2VKIA

Structure of the pdk1 ph domain k465e mutant
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
139
structure length
139
Chain Sequence
SNIEQYIHDLDSNSFELDLQFSEDEKRLLLEKQAGGNPWHQFVENNLILKMGPVDERKGLFARRRQLLLTEGPHLYYVDPVNKVLKGEIPWSQELRPEAKNFKTFFVHTPNRTYYLMDPSGNAHKWCRKIQEVWRQRYQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Mutation of the Pdk1 Ph Domain Inhibits Protein Kinase B/Akt, Leading to Small Size and Insulin Resistance.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords 3-PHOPSHOINOSITIDE DEPENDENT PROTEIN KINASE 1
total genus 39
structure length 139
sequence length 139
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2007-12-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14593 PH_3 PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2vkiA00
4EMOA 4HAXB 1XCGA 5D3YA 4KHBB 3A8PA 5JHHA 5C5BA 2CAYA 5C6RA 2P0DA 4A6FA 2L2IA 4HAUB 1QQGA 1X86A 4YL8A 1I7AA 4WVFB 2ELAA 4DX8A 2YF0A 1MK9B 1W1HA 4KAXB 4F7UP 5FI1A 4HB4B 4P7IA 3BINA 5C79A 2AEHA 2I5FA 2MDXA 1MIXA 2AL6A 3ULBA 1FHWA 1PMSA 2YS1A 1OQNA 2N0YA 5D27A 2MFQA 2Z0OA 2XQNM 1UPRA 2IYBA 1FB8A 2Y8GA 1WG7A 3AU4A 5HE2A 1V89A 1B55A 2R0DA 5EFXA 2K2JA 1W1DA 1K5GB 1V61A 1E5WA 2K00A 3KZ1A 1UPQA 4PQ0A 4GMXB 3KY9A 5DIFB 1ISNA 1P3RA 3G9WA 3T06A 2I1JA 2RLOA 4GPTB 2M14A 2RNRB 2D10A 2EC1A 2JP2A 5J3QA 1DBHA 1NTVA 2LKOA 1BTKA 1U5EA 3F5RA 2K2UA 2Q13A 1WGQA 3X23A 1P6SA 4K2OA 2D9ZA 1H10A 2R09A 3A8QA 2DYNA 5DI9B 2DA0A 4A6FB 5L81A 2MKRA 2RUKB 5C5BB 2X18A 3CXBB 2MWNB 5JP4A 2QKLA 1KI1B 3UZTA 2EJ8A 3A98B 4Z2MB 3QBVB 4HAVB 4K2PA 2GCJA 1EAZA 5D3WA 1Z87A 4PNKA 3TO1A 3TW1A 1UNQA 1FGZA 1XR0B 4Y94A 2QKMA 1LB1A 1UEFA 2PZ1A 2DN6A 5J3YA 4TYZA 4GZUA 1WJ1A 1GG3A 1J19A 4L6EA 5JHGA 1OY2A 3PVUA 3HK0A 1AQCA 4GXBA 5KQ4A 2D4QA 1FOEA 3KRXA 4MT7A 5D3XA 3PEGA 3TFMA 2DX1A 2DTCA 1ZC3B 2HTHB 2NZ8B 2CODA 2YT1A 2BCJA 4HB0B 2RSGA 2GS0A 5LONB 1K5DB 1QC6A 2D9WA 2I1KA 2ROZB 2DLWA 3TVVA 3ULCA 2Y7BA 4HATB 3ODWA 2ADZA 2M38A 4Z2NA 1NU2A 3O96A 1EVHA 1MAIA 1U5DA 1TXDA 3D8EA 3VOQA 4GMVA 2VSZA 2DX5A 2YT0A 1H4RA 3FSSA 1KZGA 1WGUA 3V5WA 2COAA 1XD4A 1X1FA 4K17A 1FGYA 4HHVA 1U5FA 1DDWA 4BBKA 5HE1A 1DDVA 1V5MA 4CYEA 2FJLA 3MDBC 2D9XA 2EMSA 4IFSA 4WSFA 3P6AA 2VKIA 1WVHA 4HB3B 4IOYX 1RJ2A 2L1CA 3N7CA 2NMBA 2W2XC 2GJYA 1DYNA 3IVFA 1WI1A 3AJ4A 1U29A 3GYOA 2UVMA 3KRWA 4HDQA 4DX90 4HAYB 1W1GA 2YVCA 2IFSA 2ZPYA 3SV1A 1AWEA 3D8FA 3P7ZA 5C16A 2KGXB 2CY4A 4ZRKA 3SYXA 4K81A 1N3HA 2OTXA 1SHCA 1MPHA 4NY0A 3ML4A 1V88A 2J59M 4D0NB 2RVBB 2UZSA 4CHMA 1FAOA 1X1GA 3PP2A 2UZRA 1Y5OA 4GN1A 1RRPB 5DH9B 4HB2B 1DDMA 2J0MA 1TJ6A 3ZDTA 5KCVA 2KCJA 4KVGB 5J3TA 2I5CA 2EMTA 2DKQA 4DXAB 1XX0A 1UNPA 1MIZB 2DHIA 2D9YA 2DHJA 5HE0A 5D3VA 1U27A 4MK0A 3LJUX 4TKNA 1BAKA 3DXDA 3SNHA 1NI2A 2COFA 4HAWB 4A6KA 1BTNA 3ODXA 4XWXA 4WJ7A 3OANA 2LOZA 1LW3A 4EJNA 4F7GA 2YSZA 1Y19B 5LOPB 3DXEA 3ZVRA 4CHJA 2CRFA 1KZ7A 3QWMA 5CLLB 1NTYA 2COCA 3HQCA 4F7HA 3FM8C 1XODA 3PSCA 3QIJA 1IRSA 4KHAA 1GC7A 2DYQA 