2VKIA

Structure of the pdk1 ph domain k465e mutant
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
139
structure length
139
Chain Sequence
SNIEQYIHDLDSNSFELDLQFSEDEKRLLLEKQAGGNPWHQFVENNLILKMGPVDERKGLFARRRQLLLTEGPHLYYVDPVNKVLKGEIPWSQELRPEAKNFKTFFVHTPNRTYYLMDPSGNAHKWCRKIQEVWRQRYQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords 3-PHOPSHOINOSITIDE DEPENDENT PROTEIN KINASE 1
publication title Mutation of the Pdk1 Ph Domain Inhibits Protein Kinase B/Akt, Leading to Small Size and Insulin Resistance.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 39
structure length 139
sequence length 139
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2007-12-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14593 PH_3 PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2vkiA00
1DBHA 5D27A 2LULA 2DHJA 4NSWA 1M7RA 2J0KA 2Y8FA 2YT0A 2Q13A 1XR0B 2LG1A 5J3YA 4GMXB 1Z87A 2D9ZA 1U29A 5L81A 3AU4A 2EMTA 2D2QA 2V76A 4CYEA 2YT1A 1FGZA 2L1CA 4WVFB 1EGXA 3ZVRA 2Y7BA 2ROZB 2ELAA 2GS0A 4A6FA 3ODXA 2LOZA 3GYOA 1V89A 4GN1A 3A8PA 5HE2A 1XD4A 2EC1A 4HAYB 1GG3A 2M38A 1ZC4B 3F5RA 3T06A 1FHOA 1MIZB 1WVHA 1U5GA 1MK9B 2FJLA 3ULCA 2N23A 2DX1A 1QQGA 2DTCA 3KZ1A 2DHIA 1FOEA 1OY2A 1SHCA 5CLQB 3QWMA 3U8ZA 5J3QA 1V5UA 1WGUA 1Q67A 2HE7A 1TXDA 4HATB 1P5TA 4MT7A 2VKIA 4KHAA 5D3VA 2CRFA 2COAA 2RVBB 1LW3A 2W2WA 5D3XA 2UZRA 2J0JA 3HQCA 4HDQA 2YF0A 3KSYA 2L2IA 3ODOA 5HE0A 3ZDTA 1GC6A 4GXBA 3PZDA 3D8EA 1MIXA 5C5BA 5CLLB 3TW1A 3DXEA 4K17A 4NY0A 3PSCA 5KCVA 5EFXA 4CHJA 1XODA 1MKEA 3D8DA 2DKPA 3WA0A 5DH9B 3F0WA 2DYQA 2IFSA 2AEHA 3FM8C 3D8FA 2ZPYA 5DHAB 2DKQA 2X18A 1DDMA 4HAZB 2GJYA 2ELBA 1UNQA 3P6AA 1K5DB 4HAUB 2CY4A 2IYBA 1UPQA 3LJUX 2YSZA 1OMWA 3DXDA 1RJ2A 3KRWA 4PNKA 4EJNA 1BAKA 1MK7B 4ZRJA 4P7IA 4IFSA 2KCJA 4A6FB 1FGYA 2UVMA 2J0MA 3TCAA 4D0NB 4HB0B 1ZC3B 2EMSA 3N7CA 2GCLA 3V5WA 1WJ1A 1WG7A 3HW2B 4HB4B 5FI1A 3X23A 3DXCA 3PP2A 5HE1A 1MPHA 2D4QA 2E2XA 3ML4A 1NU2A 4XWXA 1W1DA 3PG7A 1MAIA 2Z0QA 2LOXA 4Z2NA 2D9WA 2W2XC 4K81A 2CODA 1X05A 3SNHA 3MPXA 3CIKA 4A6KA 3AJ4A 3BJIA 4GPTB 1DDVA 1XCGA 3PEGA 2YRYA 5KQ4A 1W1GA 2BCJA 4MY6A 1UNRA 2G35A 1V61A 3FSSA 3PVWA 1Y5OA 2QKLA 5JHGA 2GCJA 2N0YA 3ODWA 4WSFA 5DI9B 2P0FA 3O96A 5FI0A 4IOYX 1AQCA 1M7EA 1FB8A 1PMSA 4WJ7A 4A6HA 2RUKB 3SV1A 2W2XD 5C5BB 2JP2A 3P7ZA 1N3HA 3QIJA 3QBVB 1IRSA 4F7HA 3KY9A 2K2JA 1J0WA 1ISNA 1TQZA 3U7DA 1FHWA 1U2BA 2YS1A 2XQNM 1DROA 1EF1A 4DX90 2YS3A 2P0DA 1EVHA 1XKEA 3WYFB 3SYXA 1WJMA 1RRPB 4L6EA 1EAZA 2OTXA 5C79A 2MDXA 3VOQA 1V88A 1XX0A 2J59M 2LYDA 4K2PA 1U27A 4GMVA 1I2HA 2K2UA 4HAVB 2DLWA 2RNRB 1LB1A 1P6SA 2D9VA 1DDWA 2K00A 1NI2A 4K2OA 1QC6A 1UEFA 1BTNA 1ZVRA 3OANA 1U5FA 1WI1A 2DHKA 1FAOA 2ADZA 1E5WA 2P8VA 2H7EA 2UZSA 2LKOA 2NZ8B 3TFMA 2MFQA 1PFJA 2VRWB 1FHXA 4EKUA 4KVGB 1V5MA 3IVFA 3M1IB 2DX5A 3VIAA 3FEHA 2D9XA 2D11A 3PVUA 4HB2B 2VSZA 2MWNB 2Z0OA 4TKNA 2I1JA 4F7UP 1U5EA 3MDBC 1BTKA 3AU5A 5KQ1A 1J19A 1PLSA 2KGXB 2YVCA 3CXBB 1AWEA 4GZUA 