2VKIA

Structure of the pdk1 ph domain k465e mutant
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
139
structure length
139
Chain Sequence
SNIEQYIHDLDSNSFELDLQFSEDEKRLLLEKQAGGNPWHQFVENNLILKMGPVDERKGLFARRRQLLLTEGPHLYYVDPVNKVLKGEIPWSQELRPEAKNFKTFFVHTPNRTYYLMDPSGNAHKWCRKIQEVWRQRYQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords 3-PHOPSHOINOSITIDE DEPENDENT PROTEIN KINASE 1
publication title Mutation of the Pdk1 Ph Domain Inhibits Protein Kinase B/Akt, Leading to Small Size and Insulin Resistance.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 39
structure length 139
sequence length 139
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2007-12-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14593 PH_3 PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2vkiA00
1H10A 2E2XA 3FM8C 2YF0A 5HE2A 1W1DA 2YSZA 3MDBC 2M14A 1BTNA 3FEHA 2MWNB 2LOZA 4PNKA 3D8FA 1BAKA 4HB4B 1ZSQA 3GYPA 1U2BA 3A98B 5C6RA 2COCA 5CLQB 1WJ1A 4HATB 1DBHA 4XWXA 1KZ7A 2DYQA 1QC6A 2Q13A 3CIKA 5D27A 2COAA 5DHFB 4HB3B 3KZ1A 4KAXB 2P0HA 3UZTA 1N3HA 2MDXA 3QWMA 3PP2A 1DDMA 1ZM0A 4K17A 2DN6A 4HB2B 3TVVA 3ULCA 2EMTA 3SO6A 1GC7A 2YS3A 1DYNA 2EMSA 2KGXB 3KSYA 3SV1A 2Y8FA 3AU5A 2N0YA 3P6AA 1KI1B 4KHBB 3U7DA 3PVLA 1LB1A 3HQCA 4F7HA 1Y19B 4TKNA 1FHWA 1MKEA 4NSWA 3U8ZA 1EAZA 3PG7A 1MIXA 2KCJA 1SHCA 1V89A 1W1GA 2M38A 2NZ8B 2YRYA 3SNHA 5EFXA 4A6FA 1PMSA 2DX5A 1X86A 2IYBA 2DX1A 3VIAA 4KHAA 5KCVA 2G35A 3DXCA 2P0DA 4EKUA 2AEHA 1RRPB 3DXEA 4MK0A 4K81A 2K2JA 4HAVB 1V61A 1WG7A 2LYDA 2ROVA 1X11A 1UNQA 5JLJB 1SGHA 2D10A 3OANA 2RVBB 4GN1A 3AJ4A 3P7ZA 1OQNA 2H7DA 1X05A 2Y7BA 1DDVA 5L81A 3D8EA 2K00A 2ROZB 3F5RA 1EF1A 2J59M 2DTCA 3A8QA 1XKEA 1TJ6A 1U5FA 1FAOA 1XCGA 4KHOA 5KQ1A 1X1FA 4DBBA 3QBVB 5HE0A 3X23A 1BWNA 1MPHA 2RGNB 2Z0PA 1ISNA 4A6KA 1Z87A 2RLOA 2DYNA 3ULBA 3WYFB 4CHMA 1WJMA 1TQZA 3ODXA 3DXDA 3TO1A 2IFSA 2QKLA 2DKQA 2Y8GA 2YS1A 4HAZB 3T06A 4YONA 3ZVRA 4DXAB 1U5DA 5D3VA 4WVFB 3TW1A 3KRXA 1B55A 3ODWA 4IAPA 1ZC3B 1WGQA 2D9YA 2J0JA 1UPRA 4A5KA 4EJNA 2LKOA 4TYZA 3G9WA 5HE3A 4F7GA 2UVMA 1V5PA 3FSSA 1NI2A 2J0KA 1FHOA 2ELBA 1U5EA 2DKPA 5JP4A 2HTHB 3IVFA 2YT0A 2W2XD 1AWEA 2DA0A 2CRFA 1U27A 2HE7A 5DH9B 1AQCA 4Z2NA 5KQ4A 