5CLQB 1EF1A 4A6HA 2G35A 1BWNA 2DKPA 3PG7A 1WJMA 5DHAB 1M7EA 3PZDA 2LOXA 1P5TA 2LYDA 5KQ1A 3RCPA 3WYFB 1X05A 3VIAA 1FHOA 2D11A 2ROVA 2W2WA 1DROA 1J0WA 5DHFB 2D9VA 1EGXA 1OMWA 2V76A 3M1IB 3MPXA 5JLJB 2RGNB 3FEHA 3TCAA 1UNRA 2H7EA 3AU5A 2LULA 5FI0A 2YS3A 2KUPA 3PVWA 2YRYA 1PLSA 1XKEA 2E2XA 1MK7B 3KSYA 4HDOA 2J0KA 2Z0QA 2P8VA 3BJIA 2P0HA 1X11A 4C0AA 4MY6A 2DHKA 1M7RA 1U2BA 3GYPA 4YONA 3CIKA 1SGHA 2OQBA 1GC6A 2ELBA 3HW2B 2CY5A 2Y8FA 2DFKA 5HE3A 4KHOA 4DBBA 4B6HA 4HAZB 2GCLA 2VRWB 2W2XD 4ZRJA 1ZM0A 2Z0PA 1MKEA 3SO6A 3SUZA 3U8ZA 3WA0A 1ZSQA 4ZRIA 1ZVRA 2LG1A 3PVLA 2J0JA 1Q67A 3DXCA 1I2HA 3D8DA 1V5PA 1PFJA 2HE7A 3NSUA 1ZC4B 3F0WA 2YS5A 2P0FA 4A5KA 1V5UA 1U5GA 2H7DA 3ODOA 1FHXA 4EKUA 1TQZA 2D2QA 2N23A 3U7DA 4NSWA 4IAPA 5GOWB 4H8SA
chains in the Genus database with same CATH superfamily
4EMOA 4HAXB 1XCGA 5D3YA 4KHBB 3A8PA 5JHHA 5C5BA 2YT2A 2CAYA 5C6RA 2P0DA 4A6FA 2L2IA 4HAUB 1QQGA 1X86A 4YL8A 1I7AA 4WVFB 2ELAA 3HSAA 4DX8A 2YF0A 1MK9B 1W1HA 4KAXB 4F7UP 5FI1A 4HB4B 4P7IA 3BINA 1T77A 5C79A 2AEHA 2I5FA 2MDXA 1MIXA 2AL6A 3ULBA 1FHWA 1PMSA 2YS1A 1OQNA 2N0YA 5D27A 2MFQA 2Z0OA 2XQNM 1UPRA 2IYBA 1FB8A 2Y8GA 1WG7A 3AU4A 5HE2A 1V89A 1B55A 2R0DA 5EFXA 2K2JA 1W1DA 1K5GB 1V61A 1E5WA 2K00A 3KZ1A 1UPQA 4PQ0A 4HSIA 4GMXB 3KY9A 5DIFB 1ISNA 1P3RA 3G9WA 3T06A 2I1JA 3NW8A 2RLOA 4GPTB 2M14A 3NWFA 2RNRB 2D10A 2R2YA 2EC1A 2JP2A 5J3QA 1DBHA 2K49A 1NTVA 2LKOA 1BTKA 1U5EA 3F5RA 2K2UA 2Q13A 1WGQA 2KUQA 3X23A 1P6SA 2KIGA 4K2OA 2D9ZA 1H10A 2R09A 4QJ4B 3A8QA 2DYNA 5DI9B 2DA0A 4A6FB 5L81A 2MKRA 2RUKB 5C5BB 4KHBA 2X18A 2GUMA 3CXBB 2MWNB 5JP4A 2QKLA 1KI1B 3UZTA 2EJ8A 3A98B 4Z2MB 3QBVB 4HAVB 4K2PA 2GCJA 1EAZA 5D3WA 1Z87A 3OHMB 4PNKA 3TO1A 3TW1A 1UNQA 1FGZA 1XR0B 4Y94A 2QKMA 3DCXA 1LB1A 1UEFA 2PZ1A 2DN6A 5J3YA 4TYZA 2Z13A 4GZUA 1WJ1A 1GG3A 1J19A 4L6EA 5JHGA 1OY2A 3PVUA 5I2MA 3HK0A 1AQCA 4GXBA 5KQ4A 1ZYIA 1FOEA 2D4QA 3KRXA 3NWDA 4MT7A 5D3XA 3PEGA 3TFMA 2DX1A 2DTCA 1ZC3B 2HTHB 2NZ8B 2CODA 2YT1A 2BCJA 4HB0B 2RSGA 2GS0A 5LONB 1K5DB 1QC6A 2D9WA 2I1KA 2ROZB 2DLWA 3TVVA 3ULCA 2Y7BA 4HATB 3ODWA 2ADZA 2M38A 4Z2NA 1NU2A 3O96A 1EVHA 1MAIA 1U5DA 1TXDA 3D8EA 3VOQA 4GMVA 2VSZA 2DX5A 2YT0A 1H4RA 3FSSA 1KZGA 1WGUA 3V5WA 2COAA 1XD4A 1X1FA 4K17A 1FGYA 4HHVA 1U5FA 1DDWA 4BBKA 5HE1A 1DDVA 1V5MA 2K8EA 4CYEA 2FJLA 3MDBC 2D9XA 2EMSA 4IFSA 4WSFA 2Z59A 3P6AA 2VKIA 1WVHA 4L1RA 4HB3B 4IOYX 1RJ2A 4DIXA 2L1CA 2NBVA 3N7CA 4OT1A 2NMBA 2W2XC 2GJYA 1DYNA 3IVFA 1WI1A 3AJ4A 1U29A 3GYOA 2UVMA 3KRWA 4HDQA 4DX90 4HAYB 1W1GA 2YVCA 2IFSA 2ZPYA 3SV1A 1AWEA 4OSNA 3D8FA 3B77A 3P7ZA 5C16A 2KGXB 4QJ3B 2CY4A 4ZRKA 3SYXA 4K81A 1N3HA 2OTXA 1SHCA 1MPHA 4NY0A 3ML4A 1V88A 2J59M 4D0NB 2RVBB 2UZSA 4CHMA 1FAOA 1X1GA 3PP2A 4GOUA 2UZRA 1MI1A 4GNKB 1Y5OA 4GN1A 1RRPB 5DH9B 4HB2B 1DDMA 2J0MA 1TJ6A 3NWAA 5IRSA 3ZDTA 5KCVA 2KCJA 4KVGB 5J3TA 2I5CA 2EMTA 2DKQA 4DXAB 1XX0A 1UNPA 1MIZB 2DHIA 2D9YA 2DHJA 5HE0A 5D3VA 1U27A 4MK0A 3LJUX 4TKNA 1BAKA 2Z14A 3DXDA 3SNHA 1NI2A 2COFA 4HAWB 