4Y94A

Crystal structure of the ph-th module of bruton's tyrosine kinase bound to inositol hexakisphosphate
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
167
structure length
158
Chain Sequence
ATVILESIFLKRSSPLNFKKRLFLLTVQKLSYYEYDFERGRRGSKKGSIDVEKITCVETVVPEKNPPPERQIPEESSETEQISIIERFPYPFQVVYDEGPLYVFSPTEELRKRWIHQLKNVIRYNSDLVQKYHPCFWIDGQYLCCSQTAKNAMGCQIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Non-specific protein-tyrosine kinase
publication title Autoinhibition of Bruton's tyrosine kinase (Btk) and activation by soluble inositol hexakisphosphate.
pubmed doi rcsb
source organism Bos taurus
molecule tags Transferase
total genus 28
structure length 158
sequence length 167
chains with identical sequence B, C, D
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2015-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00169 PH PH domain
A PF00779 BTK BTK motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 4y94A00
1AQCA 3FM8C 1V61A 1MIXA 4H8SA 2QKMA 5FI1A 4IOYX 2MKRA 3VIAA 2DKQA 3PP2A 1U27A 2H7EA 4HAVB 4HAUB 1KZGA 1XD4A 4KHOA 2UZRA 1UPQA 2UVMA 2ROVA 5HE1A 5HE3A 1UNPA 2D9VA 1E5WA 5C16A 1WGUA 3PG7A 2ADZA 1XR0B 1LB1A 2COCA 1DDMA 1U5GA 1Y5OA 1DDVA 4GPTB 3KY9A 4K17A 2P0DA 2LG1A 1TXDA 4YONA 2OQBA 3TO1A 1PFJA 3M1IB 2E2XA 5D3YA 4L6EA 3HK0A 4HB0B 1ZC3B 1U29A 1V89A 3DXCA 5HE0A 1H10A 1J19A 2Q13A 2Y7BA 1B55A 3SV1A 3AJ4A 3ODXA 4CHMA 3A8QA 5J3YA 2DN6A 1XODA 2I5FA 3IVFA 1IRSA 3PEGA 3WA0A 2HTHB 2RNRB 5DI9B 2CY4A 4A6HA 2RUKB 3D8FA 1ZC4B 1BTKA 2DYQA 3CXBB 2GJYA 1DROA 1UEFA 5FI0A 2KGXB 1NU2A 4TKNA 3ODWA 2AEHA 1XCGA 2D9WA 2DA0A 2AL6A 4GN1A 3ODOA 2MWNB 1DYNA 5C79A 4HAXB 1V5PA 5C5BA 1WG7A 1MPHA 4A6FA 5C6RA 3FEHA 1W1HA 2G35A 2D2QA 3QBVB 2D4QA 1BWNA 4DX90 1OY2A 2LYDA 2MDXA 3X23A 5JLJB 2EC1A 1P5TA 3PSCA 1I2HA 2NMBA 3KRXA 2M38A 2CODA 3U7DA 4GMVA 1PLSA 4BBKA 1UNRA 3BINA 3VOQA 2EMSA 1M7EA 2YRYA 5J3QA 3F0WA 1H4RA 3A98B 3TCAA 2DKPA 4Z2NA 2W2XC 2GS0A 5JHGA 1EAZA 4Y94A 2KUPA 5DIFB 3HW2B 5D27A 1WGQA 2J0JA 1AWEA 1UPRA 3AU5A 4YL8A 1X1GA 4DXAB 5KCVA 3AU4A 1RJ2A 2D10A 2COFA 2J0KA 1DDWA 1TQZA 2W2XD 3NSUA 3ULCA 4D0NB 4F7GA 2X18A 2LOXA 5DHAB 1GG3A 5J3TA 3OANA 2RSGA 4HB3B 5LONB 2UZSA 2W2WA 4Z2MB 4EJNA 2I5CA 4HAYB 1EGXA 4HAZB 3UZTA 3LJUX 3U8ZA 2RLOA 3KSYA 1WJ1A 4GXBA 3QIJA 2D9YA 1WJMA 3PZDA 1EF1A 5D3VA 4IFSA 2DX5A 5DHFB 2DFKA 3MDBC 2Z0QA 5CLLB 4PNKA 2YS3A 2FJLA 4A5KA 1ISNA 1Z87A 4K2OA 2JP2A 1PMSA 2I1JA 2GCLA 2YS5A 1V5MA 1FOEA 2N23A 3DXDA 5DH9B 3A8PA 2RVBB 1W1DA 4F7HA 5JHHA 4ZRIA 1U5FA 1X86A 4ZRKA 4HHVA 4K81A 1ZM0A 2H7DA 1ZSQA 2CRFA 3WYFB 2P8VA 1FGZA 4WSFA 4DX8A 2M14A 1U2BA 4MT7A 1Y19B 2J59M 1FHWA 3P7ZA 3G9WA 2LKOA 4NY0A 4MY6A 4WVFB 1P6SA 3TW1A 1N3HA 1OQNA 3PVUA 4K2PA 2CY5A 1TJ6A 1Q67A 1RRPB 4EKUA 3SYXA 2PZ1A 3GYPA 2Y8FA 3SNHA 5L81A 5HE2A 2L2IA 4NSWA 2DHKA 5EFXA 1MK7B 3HQCA 2EJ8A 1U5EA 2OTXA 2DYNA 3N7CA 4ZRJA 4WJ7A 4XWXA 2YF0A 1NI2A 2ELAA 3TFMA 4KHAA 1J0WA 3DXEA 2DHIA 2R09A 2D9XA 3KZ1A 4CHJA 2N0YA 2CAYA 5KQ1A 