 1WG7A 3AJ4A 4HAZB 1V61A 5JHGA 2COCA 1U27A 2Z59A 4BBKA 3SO6A 4K81A 3A8PA 3KZ1A 4KVGB 2Z0QA 4ZRKA 4HB0B 3HIEA 4DXAB 2K49A 5LOPB 1EGXA 3PG7A 4GOUA 2CRFA 2KGXB 1EVHA 2UVMA 4QJ3B 1K5GB 1Q67A 1X05A 1ZC3B 2RGNB 3D8FA 4GZUA 5CLLB 3TVVA 5JP4A 5J3QA 1GG3A 3G9WA 1DDWA 1UPRA 2RNRB 1W1HA 1UNRA 1T77A 4YL8A 1KZ7A 1ZM0A 4DBBA 2W2WA 2HE7A 5I2MA 2L2IA 4IAPA 3U8ZA 2IFSA 1DDMA 2Y8FA 1XCGA 4A5KA 1U5FA 2D9XA 4QXAB 4C0AA 2I5FA 2DX1A 2N23A 3TCAA 2NBVA 1RRPB 3LJUX 2YSZA 2PZ1A 2RRFA 1FB8A 1M7RA 5DHFB 1OY2A 4KAXB 4TKNA 3A8QA 2Z0OA 1V5PA 3PSCA 5KCVA 2YS3A 1B55A 4PQ0A 1UEFA 2RSGA 1PFJA 1P5TA 3U12A 4DX90 4F7UP 1TJ6A 2YS1A 1IRSA 2YRYA 1NU2A 5KQ1A 1BTKA 3SYXA 5DI9B 1U29A 2L1CA 3TW1A 2CODA 4DX8A 2ZKMX 1XR0B 2GUMA 1M7EA 2DHIA 2KCJA 4KHOA 4L6EA 4K17A 5D3YA 3V5WA 2UZRA 2YT2A 2EMTA 4HAVB 5C16A 2H7DA 3IVFA 1MK7B 3ML4A 1EAZA 3QIJA 2K8EA 2EC1A 1WGUA 2OTXA 3VOQA 2DKPA 1E5WA 5HE3A 2P0FA 4NSWA 1U2BA 2K2JA 2Z0PA 3DCXA 5HE2A 2M38A 5IRSA 1H10A 4HATB 2D4QA 3TFMA 4IOYX 2J0KA 4HB2B 5I2SA 2MWNB 2R0DA 4WJ7A 1MIZB 2D9WA 4F7HA 4B6HA 2QKLA 5C5BA 2COAA 4P7IA 4ZRIA 5FI1A 1LB1A 1SHCA 4KHAA 2RVBB 2P0DA 5C79A 3DXEA 1BTNA 4GMVA 3F0WA 1XKEA 3PVLA 3PZDA 4ZRJA 3U7DA 1DBHA 4WSFA 2DN6A 4Z2NA 2KUQA 4L1RA 3F5RA 3SUZA 2G35A 2DTCA 2YF0A 1UNPA 3OANA 4CHMA 2OQBA 1KI1B 4A6HA 2LOXA 5D3XA 1SGHA 5HE0A 5J3YA 5C6RA 2DYQA 4MT7A 2YT1A 2ROVA 2MKRA 1V88A 3A58A 2Z14A 2LULA 3VIAA 2H7EA 3RCPA 1BWNA 3ZDTA 2K2UA 3AU5A 5D27A 1MPHA 4A6FB 3FVCA 2ADZA 3X23A 1U5GA 2EJ8A 3SV1A 4YONA 3HQCA 2UZSA 2N0YA 4QJ5B 3NW8A 1FHOA 2Z13A 3A98B 1X1GA 2YS5A 5DHAB 3KRWA 1XODA 4IFSA 4A6FA 2HTHB 2YT0A 3PP2A 2MDXA 5HE1A 4GPTB 2M14A 3DXCA 2DHJA 1W1GA 1FHXA 3KRXA 1FGYA 4H8SA 2FJLA 4HB4B 1NTVA 1MAIA 2I5CA 4MK0A 3NWFA 1FAOA 4HHVA 3FM8C 3WA0A 4CHJA 5JHHA 5LG4B 2R2YA 3WYFB 2DFKA 2ROZB 1EF1A 2CAYA 2ELBA 3SNHA 1GC6A 2FJUB 2KIGA 4MY6A 4F7GA 4XWXA 2RLOA 1J0WA 2GCLA 1PLSA 1NTYA 3N7CA 1FHWA 4OSNA 1BAKA 5C5BB 1P3RA 2E2XA 2GJYA 2VSZA 4EMOA 5DIFB 1K5DB 1V5UA 1J19A 1KZGA 1MI1A 2D9VA 4EJNA 1ZYIA 2NMBA 2D10A 2MFQA 3BJIA 5J3TA 3ULCA 4HAXB 5EFXA 3KSYA 2I1JA 3FEHA 3ULBA 4WVFB 5LONB 3T06A 1X1FA 4D6WA 1MK9B 1OQNA 5CLQB 1UNQA 1NI2A 1DROA 1RJ2A 4CYEA 1Z87A 4Z2MB 2X18A 4OT1A
chains in the Genus database with same CATH topology