3A98B 4HHVA 5DHFB 5C16A 5LOPB 4MK0A 5JLJB 2AL6A 2COCA 3NSUA 2Z0PA 4A5KA 2DA0A 1WGQA 4KAXB 4B6HA 4HAXB 2CY5A 1GC7A 2I5FA 1UNPA 3A8QA 4EMOA 2DFKA 5D3YA 4YONA 4HDOA 4F7GA 3TO1A 4TYZA 1OQNA 3PVLA 1UPRA 1P3RA 3TVVA 2DN6A 4IAPA 1SGHA 3KRXA 2CAYA 2I1KA 4ZRKA 2HTHB 3BINA 1W1HA 4H8SA 4KHOA 4YL8A 5GOWB 5JHHA 2R09A 1X86A 1V5PA 1KI1B 2P0HA 3SO6A 2EJ8A 5C6RA 1KZGA 2RSGA 1ZSQA 1BWNA 1B55A 4Y94A 1K5GB 2H7DA 4ZRIA 1I7AA 3UZTA 2MKRA 2R0DA 2DYNA 2I5CA 1U5DA 5J3TA 1NTYA 2RGNB 3SUZA 5JP4A 4CHMA 1ZM0A 4HAWB 3G9WA 2OQBA 1X1GA 1Y19B 5HE3A 3HK0A 4PQ0A 4DX8A 3RCPA 2ROVA 2D9YA 4BBKA 1H10A 5DIFB 2COFA 2KUPA 2M14A 2NMBA 1TJ6A 3ULBA 2D10A 1X11A 1KZ7A 2RLOA 4KHBB 1NTVA 2YS5A 1X1FA 1H4RA 5D3WA 5LONB 4C0AA 2QKMA 4Z2MB 2PZ1A 2Y8GA 4DBBA 1DYNA 3GYPA 4HB3B 4DXAB
chains in the Genus database with same CATH superfamily
1DBHA 5D27A 2LULA 2DHJA 4NSWA 1M7RA 2J0KA 2Y8FA 2YT0A 3A58A 2Q13A 1XR0B 2LG1A 5J3YA 4GMXB 1Z87A 2D9ZA 1U29A 5L81A 3AU4A 2EMTA 2D2QA 2V76A 4CYEA 2YT1A 1FGZA 2L1CA 4WVFB 1EGXA 3ZVRA 2Y7BA 2ROZB 2ELAA 2GS0A 4A6FA 3ODXA 2LOZA 3GYOA 4L1RA 1V89A 4GN1A 3A8PA 5HE2A 1XD4A 2EC1A 4HAYB 1GG3A 2M38A 1ZC4B 3F5RA 3T06A 1FHOA 1MIZB 1WVHA 1U5GA 1MK9B 2FJLA 3ULCA 2N23A 4D6WA 2DX1A 1QQGA 3OHMB 2DTCA 3KZ1A 2DHIA 1FOEA 1OY2A 1SHCA 5CLQB 3QWMA 3U8ZA 5J3QA 1V5UA 1WGUA 1Q67A 2HE7A 2RRFA 3NW8A 1TXDA 4HATB 1P5TA 4MT7A 2VKIA 4KHAA 5D3VA 2CRFA 4HSIA 2COAA 3NWDA 2RVBB 1LW3A 2W2WA 2FJUB 5D3XA 2UZRA 2J0JA 3HQCA 4HDQA 2YF0A 3KSYA 2L2IA 3ODOA 5HE0A 3ZDTA 1GC6A 4GXBA 3PZDA 3D8EA 1MIXA 5C5BA 5CLLB 3TW1A 3DXEA 4K17A 4NY0A 3PSCA 5KCVA 2KIEA 5EFXA 4CHJA 1XODA 1MKEA 3D8DA 4OSNA 2DKPA 3WA0A 5DH9B 3F0WA 2DYQA 2IFSA 2AEHA 3FM8C 3D8FA 2ZPYA 5DHAB 2DKQA 2X18A 1DDMA 4HAZB 2GJYA 2ELBA 1UNQA 3P6AA 2K8EA 1K5DB 4HAUB 2CY4A 2IYBA 1UPQA 3LJUX 1T77A 2YSZA 1OMWA 3DXDA 1RJ2A 3KRWA 4PNKA 4EJNA 1BAKA 1MK7B 4ZRJA 4P7IA 4IFSA 2KCJA 4A6FB 1FGYA 2NBVA 3DCXA 2UVMA 2J0MA 3TCAA 4D0NB 4HB0B 1ZC3B 2EMSA 3N7CA 2GCLA 3V5WA 1WJ1A 1WG7A 2KIGA 3HW2B 4HB4B 5FI1A 3X23A 3DXCA 2ZKMX 3PP2A 5HE1A 1MPHA 2D4QA 3NWFA 2E2XA 3ML4A 1NU2A 3HSAA 4XWXA 1W1DA 3PG7A 1MAIA 2Z0QA 2LOXA 4GOUA 5IRSA 3NWAA 4Z2NA 2Z4DA 2D9WA 2W2XC 4K81A 2CODA 1X05A 3SNHA 3MPXA 3CIKA 4A6KA 3AJ4A 3BJIA 4GPTB 1DDVA 1XCGA 3PEGA 2YRYA 5KQ4A 1W1GA 2BCJA 4MY6A 1UNRA 2G35A 1V61A 3FSSA 3PVWA 1Y5OA 4QJ4B 2QKLA 5JHGA 4DIXA 2GCJA 2N0YA 3ODWA 4WSFA 5DI9B 2P0FA 2YT2A 3O96A 5FI0A 4IOYX 3B77A 1AQCA 1M7EA 1FB8A 1PMSA 4WJ7A 4A6HA 2RUKB 3SV1A 2W2XD 5C5BB 2JP2A 3P7ZA 1N3HA 4QXAB 3QIJA 3QBVB 1IRSA 4F7HA 2K2JA 3KY9A 1J0WA 3FVCA 1ISNA 1TQZA 3U7DA 1FHWA 1U2BA 2YS1A 2XQNM 1DROA 1EF1A 4DX90 2YS3A 2P0DA 5I2MA 1EVHA 1XKEA 3WYFB 3SYXA 1WJMA 1RRPB 4L6EA 1EAZA 2OTXA 5C79A 2MDXA 3U12A 3VOQA 1V88A 1XX0A 2J59M 2LYDA 4K2PA 1U27A 4GMVA 1I2HA 2K2UA 4HAVB 2DLWA 2RNRB 1LB1A 1P6SA 2D9VA 1DDWA 2K00A 1NI2A 4K2OA 1QC6A 1UEFA 1BTNA 1ZVRA 3OANA 1U5FA 1WI1A 1ZYIA 2DHKA 1FAOA 2ADZA 1E5WA 2P8VA 5M4YB 2H7EA 2UZSA 2LKOA 2NZ8B 3TFMA 2MFQA 1PFJA 2VRWB 