4A6KA 1BTNA 3ODXA 4XWXA 4WJ7A 5I2SA 3OANA 4D6WA 2ZKMX 2LOZA 1LW3A 4EJNA 4F7GA 2YSZA 1Y19B 5LOPB 3DXEA 3ZVRA 4CHJA 2CRFA 1KZ7A 3QWMA 2FJUB 5CLLB 1NTYA 2COCA 3HQCA 4QXAB 4F7HA 3FM8C 1XODA 3PSCA 3HIEA 3QIJA 1IRSA 4KHAA 1GC7A 2DYQA 5CLQB 1EF1A 4A6HA 2G35A 4CSQA 1BWNA 2DKPA 3PG7A 1WJMA 5DHAB 1M7EA 3PZDA 2LOXA 1P5TA 2LYDA 5KQ1A 3RCPA 3WYFB 1X05A 3VIAA 1FHOA 2KIEA 2D11A 2ROVA 2W2WA 1DROA 5LG4B 1J0WA 5DHFB 2D9VA 1EGXA 1OMWA 2V76A 3M1IB 3MPXA 5JLJB 2RGNB 3FEHA 3TCAA 1UNRA 2H7EA 5M4YB 3AU5A 2LULA 5FI0A 2YS3A 2KUPA 3PVWA 2YRYA 2RRFA 1PLSA 1XKEA 2E2XA 1MK7B 3KSYA 4HDOA 2J0KA 2Z0QA 2P8VA 3BJIA 2P0HA 1X11A 4C0AA 4MY6A 2DHKA 1M7RA 1U2BA 3GYPA 4YONA 3CIKA 1SGHA 2OQBA 1GC6A 2ELBA 3HW2B 2CY5A 2Y8FA 2DFKA 5HE3A 4KHOA 4DBBA 4B6HA 4HAZB 2GCLA 2VRWB 2W2XD 4ZRJA 1ZM0A 2Z0PA 1MKEA 3SO6A 3SUZA 3U8ZA 3WA0A 1ZSQA 2Z4DA 2KR0A 4QJ5B 4ZRIA 1ZVRA 2LG1A 3PVLA 2J0JA 1Q67A 3DXCA 1I2HA 3D8DA 1V5PA 1PFJA 2HE7A 3NSUA 1ZC4B 3A58A 3F0WA 2YS5A 2P0FA 4A5KA 1V5UA 1U5GA 2H7DA 3ODOA 1FHXA 3FVCA 4EKUA 1TQZA 2D2QA 2N23A 3U7DA 4NSWA 4IAPA 5GOWB 4H8SA 3U12A
chains in the Genus database with same CATH topology
4EMOA 4HAXB 1XCGA 5D3YA 4KHBB 3A8PA 5JHHA 5C5BA 2CAYA 5C6RA 2P0DA 4A6FA 2L2IA 4HAUB 1QQGA 1X86A 4YL8A 1I7AA 4WVFB 2ELAA 4DX8A 2YF0A 1MK9B 1W1HA 4KAXB 4F7UP 5FI1A 4HB4B 4P7IA 3BINA 5C79A 2AEHA 2I5FA 2MDXA 1MIXA 2AL6A 3ULBA 1FHWA 1PMSA 2YS1A 1OQNA 2N0YA 5D27A 2MFQA 2Z0OA 2XQNM 1UPRA 2IYBA 1FB8A 2Y8GA 1WG7A 3AU4A 5HE2A 1V89A 1B55A 2R0DA 5EFXA 2K2JA 1W1DA 1K5GB 1V61A 1E5WA 2K00A 3KZ1A 1UPQA 4PQ0A 4GMXB 3KY9A 5DIFB 1ISNA 1P3RA 3G9WA 3T06A 2I1JA 2RLOA 4GPTB 2M14A 2RNRB 2D10A 2EC1A 2JP2A 5J3QA 1DBHA 1NTVA 2LKOA 1BTKA 1U5EA 3F5RA 2K2UA 2Q13A 1WGQA 3X23A 1P6SA 4K2OA 2D9ZA 1H10A 2R09A 3A8QA 2DYNA 5DI9B 2DA0A 4A6FB 5L81A 2MKRA 2RUKB 5C5BB 2X18A 3CXBB 2MWNB 5JP4A 2QKLA 1KI1B 3UZTA 2EJ8A 3A98B 4Z2MB 3QBVB 4HAVB 4K2PA 2GCJA 1EAZA 5D3WA 1Z87A 4PNKA 3TO1A 3TW1A 1UNQA 1FGZA 1XR0B 4Y94A 2QKMA 1LB1A 1UEFA 2PZ1A 2DN6A 5J3YA 4TYZA 4GZUA 1WJ1A 1GG3A 1J19A 4L6EA 5JHGA 1OY2A 3PVUA 3HK0A 1AQCA 4GXBA 5KQ4A 2D4QA 1FOEA 3KRXA 4MT7A 5D3XA 3PEGA 3TFMA 2DX1A 2DTCA 1ZC3B 2HTHB 2NZ8B 2CODA 2YT1A 2BCJA 4HB0B 2RSGA 2GS0A 5LONB 1K5DB 1QC6A 2D9WA 2I1KA 2ROZB 2DLWA 3TVVA 3ULCA 2Y7BA 4HATB 3ODWA 2ADZA 2M38A 4Z2NA 1NU2A 3O96A 1EVHA 1MAIA 1U5DA 1TXDA 3D8EA 3VOQA 4GMVA 2VSZA 2DX5A 2YT0A 1H4RA 3FSSA 1KZGA 1WGUA 3V5WA 2COAA 1XD4A 1X1FA 4K17A 1FGYA 4HHVA 1U5FA 1DDWA 4BBKA 5HE1A 1DDVA 1V5MA 4CYEA 2FJLA 3MDBC 2D9XA 2EMSA 4IFSA 4WSFA 3P6AA 2VKIA 1WVHA 4HB3B 4IOYX 1RJ2A 2L1CA 3N7CA 2NMBA 2W2XC 2GJYA 1DYNA 3IVFA 1WI1A 3AJ4A 1U29A 3GYOA 2UVMA 3KRWA 4HDQA 4DX90 4HAYB 1W1GA 2YVCA 2IFSA 2ZPYA 3SV1A 1AWEA 3D8FA 3P7ZA 5C16A 2KGXB 2CY4A 4ZRKA 3SYXA 4K81A 1N3HA 2OTXA 1SHCA 1MPHA 4NY0A 3ML4A 1V88A 2J59M 4D0NB 2RVBB 2UZSA 4CHMA 1FAOA 1X1GA 3PP2A 2UZRA 1Y5OA 4GN1A 1RRPB 5DH9B 4HB2B 1DDMA 2J0MA 1TJ6A 3ZDTA 5KCVA 2KCJA 4KVGB 5J3TA 2I5CA 2EMTA 2DKQA 4DXAB 1XX0A 1UNPA 