2DX1A 1W1GA 2ROZB 1MIZB 1XX0A 4HB4B 1MKEA 1QQGA 2VSZA 5GOWB 3D8EA 4GMXB 4DBBA 1I7AA 2ELBA 2BCJA 2DLWA 1X1FA 2P0FA 1WI1A 3ZDTA 1KZ7A 2LULA 4HAWB 3F5RA 3P6AA 1GC7A 3FSSA 3D8DA 3ML4A 1U5DA 2LOZA 5D3WA 1WVHA 1FAOA 4KAXB 4PQ0A 1X11A 2K00A 2I1KA 2YT0A 2IFSA 1SGHA 2D11A 3ULBA 1V5UA 3KRWA 2EMTA 3TVVA 3RCPA 4F7UP 2QKLA 4CYEA 1P3RA 2VRWB 1ZVRA 1NTVA 2COAA 1M7RA 2V76A 2D9ZA 2RGNB 1UNQA 3MPXA 4GZUA 2Z0OA 4EMOA 1BTNA 1FGYA 1K5DB 3SO6A 4HB2B 1GC6A 4HATB 2GCJA 2ZPYA 1QC6A 4B6HA 2Z0PA 5JP4A 2YS1A 1FHOA 2P0HA 1SHCA 1EVHA 3CIKA 5D3XA 2KCJA 1V88A 4P7IA 1KI1B 2NZ8B 2DTCA 2YSZA 4KVGB 2K2UA 2Y8GA 2MFQA 1X05A 1BAKA 3SUZA 1DBHA 2K2JA 3GYOA 2HE7A 5LOPB 3ZVRA 2DHJA 5CLQB 4IAPA 4C0AA 1NTYA 4MK0A 1MAIA 2YT1A 1OMWA 1K5GB 3T06A 5C5BB 2XQNM 3QWMA 2IYBA 4A6FB 1XKEA 4HDOA 3PVWA 4HDQA 1FHXA 2YVCA 3PVLA 3BJIA 2L1CA 1FB8A 4KHBB 4TYZA 2R0DA 4A6KA 5KQ4A 1LW3A 1MK9B 3V5WA 2J0MA 2VKIA 3O96A
chains in the Genus database with same CATH superfamily
3NWFA 2Z59A 1AQCA 3FM8C 1V61A 2Z14A 1MIXA 4H8SA 2QKMA 5FI1A 4IOYX 2MKRA 3VIAA 3HSAA 2DKQA 3PP2A 1U27A 2H7EA 4HAVB 4HAUB 1KZGA 1XD4A 4KHOA 4QJ4B 2UZRA 1UPQA 2UVMA 2ROVA 5HE1A 5HE3A 1UNPA 2D9VA 1E5WA 5C16A 1WGUA 3PG7A 2ADZA 1XR0B 1LB1A 2COCA 1DDMA 1U5GA 1Y5OA 1DDVA 4GPTB 3KY9A 4K17A 2P0DA 2KUQA 2LG1A 1TXDA 4YONA 2OQBA 3TO1A 1PFJA 3M1IB 2E2XA 5D3YA 4L6EA 3HK0A 4GOUA 4HB0B 1ZC3B 1U29A 1V89A 3DXCA 5HE0A 4QXAB 5I2SA 2K49A 1H10A 1J19A 2Q13A 2Y7BA 1B55A 3SV1A 3AJ4A 3ODXA 1MI1A 4CHMA 3A8QA 2RRFA 5J3YA 2DN6A 5IRSA 1XODA 2I5FA 3DCXA 1IRSA 3IVFA 3PEGA 3WA0A 2HTHB 2RNRB 3FVCA 5DI9B 2CY4A 4A6HA 2RUKB 1T77A 3D8FA 1ZC4B 1BTKA 2DYQA 3CXBB 2GJYA 1DROA 1UEFA 3NW8A 5FI0A 2KGXB 1NU2A 4TKNA 3ODWA 2AEHA 3NWDA 1XCGA 2D9WA 2DA0A 2AL6A 4GN1A 3ODOA 2MWNB 1DYNA 5C79A 4HAXB 1V5PA 5C5BA 1WG7A 1MPHA 4DIXA 4A6FA 5C6RA 3FEHA 1W1HA 2G35A 2D2QA 3QBVB 2NBVA 2D4QA 1BWNA 4DX90 2KIEA 1OY2A 4KHBA 2LYDA 2MDXA 2KR0A 3X23A 5JLJB 2EC1A 1P5TA 3PSCA 1I2HA 2NMBA 3KRXA 2M38A 2CODA 3U7DA 4GMVA 4QJ3B 1PLSA 4BBKA 1UNRA 3BINA 5I2MA 2GUMA 3VOQA 2EMSA 1M7EA 2YRYA 5J3QA 3F0WA 1H4RA 3A98B 3TCAA 2DKPA 4Z2NA 2W2XC 2GS0A 5JHGA 1EAZA 4Y94A 2KUPA 5DIFB 3HW2B 5D27A 1WGQA 2J0JA 1AWEA 1UPRA 3AU5A 4YL8A 1X1GA 4DXAB 5KCVA 3AU4A 2Z4DA 1RJ2A 2D10A 2KIGA 2COFA 2J0KA 1DDWA 1TQZA 2W2XD 3NSUA 3ULCA 4D0NB 4F7GA 2X18A 2LOXA 5DHAB 1GG3A 5J3TA 3OANA 2RSGA 4HB3B 5LONB 2UZSA 2W2WA 4Z2MB 4EJNA 2I5CA 4HAYB 1EGXA 4HAZB 3UZTA 3LJUX 3U8ZA 2RLOA 3KSYA 4L1RA 1WJ1A 4GNKB 4GXBA 3QIJA 2D9YA 1WJMA 3PZDA 1EF1A 5D3VA 4IFSA 2DX5A 5DHFB 2DFKA 3MDBC 2Z0QA 5CLLB 4PNKA 2YS3A 2FJLA 4A5KA 4D6WA 1ISNA 1Z87A 4K2OA 2JP2A 1PMSA 2I1JA 2GCLA 2YS5A 1V5MA 1FOEA 2N23A 3DXDA 5DH9B 3A8PA 2RVBB 1W1DA 4F7HA 5JHHA 3A58A 4ZRIA 1U5FA 1X86A 4ZRKA 4HHVA 4K81A 1ZM0A 2H7DA 1ZSQA 2CRFA 3WYFB 2P8VA 1FGZA 4WSFA 4DX8A 2M14A 1U2BA 4MT7A 1Y19B 2J59M 1FHWA 3P7ZA 3G9WA 2LKOA 4NY0A 4MY6A 4WVFB 1P6SA 3TW1A 1N3HA 2YT2A 1OQNA 3PVUA 4K2PA 2CY5A 1TJ6A 1Q67A 1RRPB 4EKUA 3SYXA 2PZ1A 3GYPA 2Y8FA 3SNHA 5L81A 5HE2A 