4Y94A

Crystal structure of the ph-th module of bruton's tyrosine kinase bound to inositol hexakisphosphate
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
167
structure length
158
Chain Sequence
b'ATVILESIFLKRSSPLNFKKRLFLLTVQKLSYYEYDFERGRRGSKKGSIDVEKITCVETVVPEKNPPPERQIPEESSETEQISIIERFPYPFQVVYDEGPLYVFSPTEELRKRWIHQLKNVIRYNSDLVQKYHPCFWIDGQYLCCSQTAKNAMGCQIL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Non-specific protein-tyrosine kinase
molecule tags Transferase
source organism Bos taurus
publication title Autoinhibition of Bruton's tyrosine kinase (Btk) and activation by soluble inositol hexakisphosphate.
pubmed doi rcsb
total genus 28
structure length 158
sequence length 167
chains with identical sequence B, C, D
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2015-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00169 PH PH domain
A PF00779 BTK BTK motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 4y94A00
1V61A 2HTHB 3F5RA 2GJYA 2VRWB 1K5GB 5DHFB 1W1DA 4HAWB 1DDWA 2K00A 1TJ6A 1WG7A 2L1CA 4GN1A 2GCLA 3SNHA 2MFQA 5LONB 4A6FA 1QC6A 4HAUB 2CRFA 2P8VA 1P3RA 3ODXA 1XX0A 3PG7A 3ODOA 5D3YA 1DDMA 5J3YA 1DDVA 3DXDA 2D9WA 2I1KA 1E5WA 4D0NB 2J0JA 4GMVA 2NMBA 1U5DA 4CHJA 4HAYB 5DHAB 3O96A 1Y19B 1Z87A 1LB1A 1FOEA 1I7AA 2P0DA 1NTYA 2R0DA 1FGYA 1X11A 4HAXB 4IOYX 1FHWA 2GS0A 2HE7A 2OQBA 1P6SA 2Q13A 5LOPB 4ZRIA 4DXAB 2Y7BA 2KGXB 1W1HA 2L2IA 4WSFA 4IFSA 1FHXA 1Q67A 2D9YA 3OANA 2DHIA 4EJNA 3DXCA 1RRPB 2DX5A 2ELBA 4HB2B 4F7GA 1KI1B 2NZ8B 1XODA 2D2QA 1GC6A 2RVBB 3VIAA 2VKIA 2X18A 4YL8A 2DHJA 1M7EA 1NI2A 2M38A 2MDXA 3ZDTA 1FAOA 2YT0A 2COAA 4A5KA 3HW2B 2RGNB 5C16A 4K81A 2IYBA 4DX90 1NU2A 2LOZA 3N7CA 1OY2A 3SO6A 5DH9B 1SGHA 4KVGB 1UPRA 2UZSA 3D8EA 2J0MA 4DX8A 3PVUA 2G35A 3FM8C 2D11A 2Z0QA 4F7HA 5JP4A 1ZSQA 4HDQA 2ROVA 4EMOA 5FI0A 1TXDA 1FGZA 1DROA 4HAVB 3TCAA 2LULA 3WA0A 3BINA 1ZC4B 4GZUA 2RNRB 2YRYA 2KCJA 4Z2NA 2DYNA 4BBKA 2M14A 1MIXA 1M7RA 5HE3A 1MIZB 2QKMA 3KRWA 4A6KA 3GYOA 2K2JA 2EMSA 5KCVA 1H10A 2I5FA 1OMWA 3RCPA 2UVMA 1Y5OA 1I2HA 4CYEA 1K5DB 3SV1A 4MT7A 2DKQA 4NY0A 2LOXA 5L81A 4P7IA 5HE2A 1DBHA 1KZGA 2DN6A 2Y8GA 3SUZA 3ZVRA 2EMTA 1MK7B 4CHMA 1U27A 3F0WA 4KHAA 2RUKB 4KHOA 4HDOA 2DX1A 4TKNA 4GPTB 2D9ZA 1TQZA 2CAYA 1U5EA 5JLJB 3QIJA 3HQCA 4KAXB 3X23A 2RLOA 2DHKA 5D3VA 1GC7A 4WJ7A 5D3WA 5JHHA 1XD4A 4Z2MB 1W1GA 2COCA 2KUPA 1V5PA 1U5FA 4F7UP 3AJ4A 4K17A 5JHGA 2AL6A 3TO1A 1X1GA 1PLSA 4K2OA 1UNPA 2N0YA 4TYZA 1WI1A 2DLWA 3IVFA 2W2XD 3D8FA 3NSUA 2LKOA 4HB3B 2I1JA 5HE0A 4HHVA 3BJIA 1X1FA 1GG3A 2MWNB 2LYDA 5CLLB 1AWEA 3AU5A 2W2WA 1UPQA 1LW3A 2D9VA 1DYNA 1WJ1A 2ZPYA 2E2XA 2BCJA 4MY6A 3U8ZA 1PMSA 4H8SA 2Z0PA 3PVLA 4HATB 5J3QA 2Y8FA 1X86A 3ULBA 1QQGA 5C6RA 1UNQA 3TVVA 1BWNA 1V88A 1EVHA 2D10A 2VSZA 1B55A 4PNKA 1X05A 3QWMA 3WYFB 1OQNA 1EGXA 2I5CA 3SYXA 2JP2A 2YS1A 3FEHA 2MKRA 3A8PA 4A6HA 1WJMA 2YF0A 2COFA 4L6EA 2UZRA 3KSYA 1FHOA 1IRSA 2DFKA 4EKUA 1AQCA 1XCGA 3U7DA 4HAZB 2P0FA 3PEGA 2ELAA 2EJ8A 