3ZVRA 4HDQA 3DXDA 1U5DA 3PVUA 1XD4A 4HAUB 4Y94A 1Y5OA 4K2PA 2BCJA 3GYPA 1AQCA 2K00A 4NY0A 2GCJA 2LYDA 2IYBA 1W1DA 4K2OA 3PVWA 3ODXA 5KQ4A 3AU4A 5JLJB 2VRWB 1WVHA 1X11A 2YVCA 2DKQA 2J0MA 2CY4A 2ELAA 1FOEA 1ZVRA 4GMXB 2D9YA 5D3WA 3P6AA 2COFA 3PEGA 2LOZA 4A6KA 1ZSQA 2DX5A 3QBVB 2D2QA 2P0HA 2P8VA 2AL6A 4TYZA 4PNKA 4D0NB 1LW3A 3HW2B 1FGZA 3D8DA 3ODOA 2Q13A 3TO1A 4HDOA 2GS0A 1QQGA 3UZTA 2JP2A 1MIXA 3CXBB 1XX0A 2XQNM 3BINA 2NZ8B 1U5EA 1DYNA 4HAYB 2Y7BA 4GN1A 3ODWA 1N3HA 3MPXA 2KUPA 3D8EA 5FI0A 2J59M 2CY5A 3NSUA 1I2HA 2DA0A 1V89A 2LG1A 2DHKA 5L81A 4KHBB 2EMSA 1H4RA 4HAWB 2D11A 1MKEA 1I7AA 1ZC4B 3CIKA 3HK0A 1GC7A 2R09A 1PMSA 3O96A 2DLWA 1ISNA 2I1KA 2VKIA 2W2XD 5D3VA 2Y8GA 1P6SA 2J0JA 2AEHA 1Y19B 2W2XC 4EKUA 2LKOA 5GOWB 3FSSA 3M1IB 1TQZA 3GYOA 1OMWA 1V5MA 1WJMA 1UPQA 3QWMA 2RUKB 2ZPYA 1WJ1A 2D9ZA 1DDVA 1QC6A 4GXBA 1WI1A 2V76A 3P7ZA 1WGQA 3KY9A 1X86A 4HB3B 2DYNA 1AWEA 2QKMA 1TXDA 3MDBC 5DH9B 1WG7A 3AJ4A 4HAZB 1V61A 5JHGA 2COCA 1U27A 4BBKA 3SO6A 4K81A 3A8PA 3KZ1A 4KVGB 2Z0QA 4ZRKA 4HB0B 4DXAB 5LOPB 1EGXA 3PG7A 2CRFA 2KGXB 1EVHA 2UVMA 1K5GB 1Q67A 1X05A 1ZC3B 2RGNB 3D8FA 4GZUA 5CLLB 3TVVA 5JP4A 5J3QA 1GG3A 3G9WA 1DDWA 1UPRA 2RNRB 1W1HA 1UNRA 4YL8A 1KZ7A 1ZM0A 4DBBA 2W2WA 2HE7A 2L2IA 4IAPA 3U8ZA 2IFSA 1DDMA 2Y8FA 1XCGA 4A5KA 1U5FA 2D9XA 4C0AA 2I5FA 2DX1A 2N23A 3TCAA 1RRPB 3LJUX 2YSZA 2PZ1A 1FB8A 1M7RA 5DHFB 1OY2A 4KAXB 4TKNA 3A8QA 2Z0OA 1V5PA 3PSCA 5KCVA 2YS3A 1B55A 4PQ0A 1UEFA 2RSGA 1PFJA 1P5TA 4DX90 4F7UP 1TJ6A 2YS1A 1IRSA 2YRYA 1NU2A 5KQ1A 1BTKA 3SYXA 5DI9B 1U29A 2L1CA 3TW1A 2CODA 4DX8A 1XR0B 1M7EA 2DHIA 2KCJA 4KHOA 4L6EA 4K17A 5D3YA 3V5WA 2UZRA 5C16A 2EMTA 4HAVB 2H7DA 3IVFA 1MK7B 3ML4A 1EAZA 3QIJA 2EC1A 1WGUA 2OTXA 3VOQA 2DKPA 1E5WA 5HE3A 2P0FA 4NSWA 1U2BA 2K2JA 2Z0PA 5HE2A 2M38A 1H10A 4HATB 2D4QA 3TFMA 4IOYX 2J0KA 4HB2B 2MWNB 2R0DA 4WJ7A 1MIZB 2D9WA 4F7HA 4B6HA 2QKLA 5C5BA 2COAA 4P7IA 4ZRIA 5FI1A 1LB1A 1SHCA 4KHAA 2RVBB 2P0DA 5C79A 3DXEA 1BTNA 4GMVA 3F0WA 1XKEA 3PVLA 3PZDA 4ZRJA 3U7DA 1DBHA 4WSFA 2DN6A 4Z2NA 3F5RA 3SUZA 2G35A 2DTCA 2YF0A 1UNPA 3OANA 4CHMA 2OQBA 1KI1B 4A6HA 2LOXA 5D3XA 1SGHA 5HE0A 5J3YA 5C6RA 2DYQA 4MT7A 2YT1A 2ROVA 2MKRA 1V88A 2LULA 3VIAA 2H7EA 3RCPA 1BWNA 3ZDTA 2K2UA 3AU5A 5D27A 1MPHA 4A6FB 2ADZA 3X23A 1U5GA 2EJ8A 3SV1A 4YONA 3HQCA 2UZSA 2N0YA 1FHOA 3A98B 1X1GA 2YS5A 5DHAB 3KRWA 1XODA 4IFSA 4A6FA 2HTHB 2YT0A 3PP2A 2MDXA 5HE1A 4GPTB 2M14A 3DXCA 2DHJA 1W1GA 1FHXA 3KRXA 1FGYA 4H8SA 2FJLA 4HB4B 1NTVA 1MAIA 2I5CA 