2L2IA 4NSWA 2DHKA 5EFXA 1MK7B 3HQCA 2EJ8A 3U12A 1U5EA 2OTXA 2Z13A 2DYNA 3N7CA 4ZRJA 4WJ7A 4XWXA 5M4YB 2YF0A 1NI2A 2ELAA 2ZKMX 3TFMA 4KHAA 1J0WA 3DXEA 2DHIA 2R09A 2D9XA 3KZ1A 4CHJA 2N0YA 4CSQA 2CAYA 5KQ1A 3B77A 2DX1A 1W1GA 2ROZB 1MIZB 1XX0A 4HB4B 1MKEA 1QQGA 2VSZA 5GOWB 3D8EA 4GMXB 4DBBA 1I7AA 2ELBA 2BCJA 2R2YA 2DLWA 1X1FA 2P0FA 1WI1A 3ZDTA 1KZ7A 2LULA 4HAWB 3F5RA 3P6AA 1GC7A 3FSSA 3D8DA 3ML4A 1U5DA 2LOZA 4OT1A 5D3WA 1WVHA 1FAOA 2K8EA 4KAXB 1ZYIA 4PQ0A 1X11A 2K00A 2I1KA 2YT0A 2IFSA 1SGHA 2D11A 4QJ5B 3ULBA 1V5UA 3KRWA 2EMTA 3TVVA 3RCPA 4F7UP 2QKLA 4CYEA 1P3RA 2VRWB 1ZVRA 3NWAA 1NTVA 2COAA 1M7RA 2V76A 2D9ZA 2RGNB 1UNQA 3MPXA 4GZUA 2Z0OA 4EMOA 1BTNA 1FGYA 1K5DB 3SO6A 4HB2B 1GC6A 4HATB 2GCJA 2ZPYA 1QC6A 4B6HA 2Z0PA 5JP4A 2YS1A 1FHOA 2P0HA 1SHCA 1EVHA 3HIEA 3CIKA 5D3XA 2KCJA 1V88A 4P7IA 1KI1B 2NZ8B 2DTCA 2YSZA 4KVGB 2K2UA 2Y8GA 4OSNA 2MFQA 1X05A 1BAKA 3SUZA 1DBHA 5LG4B 2K2JA 3GYOA 2HE7A 5LOPB 4HSIA 3ZVRA 2DHJA 5CLQB 4IAPA 4C0AA 1NTYA 4MK0A 1MAIA 2YT1A 1OMWA 1K5GB 3T06A 5C5BB 2XQNM 3QWMA 2IYBA 4A6FB 1XKEA 4HDOA 3OHMB 3PVWA 4HDQA 1FHXA 2YVCA 3PVLA 3BJIA 2L1CA 1FB8A 4KHBB 4TYZA 2R0DA 4A6KA 5KQ4A 1LW3A 1MK9B 3V5WA 2J0MA 2VKIA 3O96A 2FJUB
chains in the Genus database with same CATH topology
1AQCA 3FM8C 1V61A 1MIXA 4H8SA 2QKMA 5FI1A 4IOYX 2MKRA 3VIAA 2DKQA 3PP2A 1U27A 2H7EA 4HAVB 4HAUB 1KZGA 1XD4A 4KHOA 2UZRA 1UPQA 2UVMA 2ROVA 5HE1A 5HE3A 1UNPA 2D9VA 1E5WA 5C16A 1WGUA 3PG7A 2ADZA 1XR0B 1LB1A 2COCA 1DDMA 1U5GA 1Y5OA 1DDVA 4GPTB 3KY9A 4K17A 2P0DA 2LG1A 1TXDA 4YONA 2OQBA 3TO1A 1PFJA 3M1IB 2E2XA 5D3YA 4L6EA 3HK0A 4HB0B 1ZC3B 1U29A 1V89A 3DXCA 5HE0A 1H10A 1J19A 2Q13A 2Y7BA 1B55A 3SV1A 3AJ4A 3ODXA 4CHMA 3A8QA 5J3YA 2DN6A 1XODA 2I5FA 3IVFA 1IRSA 3PEGA 3WA0A 2HTHB 2RNRB 5DI9B 2CY4A 4A6HA 2RUKB 3D8FA 1ZC4B 1BTKA 2DYQA 3CXBB 2GJYA 1DROA 1UEFA 5FI0A 2KGXB 1NU2A 4TKNA 3ODWA 2AEHA 1XCGA 2D9WA 2DA0A 2AL6A 4GN1A 3ODOA 2MWNB 1DYNA 5C79A 4HAXB 1V5PA 5C5BA 1WG7A 1MPHA 4A6FA 5C6RA 3FEHA 1W1HA 2G35A 2D2QA 3QBVB 2D4QA 1BWNA 4DX90 1OY2A 2LYDA 2MDXA 3X23A 5JLJB 2EC1A 1P5TA 3PSCA 1I2HA 2NMBA 3KRXA 2M38A 2CODA 3U7DA 4GMVA 1PLSA 4BBKA 1UNRA 3BINA 3VOQA 2EMSA 1M7EA 2YRYA 5J3QA 3F0WA 1H4RA 3A98B 3TCAA 2DKPA 4Z2NA 2W2XC 2GS0A 5JHGA 1EAZA 4Y94A 2KUPA 5DIFB 3HW2B 5D27A 1WGQA 2J0JA 1AWEA 1UPRA 3AU5A 4YL8A 1X1GA 4DXAB 5KCVA 3AU4A 1RJ2A 2D10A 2COFA 2J0KA 1DDWA 1TQZA 2W2XD 3NSUA 3ULCA 4D0NB 4F7GA 2X18A 2LOXA 5DHAB 1GG3A 5J3TA 3OANA 2RSGA 4HB3B 5LONB 2UZSA 2W2WA 4Z2MB 4EJNA 2I5CA 4HAYB 1EGXA 4HAZB 3UZTA 3LJUX 3U8ZA 2RLOA 3KSYA 1WJ1A 4GXBA 3QIJA 2D9YA 1WJMA 3PZDA 1EF1A 5D3VA 4IFSA 2DX5A 5DHFB 2DFKA 3MDBC 2Z0QA 5CLLB 4PNKA 2YS3A 2FJLA 4A5KA 1ISNA 1Z87A 4K2OA 2JP2A 1PMSA 2I1JA 2GCLA 2YS5A 1V5MA 1FOEA 2N23A 3DXDA 5DH9B 3A8PA 2RVBB 1W1DA 4F7HA 5JHHA 4ZRIA 1U5FA 1X86A 4ZRKA 4HHVA 4K81A 1ZM0A 2H7DA 1ZSQA 2CRFA 3WYFB 2P8VA 1FGZA 4WSFA 4DX8A 2M14A 1U2BA 4MT7A 1Y19B 2J59M 1FHWA 3P7ZA 3G9WA 2LKOA 4NY0A 4MY6A 4WVFB 1P6SA 3TW1A 1N3HA 1OQNA 3PVUA 