1MKEA 5D27A 1WGQA 4DBBA 1P5TA 3P6AA 3CXBB 2LG1A 2W2XC 1J0WA 3MPXA 1RJ2A 3PZDA 3KY9A 1ISNA 2Z0OA 1NTVA 1PFJA 3ULCA 3VOQA 4GXBA 1V5UA 1ZC3B 4C0AA 5EFXA 4MK0A 1BTKA 2CY5A 1UNRA 1XKEA 3ML4A 4XWXA 2AEHA 2DA0A 3A98B 3TFMA 1BTNA 3LJUX 1V89A 2ROZB 5KQ4A 3PP2A 3KZ1A 5D3XA 2DTCA 2YVCA 2H7EA 4Y94A 5FI1A 1MPHA 1EF1A 3V5WA 1ZVRA 5DI9B 4KHBB 4HB4B 2OTXA 5J3TA 3GYPA 2D9XA 3DXEA 4ZRKA 2N23A 4GMXB 3TW1A 1N3HA 2DKPA 2GCJA 3M1IB 4PQ0A 5GOWB 4HB0B 3FSSA 3CIKA 1H4RA 2YT1A 1MK9B 2PZ1A 1UEFA 3P7ZA 1EAZA 2YSZA 1WGUA 3QBVB 4A6FB 3PVWA 3ODWA 1XR0B 1U5GA 2K2UA 3PSCA 4WVFB 2J0KA 5CLQB 1WVHA 5C5BA 2D4QA 2RSGA 3A8QA 3UZTA 1MAIA 2V76A 2R09A 1KZ7A 3T06A 1U29A 2DYQA 5C5BB 2H7DA 5KQ1A 2J59M 2YS5A 3MDBC 4B6HA 5C79A 1SHCA 1J19A 5HE1A 1BAKA 1V5MA 2ADZA 2QKLA 4IAPA 4K2PA 3KRXA 2EC1A 2IFSA 2FJLA 2CODA 3D8DA 1ZM0A 2CY4A 4NSWA 1FB8A 2YS3A 3AU4A 3HK0A 2XQNM 5DIFB 4YONA 3G9WA 4ZRJA 1U2BA 2P0HA
chains in the Genus database with same CATH superfamily
2GUMA 1V61A 2HTHB 3F5RA 2GJYA 2VRWB 1K5GB 5DHFB 1W1DA 4HAWB 1DDWA 2K00A 1TJ6A 1WG7A 2L1CA 4GN1A 2GCLA 3SNHA 2MFQA 5LONB 4A6FA 1QC6A 4HAUB 2CRFA 2P8VA 1P3RA 3ODXA 2Z4DA 1XX0A 3PG7A 3ODOA 5D3YA 1DDMA 2K49A 1DDVA 5J3YA 2YT2A 3DXDA 5I2MA 2D9WA 2I1KA 1E5WA 4D0NB 2J0JA 4GMVA 2NMBA 1U5DA 4CHJA 4HAYB 5DHAB 3O96A 1Y19B 1Z87A 1LB1A 1FOEA 1I7AA 2P0DA 1NTYA 2R0DA 1FGYA 1X11A 4HAXB 4IOYX 1FHWA 2GS0A 4CSQA 2HE7A 2OQBA 1P6SA 2Q13A 5LOPB 4ZRIA 4DXAB 2Y7BA 2KGXB 1W1HA 1ZYIA 2L2IA 4WSFA 3B77A 4IFSA 1FHXA 1Q67A 2D9YA 3OANA 2DHIA 4EJNA 3DXCA 4L1RA 1RRPB 2DX5A 2ELBA 4HB2B 4F7GA 3NWFA 1KI1B 2NZ8B 1XODA 2D2QA 4OT1A 1GC6A 2RVBB 3VIAA 2VKIA 2X18A 4YL8A 4D6WA 2DHJA 1M7EA 1NI2A 2M38A 2MDXA 3ZDTA 1FAOA 2YT0A 2COAA 4A5KA 3HW2B 2RGNB 5C16A 4K81A 2IYBA 4DX90 3U12A 1NU2A 2LOZA 3N7CA 1OY2A 3SO6A 5DH9B 1SGHA 4KVGB 1UPRA 2UZSA 3D8EA 2J0MA 4DX8A 3PVUA 2G35A 3FM8C 2D11A 2Z0QA 4F7HA 5JP4A 1ZSQA 4HDQA 2ROVA 4EMOA 5FI0A 1TXDA 1FGZA 1DROA 4HAVB 2KR0A 3TCAA 2LULA 3WA0A 3NWDA 2ZKMX 3BINA 3HSAA 1ZC4B 4GZUA 2RNRB 2YRYA 2KCJA 4Z2NA 2DYNA 4BBKA 2M14A 1MIXA 1M7RA 5HE3A 1MIZB 2QKMA 3KRWA 4A6KA 3GYOA 2K2JA 2EMSA 5KCVA 1H10A 2I5FA 1OMWA 3RCPA 2UVMA 1Y5OA 1I2HA 4CYEA 1K5DB 3SV1A 4MT7A 2DKQA 2NBVA 4NY0A 2LOXA 5L81A 4P7IA 5HE2A 1DBHA 1KZGA 2DN6A 2Y8GA 3SUZA 3ZVRA 2EMTA 1MK7B 3OHMB 4CHMA 1U27A 2Z13A 3F0WA 4KHAA 2RUKB 4KHOA 4HDOA 2RRFA 2DX1A 4TKNA 4GPTB 2D9ZA 1TQZA 2CAYA 1U5EA 4QXAB 5JLJB 3QIJA 3HQCA 4KAXB 3X23A 2RLOA 2DHKA 5D3VA 1GC7A 4WJ7A 5D3WA 5JHHA 1XD4A 4Z2MB 5IRSA 1W1GA 2COCA 2KUPA 1V5PA 1U5FA 4F7UP 3AJ4A 4K17A 5JHGA 2AL6A 3TO1A 1X1GA 1PLSA 4K2OA 1UNPA 2N0YA 4TYZA 1WI1A 2DLWA 3IVFA 4QJ3B 2W2XD 3D8FA 3NSUA 4HSIA 2LKOA 4HB3B 2I1JA 5HE0A 2Z14A 4HHVA 3BJIA 1X1FA 1GG3A 2MWNB 2LYDA 5CLLB 1AWEA 3AU5A 4QJ4B 2W2WA 1UPQA 1LW3A 2D9VA 1DYNA 1WJ1A 2ZPYA 2E2XA 2BCJA 4MY6A 3U8ZA 1PMSA 4H8SA 2Z0PA 3PVLA 4HATB 5J3QA 2Y8FA 1X86A 3ULBA 1QQGA 5C6RA 1UNQA 3TVVA 1BWNA 1V88A 1EVHA 2FJUB 3HIEA 2D10A 2VSZA 1B55A 4PNKA 1X05A 3QWMA 3WYFB 1OQNA 1EGXA 2I5CA 