2Z14A 1FHXA 4EKUA 4KVGB 1V5MA 2KUQA 3IVFA 4CSQA 3M1IB 2DX5A 3VIAA 3FEHA 2D9XA 2D11A 3PVUA 4HB2B 2VSZA 2MWNB 2Z0OA 4TKNA 2KR0A 2I1JA 4F7UP 1U5EA 3MDBC 1BTKA 3AU5A 5KQ1A 4QJ3B 1J19A 1PLSA 2KGXB 2YVCA 3CXBB 1AWEA 4GZUA 3A98B 4HHVA 5DHFB 5C16A 5LOPB 4MK0A 5JLJB 2K49A 2AL6A 2COCA 4KHBA 3NSUA 2Z0PA 4A5KA 2DA0A 1WGQA 4KAXB 4B6HA 1MI1A 4HAXB 2CY5A 2R2YA 1GC7A 2I5FA 4QJ5B 2GUMA 1UNPA 3A8QA 4EMOA 2DFKA 2Z59A 5D3YA 4YONA 4HDOA 4F7GA 3TO1A 4TYZA 1OQNA 3PVLA 1UPRA 1P3RA 3TVVA 2DN6A 4IAPA 2Z13A 1SGHA 3KRXA 2CAYA 2I1KA 4ZRKA 2HTHB 3BINA 1W1HA 4H8SA 4KHOA 4YL8A 5GOWB 5JHHA 2R09A 1X86A 5I2SA 1V5PA 1KI1B 2P0HA 3SO6A 2EJ8A 5C6RA 1KZGA 2RSGA 1ZSQA 1BWNA 1B55A 4Y94A 1K5GB 2H7DA 4ZRIA 1I7AA 3UZTA 2MKRA 3HIEA 2R0DA 2DYNA 2I5CA 1U5DA 5J3TA 1NTYA 2RGNB 3SUZA 5JP4A 4CHMA 1ZM0A 4GNKB 4HAWB 4OT1A 3G9WA 2OQBA 1X1GA 1Y19B 5HE3A 3HK0A 4PQ0A 4DX8A 3RCPA 2ROVA 2D9YA 4BBKA 1H10A 5DIFB 2COFA 2KUPA 2M14A 2NMBA 1TJ6A 3ULBA 2D10A 5LG4B 1X11A 1KZ7A 2RLOA 4KHBB 1NTVA 2YS5A 1X1FA 1H4RA 5D3WA 5LONB 4C0AA 2QKMA 4Z2MB 2PZ1A 2Y8GA 4DBBA 1DYNA 3GYPA 4HB3B 4DXAB
chains in the Genus database with same CATH topology
1DBHA 5D27A 2LULA 2DHJA 4NSWA 1M7RA 2J0KA 2Y8FA 2YT0A 2Q13A 1XR0B 2LG1A 5J3YA 4GMXB 1Z87A 2D9ZA 1U29A 5L81A 3AU4A 2EMTA 2D2QA 2V76A 4CYEA 2YT1A 1FGZA 2L1CA 4WVFB 1EGXA 3ZVRA 2Y7BA 2ROZB 2ELAA 2GS0A 4A6FA 3ODXA 2LOZA 3GYOA 1V89A 4GN1A 3A8PA 5HE2A 1XD4A 2EC1A 4HAYB 1GG3A 2M38A 1ZC4B 3F5RA 3T06A 1FHOA 1MIZB 1WVHA 1U5GA 1MK9B 2FJLA 3ULCA 2N23A 2DX1A 1QQGA 2DTCA 3KZ1A 2DHIA 1FOEA 1OY2A 1SHCA 5CLQB 3QWMA 3U8ZA 5J3QA 1V5UA 1WGUA 1Q67A 2HE7A 1TXDA 4HATB 1P5TA 4MT7A 2VKIA 4KHAA 5D3VA 2CRFA 2COAA 2RVBB 1LW3A 2W2WA 5D3XA 2UZRA 2J0JA 3HQCA 4HDQA 2YF0A 3KSYA 2L2IA 3ODOA 5HE0A 3ZDTA 1GC6A 4GXBA 3PZDA 3D8EA 1MIXA 5C5BA 5CLLB 3TW1A 3DXEA 4K17A 4NY0A 3PSCA 5KCVA 5EFXA 4CHJA 1XODA 1MKEA 3D8DA 2DKPA 3WA0A 5DH9B 3F0WA 2DYQA 2IFSA 2AEHA 3FM8C 3D8FA 2ZPYA 5DHAB 2DKQA 2X18A 1DDMA 4HAZB 2GJYA 2ELBA 1UNQA 3P6AA 1K5DB 4HAUB 2CY4A 2IYBA 1UPQA 3LJUX 2YSZA 1OMWA 3DXDA 1RJ2A 3KRWA 4PNKA 4EJNA 1BAKA 1MK7B 4ZRJA 4P7IA 4IFSA 2KCJA 4A6FB 1FGYA 2UVMA 2J0MA 3TCAA 4D0NB 4HB0B 1ZC3B 2EMSA 3N7CA 2GCLA 3V5WA 1WJ1A 1WG7A 3HW2B 4HB4B 5FI1A 3X23A 3DXCA 3PP2A 5HE1A 1MPHA 2D4QA 2E2XA 3ML4A 1NU2A 4XWXA 1W1DA 3PG7A 1MAIA 2Z0QA 2LOXA 4Z2NA 2D9WA 2W2XC 4K81A 2CODA 1X05A 3SNHA 3MPXA 3CIKA 4A6KA 3AJ4A 3BJIA 4GPTB 1DDVA 1XCGA 3PEGA 2YRYA 5KQ4A 1W1GA 2BCJA 4MY6A 1UNRA 2G35A 1V61A 3FSSA 3PVWA 1Y5OA 2QKLA 5JHGA 2GCJA 2N0YA 3ODWA 4WSFA 5DI9B 2P0FA 3O96A 5FI0A 4IOYX 1AQCA 1M7EA 1FB8A 1PMSA 4WJ7A 4A6HA 2RUKB 3SV1A 2W2XD 5C5BB 2JP2A 3P7ZA 1N3HA 3QIJA 3QBVB 1IRSA 4F7HA 3KY9A 2K2JA 1J0WA 1ISNA 1TQZA 3U7DA 1FHWA 1U2BA 2YS1A 2XQNM 1DROA 1EF1A 4DX90 2YS3A 2P0DA 1EVHA 1XKEA 3WYFB 3SYXA 1WJMA 1RRPB 4L6EA 1EAZA 2OTXA 5C79A 2MDXA 3VOQA 1V88A 1XX0A 2J59M 2LYDA 4K2PA 1U27A 4GMVA 1I2HA 2K2UA 4HAVB 2DLWA 2RNRB 1LB1A 1P6SA 2D9VA 1DDWA 2K00A 1NI2A 4K2OA 1QC6A 1UEFA 1BTNA 1ZVRA 