4K2PA 2CY5A 1TJ6A 1Q67A 1RRPB 4EKUA 3SYXA 2PZ1A 3GYPA 2Y8FA 3SNHA 5L81A 5HE2A 2L2IA 4NSWA 2DHKA 5EFXA 1MK7B 3HQCA 2EJ8A 1U5EA 2OTXA 2DYNA 3N7CA 4ZRJA 4WJ7A 4XWXA 2YF0A 1NI2A 2ELAA 3TFMA 4KHAA 1J0WA 3DXEA 2DHIA 2R09A 2D9XA 3KZ1A 4CHJA 2N0YA 2CAYA 5KQ1A 2DX1A 1W1GA 2ROZB 1MIZB 1XX0A 4HB4B 1MKEA 1QQGA 2VSZA 5GOWB 3D8EA 4GMXB 4DBBA 1I7AA 2ELBA 2BCJA 2DLWA 1X1FA 2P0FA 1WI1A 3ZDTA 1KZ7A 2LULA 4HAWB 3F5RA 3P6AA 1GC7A 3FSSA 3D8DA 3ML4A 1U5DA 2LOZA 5D3WA 1WVHA 1FAOA 4KAXB 4PQ0A 1X11A 2K00A 2I1KA 2YT0A 2IFSA 1SGHA 2D11A 3ULBA 1V5UA 3KRWA 2EMTA 3TVVA 3RCPA 4F7UP 2QKLA 4CYEA 1P3RA 2VRWB 1ZVRA 1NTVA 2COAA 1M7RA 2V76A 2D9ZA 2RGNB 1UNQA 3MPXA 4GZUA 2Z0OA 4EMOA 1BTNA 1FGYA 1K5DB 3SO6A 4HB2B 1GC6A 4HATB 2GCJA 2ZPYA 1QC6A 4B6HA 2Z0PA 5JP4A 2YS1A 1FHOA 2P0HA 1SHCA 1EVHA 3CIKA 5D3XA 2KCJA 1V88A 4P7IA 1KI1B 2NZ8B 2DTCA 2YSZA 4KVGB 2K2UA 2Y8GA 2MFQA 1X05A 1BAKA 3SUZA 1DBHA 2K2JA 3GYOA 2HE7A 5LOPB 3ZVRA 2DHJA 5CLQB 4IAPA 4C0AA 1NTYA 4MK0A 1MAIA 2YT1A 1OMWA 1K5GB 3T06A 5C5BB 2XQNM 3QWMA 2IYBA 4A6FB 1XKEA 4HDOA 3PVWA 4HDQA 1FHXA 2YVCA 3PVLA 3BJIA 2L1CA 1FB8A 4KHBB 4TYZA 2R0DA 4A6KA 5KQ4A 1LW3A 1MK9B 3V5WA 2J0MA 2VKIA 3O96A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1AQC A;  3FM8 C;  1V61 A;  1MIX A;  4H8S A;  2QKM A;  5FI1 A;  4IOY X;  2MKR A;  3VIA A;  2DKQ A;  3PP2 A;  1U27 A;  2H7E A;  4HAV B;  4HAU B;  1KZG A;  1XD4 A;  4KHO A;  2UZR A;  1UPQ A;  2UVM A;  2ROV A;  5HE1 A;  5HE3 A;  1UNP A;  2D9V A;  1E5W A;  5C16 A;  1WGU A;  3PG7 A;  2ADZ A;  1XR0 B;  1LB1 A;  2COC A;  1DDM A;  1U5G A;  1Y5O A;  1DDV A;  4GPT B;  3KY9 A;  4K17 A;  2P0D A;  2LG1 A;  1TXD A;  4YON A;  2OQB A;  3TO1 A;  1PFJ A;  3M1I B;  2E2X A;  5D3Y A;  4L6E A;  3HK0 A;  4HB0 B;  1ZC3 B;  1U29 A;  1V89 A;  3DXC A;  5HE0 A;  1H10 A;  1J19 A;  2Q13 A;  2Y7B A;  1B55 A;  3SV1 A;  3AJ4 A;  3ODX A;  4CHM A;  3A8Q A;  5J3Y A;  2DN6 A;  1XOD A;  2I5F A;  3IVF A;  1IRS A;  3PEG A;  3WA0 A;  2HTH B;  2RNR B;  5DI9 B;  2CY4 A;  4A6H A;  2RUK B;  3D8F A;  1ZC4 B;  1BTK A;  2DYQ A;  3CXB B;  2GJY A;  1DRO A;  1UEF A;  5FI0 A;  2KGX B;  1NU2 A;  4TKN A;  3ODW A;  2AEH A;  1XCG A;  2D9W A;  2DA0 A;  2AL6 A;  4GN1 A;  3ODO A;  2MWN B;  1DYN A;  5C79 A;  4HAX B;  1V5P A;  5C5B A;  1WG7 A;  1MPH A;  4A6F A;  5C6R A;  3FEH A;  1W1H A;  2G35 A;  2D2Q A;  3QBV B;  2D4Q A;  1BWN A;  4DX9 0;  1OY2 A;  2LYD A;  2MDX A;  3X23 A;  5JLJ B;  2EC1 A;  1P5T A;  3PSC A;  1I2H A;  2NMB A;  3KRX A;  2M38 A;  2COD A;  3U7D A;  4GMV A;  1PLS A;  4BBK A;  1UNR A;  3BIN A;  3VOQ A;  2EMS A;  1M7E A;  2YRY A;  5J3Q A;  3F0W A;  1H4R A;  3A98 B;  3TCA A;  2DKP A;  4Z2N A;  2W2X C;  2GS0 A;  5JHG A;  1EAZ A;  4Y94 A;  2KUP A;  5DIF B;  3HW2 B;  5D27 A;  1WGQ A;  2J0J A;  1AWE A;  1UPR A;  3AU5 A;  4YL8 A;  1X1G A;  4DXA B;  5KCV A;  3AU4 A;  1RJ2 A;  2D10 A;  2COF A;  2J0K A;  1DDW A;  1TQZ A;  2W2X D;  3NSU A;  3ULC A;  4D0N B;  4F7G A;  2X18 A;  2LOX A;  5DHA B;  1GG3 