3SYXA 2JP2A 2YS1A 3FEHA 2MKRA 3A8PA 4A6HA 1WJMA 2YF0A 2COFA 4L6EA 2UZRA 3KSYA 5LG4B 5M4YB 1FHOA 1IRSA 2DFKA 4EKUA 1AQCA 1XCGA 3U7DA 4HAZB 2P0FA 3PEGA 2ELAA 2KIGA 2EJ8A 4DIXA 1MKEA 3A58A 5D27A 1WGQA 4DBBA 1P5TA 3P6AA 3CXBB 2LG1A 2W2XC 3FVCA 1J0WA 3MPXA 1RJ2A 2K8EA 2Z59A 3PZDA 3KY9A 1ISNA 2Z0OA 1NTVA 1PFJA 2R2YA 3ULCA 3VOQA 4OSNA 4GXBA 1V5UA 1ZC3B 3DCXA 1T77A 4C0AA 5EFXA 4MK0A 1BTKA 2CY5A 1UNRA 1XKEA 5I2SA 3ML4A 4XWXA 2AEHA 2DA0A 3A98B 3TFMA 1BTNA 3LJUX 1V89A 3NWAA 2ROZB 5KQ4A 3PP2A 3KZ1A 5D3XA 2DTCA 2YVCA 2H7EA 4Y94A 2KUQA 5FI1A 1MPHA 1EF1A 3V5WA 1ZVRA 5DI9B 4KHBB 4HB4B 2OTXA 5J3TA 3GYPA 2D9XA 3DXEA 4ZRKA 2N23A 4GMXB 3TW1A 1N3HA 2DKPA 2GCJA 3M1IB 4PQ0A 5GOWB 4HB0B 3FSSA 3CIKA 1H4RA 2YT1A 4GNKB 1MK9B 2PZ1A 1UEFA 3P7ZA 1EAZA 2YSZA 1WGUA 3QBVB 4A6FB 3PVWA 3ODWA 1XR0B 1U5GA 2K2UA 3PSCA 4WVFB 2J0KA 5CLQB 1MI1A 1WVHA 5C5BA 2D4QA 2RSGA 3A8QA 3UZTA 1MAIA 2V76A 2R09A 1KZ7A 3NW8A 3T06A 1U29A 4KHBA 2DYQA 5C5BB 2KIEA 2H7DA 5KQ1A 2J59M 2YS5A 3MDBC 4B6HA 5C79A 1SHCA 1J19A 5HE1A 1BAKA 1V5MA 2ADZA 2QKLA 4IAPA 4K2PA 3KRXA 4QJ5B 2EC1A 2IFSA 2FJLA 2CODA 3D8DA 1ZM0A 2CY4A 4NSWA 1FB8A 2YS3A 3AU4A 3HK0A 4GOUA 2XQNM 5DIFB 4YONA 3G9WA 4ZRJA 1U2BA 2P0HA
chains in the Genus database with same CATH topology
1V61A 2HTHB 3F5RA 2GJYA 2VRWB 1K5GB 5DHFB 1W1DA 4HAWB 1DDWA 2K00A 1TJ6A 1WG7A 2L1CA 4GN1A 2GCLA 3SNHA 2MFQA 5LONB 4A6FA 1QC6A 4HAUB 2CRFA 2P8VA 1P3RA 3ODXA 1XX0A 3PG7A 3ODOA 5D3YA 1DDMA 5J3YA 1DDVA 3DXDA 2D9WA 2I1KA 1E5WA 4D0NB 2J0JA 4GMVA 2NMBA 1U5DA 4CHJA 4HAYB 5DHAB 3O96A 1Y19B 1Z87A 1LB1A 1FOEA 1I7AA 2P0DA 1NTYA 2R0DA 1FGYA 1X11A 4HAXB 4IOYX 1FHWA 2GS0A 2HE7A 2OQBA 1P6SA 2Q13A 5LOPB 4ZRIA 4DXAB 2Y7BA 2KGXB 1W1HA 2L2IA 4WSFA 4IFSA 1FHXA 1Q67A 2D9YA 3OANA 2DHIA 4EJNA 3DXCA 1RRPB 2DX5A 2ELBA 4HB2B 4F7GA 1KI1B 2NZ8B 1XODA 2D2QA 1GC6A 2RVBB 3VIAA 2VKIA 2X18A 4YL8A 2DHJA 1M7EA 1NI2A 2M38A 2MDXA 3ZDTA 1FAOA 2YT0A 2COAA 4A5KA 3HW2B 2RGNB 5C16A 4K81A 2IYBA 4DX90 1NU2A 2LOZA 3N7CA 1OY2A 3SO6A 5DH9B 1SGHA 4KVGB 1UPRA 2UZSA 3D8EA 2J0MA 4DX8A 3PVUA 2G35A 3FM8C 2D11A 2Z0QA 4F7HA 5JP4A 1ZSQA 4HDQA 2ROVA 4EMOA 5FI0A 1TXDA 1FGZA 1DROA 4HAVB 3TCAA 2LULA 3WA0A 3BINA 1ZC4B 4GZUA 2RNRB 2YRYA 2KCJA 4Z2NA 2DYNA 4BBKA 2M14A 1MIXA 1M7RA 5HE3A 1MIZB 2QKMA 3KRWA 4A6KA 3GYOA 2K2JA 2EMSA 5KCVA 1H10A 2I5FA 1OMWA 3RCPA 2UVMA 1Y5OA 1I2HA 4CYEA 1K5DB 3SV1A 4MT7A 2DKQA 4NY0A 2LOXA 5L81A 4P7IA 5HE2A 1DBHA 1KZGA 2DN6A 2Y8GA 3SUZA 3ZVRA 2EMTA 1MK7B 4CHMA 1U27A 3F0WA 4KHAA 2RUKB 4KHOA 4HDOA 2DX1A 4TKNA 4GPTB 2D9ZA 1TQZA 2CAYA 1U5EA 5JLJB 3QIJA 3HQCA 4KAXB 3X23A 2RLOA 2DHKA 5D3VA 1GC7A 4WJ7A 5D3WA 5JHHA 1XD4A 4Z2MB 1W1GA 2COCA 2KUPA 1V5PA 1U5FA 4F7UP 3AJ4A 4K17A 5JHGA 2AL6A 3TO1A 1X1GA 1PLSA 4K2OA 1UNPA 2N0YA 4TYZA 1WI1A 2DLWA 3IVFA 2W2XD 3D8FA 3NSUA 2LKOA 4HB3B 2I1JA 5HE0A 4HHVA 3BJIA 1X1FA 1GG3A 2MWNB 2LYDA 5CLLB 1AWEA 3AU5A 2W2WA 1UPQA 1LW3A 2D9VA 1DYNA 1WJ1A 2ZPYA 2E2XA 2BCJA 4MY6A 3U8ZA 1PMSA 4H8SA 2Z0PA 3PVLA 4HATB 5J3QA 2Y8FA 1X86A 3ULBA 