1MIZB 2DHIA 2D9YA 2DHJA 5HE0A 5D3VA 1U27A 4MK0A 3LJUX 4TKNA 1BAKA 3DXDA 3SNHA 1NI2A 2COFA 4HAWB 4A6KA 1BTNA 3ODXA 4XWXA 4WJ7A 3OANA 2LOZA 1LW3A 4EJNA 4F7GA 2YSZA 1Y19B 5LOPB 3DXEA 3ZVRA 4CHJA 2CRFA 1KZ7A 3QWMA 5CLLB 1NTYA 2COCA 3HQCA 4F7HA 3FM8C 1XODA 3PSCA 3QIJA 1IRSA 4KHAA 1GC7A 2DYQA 5CLQB 1EF1A 4A6HA 2G35A 1BWNA 2DKPA 3PG7A 1WJMA 5DHAB 1M7EA 3PZDA 2LOXA 1P5TA 2LYDA 5KQ1A 3RCPA 3WYFB 1X05A 3VIAA 1FHOA 2D11A 2ROVA 2W2WA 1DROA 1J0WA 5DHFB 2D9VA 1EGXA 1OMWA 2V76A 3M1IB 3MPXA 5JLJB 2RGNB 3FEHA 3TCAA 1UNRA 2H7EA 3AU5A 2LULA 5FI0A 2YS3A 2KUPA 3PVWA 2YRYA 1PLSA 1XKEA 2E2XA 1MK7B 3KSYA 4HDOA 2J0KA 2Z0QA 2P8VA 3BJIA 2P0HA 1X11A 4C0AA 4MY6A 2DHKA 1M7RA 1U2BA 3GYPA 4YONA 3CIKA 1SGHA 2OQBA 1GC6A 2ELBA 3HW2B 2CY5A 2Y8FA 2DFKA 5HE3A 4KHOA 4DBBA 4B6HA 4HAZB 2GCLA 2VRWB 2W2XD 4ZRJA 1ZM0A 2Z0PA 1MKEA 3SO6A 3SUZA 3U8ZA 3WA0A 1ZSQA 4ZRIA 1ZVRA 2LG1A 3PVLA 2J0JA 1Q67A 3DXCA 1I2HA 3D8DA 1V5PA 1PFJA 2HE7A 3NSUA 1ZC4B 3F0WA 2YS5A 2P0FA 4A5KA 1V5UA 1U5GA 2H7DA 3ODOA 1FHXA 4EKUA 1TQZA 2D2QA 2N23A 3U7DA 4NSWA 4IAPA 5GOWB 4H8SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4EMO A;  4HAX B;  1XCG A;  5D3Y A;  4KHB B;  3A8P A;  5JHH A;  5C5B A;  2CAY A;  5C6R A;  2P0D A;  4A6F A;  2L2I A;  4HAU B;  1QQG A;  1X86 A;  4YL8 A;  1I7A A;  4WVF B;  2ELA A;  4DX8 A;  2YF0 A;  1MK9 B;  1W1H A;  4KAX B;  4F7U P;  5FI1 A;  4HB4 B;  4P7I A;  3BIN A;  5C79 A;  2AEH A;  2I5F A;  2MDX A;  1MIX A;  2AL6 A;  3ULB A;  1FHW A;  1PMS A;  2YS1 A;  1OQN A;  2N0Y A;  5D27 A;  2MFQ A;  2Z0O A;  2XQN M;  1UPR A;  2IYB A;  1FB8 A;  2Y8G A;  1WG7 A;  3AU4 A;  5HE2 A;  1V89 A;  1B55 A;  2R0D A;  5EFX A;  2K2J A;  1W1D A;  1K5G B;  1V61 A;  1E5W A;  2K00 A;  3KZ1 A;  1UPQ A;  4PQ0 A;  4GMX B;  3KY9 A;  5DIF B;  1ISN A;  1P3R A;  3G9W A;  3T06 A;  2I1J A;  2RLO A;  4GPT B;  2M14 A;  2RNR B;  2D10 A;  2EC1 A;  2JP2 A;  5J3Q A;  1DBH A;  1NTV A;  2LKO A;  1BTK A;  1U5E A;  3F5R A;  2K2U A;  2Q13 A;  1WGQ A;  3X23 A;  1P6S A;  4K2O A;  2D9Z A;  1H10 A;  2R09 A;  3A8Q A;  2DYN A;  5DI9 B;  2DA0 A;  4A6F B;  5L81 A;  2MKR A;  2RUK B;  5C5B B;  2X18 A;  3CXB B;  2MWN B;  5JP4 A;  2QKL A;  1KI1 B;  3UZT A;  2EJ8 A;  3A98 B;  4Z2M B;  3QBV B;  4HAV B;  4K2P A;  2GCJ A;  1EAZ A;  5D3W A;  1Z87 A;  4PNK A;  3TO1 A;  3TW1 A;  1UNQ A;  1FGZ A;  1XR0 B;  4Y94 A;  2QKM A;  1LB1 A;  1UEF A;  2PZ1 A;  2DN6 A;  5J3Y A;  4TYZ A;  4GZU A;  1WJ1 A;  1GG3 A;  1J19 A;  4L6E A;  5JHG A;  1OY2 A;  3PVU A;  3HK0 A;  1AQC A;  4GXB A;  5KQ4 A;  2D4Q A;  1FOE A;  3KRX A;  4MT7 A;  5D3X A;  3PEG A;  3TFM A;  2DX1 A;  2DTC A;  1ZC3 B;  2HTH B;  2NZ8 B;  2COD A;  2YT1 A;  2BCJ A;  4HB0 B;  2RSG A;  2GS0 A;  5LON B;  1K5D B;  1QC6 A;  2D9W A;  2I1K A;  2ROZ B;  2DLW A;  3TVV A;  3ULC A;  2Y7B A;  4HAT B;  3ODW A;  2ADZ A;  2M38 A;  4Z2N A;  1NU2 A;  3O96 A;  1EVH A;  1MAI A;  1U5D A;  1TXD A;  3D8E A;  3VOQ A;  4GMV A;  2VSZ A;  2DX5 A;  2YT0 A;  