A;  5J3T A;  3OAN A;  2RSG A;  4HB3 B;  5LON B;  2UZS A;  2W2W A;  4Z2M B;  4EJN A;  2I5C A;  4HAY B;  1EGX A;  4HAZ B;  3UZT A;  3LJU X;  3U8Z A;  2RLO A;  3KSY A;  1WJ1 A;  4GXB A;  3QIJ A;  2D9Y A;  1WJM A;  3PZD A;  1EF1 A;  5D3V A;  4IFS A;  2DX5 A;  5DHF B;  2DFK A;  3MDB C;  2Z0Q A;  5CLL B;  4PNK A;  2YS3 A;  2FJL A;  4A5K A;  1ISN A;  1Z87 A;  4K2O A;  2JP2 A;  1PMS A;  2I1J A;  2GCL A;  2YS5 A;  1V5M A;  1FOE A;  2N23 A;  3DXD A;  5DH9 B;  3A8P A;  2RVB B;  1W1D A;  4F7H A;  5JHH A;  4ZRI A;  1U5F A;  1X86 A;  4ZRK A;  4HHV A;  4K81 A;  1ZM0 A;  2H7D A;  1ZSQ A;  2CRF A;  3WYF B;  2P8V A;  1FGZ A;  4WSF A;  4DX8 A;  2M14 A;  1U2B A;  4MT7 A;  1Y19 B;  2J59 M;  1FHW A;  3P7Z A;  3G9W A;  2LKO A;  4NY0 A;  4MY6 A;  4WVF B;  1P6S A;  3TW1 A;  1N3H A;  1OQN A;  3PVU A;  4K2P A;  2CY5 A;  1TJ6 A;  1Q67 A;  1RRP B;  4EKU A;  3SYX A;  2PZ1 A;  3GYP A;  2Y8F A;  3SNH A;  5L81 A;  5HE2 A;  2L2I A;  4NSW A;  2DHK A;  5EFX A;  1MK7 B;  3HQC A;  2EJ8 A;  1U5E A;  2OTX A;  2DYN A;  3N7C A;  4ZRJ A;  4WJ7 A;  4XWX A;  2YF0 A;  1NI2 A;  2ELA A;  3TFM A;  4KHA A;  1J0W A;  3DXE A;  2DHI A;  2R09 A;  2D9X A;  3KZ1 A;  4CHJ A;  2N0Y A;  2CAY A;  5KQ1 A;  2DX1 A;  1W1G A;  2ROZ B;  1MIZ B;  1XX0 A;  4HB4 B;  1MKE A;  1QQG A;  2VSZ A;  5GOW B;  3D8E A;  4GMX B;  4DBB A;  1I7A A;  2ELB A;  2BCJ A;  2DLW A;  1X1F A;  2P0F A;  1WI1 A;  3ZDT A;  1KZ7 A;  2LUL A;  4HAW B;  3F5R A;  3P6A A;  1GC7 A;  3FSS A;  3D8D A;  3ML4 A;  1U5D A;  2LOZ A;  5D3W A;  1WVH A;  1FAO A;  4KAX B;  4PQ0 A;  1X11 A;  2K00 A;  2I1K A;  2YT0 A;  2IFS A;  1SGH A;  2D11 A;  3ULB A;  1V5U A;  3KRW A;  2EMT A;  3TVV A;  3RCP A;  4F7U P;  2QKL A;  4CYE A;  1P3R A;  2VRW B;  1ZVR A;  1NTV A;  2COA A;  1M7R A;  2V76 A;  2D9Z A;  2RGN B;  1UNQ A;  3MPX A;  4GZU A;  2Z0O A;  4EMO A;  1BTN A;  1FGY A;  1K5D B;  3SO6 A;  4HB2 B;  1GC6 A;  4HAT B;  2GCJ A;  2ZPY A;  1QC6 A;  4B6H A;  2Z0P A;  5JP4 A;  2YS1 A;  1FHO A;  2P0H A;  1SHC A;  1EVH A;  3CIK A;  5D3X A;  2KCJ A;  1V88 A;  4P7I A;  1KI1 B;  2NZ8 B;  2DTC A;  2YSZ A;  4KVG B;  2K2U A;  2Y8G A;  2MFQ A;  1X05 A;  1BAK A;  3SUZ A;  1DBH A;  2K2J A;  3GYO A;  2HE7 A;  5LOP B;  3ZVR A;  2DHJ A;  5CLQ B;  4IAP A;  4C0A A;  1NTY A;  4MK0 A;  1MAI A;  2YT1 A;  1OMW A;  1K5G B;  3T06 A;  5C5B B;  2XQN M;  3QWM A;  2IYB A;  4A6F B;  1XKE A;  4HDO A;  3PVW A;  4HDQ A;  1FHX A;  2YVC A;  3PVL A;  3BJI A;  2L1C A;  1FB8 A;  4KHB B;  4TYZ A;  2R0D A;  4A6K A;  5KQ4 A;  1LW3 A;  1MK9 B;  3V5W A;  2J0M A;  2VKI A;  3O96 A; 
#chains in the Genus database with same CATH topology