3OANA 1U5FA 1WI1A 2DHKA 1FAOA 2ADZA 1E5WA 2P8VA 2H7EA 2UZSA 2LKOA 2NZ8B 3TFMA 2MFQA 1PFJA 2VRWB 1FHXA 4EKUA 4KVGB 1V5MA 3IVFA 3M1IB 2DX5A 3VIAA 3FEHA 2D9XA 2D11A 3PVUA 4HB2B 2VSZA 2MWNB 2Z0OA 4TKNA 2I1JA 4F7UP 1U5EA 3MDBC 1BTKA 3AU5A 5KQ1A 1J19A 1PLSA 2KGXB 2YVCA 3CXBB 1AWEA 4GZUA 3A98B 4HHVA 5DHFB 5C16A 5LOPB 4MK0A 5JLJB 2AL6A 2COCA 3NSUA 2Z0PA 4A5KA 2DA0A 1WGQA 4KAXB 4B6HA 4HAXB 2CY5A 1GC7A 2I5FA 1UNPA 3A8QA 4EMOA 2DFKA 5D3YA 4YONA 4HDOA 4F7GA 3TO1A 4TYZA 1OQNA 3PVLA 1UPRA 1P3RA 3TVVA 2DN6A 4IAPA 1SGHA 3KRXA 2CAYA 2I1KA 4ZRKA 2HTHB 3BINA 1W1HA 4H8SA 4KHOA 4YL8A 5GOWB 5JHHA 2R09A 1X86A 1V5PA 1KI1B 2P0HA 3SO6A 2EJ8A 5C6RA 1KZGA 2RSGA 1ZSQA 1BWNA 1B55A 4Y94A 1K5GB 2H7DA 4ZRIA 1I7AA 3UZTA 2MKRA 2R0DA 2DYNA 2I5CA 1U5DA 5J3TA 1NTYA 2RGNB 3SUZA 5JP4A 4CHMA 1ZM0A 4HAWB 3G9WA 2OQBA 1X1GA 1Y19B 5HE3A 3HK0A 4PQ0A 4DX8A 3RCPA 2ROVA 2D9YA 4BBKA 1H10A 5DIFB 2COFA 2KUPA 2M14A 2NMBA 1TJ6A 3ULBA 2D10A 1X11A 1KZ7A 2RLOA 4KHBB 1NTVA 2YS5A 1X1FA 1H4RA 5D3WA 5LONB 4C0AA 2QKMA 4Z2MB 2PZ1A 2Y8GA 4DBBA 1DYNA 3GYPA 4HB3B 4DXAB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DBH A;  5D27 A;  2LUL A;  2DHJ A;  4NSW A;  1M7R A;  2J0K A;  2Y8F A;  2YT0 A;  2Q13 A;  1XR0 B;  2LG1 A;  5J3Y A;  4GMX B;  1Z87 A;  2D9Z A;  1U29 A;  5L81 A;  3AU4 A;  2EMT A;  2D2Q A;  2V76 A;  4CYE A;  2YT1 A;  1FGZ A;  2L1C A;  4WVF B;  1EGX A;  3ZVR A;  2Y7B A;  2ROZ B;  2ELA A;  2GS0 A;  4A6F A;  3ODX A;  2LOZ A;  3GYO A;  1V89 A;  4GN1 A;  3A8P A;  5HE2 A;  1XD4 A;  2EC1 A;  4HAY B;  1GG3 A;  2M38 A;  1ZC4 B;  3F5R A;  3T06 A;  1FHO A;  1MIZ B;  1WVH A;  1U5G A;  1MK9 B;  2FJL A;  3ULC A;  2N23 A;  2DX1 A;  1QQG A;  2DTC A;  3KZ1 A;  2DHI A;  1FOE A;  1OY2 A;  1SHC A;  5CLQ B;  3QWM A;  3U8Z A;  5J3Q A;  1V5U A;  1WGU A;  1Q67 A;  2HE7 A;  1TXD A;  4HAT B;  1P5T A;  4MT7 A;  2VKI A;  4KHA A;  5D3V A;  2CRF A;  2COA A;  2RVB B;  1LW3 A;  2W2W A;  5D3X A;  2UZR A;  2J0J A;  3HQC A;  4HDQ A;  2YF0 A;  3KSY A;  2L2I A;  3ODO A;  5HE0 A;  3ZDT A;  1GC6 A;  4GXB A;  3PZD A;  3D8E A;  1MIX A;  5C5B A;  5CLL B;  3TW1 A;  3DXE A;  4K17 A;  4NY0 A;  3PSC A;  5KCV A;  5EFX A;  4CHJ A;  1XOD A;  1MKE A;  3D8D A;  2DKP A;  3WA0 A;  5DH9 B;  3F0W A;  2DYQ A;  2IFS A;  2AEH A;  3FM8 C;  3D8F A;  2ZPY A;  5DHA B;  2DKQ A;  2X18 A;  1DDM A;  4HAZ B;  2GJY A;  2ELB A;  1UNQ A;  3P6A A;  1K5D B;  4HAU B;  2CY4 A;  2IYB A;  1UPQ A;  3LJU X;  2YSZ A;  1OMW A;  3DXD A;  1RJ2 A;  3KRW A;  4PNK A;  4EJN A;  1BAK A;  1MK7 B;  4ZRJ A;  4P7I A;  4IFS A;  2KCJ A;  4A6F B;  1FGY A;  2UVM A;  2J0M A;  3TCA A;  4D0N B;  4HB0 B;  1ZC3 B;  2EMS A;  3N7C A;  2GCL A;  3V5W A;  1WJ1 A;  1WG7 A;  3HW2 B;  4HB4 B;  5FI1 A;  3X23 A;  3DXC A;  3PP2 A;  5HE1 A;  1MPH A;  2D4Q A;  2E2X A;  3ML4 A;  1NU2 A;  4XWX A;  1W1D A;  3PG7 A;  1MAI A;  2Z0Q A;  2LOX A;  4Z2N A;  2D9W A;  2W2X C;  4K81 A;  2COD A;  1X05 A;  3SNH A;  3MPX A;  3CIK A;  4A6K