4MK0A 1FAOA 4HHVA 3FM8C 3WA0A 4CHJA 5JHHA 3WYFB 2DFKA 2ROZB 1EF1A 2CAYA 2ELBA 3SNHA 1GC6A 4MY6A 4F7GA 4XWXA 2RLOA 1J0WA 2GCLA 1PLSA 1NTYA 3N7CA 1FHWA 1BAKA 5C5BB 1P3RA 2E2XA 2GJYA 2VSZA 4EMOA 5DIFB 1K5DB 1V5UA 1J19A 1KZGA 2D9VA 4EJNA 2NMBA 2D10A 2MFQA 3BJIA 5J3TA 3ULCA 4HAXB 5EFXA 3KSYA 2I1JA 3FEHA 3ULBA 4WVFB 5LONB 3T06A 1X1FA 1MK9B 1OQNA 5CLQB 1UNQA 1NI2A 1DROA 1RJ2A 4CYEA 1Z87A 4Z2MB 2X18A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZVR A;  4HDQ A;  3DXD A;  1U5D A;  3PVU A;  1XD4 A;  4HAU B;  4Y94 A;  1Y5O A;  4K2P A;  2BCJ A;  3GYP A;  1AQC A;  2K00 A;  4NY0 A;  2GCJ A;  2LYD A;  2IYB A;  1W1D A;  4K2O A;  3PVW A;  3ODX A;  5KQ4 A;  3AU4 A;  5JLJ B;  2VRW B;  1WVH A;  1X11 A;  2YVC A;  2DKQ A;  2J0M A;  2CY4 A;  2ELA A;  1FOE A;  1ZVR A;  4GMX B;  2D9Y A;  5D3W A;  3P6A A;  2COF A;  3PEG A;  2LOZ A;  4A6K A;  1ZSQ A;  2DX5 A;  3QBV B;  2D2Q A;  2P0H A;  2P8V A;  2AL6 A;  4TYZ A;  4PNK A;  4D0N B;  1LW3 A;  3HW2 B;  1FGZ A;  3D8D A;  3ODO A;  2Q13 A;  3TO1 A;  4HDO A;  2GS0 A;  1QQG A;  3UZT A;  2JP2 A;  1MIX A;  3CXB B;  1XX0 A;  2XQN M;  3BIN A;  2NZ8 B;  1U5E A;  1DYN A;  4HAY B;  2Y7B A;  4GN1 A;  3ODW A;  1N3H A;  3MPX A;  2KUP A;  3D8E A;  5FI0 A;  2J59 M;  2CY5 A;  3NSU A;  1I2H A;  2DA0 A;  1V89 A;  2LG1 A;  2DHK A;  5L81 A;  4KHB B;  2EMS A;  1H4R A;  4HAW B;  2D11 A;  1MKE A;  1I7A A;  1ZC4 B;  3CIK A;  3HK0 A;  1GC7 A;  2R09 A;  1PMS A;  3O96 A;  2DLW A;  1ISN A;  2I1K A;  2VKI A;  2W2X D;  5D3V A;  2Y8G A;  1P6S A;  2J0J A;  2AEH A;  1Y19 B;  2W2X C;  4EKU A;  2LKO A;  5GOW B;  3FSS A;  3M1I B;  1TQZ A;  3GYO A;  1OMW A;  1V5M A;  1WJM A;  1UPQ A;  3QWM A;  2RUK B;  2ZPY A;  1WJ1 A;  2D9Z A;  1DDV A;  1QC6 A;  4GXB A;  1WI1 A;  2V76 A;  3P7Z A;  1WGQ A;  3KY9 A;  1X86 A;  4HB3 B;  2DYN A;  1AWE A;  2QKM A;  1TXD A;  3MDB C;  5DH9 B;  1WG7 A;  3AJ4 A;  4HAZ B;  1V61 A;  5JHG A;  2COC A;  1U27 A;  4BBK A;  3SO6 A;  4K81 A;  3A8P A;  3KZ1 A;  4KVG B;  2Z0Q A;  4ZRK A;  4HB0 B;  4DXA B;  5LOP B;  1EGX A;  3PG7 A;  2CRF A;  2KGX B;  1EVH A;  2UVM A;  1K5G B;  1Q67 A;  1X05 A;  1ZC3 B;  2RGN B;  3D8F A;  4GZU A;  5CLL B;  3TVV A;  5JP4 A;  5J3Q A;  1GG3 A;  3G9W A;  1DDW A;  1UPR A;  2RNR B;  1W1H A;  1UNR A;  4YL8 A;  1KZ7 A;  1ZM0 A;  4DBB A;  2W2W A;  2HE7 A;  2L2I A;  4IAP A;  3U8Z A;  2IFS A;  1DDM A;  2Y8F A;  1XCG A;  4A5K A;  1U5F A;  2D9X A;  4C0A A;  2I5F A;  2DX1 A;  2N23 A;  3TCA A;  1RRP B;  3LJU X;  2YSZ A;  2PZ1 A;  1FB8 A;  1M7R A;  5DHF B;  1OY2 A;  4KAX B;  4TKN A;  3A8Q A;  2Z0O A;  1V5P A;  3PSC A;  5KCV A;  2YS3 A;  1B55 A;  4PQ0 A;  1UEF A;  2RSG A;  1PFJ A;  1P5T A;  4DX9 0;  4F7U P;  1TJ6 A;  2YS1 A;  1IRS A;  2YRY A;  1NU2 A;  5KQ1 A;  1BTK A;  3SYX A;  5DI9 B;  1U29 A;  2L1C A;  3TW1 A;  2COD A;  4DX8 A;  1XR0 B;  1M7E A;  2DHI A;  2KCJ A;  4KHO A;  4L6E A;  4K17 A;  5D3Y A;  3V5W A;  2UZR A;  5C16 A;  2EMT A;  4HAV B;  2H7D A;  3IVF A;  1MK7 B;  3ML4 A;  1EAZ A;  3QIJ A;  2EC1 A;  1WGU A;  2OTX A;  3VOQ A;  2DKP A;  1E5W A;  5HE3 A;  2P0F A;  4NSW A;  1U2B A;  2K2J A;  2Z0P A;  5HE2 A;  2M38 A;  1H10 A;  4HAT B;  2D4Q A;  3TFM A;  4IOY X;  2J0K A;  4HB2 B;  2MWN B;  2R0D A;  4WJ7 A;  1MIZ B;  2D9W A;  4F7H A;  4B6H A;  2QKL A;  5C5B A;  2COA A;  4P7I A;  4ZRI A;  5FI1 A;  1LB1 A;  1SHC A;  4KHA A;  2RVB B;  2P0D A;  5C79 A;  3DXE A;  1BTN A;  4GMV A;  3F0W A;  1XKE A;  3PVL A;  3PZD A;  4ZRJ A;  3U7D A;  1DBH A;  4WSF A;  2DN6 A;  4Z2N A;  3F5R A;  3SUZ A;  2G35 A;  2DTC A;  2YF0 A;  1UNP A;  3OAN A;  4CHM A;  2OQB A;  1KI1 B;  4A6H A;  2LOX A;  5D3X A;  1SGH A;  5HE0 A;  5J3Y A;  5C6R A;  2DYQ A;  4MT7 A;  2YT1 A;  2ROV A;  2MKR A;  1V88 A;  2LUL A;  3VIA A;  2H7E A;  3RCP A;  1BWN A;  3ZDT A;  2K2U A;  3AU5 A;  5D27 A;  1MPH A;  4A6F B;  2ADZ A;  3X23 A;  1U5G A;  2EJ8 A;  3SV1 A;  4YON A;  3HQC A;  2UZS A;  2N0Y A;  1FHO A;  3A98 B;  1X1G A;  2YS5 A;  5DHA B;  3KRW A;  1XOD A;  4IFS A;  4A6F A;  2HTH B;  2YT0 A;  3PP2 A;  2MDX A;  5HE1 A;  4GPT B;  2M14 A;  3DXC A;  2DHJ A;  1W1G A;  1FHX A;  3KRX A;  1FGY A;  4H8S A;  2FJL A;  4HB4 B;  1NTV A;  1MAI A;  2I5C A;  4MK0 A;  1FAO A;  4HHV A;  3FM8 C;  3WA0 A;  4CHJ A;  5JHH A;  3WYF B;  2DFK A;  2ROZ B;  1EF1 A;  2CAY A;  2ELB A;  3SNH A;  1GC6 A;  4MY6 A;  4F7G A;  4XWX A;  2RLO A;  1J0W A;  2GCL A;  1PLS A;  1NTY A;  3N7C A;  1FHW A;  1BAK A;  5C5B B;  1P3R A;  2E2X A;  2GJY A;  2VSZ A;  4EMO A;  5DIF B;  1K5D B;  1V5U A;  1J19 A;  1KZG A;  2D9V A;  4EJN A;  2NMB A;  2D10 A;  2MFQ A;  3BJI A;  5J3T A;  3ULC A;  4HAX B;  5EFX A;  3KSY A;  2I1J A;  3FEH A;  3ULB A;  4WVF B;  5LON B;  3T06 A;  1X1F A;  1MK9 B;  1OQN A;  5CLQ B;  1UNQ A;  1NI2 A;  1DRO A;  1RJ2 A;  4CYE A;  1Z87 A;  4Z2M B;  2X18 A; 