1QQGA 5C6RA 1UNQA 3TVVA 1BWNA 1V88A 1EVHA 2D10A 2VSZA 1B55A 4PNKA 1X05A 3QWMA 3WYFB 1OQNA 1EGXA 2I5CA 3SYXA 2JP2A 2YS1A 3FEHA 2MKRA 3A8PA 4A6HA 1WJMA 2YF0A 2COFA 4L6EA 2UZRA 3KSYA 1FHOA 1IRSA 2DFKA 4EKUA 1AQCA 1XCGA 3U7DA 4HAZB 2P0FA 3PEGA 2ELAA 2EJ8A 1MKEA 5D27A 1WGQA 4DBBA 1P5TA 3P6AA 3CXBB 2LG1A 2W2XC 1J0WA 3MPXA 1RJ2A 3PZDA 3KY9A 1ISNA 2Z0OA 1NTVA 1PFJA 3ULCA 3VOQA 4GXBA 1V5UA 1ZC3B 4C0AA 5EFXA 4MK0A 1BTKA 2CY5A 1UNRA 1XKEA 3ML4A 4XWXA 2AEHA 2DA0A 3A98B 3TFMA 1BTNA 3LJUX 1V89A 2ROZB 5KQ4A 3PP2A 3KZ1A 5D3XA 2DTCA 2YVCA 2H7EA 4Y94A 5FI1A 1MPHA 1EF1A 3V5WA 1ZVRA 5DI9B 4KHBB 4HB4B 2OTXA 5J3TA 3GYPA 2D9XA 3DXEA 4ZRKA 2N23A 4GMXB 3TW1A 1N3HA 2DKPA 2GCJA 3M1IB 4PQ0A 5GOWB 4HB0B 3FSSA 3CIKA 1H4RA 2YT1A 1MK9B 2PZ1A 1UEFA 3P7ZA 1EAZA 2YSZA 1WGUA 3QBVB 4A6FB 3PVWA 3ODWA 1XR0B 1U5GA 2K2UA 3PSCA 4WVFB 2J0KA 5CLQB 1WVHA 5C5BA 2D4QA 2RSGA 3A8QA 3UZTA 1MAIA 2V76A 2R09A 1KZ7A 3T06A 1U29A 2DYQA 5C5BB 2H7DA 5KQ1A 2J59M 2YS5A 3MDBC 4B6HA 5C79A 1SHCA 1J19A 5HE1A 1BAKA 1V5MA 2ADZA 2QKLA 4IAPA 4K2PA 3KRXA 2EC1A 2IFSA 2FJLA 2CODA 3D8DA 1ZM0A 2CY4A 4NSWA 1FB8A 2YS3A 3AU4A 3HK0A 2XQNM 5DIFB 4YONA 3G9WA 4ZRJA 1U2BA 2P0HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1V61 A;  2HTH B;  3F5R A;  2GJY A;  2VRW B;  1K5G B;  5DHF B;  1W1D A;  4HAW B;  1DDW A;  2K00 A;  1TJ6 A;  1WG7 A;  2L1C A;  4GN1 A;  2GCL A;  3SNH A;  2MFQ A;  5LON B;  4A6F A;  1QC6 A;  4HAU B;  2CRF A;  2P8V A;  1P3R A;  3ODX A;  1XX0 A;  3PG7 A;  3ODO A;  5D3Y A;  1DDM A;  5J3Y A;  1DDV A;  3DXD A;  2D9W A;  2I1K A;  1E5W A;  4D0N B;  2J0J A;  4GMV A;  2NMB A;  1U5D A;  4CHJ A;  4HAY B;  5DHA B;  3O96 A;  1Y19 B;  1Z87 A;  1LB1 A;  1FOE A;  1I7A A;  2P0D A;  1NTY A;  2R0D A;  1FGY A;  1X11 A;  4HAX B;  4IOY X;  1FHW A;  2GS0 A;  2HE7 A;  2OQB A;  1P6S A;  2Q13 A;  5LOP B;  4ZRI A;  4DXA B;  2Y7B A;  2KGX B;  1W1H A;  2L2I A;  4WSF A;  4IFS A;  1FHX A;  1Q67 A;  2D9Y A;  3OAN A;  2DHI A;  4EJN A;  3DXC A;  1RRP B;  2DX5 A;  2ELB A;  4HB2 B;  4F7G A;  1KI1 B;  2NZ8 B;  1XOD A;  2D2Q A;  1GC6 A;  2RVB B;  3VIA A;  2VKI A;  2X18 A;  4YL8 A;  2DHJ A;  1M7E A;  1NI2 A;  2M38 A;  2MDX A;  3ZDT A;  1FAO A;  2YT0 A;  2COA A;  4A5K A;  3HW2 B;  2RGN B;  5C16 A;  4K81 A;  2IYB A;  4DX9 0;  1NU2 A;  2LOZ A;  3N7C A;  1OY2 A;  3SO6 A;  5DH9 B;  1SGH A;  4KVG B;  1UPR A;  2UZS A;  3D8E A;  2J0M A;  4DX8 A;  3PVU A;  2G35 A;  3FM8 C;  2D11 A;  2Z0Q A;  4F7H A;  5JP4 A;  1ZSQ A;  4HDQ A;  2ROV A;  4EMO A;  5FI0 A;  1TXD A;  1FGZ A;  1DRO A;  4HAV B;  3TCA A;  2LUL A;  3WA0 A;  3BIN A;  1ZC4 B;  4GZU A;  2RNR B;  2YRY A;  2KCJ A;  4Z2N A;  2DYN A;  4BBK A;  2M14 A;  1MIX A;  1M7R A;  5HE3 A;  1MIZ B;  2QKM A;  3KRW A;  4A6K A;  3GYO A;  2K2J A;  2EMS A;  5KCV A;  1H10 A;  2I5F A;  1OMW A;  3RCP A;  2UVM A;  1Y5O A;  1I2H A;  4CYE A;  1K5D B;  3SV1 A;  4MT7 A;  2DKQ A;  4NY0 A;  2LOX A;  5L81 A;  4P7I A;  5HE2 A;  1DBH A;  1KZG A;  2DN6 A;  2Y8G A;  3SUZ A;  3ZVR A;  2EMT A;  1MK7 B;  4CHM A;  1U27 A;  3F0W A;  4KHA A;  2RUK B;  4KHO A;  4HDO A;  2DX1 A;  4TKN A;  4GPT B;  2D9Z A;  1TQZ A;  2CAY A;  1U5E A;  5JLJ B;  3QIJ A;  3HQC A;  4KAX B;  3X23 A;  2RLO A;  2DHK A;  5D3V A;  1GC7 A;  4WJ7 A;  5D3W A;  5JHH A;  1XD4 A;  4Z2M B;  1W1G A;  2COC A;  2KUP A;  1V5P A;  1U5F A;  4F7U P;  3AJ4 A;  4K17 A;  5JHG A;  2AL6 A;  3TO1 A;  1X1G A;  1PLS A;  4K2O A;  1UNP A;  2N0Y A;  4TYZ A;  1WI1 A;  2DLW A;  3IVF A;  2W2X D;  3D8F A;  3NSU A;  2LKO A;  4HB3 B;  2I1J A;  5HE0 A;  4HHV A;  3BJI A;  1X1F A;  1GG3 A;  2MWN B;  2LYD A;  5CLL B;  1AWE A;  3AU5 A;  2W2W A;  1UPQ A;  1LW3 A;  2D9V A;  1DYN A;  1WJ1 A;  2ZPY A;  2E2X A;  2BCJ A;  4MY6 A;  3U8Z A;  1PMS A;  4H8S A;  2Z0P A;  3PVL A;  4HAT B;  5J3Q A;  2Y8F A;  1X86 A;  3ULB A;  1QQG A;  5C6R A;  1UNQ A;  3TVV A;  1BWN A;  1V88 A;  1EVH A;  2D10 A;  2VSZ A;  1B55 A;  4PNK A;  1X05 A;  3QWM A;  3WYF B;  1OQN A;  1EGX A;  2I5C A;  3SYX A;  2JP2 A;  2YS1 A;  3FEH A;  2MKR A;  3A8P A;  4A6H A;  1WJM A;  2YF0 A;  2COF A;  4L6E A;  2UZR A;  3KSY A;  1FHO A;  1IRS A;  2DFK A;  4EKU A;  1AQC A;  1XCG A;  3U7D A;  4HAZ B;  2P0F A;  3PEG A;  2ELA A;  2EJ8 A;  1MKE A;  5D27 A;  1WGQ A;  4DBB A;  1P5T A;  3P6A A;  3CXB B;  2LG1 A;  2W2X C;  1J0W A;  3MPX A;  1RJ2 A;  3PZD A;  3KY9 A;  1ISN A;  2Z0O A;  1NTV A;  1PFJ A;  3ULC A;  3VOQ A;  4GXB A;  1V5U A;  1ZC3 B;  4C0A A;  5EFX A;  4MK0 A;  1BTK A;  2CY5 A;  1UNR A;  1XKE A;  3ML4 A;  4XWX A;  2AEH A;  2DA0 A;  3A98 B;  3TFM A;  1BTN A;  3LJU X;  1V89 A;  2ROZ B;  5KQ4 A;  3PP2 A;  3KZ1 A;  5D3X A;  2DTC A;  2YVC A;  2H7E A;  4Y94 A;  5FI1 A;  1MPH A;  1EF1 A;  3V5W A;  1ZVR A;  5DI9 B;  4KHB B;  4HB4 B;  2OTX A;  5J3T A;  3GYP A;  2D9X A;  3DXE A;  4ZRK A;  2N23 A;  4GMX B;  3TW1 A;  1N3H A;  2DKP A;  2GCJ A;  3M1I B;  4PQ0 A;  5GOW B;  4HB0 B;  3FSS A;  3CIK A;  1H4R A;  2YT1 A;  1MK9 B;  2PZ1 A;  1UEF A;  3P7Z A;  1EAZ A;  2YSZ A;  1WGU A;  3QBV B;  4A6F B;  3PVW A;  3ODW A;  1XR0 B;  1U5G A;  2K2U A;  3PSC A;  4WVF B;  2J0K A;  5CLQ B;  1WVH A;  5C5B A;  2D4Q A;  2RSG A;  3A8Q A;  3UZT A;  1MAI A;  2V76 A;  2R09 A;  1KZ7 A;  3T06 A;  1U29 A;  2DYQ A;  5C5B B;  2H7D A;  5KQ1 A;  2J59 M;  2YS5 A;  3MDB C;  4B6H A;  5C79 A;  1SHC A;  1J19 A;  5HE1 A;  1BAK A;  1V5M A;  2ADZ A;  2QKL A;  4IAP A;  4K2P A;  3KRX A;  2EC1 A;  2IFS A;  2FJL A;  2COD A;  3D8D A;  1ZM0 A;  2CY4 A;  4NSW A;  1FB8 A;  2YS3 A;  3AU4 A;  3HK0 A;  2XQN M;  5DIF B;  4YON A;  3G9W A;  4ZRJ A;  1U2B A;  2P0H A; 
#chains in the Genus database with same CATH topology