 3NWF A;  2Z59 A;  1AQC A;  3FM8 C;  1V61 A;  2Z14 A;  1MIX A;  4H8S A;  2QKM A;  5FI1 A;  4IOY X;  2MKR A;  3VIA A;  3HSA A;  2DKQ A;  3PP2 A;  1U27 A;  2H7E A;  4HAV B;  4HAU B;  1KZG A;  1XD4 A;  4KHO A;  4QJ4 B;  2UZR A;  1UPQ A;  2UVM A;  2ROV A;  5HE1 A;  5HE3 A;  1UNP A;  2D9V A;  1E5W A;  5C16 A;  1WGU A;  3PG7 A;  2ADZ A;  1XR0 B;  1LB1 A;  2COC A;  1DDM A;  1U5G A;  1Y5O A;  1DDV A;  4GPT B;  3KY9 A;  4K17 A;  2P0D A;  2KUQ A;  2LG1 A;  1TXD A;  4YON A;  2OQB A;  3TO1 A;  1PFJ A;  3M1I B;  2E2X A;  5D3Y A;  4L6E A;  3HK0 A;  4GOU A;  4HB0 B;  1ZC3 B;  1U29 A;  1V89 A;  3DXC A;  5HE0 A;  4QXA B;  5I2S A;  2K49 A;  1H10 A;  1J19 A;  2Q13 A;  2Y7B A;  1B55 A;  3SV1 A;  3AJ4 A;  3ODX A;  1MI1 A;  4CHM A;  3A8Q A;  2RRF A;  5J3Y A;  2DN6 A;  5IRS A;  1XOD A;  2I5F A;  3DCX A;  1IRS A;  3IVF A;  3PEG A;  3WA0 A;  2HTH B;  2RNR B;  3FVC A;  5DI9 B;  2CY4 A;  4A6H A;  2RUK B;  1T77 A;  3D8F A;  1ZC4 B;  1BTK A;  2DYQ A;  3CXB B;  2GJY A;  1DRO A;  1UEF A;  3NW8 A;  5FI0 A;  2KGX B;  1NU2 A;  4TKN A;  3ODW A;  2AEH A;  3NWD A;  1XCG A;  2D9W A;  2DA0 A;  2AL6 A;  4GN1 A;  3ODO A;  2MWN B;  1DYN A;  5C79 A;  4HAX B;  1V5P A;  5C5B A;  1WG7 A;  1MPH A;  4DIX A;  4A6F A;  5C6R A;  3FEH A;  1W1H A;  2G35 A;  2D2Q A;  3QBV B;  2NBV A;  2D4Q A;  1BWN A;  4DX9 0;  2KIE A;  1OY2 A;  4KHB A;  2LYD A;  2MDX A;  2KR0 A;  3X23 A;  5JLJ B;  2EC1 A;  1P5T A;  3PSC A;  1I2H A;  2NMB A;  3KRX A;  2M38 A;  2COD A;  3U7D A;  4GMV A;  4QJ3 B;  1PLS A;  4BBK A;  1UNR A;  3BIN A;  5I2M A;  2GUM A;  3VOQ A;  2EMS A;  1M7E A;  2YRY A;  5J3Q A;  3F0W A;  1H4R A;  3A98 B;  3TCA A;  2DKP A;  4Z2N A;  2W2X C;  2GS0 A;  5JHG A;  1EAZ A;  4Y94 A;  2KUP A;  5DIF B;  3HW2 B;  5D27 A;  1WGQ A;  2J0J A;  1AWE A;  1UPR A;  3AU5 A;  4YL8 A;  1X1G A;  4DXA B;  5KCV A;  3AU4 A;  2Z4D A;  1RJ2 A;  2D10 A;  2KIG A;  2COF A;  2J0K A;  1DDW A;  1TQZ A;  2W2X D;  3NSU A;  3ULC A;  4D0N B;  4F7G A;  2X18 A;  2LOX A;  5DHA B;  1GG3 A;  5J3T A;  3OAN A;  2RSG A;  4HB3 B;  5LON B;  2UZS A;  2W2W A;  4Z2M B;  4EJN A;  2I5C A;  4HAY B;  1EGX A;  4HAZ B;  3UZT A;  3LJU X;  3U8Z A;  2RLO A;  3KSY A;  4L1R A;  1WJ1 A;  4GNK B;  4GXB A;  3QIJ A;  2D9Y A;  1WJM A;  3PZD A;  1EF1 A;  5D3V A;  4IFS A;  2DX5 A;  5DHF B;  2DFK A;  3MDB C;  2Z0Q A;  5CLL B;  4PNK A;  2YS3 A;  2FJL A;  4A5K A;  4D6W A;  1ISN A;  1Z87 A;  4K2O A;  2JP2 A;  1PMS A;  2I1J A;  2GCL A;  2YS5 A;  1V5M A;  1FOE A;  2N23 A;  3DXD A;  5DH9 B;  3A8P A;  2RVB B;  1W1D A;  4F7H A;  5JHH A;  3A58 A;  4ZRI A;  1U5F A;  1X86 A;  4ZRK A;  4HHV A;  4K81 A;  1ZM0 A;  2H7D A;  1ZSQ A;  2CRF A;  3WYF B;  2P8V A;  1FGZ A;  4WSF A;  4DX8 A;  2M14 A;  1U2B A;  4MT7 A;  1Y19 B;  2J59 M;  1FHW A;  3P7Z A;  3G9W A;  2LKO A;  4NY0 A;  4MY6 A;  4WVF B;  1P6S A;  3TW1 A;  1N3H A;  2YT2 A;  1OQN A;  3PVU A;  4K2P A;  2CY5 A;  1TJ6 A;  1Q67 A;  1RRP B;  4EKU A;  3SYX A;  2PZ1 A;  3GYP A;  2Y8F A;  3SNH A;  5L81 A;  5HE2 A;  2L2I A;  4NSW A;  2DHK A;  5EFX A;  1MK7 B;  3HQC A;  2EJ8 A;  3U12 A;  1U5E A;  2OTX A;  2Z13 A;  2DYN A;  3N7C A;  4ZRJ A;  4WJ7 A;  4XWX A;  5M4Y B;  2YF0 A;  1NI2 A;  2ELA A;  2ZKM X;  3TFM A;  4KHA A;  1J0W A;  3DXE A;  2DHI A;  2R09 A;  2D9X A;  3KZ1 A;  4CHJ A;  2N0Y A;  4CSQ A;  2CAY A;  5KQ1 A;  3B77 A;  2DX1 A;  1W1G A;  2ROZ B;  1MIZ B;  1XX0 A;  4HB4 B;  1MKE A;  1QQG A;  2VSZ A;  5GOW B;  3D8E A;  4GMX B;  4DBB A;  1I7A A;  2ELB A;  2BCJ A;  2R2Y A;  2DLW A;  1X1F A;  2P0F A;  1WI1 A;  3ZDT A;  1KZ7 A;  2LUL A;  4HAW B;  3F5R A;  3P6A A;  1GC7 A;  3FSS A;  3D8D A;  3ML4 A;  1U5D A;  2LOZ A;  4OT1 A;  5D3W A;  1WVH A;  1FAO A;  2K8E A;  4KAX B;  1ZYI A;  4PQ0 A;  1X11 A;  2K00 A;  2I1K A;  2YT0 A;  2IFS A;  1SGH A;  2D11 A;  4QJ5 B;  3ULB A;  1V5U A;  3KRW A;  2EMT A;  3TVV A;  3RCP A;  4F7U P;  2QKL A;  4CYE A;  1P3R A;  2VRW B;  1ZVR A;  3NWA A;  1NTV A;  2COA A;  1M7R A;  2V76 A;  2D9Z A;  2RGN B;  1UNQ A;  3MPX A;  4GZU A;  2Z0O A;  4EMO A;  1BTN A;  1FGY A;  1K5D B;  3SO6 A;  4HB2 B;  1GC6 A;  4HAT B;  2GCJ A;  2ZPY A;  1QC6 A;  4B6H A;  2Z0P A;  5JP4 A;  2YS1 A;  1FHO A;  2P0H A;  1SHC A;  1EVH A;  3HIE A;  3CIK A;  5D3X A;  2KCJ A;  1V88 A;  4P7I A;  1KI1 B;  2NZ8 B;  2DTC A;  2YSZ A;  4KVG B;  2K2U A;  2Y8G A;  4OSN A;  2MFQ A;  1X05 A;  1BAK A;  3SUZ A;  1DBH A;  5LG4 B;  2K2J A;  3GYO A;  2HE7 A;  5LOP B;  4HSI A;  3ZVR A;  2DHJ A;  5CLQ B;  4IAP A;  4C0A A;  1NTY A;  4MK0 A;  1MAI A;  2YT1 A;  1OMW A;  1K5G B;  3T06 A;  5C5B B;  2XQN M;  3QWM A;  2IYB A;  4A6F B;  1XKE A;  4HDO A;  3OHM B;  3PVW A;  4HDQ A;  1FHX A;  2YVC A;  3PVL A;  3BJI A;  2L1C A;  1FB8 A;  4KHB B;  4TYZ A;  2R0D A;  4A6K A;  5KQ4 A;  1LW3 A;  1MK9 B;  3V5W A;  2J0M A;  2VKI A;  3O96 A;  2FJU B; 
#chains in the Genus database with same CATH homology
 1AQC A;  3FM8 C;  1V61 A;  1MIX A;  4H8S A;  2QKM A;  5FI1 A;  4IOY X;  2MKR A;  3VIA A;  2DKQ A;  3PP2 A;  1U27 A;  2H7E A;  4HAV B;  4HAU B;  1KZG A;  1XD4 A;  4KHO A;  2UZR A;  1UPQ A;  2UVM A;  2ROV A;  5HE1 A;  5HE3 A;  1UNP A;  2D9V A;  1E5W A;  5C16 A;  1WGU A;  3PG7 A;  2ADZ A;  1XR0 B;  1LB1 A;  2COC A;  1DDM A;  1U5G A;  1Y5O A;  1DDV A;  4GPT B;  3KY9 A;  4K17 A;  2P0D A;  2LG1 A;  1TXD A;  4YON A;  2OQB A;  3TO1 A;  1PFJ A;  3M1I B;  2E2X A;  5D3Y A;  4L6E A;  3HK0 A;  4HB0 B;  1ZC3 B;  1U29 A;  1V89 A;  3DXC A;  5HE0 A;  1H10 A;  1J19 A;  2Q13 A;  2Y7B A;  1B55 A;  3SV1 A;  3AJ4 A;  3ODX A;  4CHM A;  3A8Q A;  5J3Y A;  2DN6 A;  1XOD A;  2I5F A;  3IVF A;  1IRS A;  3PEG A;  3WA0 A;  2HTH B;  2RNR B;  5DI9 B;  2CY4 A;  4A6H A;  2RUK B;  3D8F A;  1ZC4 B;  1BTK A;  2DYQ A;  3CXB B;  2GJY A;  1DRO A;  1UEF A;  5FI0 A;  2KGX B;  1NU2 A;  4TKN A;  3ODW A;  2AEH A;  1XCG A;  2D9W A;  2DA0 A;  2AL6 A;  4GN1 A;  3ODO A;  2MWN B;  1DYN A;  5C79 A;  4HAX B;  1V5P A;  5C5B A;  1WG7 A;  1MPH A;  4A6F A;  5C6R A;  3FEH A;  1W1H A;  2G35 A;  2D2Q A;  3QBV B;  2D4Q A;  1BWN A;  4DX9 0;  1OY2 A;  2LYD A;  2MDX A;  3X23 A;  5JLJ B;  2EC1 A;  1P5T A;  3PSC A;  1I2H A;  2NMB A;  3KRX A;  2M38 A;  2COD A;  3U7D A;  4GMV A;  1PLS A;  4BBK A;  1UNR A;  3BIN A;  3VOQ A;  2EMS A;  1M7E A;  2YRY A;  5J3Q A;  3F0W A;  1H4R A;  3A98 B;  3TCA