#chains in the Genus database with same CATH topology
 3ZVR A;  4HDQ A;  3DXD A;  1U5D A;  3PVU A;  1XD4 A;  4HAU B;  4Y94 A;  1Y5O A;  4K2P A;  2BCJ A;  3GYP A;  1AQC A;  2K00 A;  3NWA A;  4NY0 A;  2GCJ A;  2LYD A;  4QJ4 B;  2IYB A;  1W1D A;  4K2O A;  3PVW A;  3ODX A;  5KQ4 A;  3AU4 A;  5JLJ B;  2VRW B;  1WVH A;  1X11 A;  2YVC A;  2DKQ A;  2J0M A;  2CY4 A;  2ELA A;  1FOE A;  3B77 A;  1ZVR A;  4GMX B;  2D9Y A;  5D3W A;  3P6A A;  2COF A;  2Z4D A;  3PEG A;  2LOZ A;  4A6K A;  1ZSQ A;  2DX5 A;  3QBV B;  3NWD A;  2D2Q A;  2P0H A;  2P8V A;  2AL6 A;  4TYZ A;  4PNK A;  4D0N B;  1LW3 A;  3HW2 B;  1FGZ A;  3D8D A;  3ODO A;  2Q13 A;  3TO1 A;  4HDO A;  2KIE A;  4HSI A;  2GS0 A;  1QQG A;  3UZT A;  2JP2 A;  1MIX A;  3CXB B;  1XX0 A;  2XQN M;  3BIN A;  2NZ8 B;  1U5E A;  1DYN A;  4HAY B;  2Y7B A;  4GN1 A;  3ODW A;  1N3H A;  3MPX A;  2KUP A;  3D8E A;  5FI0 A;  2J59 M;  2CY5 A;  3HSA A;  3NSU A;  1I2H A;  2DA0 A;  1V89 A;  2LG1 A;  2DHK A;  5L81 A;  4KHB B;  2EMS A;  1H4R A;  4HAW B;  2D11 A;  1MKE A;  1I7A A;  1ZC4 B;  3CIK A;  3HK0 A;  1GC7 A;  2R09 A;  2KR0 A;  1PMS A;  3O96 A;  2DLW A;  1ISN A;  2I1K A;  2VKI A;  2W2X D;  3OHM B;  4KHB A;  5D3V A;  2Y8G A;  1P6S A;  2J0J A;  2AEH A;  1Y19 B;  5M4Y B;  2W2X C;  4EKU A;  2LKO A;  5GOW B;  3FSS A;  4DIX A;  3M1I B;  1TQZ A;  4CSQ A;  3GYO A;  1OMW A;  1V5M A;  1WJM A;  1UPQ A;  3QWM A;  2RUK B;  2ZPY A;  1WJ1 A;  2D9Z A;  1DDV A;  1QC6 A;  4GXB A;  1WI1 A;  4GNK B;  2V76 A;  3P7Z A;  1WGQ A;  3KY9 A;  1X86 A;  4HB3 B;  2DYN A;  1AWE A;  2QKM A;  1TXD A;  3MDB C;  5DH9 B;  1WG7 A;  3AJ4 A;  4HAZ B;  1V61 A;  5JHG A;  2COC A;  1U27 A;  2Z59 A;  4BBK A;  3SO6 A;  4K81 A;  3A8P A;  3KZ1 A;  4KVG B;  2Z0Q A;  4ZRK A;  4HB0 B;  3HIE A;  4DXA B;  2K49 A;  5LOP B;  1EGX A;  3PG7 A;  4GOU A;  2CRF A;  2KGX B;  1EVH A;  2UVM A;  4QJ3 B;  1K5G B;  1Q67 A;  1X05 A;  1ZC3 B;  2RGN B;  3D8F A;  4GZU A;  5CLL B;  3TVV A;  5JP4 A;  5J3Q A;  1GG3 A;  3G9W A;  1DDW A;  1UPR A;  2RNR B;  1W1H A;  1UNR A;  1T77 A;  4YL8 A;  1KZ7 A;  1ZM0 A;  4DBB A;  2W2W A;  2HE7 A;  5I2M A;  2L2I A;  4IAP A;  3U8Z A;  2IFS A;  1DDM A;  2Y8F A;  1XCG A;  4A5K A;  1U5F A;  2D9X A;  4QXA B;  4C0A A;  2I5F A;  2DX1 A;  2N23 A;  3TCA A;  2NBV A;  1RRP B;  3LJU X;  2YSZ A;  2PZ1 A;  2RRF A;  1FB8 A;  1M7R A;  5DHF B;  1OY2 A;  4KAX B;  4TKN A;  3A8Q A;  2Z0O A;  1V5P A;  3PSC A;  5KCV A;  2YS3 A;  1B55 A;  4PQ0 A;  1UEF A;  2RSG A;  1PFJ A;  1P5T A;  3U12 A;  4DX9 0;  4F7U P;  1TJ6 A;  2YS1 A;  1IRS A;  2YRY A;  1NU2 A;  5KQ1 A;  1BTK A;  3SYX A;  5DI9 B;  1U29 A;  2L1C A;  3TW1 A;  2COD A;  4DX8 A;  2ZKM X;  1XR0 B;  2GUM A;  1M7E A;  2DHI A;  2KCJ A;  4KHO A;  4L6E A;  4K17 A;  5D3Y A;  3V5W A;  2UZR A;  2YT2 A;  2EMT A;  4HAV B;  5C16 A;  2H7D A;  3IVF A;  1MK7 B;  3ML4 A;  1EAZ A;  3QIJ A;  2K8E A;  2EC1 A;  1WGU A;  2OTX A;  3VOQ A;  2DKP A;  1E5W A;  5HE3 A;  2P0F A;  4NSW A;  1U2B A;  2K2J A;  2Z0P A;  3DCX A;  5HE2 A;  2M38 A;  5IRS A;  1H10 A;  4HAT B;  2D4Q A;  3TFM A;  4IOY X;  2J0K A;  4HB2 B;  5I2S A;  2MWN B;  2R0D A;  4WJ7 A;  1MIZ B;  2D9W A;  4F7H A;  4B6H A;  2QKL A;  5C5B A;  2COA A;  4P7I A;  4ZRI A;  5FI1 A;  1LB1 A;  1SHC A;  4KHA A;  2RVB B;  2P0D A;  5C79 A;  3DXE A;  1BTN A;  4GMV A;  3F0W A;  1XKE A;  3PVL A;  3PZD A;  4ZRJ A;  3U7D A;  1DBH A;  4WSF A;  2DN6 A;  4Z2N A;  2KUQ A;  4L1R A;  3F5R A;  3SUZ A;  2G35 A;  2DTC A;  2YF0 A;  1UNP A;  3OAN A;  4CHM A;  2OQB A;  1KI1 B;  4A6H A;  2LOX A;  5D3X A;  1SGH A;  5HE0 A;  5J3Y A;  5C6R A;  2DYQ A;  4MT7 A;  2YT1 A;  2ROV A;  2MKR A;  1V88 A;  3A58 A;  2Z14 A;  2LUL A;  3VIA A;  2H7E A;  3RCP A;  1BWN A;  3ZDT A;  2K2U A;  3AU5 A;  5D27 A;  1MPH A;  4A6F B;  3FVC A;  2ADZ A;  3X23 A;  1U5G A;  2EJ8 A;  3SV1 A;  4YON A;  3HQC A;  2UZS A;  2N0Y A;  4QJ5 B;  3NW8 A;  1FHO A;  2Z13 A;  3A98 B;  1X1G A;  2YS5 A;  5DHA B;  3KRW A;  1XOD A;  4IFS A;  4A6F A;  2HTH B;  2YT0 A;  3PP2 A;  2MDX A;  5HE1 A;  4GPT B;  2M14 A;  3DXC A;  2DHJ A;  1W1G A;  1FHX A;  3KRX A;  1FGY A;  4H8S A;  2FJL A;  4HB4 B;  1NTV A;  1MAI A;  2I5C A;  4MK0 A;  3NWF A;  1FAO A;  4HHV A;  3FM8 C;  3WA0 A;  4CHJ A;  5JHH A;  5LG4 B;  2R2Y A;  3WYF B;  2DFK A;  2ROZ B;  1EF1 A;  2CAY A;  2ELB A;  3SNH A;  1GC6 A;  2FJU B;  2KIG A;  4MY6 A;  4F7G A;  4XWX A;  2RLO A;  1J0W A;  2GCL A;  1PLS A;  1NTY A;  3N7C A;  1FHW A;  4OSN A;  1BAK A;  5C5B B;  1P3R A;  2E2X A;  2GJY A;  2VSZ A;  4EMO A;  5DIF B;  1K5D B;  1V5U A;  1J19 A;  1KZG A;  1MI1 A;  2D9V A;  4EJN A;  1ZYI A;  2NMB A;  2D10 A;  2MFQ A;  3BJI A;  5J3T A;  3ULC A;  4HAX B;  5EFX A;  3KSY A;  2I1J A;  3FEH A;  3ULB A;  4WVF B;  5LON B;  3T06 A;  1X1F A;  4D6W A;  1MK9 B;  1OQN A;  5CLQ B;  1UNQ A;  1NI2 A;  1DRO A;  1RJ2 A;  4CYE A;  1Z87 A;  4Z2M B;  2X18 A;  4OT1 A; 