A;  3AJ4 A;  3BJI A;  4GPT B;  1DDV A;  1XCG A;  3PEG A;  2YRY A;  5KQ4 A;  1W1G A;  2BCJ A;  4MY6 A;  1UNR A;  2G35 A;  1V61 A;  3FSS A;  3PVW A;  1Y5O A;  2QKL A;  5JHG A;  2GCJ A;  2N0Y A;  3ODW A;  4WSF A;  5DI9 B;  2P0F A;  3O96 A;  5FI0 A;  4IOY X;  1AQC A;  1M7E A;  1FB8 A;  1PMS A;  4WJ7 A;  4A6H A;  2RUK B;  3SV1 A;  2W2X D;  5C5B B;  2JP2 A;  3P7Z A;  1N3H A;  3QIJ A;  3QBV B;  1IRS A;  4F7H A;  3KY9 A;  2K2J A;  1J0W A;  1ISN A;  1TQZ A;  3U7D A;  1FHW A;  1U2B A;  2YS1 A;  2XQN M;  1DRO A;  1EF1 A;  4DX9 0;  2YS3 A;  2P0D A;  1EVH A;  1XKE A;  3WYF B;  3SYX A;  1WJM A;  1RRP B;  4L6E A;  1EAZ A;  2OTX A;  5C79 A;  2MDX A;  3VOQ A;  1V88 A;  1XX0 A;  2J59 M;  2LYD A;  4K2P A;  1U27 A;  4GMV A;  1I2H A;  2K2U A;  4HAV B;  2DLW A;  2RNR B;  1LB1 A;  1P6S A;  2D9V A;  1DDW A;  2K00 A;  1NI2 A;  4K2O A;  1QC6 A;  1UEF A;  1BTN A;  1ZVR A;  3OAN A;  1U5F A;  1WI1 A;  2DHK A;  1FAO A;  2ADZ A;  1E5W A;  2P8V A;  2H7E A;  2UZS A;  2LKO A;  2NZ8 B;  3TFM A;  2MFQ A;  1PFJ A;  2VRW B;  1FHX A;  4EKU A;  4KVG B;  1V5M A;  3IVF A;  3M1I B;  2DX5 A;  3VIA A;  3FEH A;  2D9X A;  2D11 A;  3PVU A;  4HB2 B;  2VSZ A;  2MWN B;  2Z0O A;  4TKN A;  2I1J A;  4F7U P;  1U5E A;  3MDB C;  1BTK A;  3AU5 A;  5KQ1 A;  1J19 A;  1PLS A;  2KGX B;  2YVC A;  3CXB B;  1AWE A;  4GZU A;  3A98 B;  4HHV A;  5DHF B;  5C16 A;  5LOP B;  4MK0 A;  5JLJ B;  2AL6 A;  2COC A;  3NSU A;  2Z0P A;  4A5K A;  2DA0 A;  1WGQ A;  4KAX B;  4B6H A;  4HAX B;  2CY5 A;  1GC7 A;  2I5F A;  1UNP A;  3A8Q A;  4EMO A;  2DFK A;  5D3Y A;  4YON A;  4HDO A;  4F7G A;  3TO1 A;  4TYZ A;  1OQN A;  3PVL A;  1UPR A;  1P3R A;  3TVV A;  2DN6 A;  4IAP A;  1SGH A;  3KRX A;  2CAY A;  2I1K A;  4ZRK A;  2HTH B;  3BIN A;  1W1H A;  4H8S A;  4KHO A;  4YL8 A;  5GOW B;  5JHH A;  2R09 A;  1X86 A;  1V5P A;  1KI1 B;  2P0H A;  3SO6 A;  2EJ8 A;  5C6R A;  1KZG A;  2RSG A;  1ZSQ A;  1BWN A;  1B55 A;  4Y94 A;  1K5G B;  2H7D A;  4ZRI A;  1I7A A;  3UZT A;  2MKR A;  2R0D A;  2DYN A;  2I5C A;  1U5D A;  5J3T A;  1NTY A;  2RGN B;  3SUZ A;  5JP4 A;  4CHM A;  1ZM0 A;  4HAW B;  3G9W A;  2OQB A;  1X1G A;  1Y19 B;  5HE3 A;  3HK0 A;  4PQ0 A;  4DX8 A;  3RCP A;  2ROV A;  2D9Y A;  4BBK A;  1H10 A;  5DIF B;  2COF A;  2KUP A;  2M14 A;  2NMB A;  1TJ6 A;  3ULB A;  2D10 A;  1X11 A;  1KZ7 A;  2RLO A;  4KHB B;  1NTV A;  2YS5 A;  1X1F A;  1H4R A;  5D3W A;  5LON B;  4C0A A;  2QKM A;  4Z2M B;  2PZ1 A;  2Y8G A;  4DBB A;  1DYN A;  3GYP A;  4HB3 B;  4DXA B; 
#chains in the Genus database with same CATH topology