A;  2DKP A;  4Z2N A;  2W2X C;  2GS0 A;  5JHG A;  1EAZ A;  4Y94 A;  2KUP A;  5DIF B;  3HW2 B;  5D27 A;  1WGQ A;  2J0J A;  1AWE A;  1UPR A;  3AU5 A;  4YL8 A;  1X1G A;  4DXA B;  5KCV A;  3AU4 A;  1RJ2 A;  2D10 A;  2COF A;  2J0K A;  1DDW A;  1TQZ A;  2W2X D;  3NSU A;  3ULC A;  4D0N B;  4F7G A;  2X18 A;  2LOX A;  5DHA B;  1GG3 A;  5J3T A;  3OAN A;  2RSG A;  4HB3 B;  5LON B;  2UZS A;  2W2W A;  4Z2M B;  4EJN A;  2I5C A;  4HAY B;  1EGX A;  4HAZ B;  3UZT A;  3LJU X;  3U8Z A;  2RLO A;  3KSY A;  1WJ1 A;  4GXB A;  3QIJ A;  2D9Y A;  1WJM A;  3PZD A;  1EF1 A;  5D3V A;  4IFS A;  2DX5 A;  5DHF B;  2DFK A;  3MDB C;  2Z0Q A;  5CLL B;  4PNK A;  2YS3 A;  2FJL A;  4A5K A;  1ISN A;  1Z87 A;  4K2O A;  2JP2 A;  1PMS A;  2I1J A;  2GCL A;  2YS5 A;  1V5M A;  1FOE A;  2N23 A;  3DXD A;  5DH9 B;  3A8P A;  2RVB B;  1W1D A;  4F7H A;  5JHH A;  4ZRI A;  1U5F A;  1X86 A;  4ZRK A;  4HHV A;  4K81 A;  1ZM0 A;  2H7D A;  1ZSQ A;  2CRF A;  3WYF B;  2P8V A;  1FGZ A;  4WSF A;  4DX8 A;  2M14 A;  1U2B A;  4MT7 A;  1Y19 B;  2J59 M;  1FHW A;  3P7Z A;  3G9W A;  2LKO A;  4NY0 A;  4MY6 A;  4WVF B;  1P6S A;  3TW1 A;  1N3H A;  1OQN A;  3PVU A;  4K2P A;  2CY5 A;  1TJ6 A;  1Q67 A;  1RRP B;  4EKU A;  3SYX A;  2PZ1 A;  3GYP A;  2Y8F A;  3SNH A;  5L81 A;  5HE2 A;  2L2I A;  4NSW A;  2DHK A;  5EFX A;  1MK7 B;  3HQC A;  2EJ8 A;  1U5E A;  2OTX A;  2DYN A;  3N7C A;  4ZRJ A;  4WJ7 A;  4XWX A;  2YF0 A;  1NI2 A;  2ELA A;  3TFM A;  4KHA A;  1J0W A;  3DXE A;  2DHI A;  2R09 A;  2D9X A;  3KZ1 A;  4CHJ A;  2N0Y A;  2CAY A;  5KQ1 A;  2DX1 A;  1W1G A;  2ROZ B;  1MIZ B;  1XX0 A;  4HB4 B;  1MKE A;  1QQG A;  2VSZ A;  5GOW B;  3D8E A;  4GMX B;  4DBB A;  1I7A A;  2ELB A;  2BCJ A;  2DLW A;  1X1F A;  2P0F A;  1WI1 A;  3ZDT A;  1KZ7 A;  2LUL A;  4HAW B;  3F5R A;  3P6A A;  1GC7 A;  3FSS A;  3D8D A;  3ML4 A;  1U5D A;  2LOZ A;  5D3W A;  1WVH A;  1FAO A;  4KAX B;  4PQ0 A;  1X11 A;  2K00 A;  2I1K A;  2YT0 A;  2IFS A;  1SGH A;  2D11 A;  3ULB A;  1V5U A;  3KRW A;  2EMT A;  3TVV A;  3RCP A;  4F7U P;  2QKL A;  4CYE A;  1P3R A;  2VRW B;  1ZVR A;  1NTV A;  2COA A;  1M7R A;  2V76 A;  2D9Z A;  2RGN B;  1UNQ A;  3MPX A;  4GZU A;  2Z0O A;  4EMO A;  1BTN A;  1FGY A;  1K5D B;  3SO6 A;  4HB2 B;  1GC6 A;  4HAT B;  2GCJ A;  2ZPY A;  1QC6 A;  4B6H A;  2Z0P A;  5JP4 A;  2YS1 A;  1FHO A;  2P0H A;  1SHC A;  1EVH A;  3CIK A;  5D3X A;  2KCJ A;  1V88 A;  4P7I A;  1KI1 B;  2NZ8 B;  2DTC A;  2YSZ A;  4KVG B;  2K2U A;  2Y8G A;  2MFQ A;  1X05 A;  1BAK A;  3SUZ A;  1DBH A;  2K2J A;  3GYO A;  2HE7 A;  5LOP B;  3ZVR A;  2DHJ A;  5CLQ B;  4IAP A;  4C0A A;  1NTY A;  4MK0 A;  1MAI A;  2YT1 A;  1OMW A;  1K5G B;  3T06 A;  5C5B B;  2XQN M;  3QWM A;  2IYB A;  4A6F B;  1XKE A;  4HDO A;  3PVW A;  4HDQ A;  1FHX A;  2YVC A;  3PVL A;  3BJI A;  2L1C A;  1FB8 A;  4KHB B;  4TYZ A;  2R0D A;  4A6K A;  5KQ4 A;  1LW3 A;  1MK9 B;  3V5W A;  2J0M A;  2VKI A;  3O96 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...