#chains in the Genus database with same CATH homology
 3ZVR A;  4HDQ A;  3DXD A;  1U5D A;  3PVU A;  1XD4 A;  4HAU B;  4Y94 A;  1Y5O A;  4K2P A;  2BCJ A;  3GYP A;  1AQC A;  2K00 A;  4NY0 A;  2GCJ A;  2LYD A;  2IYB A;  1W1D A;  4K2O A;  3PVW A;  3ODX A;  5KQ4 A;  3AU4 A;  5JLJ B;  2VRW B;  1WVH A;  1X11 A;  2YVC A;  2DKQ A;  2J0M A;  2CY4 A;  2ELA A;  1FOE A;  1ZVR A;  4GMX B;  2D9Y A;  5D3W A;  3P6A A;  2COF A;  3PEG A;  2LOZ A;  4A6K A;  1ZSQ A;  2DX5 A;  3QBV B;  2D2Q A;  2P0H A;  2P8V A;  2AL6 A;  4TYZ A;  4PNK A;  4D0N B;  1LW3 A;  3HW2 B;  1FGZ A;  3D8D A;  3ODO A;  2Q13 A;  3TO1 A;  4HDO A;  2GS0 A;  1QQG A;  3UZT A;  2JP2 A;  1MIX A;  3CXB B;  1XX0 A;  2XQN M;  3BIN A;  2NZ8 B;  1U5E A;  1DYN A;  4HAY B;  2Y7B A;  4GN1 A;  3ODW A;  1N3H A;  3MPX A;  2KUP A;  3D8E A;  5FI0 A;  2J59 M;  2CY5 A;  3NSU A;  1I2H A;  2DA0 A;  1V89 A;  2LG1 A;  2DHK A;  5L81 A;  4KHB B;  2EMS A;  1H4R A;  4HAW B;  2D11 A;  1MKE A;  1I7A A;  1ZC4 B;  3CIK A;  3HK0 A;  1GC7 A;  2R09 A;  1PMS A;  3O96 A;  2DLW A;  1ISN A;  2I1K A;  2VKI A;  2W2X D;  5D3V A;  2Y8G A;  1P6S A;  2J0J A;  2AEH A;  1Y19 B;  2W2X C;  4EKU A;  2LKO A;  5GOW B;  3FSS A;  3M1I B;  1TQZ A;  3GYO A;  1OMW A;  1V5M A;  1WJM A;  1UPQ A;  3QWM A;  2RUK B;  2ZPY A;  1WJ1 A;  2D9Z A;  1DDV A;  1QC6 A;  4GXB A;  1WI1 A;  2V76 A;  3P7Z A;  1WGQ A;  3KY9 A;  1X86 A;  4HB3 B;  2DYN A;  1AWE A;  2QKM A;  1TXD A;  3MDB C;  5DH9 B;  1WG7 A;  3AJ4 A;  4HAZ B;  1V61 A;  5JHG A;  2COC A;  1U27 A;  4BBK A;  3SO6 A;  4K81 A;  3A8P A;  3KZ1 A;  4KVG B;  2Z0Q A;  4ZRK A;  4HB0 B;  4DXA B;  5LOP B;  1EGX A;  3PG7 A;  2CRF A;  2KGX B;  1EVH A;  2UVM A;  1K5G B;  1Q67 A;  1X05 A;  1ZC3 B;  2RGN B;  3D8F A;  4GZU A;  5CLL B;  3TVV A;  5JP4 A;  5J3Q A;  1GG3 A;  3G9W A;  1DDW A;  1UPR A;  2RNR B;  1W1H A;  1UNR A;  4YL8 A;  1KZ7 A;  1ZM0 A;  4DBB A;  2W2W A;  2HE7 A;  2L2I A;  4IAP A;  3U8Z A;  2IFS A;  1DDM A;  2Y8F A;  1XCG A;  4A5K A;  1U5F A;  2D9X A;  4C0A A;  2I5F A;  2DX1 A;  2N23 A;  3TCA A;  1RRP B;  3LJU X;  2YSZ A;  2PZ1 