1H4R A;  3FSS A;  1KZG A;  1WGU A;  3V5W A;  2COA A;  1XD4 A;  1X1F A;  4K17 A;  1FGY A;  4HHV A;  1U5F A;  1DDW A;  4BBK A;  5HE1 A;  1DDV A;  1V5M A;  4CYE A;  2FJL A;  3MDB C;  2D9X A;  2EMS A;  4IFS A;  4WSF A;  3P6A A;  2VKI A;  1WVH A;  4HB3 B;  4IOY X;  1RJ2 A;  2L1C A;  3N7C A;  2NMB A;  2W2X C;  2GJY A;  1DYN A;  3IVF A;  1WI1 A;  3AJ4 A;  1U29 A;  3GYO A;  2UVM A;  3KRW A;  4HDQ A;  4DX9 0;  4HAY B;  1W1G A;  2YVC A;  2IFS A;  2ZPY A;  3SV1 A;  1AWE A;  3D8F A;  3P7Z A;  5C16 A;  2KGX B;  2CY4 A;  4ZRK A;  3SYX A;  4K81 A;  1N3H A;  2OTX A;  1SHC A;  1MPH A;  4NY0 A;  3ML4 A;  1V88 A;  2J59 M;  4D0N B;  2RVB B;  2UZS A;  4CHM A;  1FAO A;  1X1G A;  3PP2 A;  2UZR A;  1Y5O A;  4GN1 A;  1RRP B;  5DH9 B;  4HB2 B;  1DDM A;  2J0M A;  1TJ6 A;  3ZDT A;  5KCV A;  2KCJ A;  4KVG B;  5J3T A;  2I5C A;  2EMT A;  2DKQ A;  4DXA B;  1XX0 A;  1UNP A;  1MIZ B;  2DHI A;  2D9Y A;  2DHJ A;  5HE0 A;  5D3V A;  1U27 A;  4MK0 A;  3LJU X;  4TKN A;  1BAK A;  3DXD A;  3SNH A;  1NI2 A;  2COF A;  4HAW B;  4A6K A;  1BTN A;  3ODX A;  4XWX A;  4WJ7 A;  3OAN A;  2LOZ A;  1LW3 A;  4EJN A;  4F7G A;  2YSZ A;  1Y19 B;  5LOP B;  3DXE A;  3ZVR A;  4CHJ A;  2CRF A;  1KZ7 A;  3QWM A;  5CLL B;  1NTY A;  2COC A;  3HQC A;  4F7H A;  3FM8 C;  1XOD A;  3PSC A;  3QIJ A;  1IRS A;  4KHA A;  1GC7 A;  2DYQ A;  5CLQ B;  1EF1 A;  4A6H A;  2G35 A;  1BWN A;  2DKP A;  3PG7 A;  1WJM A;  5DHA B;  1M7E A;  3PZD A;  2LOX A;  1P5T A;  2LYD A;  5KQ1 A;  3RCP A;  3WYF B;  1X05 A;  3VIA A;  1FHO A;  2D11 A;  2ROV A;  2W2W A;  1DRO A;  1J0W A;  5DHF B;  2D9V A;  1EGX A;  1OMW A;  2V76 A;  3M1I B;  3MPX A;  5JLJ B;  2RGN B;  3FEH A;  3TCA A;  1UNR A;  2H7E A;  3AU5 A;  2LUL A;  5FI0 A;  2YS3 A;  2KUP A;  3PVW A;  2YRY A;  1PLS A;  1XKE A;  2E2X A;  1MK7 B;  3KSY A;  4HDO A;  2J0K A;  2Z0Q A;  2P8V A;  3BJI A;  2P0H A;  1X11 A;  4C0A A;  4MY6 A;  2DHK A;  1M7R A;  1U2B A;  3GYP A;  4YON A;  3CIK A;  1SGH A;  2OQB A;  1GC6 A;  2ELB A;  3HW2 B;  2CY5 A;  2Y8F A;  2DFK A;  5HE3 A;  4KHO A;  4DBB A;  4B6H A;  4HAZ B;  2GCL A;  2VRW B;  2W2X D;  4ZRJ A;  1ZM0 A;  2Z0P A;  1MKE A;  3SO6 A;  3SUZ A;  3U8Z A;  3WA0 A;  1ZSQ A;  4ZRI A;  1ZVR A;  2LG1 A;  3PVL A;  2J0J A;  1Q67 A;  3DXC A;  1I2H A;  3D8D A;  1V5P A;  1PFJ A;  2HE7 A;  3NSU A;  1ZC4 B;  3F0W A;  2YS5 A;  2P0F A;  4A5K A;  1V5U A;  1U5G A;  2H7D A;  3ODO A;  1FHX A;  4EKU A;  1TQZ A;  2D2Q A;  2N23 A;  3U7D A;  4NSW A;  4IAP A;  5GOW B;  4H8S A; 
#chains in the Genus database with same CATH topology