 2GUM A;  1V61 A;  2HTH B;  3F5R A;  2GJY A;  2VRW B;  1K5G B;  5DHF B;  1W1D A;  4HAW B;  1DDW A;  2K00 A;  1TJ6 A;  1WG7 A;  2L1C A;  4GN1 A;  2GCL A;  3SNH A;  2MFQ A;  5LON B;  4A6F A;  1QC6 A;  4HAU B;  2CRF A;  2P8V A;  1P3R A;  3ODX A;  2Z4D A;  1XX0 A;  3PG7 A;  3ODO A;  5D3Y A;  1DDM A;  2K49 A;  1DDV A;  5J3Y A;  2YT2 A;  3DXD A;  5I2M A;  2D9W A;  2I1K A;  1E5W A;  4D0N B;  2J0J A;  4GMV A;  2NMB A;  1U5D A;  4CHJ A;  4HAY B;  5DHA B;  3O96 A;  1Y19 B;  1Z87 A;  1LB1 A;  1FOE A;  1I7A A;  2P0D A;  1NTY A;  2R0D A;  1FGY A;  1X11 A;  4HAX B;  4IOY X;  1FHW A;  2GS0 A;  4CSQ A;  2HE7 A;  2OQB A;  1P6S A;  2Q13 A;  5LOP B;  4ZRI A;  4DXA B;  2Y7B A;  2KGX B;  1W1H A;  1ZYI A;  2L2I A;  4WSF A;  3B77 A;  4IFS A;  1FHX A;  1Q67 A;  2D9Y A;  3OAN A;  2DHI A;  4EJN A;  3DXC A;  4L1R A;  1RRP B;  2DX5 A;  2ELB A;  4HB2 B;  4F7G A;  3NWF A;  1KI1 B;  2NZ8 B;  1XOD A;  2D2Q A;  4OT1 A;  1GC6 A;  2RVB B;  3VIA A;  2VKI A;  2X18 A;  4YL8 A;  4D6W A;  2DHJ A;  1M7E A;  1NI2 A;  2M38 A;  2MDX A;  3ZDT A;  1FAO A;  2YT0 A;  2COA A;  4A5K A;  3HW2 B;  2RGN B;  5C16 A;  4K81 A;  2IYB A;  4DX9 0;  3U12 A;  1NU2 A;  2LOZ A;  3N7C A;  1OY2 A;  3SO6 A;  5DH9 B;  1SGH A;  4KVG B;  1UPR A;  2UZS A;  3D8E A;  2J0M A;  4DX8 A;  3PVU A;  2G35 A;  3FM8 C;  2D11 A;  2Z0Q A;  4F7H A;  5JP4 A;  1ZSQ A;  4HDQ A;  2ROV A;  4EMO A;  5FI0 A;  1TXD A;  1FGZ A;  1DRO A;  4HAV B;  2KR0 A;  3TCA A;  2LUL A;  3WA0 A;  3NWD A;  2ZKM X;  3BIN A;  3HSA A;  1ZC4 B;  4GZU A;  2RNR B;  2YRY A;  2KCJ A;  4Z2N A;  2DYN A;  4BBK A;  2M14 A;  1MIX A;  1M7R A;  5HE3 A;  1MIZ B;  2QKM A;  3KRW A;  4A6K A;  3GYO A;  2K2J A;  2EMS A;  5KCV A;  1H10 A;  2I5F A;  1OMW A;  3RCP A;  2UVM A;  1Y5O A;  1I2H A;  4CYE A;  1K5D B;  3SV1 A;  4MT7 A;  2DKQ A;  2NBV A;  4NY0 A;  2LOX A;  5L81 A;  4P7I A;  5HE2 A;  1DBH A;  1KZG A;  2DN6 A;  2Y8G A;  3SUZ A;  3ZVR A;  2EMT A;  1MK7 B;  3OHM B;  4CHM A;  1U27 A;  2Z13 A;  3F0W A;  4KHA A;  2RUK B;  4KHO A;  4HDO A;  2RRF A;  2DX1 A;  4TKN A;  4GPT B;  2D9Z A;  1TQZ A;  2CAY A;  1U5E A;  4QXA B;  5JLJ B;  3QIJ A;  3HQC A;  4KAX B;  3X23 A;  2RLO A;  2DHK A;  5D3V A;  1GC7 A;  4WJ7 A;  5D3W A;  5JHH A;  1XD4 A;  4Z2M B;  5IRS A;  1W1G A;  2COC A;  2KUP A;  1V5P A;  1U5F A;  4F7U P;  3AJ4 A;  4K17 A;  5JHG A;  2AL6 A;  3TO1 A;  1X1G A;  1PLS A;  4K2O A;  1UNP A;  2N0Y A;  4TYZ A;  1WI1 A;  2DLW A;  3IVF A;  4QJ3 B;  2W2X D;  3D8F A;  3NSU A;  4HSI A;  2LKO A;  4HB3 B;  2I1J A;  5HE0 A;  2Z14 A;  4HHV A;  3BJI A;  1X1F A;  1GG3 A;  2MWN B;  2LYD A;  5CLL B;  1AWE A;  3AU5 A;  4QJ4 B;  2W2W A;  1UPQ A;  1LW3 A;  2D9V A;  1DYN A;  1WJ1 A;  2ZPY A;  2E2X A;  2BCJ A;  4MY6 A;  3U8Z A;  1PMS A;  4H8S A;  2Z0P A;  3PVL A;  4HAT B;  5J3Q A;  2Y8F A;  1X86 A;  3ULB A;  1QQG A;  5C6R A;  1UNQ A;  3TVV A;  1BWN A;  1V88 A;  1EVH A;  2FJU B;  3HIE A;  2D10 A;  2VSZ A;  1B55 A;  4PNK A;  1X05 A;  3QWM A;  3WYF B;  1OQN A;  1EGX A;  2I5C A;  3SYX A;  2JP2 A;  2YS1 A;  3FEH A;  2MKR A;  3A8P A;  4A6H A;  1WJM A;  2YF0 A;  2COF A;  4L6E A;  2UZR A;  3KSY A;  5LG4 B;  5M4Y B;  1FHO A;  1IRS A;  2DFK A;  4EKU A;  1AQC A;  1XCG A;  3U7D A;  4HAZ B;  2P0F A;  3PEG A;  2ELA A;  2KIG A;  2EJ8 A;  4DIX A;  1MKE A;  3A58 A;  5D27 