A;  1FB8 A;  1M7R A;  5DHF B;  1OY2 A;  4KAX B;  4TKN A;  3A8Q A;  2Z0O A;  1V5P A;  3PSC A;  5KCV A;  2YS3 A;  1B55 A;  4PQ0 A;  1UEF A;  2RSG A;  1PFJ A;  1P5T A;  4DX9 0;  4F7U P;  1TJ6 A;  2YS1 A;  1IRS A;  2YRY A;  1NU2 A;  5KQ1 A;  1BTK A;  3SYX A;  5DI9 B;  1U29 A;  2L1C A;  3TW1 A;  2COD A;  4DX8 A;  1XR0 B;  1M7E A;  2DHI A;  2KCJ A;  4KHO A;  4L6E A;  4K17 A;  5D3Y A;  3V5W A;  2UZR A;  5C16 A;  2EMT A;  4HAV B;  2H7D A;  3IVF A;  1MK7 B;  3ML4 A;  1EAZ A;  3QIJ A;  2EC1 A;  1WGU A;  2OTX A;  3VOQ A;  2DKP A;  1E5W A;  5HE3 A;  2P0F A;  4NSW A;  1U2B A;  2K2J A;  2Z0P A;  5HE2 A;  2M38 A;  1H10 A;  4HAT B;  2D4Q A;  3TFM A;  4IOY X;  2J0K A;  4HB2 B;  2MWN B;  2R0D A;  4WJ7 A;  1MIZ B;  2D9W A;  4F7H A;  4B6H A;  2QKL A;  5C5B A;  2COA A;  4P7I A;  4ZRI A;  5FI1 A;  1LB1 A;  1SHC A;  4KHA A;  2RVB B;  2P0D A;  5C79 A;  3DXE A;  1BTN A;  4GMV A;  3F0W A;  1XKE A;  3PVL A;  3PZD A;  4ZRJ A;  3U7D A;  1DBH A;  4WSF A;  2DN6 A;  4Z2N A;  3F5R A;  3SUZ A;  2G35 A;  2DTC A;  2YF0 A;  1UNP A;  3OAN A;  4CHM A;  2OQB A;  1KI1 B;  4A6H A;  2LOX A;  5D3X A;  1SGH A;  5HE0 A;  5J3Y A;  5C6R A;  2DYQ A;  4MT7 A;  2YT1 A;  2ROV A;  2MKR A;  1V88 A;  2LUL A;  3VIA A;  2H7E A;  3RCP A;  1BWN A;  3ZDT A;  2K2U A;  3AU5 A;  5D27 A;  1MPH A;  4A6F B;  2ADZ A;  3X23 A;  1U5G A;  2EJ8 A;  3SV1 A;  4YON A;  3HQC A;  2UZS A;  2N0Y A;  1FHO A;  3A98 B;  1X1G A;  2YS5 A;  5DHA B;  3KRW A;  1XOD A;  4IFS A;  4A6F A;  2HTH B;  2YT0 A;  3PP2 A;  2MDX A;  5HE1 A;  4GPT B;  2M14 A;  3DXC A;  2DHJ A;  1W1G A;  1FHX A;  3KRX A;  1FGY A;  4H8S A;  2FJL A;  4HB4 B;  1NTV A;  1MAI A;  2I5C A;  4MK0 A;  1FAO A;  4HHV A;  3FM8 C;  3WA0 A;  4CHJ A;  5JHH A;  3WYF B;  2DFK A;  2ROZ B;  1EF1 A;  2CAY A;  2ELB A;  3SNH A;  1GC6 A;  4MY6 A;  4F7G A;  4XWX A;  2RLO A;  1J0W A;  2GCL A;  1PLS A;  1NTY A;  3N7C A;  1FHW A;  1BAK A;  5C5B B;  1P3R A;  2E2X A;  2GJY A;  2VSZ A;  4EMO A;  5DIF B;  1K5D B;  1V5U A;  1J19 A;  1KZG A;  2D9V A;  4EJN A;  2NMB A;  2D10 A;  2MFQ A;  3BJI A;  5J3T A;  3ULC A;  4HAX B;  5EFX A;  3KSY A;  2I1J A;  3FEH A;  3ULB A;  4WVF B;  5LON B;  3T06 A;  1X1F A;  1MK9 B;  1OQN A;  5CLQ B;  1UNQ A;  1NI2 A;  1DRO A;  1RJ2 A;  4CYE A;  1Z87 A;  4Z2M B;  2X18 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...