 4EMO A;  4HAX B;  1XCG A;  5D3Y A;  4KHB B;  3A8P A;  5JHH A;  5C5B A;  2YT2 A;  2CAY A;  5C6R A;  2P0D A;  4A6F A;  2L2I A;  4HAU B;  1QQG A;  1X86 A;  4YL8 A;  1I7A A;  4WVF B;  2ELA A;  3HSA A;  4DX8 A;  2YF0 A;  1MK9 B;  1W1H A;  4KAX B;  4F7U P;  5FI1 A;  4HB4 B;  4P7I A;  3BIN A;  1T77 A;  5C79 A;  2AEH A;  2I5F A;  2MDX A;  1MIX A;  2AL6 A;  3ULB A;  1FHW A;  1PMS A;  2YS1 A;  1OQN A;  2N0Y A;  5D27 A;  2MFQ A;  2Z0O A;  2XQN M;  1UPR A;  2IYB A;  1FB8 A;  2Y8G A;  1WG7 A;  3AU4 A;  5HE2 A;  1V89 A;  1B55 A;  2R0D A;  5EFX A;  2K2J A;  1W1D A;  1K5G B;  1V61 A;  1E5W A;  2K00 A;  3KZ1 A;  1UPQ A;  4PQ0 A;  4HSI A;  4GMX B;  3KY9 A;  5DIF B;  1ISN A;  1P3R A;  3G9W A;  3T06 A;  2I1J A;  3NW8 A;  2RLO A;  4GPT B;  2M14 A;  3NWF A;  2RNR B;  2D10 A;  2R2Y A;  2EC1 A;  2JP2 A;  5J3Q A;  1DBH A;  2K49 A;  1NTV A;  2LKO A;  1BTK A;  1U5E A;  3F5R A;  2K2U A;  2Q13 A;  1WGQ A;  2KUQ A;  3X23 A;  1P6S A;  2KIG A;  4K2O A;  2D9Z A;  1H10 A;  2R09 A;  4QJ4 B;  3A8Q A;  2DYN A;  5DI9 B;  2DA0 A;  4A6F B;  5L81 A;  2MKR A;  2RUK B;  5C5B B;  4KHB A;  2X18 A;  2GUM A;  3CXB B;  2MWN B;  5JP4 A;  2QKL A;  1KI1 B;  3UZT A;  2EJ8 A;  3A98 B;  4Z2M B;  3QBV B;  4HAV B;  4K2P A;  2GCJ A;  1EAZ A;  5D3W A;  1Z87 A;  3OHM B;  4PNK A;  3TO1 A;  3TW1 A;  1UNQ A;  1FGZ A;  1XR0 B;  4Y94 A;  2QKM A;  3DCX A;  1LB1 A;  1UEF A;  2PZ1 A;  2DN6 A;  5J3Y A;  4TYZ A;  2Z13 A;  4GZU A;  1WJ1 A;  1GG3 A;  1J19 A;  4L6E A;  5JHG A;  1OY2 A;  3PVU A;  5I2M A;  3HK0 A;  1AQC A;  4GXB A;  5KQ4 A;  1ZYI A;  1FOE A;  2D4Q A;  3KRX A;  3NWD A;  4MT7 A;  5D3X A;  3PEG A;  3TFM A;  2DX1 A;  2DTC A;  1ZC3 B;  2HTH B;  2NZ8 B;  2COD A;  2YT1 A;  2BCJ A;  4HB0 B;  2RSG A;  2GS0 A;  5LON B;  1K5D B;  1QC6 A;  2D9W A;  2I1K A;  2ROZ B;  2DLW A;  3TVV A;  3ULC A;  2Y7B A;  4HAT B;  3ODW A;  2ADZ A;  2M38 A;  4Z2N A;  1NU2 A;  3O96 A;  1EVH A;  1MAI A;  1U5D A;  1TXD A;  3D8E A;  3VOQ A;  4GMV A;  2VSZ A;  2DX5 A;  2YT0 A;  1H4R A;  3FSS A;  1KZG A;  1WGU A;  3V5W A;  2COA A;  1XD4 A;  1X1F A;  4K17 A;  1FGY A;  4HHV A;  1U5F A;  1DDW A;  4BBK A;  5HE1 A;  1DDV A;  1V5M A;  2K8E A;  4CYE A;  2FJL A;  3MDB C;  2D9X A;  2EMS A;  4IFS A;  4WSF A;  2Z59 A;  3P6A A;  2VKI A;  1WVH A;  4L1R A;  4HB3 B;  4IOY X;  1RJ2 A;  4DIX A;  2L1C A;  2NBV A;  3N7C A;  4OT1 A;  2NMB A;  2W2X C;  2GJY A;  1DYN A;  3IVF A;  1WI1 A;  3AJ4 A;  1U29 A;  3GYO A;  2UVM A;  3KRW A;  4HDQ A;  4DX9 0;  4HAY B;  1W1G A;  2YVC A;  2IFS A;  2ZPY A;  3SV1 A;  1AWE A;  4OSN A;  3D8F A;  3B77 A;  3P7Z A;  5C16 A;  2KGX B;  4QJ3 B;  2CY4 A;  4ZRK A;  3SYX A;  4K81 A;  1N3H A;  2OTX A;  1SHC A;  1MPH A;  4NY0 A;  3ML4 A;  1V88 A;  2J59 M;  4D0N B;  2RVB B;  2UZS A;  4CHM A;  1FAO A;  1X1G A;  3PP2 A;  4GOU A;  2UZR A;  1MI1 A;  4GNK B;  1Y5O A;  4GN1 A;  1RRP B;  5DH9 B;  4HB2 B;  1DDM A;  2J0M A;  1TJ6 A;  3NWA A;  5IRS A;  3ZDT A;  5KCV A;  2KCJ A;  4KVG B;  5J3T A;  2I5C A;  2EMT A;  2DKQ A;  4DXA B;  1XX0 A;  1UNP A;  1MIZ B;  2DHI A;  2D9Y A;  2DHJ A;  5HE0 A;  5D3V A;  1U27 A;  4MK0 A;  3LJU X;  4TKN A;  1BAK A;  2Z14 A;  3DXD A;  3SNH A;  1NI2 A;  2COF A;  4HAW B;  4A6K A;  1BTN A;  3ODX A;  4XWX A;  4WJ7 A;  5I2S A;  3OAN A;  4D6W A;  2ZKM X;  2LOZ A;  1LW3 A;  4EJN A;  4F7G A;  2YSZ A;  1Y19 B;  5LOP B;  