 1DBH A;  5D27 A;  2LUL A;  2DHJ A;  4NSW A;  1M7R A;  2J0K A;  2Y8F A;  2YT0 A;  3A58 A;  2Q13 A;  1XR0 B;  2LG1 A;  5J3Y A;  4GMX B;  1Z87 A;  2D9Z A;  1U29 A;  5L81 A;  3AU4 A;  2EMT A;  2D2Q A;  2V76 A;  4CYE A;  2YT1 A;  1FGZ A;  2L1C A;  4WVF B;  1EGX A;  3ZVR A;  2Y7B A;  2ROZ B;  2ELA A;  2GS0 A;  4A6F A;  3ODX A;  2LOZ A;  3GYO A;  4L1R A;  1V89 A;  4GN1 A;  3A8P A;  5HE2 A;  1XD4 A;  2EC1 A;  4HAY B;  1GG3 A;  2M38 A;  1ZC4 B;  3F5R A;  3T06 A;  1FHO A;  1MIZ B;  1WVH A;  1U5G A;  1MK9 B;  2FJL A;  3ULC A;  2N23 A;  4D6W A;  2DX1 A;  1QQG A;  3OHM B;  2DTC A;  3KZ1 A;  2DHI A;  1FOE A;  1OY2 A;  1SHC A;  5CLQ B;  3QWM A;  3U8Z A;  5J3Q A;  1V5U A;  1WGU A;  1Q67 A;  2HE7 A;  2RRF A;  3NW8 A;  1TXD A;  4HAT B;  1P5T A;  4MT7 A;  2VKI A;  4KHA A;  5D3V A;  2CRF A;  4HSI A;  2COA A;  3NWD A;  2RVB B;  1LW3 A;  2W2W A;  2FJU B;  5D3X A;  2UZR A;  2J0J A;  3HQC A;  4HDQ A;  2YF0 A;  3KSY A;  2L2I A;  3ODO A;  5HE0 A;  3ZDT A;  1GC6 A;  4GXB A;  3PZD A;  3D8E A;  1MIX A;  5C5B A;  5CLL B;  3TW1 A;  3DXE A;  4K17 A;  4NY0 A;  3PSC A;  5KCV A;  2KIE A;  5EFX A;  4CHJ A;  1XOD A;  1MKE A;  3D8D A;  4OSN A;  2DKP A;  3WA0 A;  5DH9 B;  3F0W A;  2DYQ A;  2IFS A;  2AEH A;  3FM8 C;  3D8F A;  2ZPY A;  5DHA B;  2DKQ A;  2X18 A;  1DDM A;  4HAZ B;  2GJY A;  2ELB A;  1UNQ A;  3P6A A;  2K8E A;  1K5D B;  4HAU B;  2CY4 A;  2IYB A;  1UPQ A;  3LJU X;  1T77 A;  2YSZ A;  1OMW A;  3DXD A;  1RJ2 A;  3KRW A;  4PNK A;  4EJN A;  1BAK A;  1MK7 B;  4ZRJ A;  4P7I A;  4IFS A;  2KCJ A;  4A6F B;  1FGY A;  2NBV A;  3DCX A;  2UVM A;  2J0M A;  3TCA A;  4D0N B;  4HB0 B;  1ZC3 B;  2EMS A;  3N7C A;  2GCL A;  3V5W A;  1WJ1 A;  1WG7 A;  2KIG A;  3HW2 B;  4HB4 B;  5FI1 A;  3X23 A;  3DXC A;  2ZKM X;  3PP2 A;  5HE1 A;  1MPH A;  2D4Q A;  3NWF A;  2E2X A;  3ML4 A;  1NU2 A;  3HSA A;  4XWX A;  1W1D A;  3PG7 A;  1MAI A;  2Z0Q A;  2LOX A;  4GOU A;  5IRS A;  3NWA A;  4Z2N A;  2Z4D A;  2D9W A;  2W2X C;  4K81 A;  2COD A;  1X05 A;  3SNH A;  3MPX A;  3CIK A;  4A6K A;  3AJ4 A;  3BJI A;  4GPT B;  1DDV A;  1XCG A;  3PEG A;  2YRY A;  5KQ4 A;  1W1G A;  2BCJ A;  4MY6 A;  1UNR A;  2G35 A;  1V61 A;  3FSS A;  3PVW A;  1Y5O A;  4QJ4 B;  2QKL A;  5JHG A;  4DIX A;  2GCJ A;  2N0Y A;  3ODW A;  4WSF A;  5DI9 B;  2P0F A;  2YT2 A;  3O96 A;  5FI0 A;  4IOY X;  3B77 A;  1AQC A;  1M7E A;  1FB8 A;  1PMS A;  4WJ7 A;  4A6H A;  2RUK B;  3SV1 A;  2W2X D;  5C5B B;  2JP2 A;  3P7Z A;  1N3H A;  4QXA B;  3QIJ A;  3QBV B;  1IRS A;  4F7H A;  2K2J A;  3KY9 A;  1J0W A;  3FVC A;  1ISN A;  1TQZ A;  3U7D A;  1FHW A;  1U2B A;  2YS1 A;  2XQN M;  1DRO A;  1EF1 A;  4DX9 0;  2YS3 A;  2P0D A;  5I2M A;  1EVH A;  1XKE A;  3WYF B;  3SYX A;  1WJM A;  1RRP B;  4L6E A;  1EAZ A;  2OTX A;  5C79 A;  2MDX A;  3U12 A;  3VOQ A;  1V88 A;  1XX0 A;  2J59 M;  2LYD A;  4K2P A;  1U27 A;  4GMV A;  1I2H A;  2K2U A;  4HAV B;  2DLW A;  2RNR B;  1LB1 A;  1P6S A;  2D9V A;  1DDW A;  2K00 A;  1NI2 A;  4K2O A;  1QC6 A;  1UEF A;  1BTN A;  1ZVR A;  3OAN A;  1U5F A;  1WI1 A;  1ZYI A;  2DHK A;  1FAO A;  2ADZ A;  1E5W A;  2P8V A;  5M4Y B;  2H7E A;  2UZS A;  2LKO A;  2NZ8 B;  3TFM A;  2MFQ A;  1PFJ A;  2VRW B;  2Z14 A;  1FHX A;  4EKU A;  4KVG B;  1V5M A;  2KUQ A;  3IVF A;  4CSQ A;  3M1I B;  2DX5 A;  3VIA A;  3FEH A;  2D9X A;  2D11 A;  3PVU A;  4HB2 B;  2VSZ A;  