A;  1WGQ A;  4DBB A;  1P5T A;  3P6A A;  3CXB B;  2LG1 A;  2W2X C;  3FVC A;  1J0W A;  3MPX A;  1RJ2 A;  2K8E A;  2Z59 A;  3PZD A;  3KY9 A;  1ISN A;  2Z0O A;  1NTV A;  1PFJ A;  2R2Y A;  3ULC A;  3VOQ A;  4OSN A;  4GXB A;  1V5U A;  1ZC3 B;  3DCX A;  1T77 A;  4C0A A;  5EFX A;  4MK0 A;  1BTK A;  2CY5 A;  1UNR A;  1XKE A;  5I2S A;  3ML4 A;  4XWX A;  2AEH A;  2DA0 A;  3A98 B;  3TFM A;  1BTN A;  3LJU X;  1V89 A;  3NWA A;  2ROZ B;  5KQ4 A;  3PP2 A;  3KZ1 A;  5D3X A;  2DTC A;  2YVC A;  2H7E A;  4Y94 A;  2KUQ A;  5FI1 A;  1MPH A;  1EF1 A;  3V5W A;  1ZVR A;  5DI9 B;  4KHB B;  4HB4 B;  2OTX A;  5J3T A;  3GYP A;  2D9X A;  3DXE A;  4ZRK A;  2N23 A;  4GMX B;  3TW1 A;  1N3H A;  2DKP A;  2GCJ A;  3M1I B;  4PQ0 A;  5GOW B;  4HB0 B;  3FSS A;  3CIK A;  1H4R A;  2YT1 A;  4GNK B;  1MK9 B;  2PZ1 A;  1UEF A;  3P7Z A;  1EAZ A;  2YSZ A;  1WGU A;  3QBV B;  4A6F B;  3PVW A;  3ODW A;  1XR0 B;  1U5G A;  2K2U A;  3PSC A;  4WVF B;  2J0K A;  5CLQ B;  1MI1 A;  1WVH A;  5C5B A;  2D4Q A;  2RSG A;  3A8Q A;  3UZT A;  1MAI A;  2V76 A;  2R09 A;  1KZ7 A;  3NW8 A;  3T06 A;  1U29 A;  4KHB A;  2DYQ A;  5C5B B;  2KIE A;  2H7D A;  5KQ1 A;  2J59 M;  2YS5 A;  3MDB C;  4B6H A;  5C79 A;  1SHC A;  1J19 A;  5HE1 A;  1BAK A;  1V5M A;  2ADZ A;  2QKL A;  4IAP A;  4K2P A;  3KRX A;  4QJ5 B;  2EC1 A;  2IFS A;  2FJL A;  2COD A;  3D8D A;  1ZM0 A;  2CY4 A;  4NSW A;  1FB8 A;  2YS3 A;  3AU4 A;  3HK0 A;  4GOU A;  2XQN M;  5DIF B;  4YON A;  3G9W A;  4ZRJ A;  1U2B A;  2P0H A; 
#chains in the Genus database with same CATH homology
 1V61 A;  2HTH B;  3F5R A;  2GJY A;  2VRW B;  1K5G B;  5DHF B;  1W1D A;  4HAW B;  1DDW A;  2K00 A;  1TJ6 A;  1WG7 A;  2L1C A;  4GN1 A;  2GCL A;  3SNH A;  2MFQ A;  5LON B;  4A6F A;  1QC6 A;  4HAU B;  2CRF A;  2P8V A;  1P3R A;  3ODX A;  1XX0 A;  3PG7 A;  3ODO A;  5D3Y A;  1DDM A;  5J3Y A;  1DDV A;  3DXD A;  2D9W A;  2I1K A;  1E5W A;  4D0N B;  2J0J A;  4GMV A;  2NMB A;  1U5D A;  4CHJ A;  4HAY B;  5DHA B;  3O96 A;  1Y19 B;  1Z87 A;  1LB1 A;  1FOE A;  1I7A A;  2P0D A;  1NTY A;  2R0D A;  1FGY A;  1X11 A;  4HAX B;  4IOY X;  1FHW A;  2GS0 A;  2HE7 A;  2OQB A;  1P6S A;  2Q13 A;  5LOP B;  4ZRI A;  4DXA B;  2Y7B A;  2KGX B;  1W1H A;  2L2I A;  4WSF A;  4IFS A;  1FHX A;  1Q67 A;  2D9Y A;  3OAN A;  2DHI A;  4EJN A;  3DXC A;  1RRP B;  2DX5 A;  2ELB A;  4HB2 B;  4F7G A;  1KI1 B;  2NZ8 B;  1XOD A;  2D2Q A;  1GC6 A;  2RVB B;  3VIA A;  2VKI A;  2X18 A;  4YL8 A;  2DHJ A;  1M7E A;  1NI2 A;  2M38 A;  2MDX A;  3ZDT A;  1FAO A;  2YT0 A;  2COA A;  4A5K A;  3HW2 B;  2RGN B;  5C16 A;  4K81 A;  2IYB A;  4DX9 0;  1NU2 A;  2LOZ A;  3N7C A;  1OY2 A;  3SO6 A;  5DH9 B;  1SGH A;  4KVG B;  1UPR A;  2UZS A;  3D8E A;  2J0M A;  4DX8 A;  3PVU A;  2G35 A;  3FM8 C;  2D11 A;  2Z0Q A;  4F7H A;  5JP4 A;  1ZSQ A;  4HDQ A;  2ROV A;  4EMO A;  5FI0 A;  1TXD A;  1FGZ A;  1DRO A;  4HAV B;  3TCA A;  2LUL A;  3WA0 A;  3BIN A;  1ZC4 B;  4GZU A;  2RNR B;  2YRY A;  2KCJ A;  4Z2N