3DXE A;  3ZVR A;  4CHJ A;  2CRF A;  1KZ7 A;  3QWM A;  2FJU B;  5CLL B;  1NTY A;  2COC A;  3HQC A;  4QXA B;  4F7H A;  3FM8 C;  1XOD A;  3PSC A;  3HIE A;  3QIJ A;  1IRS A;  4KHA A;  1GC7 A;  2DYQ A;  5CLQ B;  1EF1 A;  4A6H A;  2G35 A;  4CSQ A;  1BWN A;  2DKP A;  3PG7 A;  1WJM A;  5DHA B;  1M7E A;  3PZD A;  2LOX A;  1P5T A;  2LYD A;  5KQ1 A;  3RCP A;  3WYF B;  1X05 A;  3VIA A;  1FHO A;  2KIE A;  2D11 A;  2ROV A;  2W2W A;  1DRO A;  5LG4 B;  1J0W A;  5DHF B;  2D9V A;  1EGX A;  1OMW A;  2V76 A;  3M1I B;  3MPX A;  5JLJ B;  2RGN B;  3FEH A;  3TCA A;  1UNR A;  2H7E A;  5M4Y B;  3AU5 A;  2LUL A;  5FI0 A;  2YS3 A;  2KUP A;  3PVW A;  2YRY A;  2RRF A;  1PLS A;  1XKE A;  2E2X A;  1MK7 B;  3KSY A;  4HDO A;  2J0K A;  2Z0Q A;  2P8V A;  3BJI A;  2P0H A;  1X11 A;  4C0A A;  4MY6 A;  2DHK A;  1M7R A;  1U2B A;  3GYP A;  4YON A;  3CIK A;  1SGH A;  2OQB A;  1GC6 A;  2ELB A;  3HW2 B;  2CY5 A;  2Y8F A;  2DFK A;  5HE3 A;  4KHO A;  4DBB A;  4B6H A;  4HAZ B;  2GCL A;  2VRW B;  2W2X D;  4ZRJ A;  1ZM0 A;  2Z0P A;  1MKE A;  3SO6 A;  3SUZ A;  3U8Z A;  3WA0 A;  1ZSQ A;  2Z4D A;  2KR0 A;  4QJ5 B;  4ZRI A;  1ZVR A;  2LG1 A;  3PVL A;  2J0J A;  1Q67 A;  3DXC A;  1I2H A;  3D8D A;  1V5P A;  1PFJ A;  2HE7 A;  3NSU A;  1ZC4 B;  3A58 A;  3F0W A;  2YS5 A;  2P0F A;  4A5K A;  1V5U A;  1U5G A;  2H7D A;  3ODO A;  1FHX A;  3FVC A;  4EKU A;  1TQZ A;  2D2Q A;  2N23 A;  3U7D A;  4NSW A;  4IAP A;  5GOW B;  4H8S A;  3U12 A; 
#chains in the Genus database with same CATH homology
 4EMO A;  4HAX B;  1XCG A;  5D3Y A;  4KHB B;  3A8P A;  5JHH A;  5C5B A;  2CAY A;  5C6R A;  2P0D A;  4A6F A;  2L2I A;  4HAU B;  1QQG A;  1X86 A;  4YL8 A;  1I7A A;  4WVF B;  2ELA A;  4DX8 A;  2YF0 A;  1MK9 B;  1W1H A;  4KAX B;  4F7U P;  5FI1 A;  4HB4 B;  4P7I A;  3BIN A;  5C79 A;  2AEH A;  2I5F A;  2MDX A;  1MIX A;  2AL6 A;  3ULB A;  1FHW A;  1PMS A;  2YS1 A;  1OQN A;  2N0Y A;  5D27 A;  2MFQ A;  2Z0O A;  2XQN M;  1UPR A;  2IYB A;  1FB8 A;  2Y8G A;  1WG7 A;  3AU4 A;  5HE2 A;  1V89 A;  1B55 A;  2R0D A;  5EFX A;  2K2J A;  1W1D A;  1K5G B;  1V61 A;  1E5W A;  2K00 A;  3KZ1 A;  1UPQ A;  4PQ0 A;  4GMX B;  3KY9 A;  5DIF B;  1ISN A;  1P3R A;  3G9W A;  3T06 A;  2I1J A;  2RLO A;  4GPT B;  2M14 A;  2RNR B;  2D10 A;  2EC1 A;  2JP2 A;  5J3Q A;  1DBH A;  1NTV A;  2LKO A;  1BTK A;  1U5E A;  3F5R A;  2K2U A;  2Q13 A;  1WGQ A;  3X23 A;  1P6S A;  4K2O A;  2D9Z A;  1H10 A;  2R09 A;  3A8Q A;  2DYN A;  5DI9 B;  2DA0 A;  4A6F B;  5L81 A;  2MKR A;  2RUK B;  5C5B B;  2X18 A;  3CXB B;  2MWN B;  5JP4 A;  2QKL A;  1KI1 B;  3UZT A;  2EJ8 A;  3A98 B;  4Z2M B;  3QBV B;  4HAV B;  4K2P A;  2GCJ A;  1EAZ A;  5D3W A;  1Z87 A;  4PNK A;  3TO1 A;  3TW1 A;  1UNQ A;  1FGZ A;  1XR0 B;  4Y94 A;  2QKM A;  1LB1 A;  1UEF A;  2PZ1 A;  2DN6 A;  5J3Y A;  4TYZ A;  4GZU A;  1WJ1 A;  1GG3 A;  1J19 A;  4L6E A;  5JHG A;  1OY2 A;  3PVU A;  3HK0 A;  1AQC A;  4GXB A;  5KQ4 A;  2D4Q A;  1FOE A;  3KRX