2MWN B;  2Z0O A;  4TKN A;  2KR0 A;  2I1J A;  4F7U P;  1U5E A;  3MDB C;  1BTK A;  3AU5 A;  5KQ1 A;  4QJ3 B;  1J19 A;  1PLS A;  2KGX B;  2YVC A;  3CXB B;  1AWE A;  4GZU A;  3A98 B;  4HHV A;  5DHF B;  5C16 A;  5LOP B;  4MK0 A;  5JLJ B;  2K49 A;  2AL6 A;  2COC A;  4KHB A;  3NSU A;  2Z0P A;  4A5K A;  2DA0 A;  1WGQ A;  4KAX B;  4B6H A;  1MI1 A;  4HAX B;  2CY5 A;  2R2Y A;  1GC7 A;  2I5F A;  4QJ5 B;  2GUM A;  1UNP A;  3A8Q A;  4EMO A;  2DFK A;  2Z59 A;  5D3Y A;  4YON A;  4HDO A;  4F7G A;  3TO1 A;  4TYZ A;  1OQN A;  3PVL A;  1UPR A;  1P3R A;  3TVV A;  2DN6 A;  4IAP A;  2Z13 A;  1SGH A;  3KRX A;  2CAY A;  2I1K A;  4ZRK A;  2HTH B;  3BIN A;  1W1H A;  4H8S A;  4KHO A;  4YL8 A;  5GOW B;  5JHH A;  2R09 A;  1X86 A;  5I2S A;  1V5P A;  1KI1 B;  2P0H A;  3SO6 A;  2EJ8 A;  5C6R A;  1KZG A;  2RSG A;  1ZSQ A;  1BWN A;  1B55 A;  4Y94 A;  1K5G B;  2H7D A;  4ZRI A;  1I7A A;  3UZT A;  2MKR A;  3HIE A;  2R0D A;  2DYN A;  2I5C A;  1U5D A;  5J3T A;  1NTY A;  2RGN B;  3SUZ A;  5JP4 A;  4CHM A;  1ZM0 A;  4GNK B;  4HAW B;  4OT1 A;  3G9W A;  2OQB A;  1X1G A;  1Y19 B;  5HE3 A;  3HK0 A;  4PQ0 A;  4DX8 A;  3RCP A;  2ROV A;  2D9Y A;  4BBK A;  1H10 A;  5DIF B;  2COF A;  2KUP A;  2M14 A;  2NMB A;  1TJ6 A;  3ULB A;  2D10 A;  5LG4 B;  1X11 A;  1KZ7 A;  2RLO A;  4KHB B;  1NTV A;  2YS5 A;  1X1F A;  1H4R A;  5D3W A;  5LON B;  4C0A A;  2QKM A;  4Z2M B;  2PZ1 A;  2Y8G A;  4DBB A;  1DYN A;  3GYP A;  4HB3 B;  4DXA B; 
#chains in the Genus database with same CATH homology
 1DBH A;  5D27 A;  2LUL A;  2DHJ A;  4NSW A;  1M7R A;  2J0K A;  2Y8F A;  2YT0 A;  2Q13 A;  1XR0 B;  2LG1 A;  5J3Y A;  4GMX B;  1Z87 A;  2D9Z A;  1U29 A;  5L81 A;  3AU4 A;  2EMT A;  2D2Q A;  2V76 A;  4CYE A;  2YT1 A;  1FGZ A;  2L1C A;  4WVF B;  1EGX A;  3ZVR A;  2Y7B A;  2ROZ B;  2ELA A;  2GS0 A;  4A6F A;  3ODX A;  2LOZ A;  3GYO A;  1V89 A;  4GN1 A;  3A8P A;  5HE2 A;  1XD4 A;  2EC1 A;  4HAY B;  1GG3 A;  2M38 A;  1ZC4 B;  3F5R A;  3T06 A;  1FHO A;  1MIZ B;  1WVH A;  1U5G A;  1MK9 B;  2FJL A;  3ULC A;  2N23 A;  2DX1 A;  1QQG A;  2DTC A;  3KZ1 A;  2DHI A;  1FOE A;  1OY2 A;  1SHC A;  5CLQ B;  3QWM A;  3U8Z A;  5J3Q A;  1V5U A;  1WGU A;  1Q67 A;  2HE7 A;  1TXD A;  4HAT B;  1P5T A;  4MT7 A;  2VKI A;  4KHA A;  5D3V A;  2CRF A;  2COA A;  2RVB B;  1LW3 A;  2W2W A;  5D3X A;  2UZR A;  2J0J A;  3HQC A;  4HDQ A;  2YF0 A;  3KSY A;  2L2I A;  3ODO A;  5HE0 A;  3ZDT A;  1GC6 A;  4GXB A;  3PZD A;  3D8E A;  1MIX A;  5C5B A;  5CLL B;  3TW1 A;  3DXE A;  4K17 A;  4NY0 A;  3PSC A;  5KCV A;  5EFX A;  4CHJ A;  1XOD A;  1MKE A;  3D8D A;  2DKP A;  3WA0 A;  5DH9 B;  3F0W A;  2DYQ A;  2IFS A;  2AEH A;  3FM8 C;  3D8F A;  2ZPY A;  5DHA B;  2DKQ A;  2X18 A;  1DDM A;  4HAZ B;  2GJY A;  2ELB A;  1UNQ A;  3P6A A;  1K5D B;  4HAU B;  2CY4 A;  2IYB A;  1UPQ A;  3LJU X;  2YSZ A;  1OMW A;  3DXD A;  1RJ2 A;  3KRW A;  4PNK A;  4EJN A;  1BAK A;  1MK7 B;  4ZRJ A;  4P7I A;  4IFS A;  2KCJ A;  