A;  2DYN A;  4BBK A;  2M14 A;  1MIX A;  1M7R A;  5HE3 A;  1MIZ B;  2QKM A;  3KRW A;  4A6K A;  3GYO A;  2K2J A;  2EMS A;  5KCV A;  1H10 A;  2I5F A;  1OMW A;  3RCP A;  2UVM A;  1Y5O A;  1I2H A;  4CYE A;  1K5D B;  3SV1 A;  4MT7 A;  2DKQ A;  4NY0 A;  2LOX A;  5L81 A;  4P7I A;  5HE2 A;  1DBH A;  1KZG A;  2DN6 A;  2Y8G A;  3SUZ A;  3ZVR A;  2EMT A;  1MK7 B;  4CHM A;  1U27 A;  3F0W A;  4KHA A;  2RUK B;  4KHO A;  4HDO A;  2DX1 A;  4TKN A;  4GPT B;  2D9Z A;  1TQZ A;  2CAY A;  1U5E A;  5JLJ B;  3QIJ A;  3HQC A;  4KAX B;  3X23 A;  2RLO A;  2DHK A;  5D3V A;  1GC7 A;  4WJ7 A;  5D3W A;  5JHH A;  1XD4 A;  4Z2M B;  1W1G A;  2COC A;  2KUP A;  1V5P A;  1U5F A;  4F7U P;  3AJ4 A;  4K17 A;  5JHG A;  2AL6 A;  3TO1 A;  1X1G A;  1PLS A;  4K2O A;  1UNP A;  2N0Y A;  4TYZ A;  1WI1 A;  2DLW A;  3IVF A;  2W2X D;  3D8F A;  3NSU A;  2LKO A;  4HB3 B;  2I1J A;  5HE0 A;  4HHV A;  3BJI A;  1X1F A;  1GG3 A;  2MWN B;  2LYD A;  5CLL B;  1AWE A;  3AU5 A;  2W2W A;  1UPQ A;  1LW3 A;  2D9V A;  1DYN A;  1WJ1 A;  2ZPY A;  2E2X A;  2BCJ A;  4MY6 A;  3U8Z A;  1PMS A;  4H8S A;  2Z0P A;  3PVL A;  4HAT B;  5J3Q A;  2Y8F A;  1X86 A;  3ULB A;  1QQG A;  5C6R A;  1UNQ A;  3TVV A;  1BWN A;  1V88 A;  1EVH A;  2D10 A;  2VSZ A;  1B55 A;  4PNK A;  1X05 A;  3QWM A;  3WYF B;  1OQN A;  1EGX A;  2I5C A;  3SYX A;  2JP2 A;  2YS1 A;  3FEH A;  2MKR A;  3A8P A;  4A6H A;  1WJM A;  2YF0 A;  2COF A;  4L6E A;  2UZR A;  3KSY A;  1FHO A;  1IRS A;  2DFK A;  4EKU A;  1AQC A;  1XCG A;  3U7D A;  4HAZ B;  2P0F A;  3PEG A;  2ELA A;  2EJ8 A;  1MKE A;  5D27 A;  1WGQ A;  4DBB A;  1P5T A;  3P6A A;  3CXB B;  2LG1 A;  2W2X C;  1J0W A;  3MPX A;  1RJ2 A;  3PZD A;  3KY9 A;  1ISN A;  2Z0O A;  1NTV A;  1PFJ A;  3ULC A;  3VOQ A;  4GXB A;  1V5U A;  1ZC3 B;  4C0A A;  5EFX A;  4MK0 A;  1BTK A;  2CY5 A;  1UNR A;  1XKE A;  3ML4 A;  4XWX A;  2AEH A;  2DA0 A;  3A98 B;  3TFM A;  1BTN A;  3LJU X;  1V89 A;  2ROZ B;  5KQ4 A;  3PP2 A;  3KZ1 A;  5D3X A;  2DTC A;  2YVC A;  2H7E A;  4Y94 A;  5FI1 A;  1MPH A;  1EF1 A;  3V5W A;  1ZVR A;  5DI9 B;  4KHB B;  4HB4 B;  2OTX A;  5J3T A;  3GYP A;  2D9X A;  3DXE A;  4ZRK A;  2N23 A;  4GMX B;  3TW1 A;  1N3H A;  2DKP A;  2GCJ A;  3M1I B;  4PQ0 A;  5GOW B;  4HB0 B;  3FSS A;  3CIK A;  1H4R A;  2YT1 A;  1MK9 B;  2PZ1 A;  1UEF A;  3P7Z A;  1EAZ A;  2YSZ A;  1WGU A;  3QBV B;  4A6F B;  3PVW A;  3ODW A;  1XR0 B;  1U5G A;  2K2U A;  3PSC A;  4WVF B;  2J0K A;  5CLQ B;  1WVH A;  5C5B A;  2D4Q A;  2RSG A;  3A8Q A;  3UZT A;  1MAI A;  2V76 A;  2R09 A;  1KZ7 A;  3T06 A;  1U29 A;  2DYQ A;  5C5B B;  2H7D A;  5KQ1 A;  2J59 M;  2YS5 A;  3MDB C;  4B6H A;  5C79 A;  1SHC A;  1J19 A;  5HE1 A;  1BAK A;  1V5M A;  2ADZ A;  2QKL A;  4IAP A;  4K2P A;  3KRX A;  2EC1 A;  2IFS A;  2FJL A;  2COD A;  3D8D A;  1ZM0 A;  2CY4 A;  4NSW A;  1FB8 A;  2YS3 A;  3AU4 A;  3HK0 A;  2XQN M;  5DIF B;  4YON A;  3G9W A;  4ZRJ A;  1U2B A;  2P0H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...