A;  4MT7 A;  5D3X A;  3PEG A;  3TFM A;  2DX1 A;  2DTC A;  1ZC3 B;  2HTH B;  2NZ8 B;  2COD A;  2YT1 A;  2BCJ A;  4HB0 B;  2RSG A;  2GS0 A;  5LON B;  1K5D B;  1QC6 A;  2D9W A;  2I1K A;  2ROZ B;  2DLW A;  3TVV A;  3ULC A;  2Y7B A;  4HAT B;  3ODW A;  2ADZ A;  2M38 A;  4Z2N A;  1NU2 A;  3O96 A;  1EVH A;  1MAI A;  1U5D A;  1TXD A;  3D8E A;  3VOQ A;  4GMV A;  2VSZ A;  2DX5 A;  2YT0 A;  1H4R A;  3FSS A;  1KZG A;  1WGU A;  3V5W A;  2COA A;  1XD4 A;  1X1F A;  4K17 A;  1FGY A;  4HHV A;  1U5F A;  1DDW A;  4BBK A;  5HE1 A;  1DDV A;  1V5M A;  4CYE A;  2FJL A;  3MDB C;  2D9X A;  2EMS A;  4IFS A;  4WSF A;  3P6A A;  2VKI A;  1WVH A;  4HB3 B;  4IOY X;  1RJ2 A;  2L1C A;  3N7C A;  2NMB A;  2W2X C;  2GJY A;  1DYN A;  3IVF A;  1WI1 A;  3AJ4 A;  1U29 A;  3GYO A;  2UVM A;  3KRW A;  4HDQ A;  4DX9 0;  4HAY B;  1W1G A;  2YVC A;  2IFS A;  2ZPY A;  3SV1 A;  1AWE A;  3D8F A;  3P7Z A;  5C16 A;  2KGX B;  2CY4 A;  4ZRK A;  3SYX A;  4K81 A;  1N3H A;  2OTX A;  1SHC A;  1MPH A;  4NY0 A;  3ML4 A;  1V88 A;  2J59 M;  4D0N B;  2RVB B;  2UZS A;  4CHM A;  1FAO A;  1X1G A;  3PP2 A;  2UZR A;  1Y5O A;  4GN1 A;  1RRP B;  5DH9 B;  4HB2 B;  1DDM A;  2J0M A;  1TJ6 A;  3ZDT A;  5KCV A;  2KCJ A;  4KVG B;  5J3T A;  2I5C A;  2EMT A;  2DKQ A;  4DXA B;  1XX0 A;  1UNP A;  1MIZ B;  2DHI A;  2D9Y A;  2DHJ A;  5HE0 A;  5D3V A;  1U27 A;  4MK0 A;  3LJU X;  4TKN A;  1BAK A;  3DXD A;  3SNH A;  1NI2 A;  2COF A;  4HAW B;  4A6K A;  1BTN A;  3ODX A;  4XWX A;  4WJ7 A;  3OAN A;  2LOZ A;  1LW3 A;  4EJN A;  4F7G A;  2YSZ A;  1Y19 B;  5LOP B;  3DXE A;  3ZVR A;  4CHJ A;  2CRF A;  1KZ7 A;  3QWM A;  5CLL B;  1NTY A;  2COC A;  3HQC A;  4F7H A;  3FM8 C;  1XOD A;  3PSC A;  3QIJ A;  1IRS A;  4KHA A;  1GC7 A;  2DYQ A;  5CLQ B;  1EF1 A;  4A6H A;  2G35 A;  1BWN A;  2DKP A;  3PG7 A;  1WJM A;  5DHA B;  1M7E A;  3PZD A;  2LOX A;  1P5T A;  2LYD A;  5KQ1 A;  3RCP A;  3WYF B;  1X05 A;  3VIA A;  1FHO A;  2D11 A;  2ROV A;  2W2W A;  1DRO A;  1J0W A;  5DHF B;  2D9V A;  1EGX A;  1OMW A;  2V76 A;  3M1I B;  3MPX A;  5JLJ B;  2RGN B;  3FEH A;  3TCA A;  1UNR A;  2H7E A;  3AU5 A;  2LUL A;  5FI0 A;  2YS3 A;  2KUP A;  3PVW A;  2YRY A;  1PLS A;  1XKE A;  2E2X A;  1MK7 B;  3KSY A;  4HDO A;  2J0K A;  2Z0Q A;  2P8V A;  3BJI A;  2P0H A;  1X11 A;  4C0A A;  4MY6 A;  2DHK A;  1M7R A;  1U2B A;  3GYP A;  4YON A;  3CIK A;  1SGH A;  2OQB A;  1GC6 A;  2ELB A;  3HW2 B;  2CY5 A;  2Y8F A;  2DFK A;  5HE3 A;  4KHO A;  4DBB A;  4B6H A;  4HAZ B;  2GCL A;  2VRW B;  2W2X D;  4ZRJ A;  1ZM0 A;  2Z0P A;  1MKE A;  3SO6 A;  3SUZ A;  3U8Z A;  3WA0 A;  1ZSQ A;  4ZRI A;  1ZVR A;  2LG1 A;  3PVL A;  2J0J A;  1Q67 A;  3DXC A;  1I2H A;  3D8D A;  1V5P A;  1PFJ A;  2HE7 A;  3NSU A;  1ZC4 B;  3F0W A;  2YS5 A;  2P0F A;  4A5K A;  1V5U A;  1U5G A;  2H7D A;  3ODO A;  1FHX A;  4EKU A;  1TQZ A;  2D2Q A;  2N23 A;  3U7D A;  4NSW A;  4IAP A;  5GOW B;  4H8S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...