4A6F B;  1FGY A;  2UVM A;  2J0M A;  3TCA A;  4D0N B;  4HB0 B;  1ZC3 B;  2EMS A;  3N7C A;  2GCL A;  3V5W A;  1WJ1 A;  1WG7 A;  3HW2 B;  4HB4 B;  5FI1 A;  3X23 A;  3DXC A;  3PP2 A;  5HE1 A;  1MPH A;  2D4Q A;  2E2X A;  3ML4 A;  1NU2 A;  4XWX A;  1W1D A;  3PG7 A;  1MAI A;  2Z0Q A;  2LOX A;  4Z2N A;  2D9W A;  2W2X C;  4K81 A;  2COD A;  1X05 A;  3SNH A;  3MPX A;  3CIK A;  4A6K A;  3AJ4 A;  3BJI A;  4GPT B;  1DDV A;  1XCG A;  3PEG A;  2YRY A;  5KQ4 A;  1W1G A;  2BCJ A;  4MY6 A;  1UNR A;  2G35 A;  1V61 A;  3FSS A;  3PVW A;  1Y5O A;  2QKL A;  5JHG A;  2GCJ A;  2N0Y A;  3ODW A;  4WSF A;  5DI9 B;  2P0F A;  3O96 A;  5FI0 A;  4IOY X;  1AQC A;  1M7E A;  1FB8 A;  1PMS A;  4WJ7 A;  4A6H A;  2RUK B;  3SV1 A;  2W2X D;  5C5B B;  2JP2 A;  3P7Z A;  1N3H A;  3QIJ A;  3QBV B;  1IRS A;  4F7H A;  3KY9 A;  2K2J A;  1J0W A;  1ISN A;  1TQZ A;  3U7D A;  1FHW A;  1U2B A;  2YS1 A;  2XQN M;  1DRO A;  1EF1 A;  4DX9 0;  2YS3 A;  2P0D A;  1EVH A;  1XKE A;  3WYF B;  3SYX A;  1WJM A;  1RRP B;  4L6E A;  1EAZ A;  2OTX A;  5C79 A;  2MDX A;  3VOQ A;  1V88 A;  1XX0 A;  2J59 M;  2LYD A;  4K2P A;  1U27 A;  4GMV A;  1I2H A;  2K2U A;  4HAV B;  2DLW A;  2RNR B;  1LB1 A;  1P6S A;  2D9V A;  1DDW A;  2K00 A;  1NI2 A;  4K2O A;  1QC6 A;  1UEF A;  1BTN A;  1ZVR A;  3OAN A;  1U5F A;  1WI1 A;  2DHK A;  1FAO A;  2ADZ A;  1E5W A;  2P8V A;  2H7E A;  2UZS A;  2LKO A;  2NZ8 B;  3TFM A;  2MFQ A;  1PFJ A;  2VRW B;  1FHX A;  4EKU A;  4KVG B;  1V5M A;  3IVF A;  3M1I B;  2DX5 A;  3VIA A;  3FEH A;  2D9X A;  2D11 A;  3PVU A;  4HB2 B;  2VSZ A;  2MWN B;  2Z0O A;  4TKN A;  2I1J A;  4F7U P;  1U5E A;  3MDB C;  1BTK A;  3AU5 A;  5KQ1 A;  1J19 A;  1PLS A;  2KGX B;  2YVC A;  3CXB B;  1AWE A;  4GZU A;  3A98 B;  4HHV A;  5DHF B;  5C16 A;  5LOP B;  4MK0 A;  5JLJ B;  2AL6 A;  2COC A;  3NSU A;  2Z0P A;  4A5K A;  2DA0 A;  1WGQ A;  4KAX B;  4B6H A;  4HAX B;  2CY5 A;  1GC7 A;  2I5F A;  1UNP A;  3A8Q A;  4EMO A;  2DFK A;  5D3Y A;  4YON A;  4HDO A;  4F7G A;  3TO1 A;  4TYZ A;  1OQN A;  3PVL A;  1UPR A;  1P3R A;  3TVV A;  2DN6 A;  4IAP A;  1SGH A;  3KRX A;  2CAY A;  2I1K A;  4ZRK A;  2HTH B;  3BIN A;  1W1H A;  4H8S A;  4KHO A;  4YL8 A;  5GOW B;  5JHH A;  2R09 A;  1X86 A;  1V5P A;  1KI1 B;  2P0H A;  3SO6 A;  2EJ8 A;  5C6R A;  1KZG A;  2RSG A;  1ZSQ A;  1BWN A;  1B55 A;  4Y94 A;  1K5G B;  2H7D A;  4ZRI A;  1I7A A;  3UZT A;  2MKR A;  2R0D A;  2DYN A;  2I5C A;  1U5D A;  5J3T A;  1NTY A;  2RGN B;  3SUZ A;  5JP4 A;  4CHM A;  1ZM0 A;  4HAW B;  3G9W A;  2OQB A;  1X1G A;  1Y19 B;  5HE3 A;  3HK0 A;  4PQ0 A;  4DX8 A;  3RCP A;  2ROV A;  2D9Y A;  4BBK A;  1H10 A;  5DIF B;  2COF A;  2KUP A;  2M14 A;  2NMB A;  1TJ6 A;  3ULB A;  2D10 A;  1X11 A;  1KZ7 A;  2RLO A;  4KHB B;  1NTV A;  2YS5 A;  1X1F A;  1H4R A;  5D3W A;  5LON B;  4C0A A;  2QKM A;  4Z2M B;  2PZ1 A;  2Y8G A;  4DBB A;  1DYN A;  3GYP A;  4HB3 B;  4DXA B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...