1UPQA 2N23A 1MK7B 2FJLA 2XQNM 2UZRA 4GZUA 3PEGA 1DROA 2D9XA 4GXBA 1K5DB 2GCLA 4HHVA 4HAYB 3WA0A 4F7UP 2KUPA 1RJ2A 3BINA 1FHXA 1XD4A 2ELAA 1XR0B 2W2WA 2EJ8A 4HAWB 1X1GA 4CYEA 3LJUX 1P6SA 4B6HA 2Z0QA 4BBKA 1FGYA 2UZSA 2DFKA 5JHHA 4GMVA 4WJ7A 2OQBA 5LONB 3ZDTA 2CY4A 5D3WA 1U5GA 3TCAA 1PFJA 1MAIA 2D9WA 5FI0A 4HAUB 2ZPYA 4K2PA 1V88A 2RUKB 4C0AA 2GJYA 1WGUA 3HK0A 4D0NB 1NTVA 2P8VA 2YVCA 4DX8A 2ADZA 2BCJA 4HB0B 2LG1A 2MKRA 2QKMA 1I7AA 2I5CA 3N7CA 3TFMA 1UNRA 5DI9B 4CHJA 1J0WA 1NU2A 3PVUA 5D3XA 1TXDA 4GMXB 1UEFA 3O96A 1ZC4B 1KZGA 2JP2A 3V5WA 2VSZA 1QQGA 1MIZB 1MK9B 5DHAB 3BJIA 2Z0OA 4DX90 1K5GB 2OTXA 3F0WA 4Y94A 2DHJA 3PVWA 1XX0A 4PQ0A 5FI1A 1FB8A 5C5BB 1OY2A 5GOWB 5LOPB 1IRSA 4H8SA 1OMWA 2X18A 5HE1A 1DDWA 1ZVRA 3PZDA 4MY6A 3RCPA 1J19A 3SYXA 1Y5OA 3AU4A 2RSGA 4WSFA 4K2OA 1GC6A 2D9VA 4A6HA 2PZ1A 2YS5A 4HDQA 2I1JA 3ML4A 4HDOA 2I1KA 1BTKA 1PLSA 1M7EA 1XODA 3HW2B 2R0DA 5C79A 1EGXA 2D11A 1H4RA 1NTYA 2P0FA 4YL8A 3NSUA 2L1CA 2MFQA 1FOEA 4ZRKA 2J0MA 5J3YA 3ODOA 4ZRJA 2L2IA 2V76A 5D3YA 1WVHA 2W2XC 2GCJA 4MT7A 3CXBB 2DHIA 1WI1A 1W1HA 1EVHA 1Q67A 1E5WA 2VRWB 3QIJA 4IFSA 2NMBA 3KRWA 5DIFB 4EMOA 1GG3A 2RNRB 2EC1A 4ZRIA 5J3TA 2YT1A 1M7RA 2D9ZA 3GYOA 5C5BA 2DHKA 5CLLB 1P5TA 4IOYX 4KVGB 5J3QA 2GS0A 1I2HA 2R09A 2COFA 2I5FA 4P7IA 4NY0A 5JHGA 2H7EA 1U29A 2D4QA 2CY5A 2D2QA 3M1IB 3VOQA 3PSCA 4GPTB 4HAXB 3MPXA 1FGZA 3KY9A 4L6EA 2LOXA 1UNPA 1V5MA 2VKIA 4A6FB 1LW3A 1P3RA 2DLWA 5C16A 3SUZA 2CODA 2K2UA 2CAYA 4Z2MB 3A8PA 3D8DA 1V5UA 2LULA 2AL6A
chains in the Genus database with same CATH superfamily
1H10A 2E2XA 3FM8C 2YF0A 5HE2A 1W1DA 2YSZA 3MDBC 2M14A 1BTNA 3FEHA 2MWNB 2LOZA 4GOUA 4PNKA 3D8FA 1BAKA 4HB4B 1ZSQA 3GYPA 1U2BA 3A98B 5C6RA 2GUMA 2COCA 5CLQB 1WJ1A 4HATB 1DBHA 4XWXA 1KZ7A 2DYQA 1QC6A 2Q13A 3CIKA 5D27A 2COAA 5DHFB 4HB3B 3KZ1A 4KAXB 2P0HA 3UZTA 1N3HA 2MDXA 3QWMA 3PP2A 1DDMA 3HSAA 1ZM0A 4K17A 2DN6A 4HB2B 3TVVA 3ULCA 2EMTA 3SO6A 1GC7A 2YS3A 1DYNA 2EMSA 2KGXB 3KSYA 3SV1A 3NW8A 3U12A 2Y8FA 3AU5A 2N0YA 3P6AA 1KI1B 4KHBB 3U7DA 3PVLA 1LB1A 3HQCA 4F7HA 1Y19B 4TKNA 1FHWA 1MKEA 4NSWA 3U8ZA 1EAZA 3PG7A 1MIXA 4GNKB 2KCJA 1SHCA 1V89A 1W1GA 2M38A 2NZ8B 2YRYA 3SNHA 5EFXA 4A6FA 3HIEA 1PMSA 2DX5A 1X86A 2IYBA 2DX1A 3VIAA 4KHAA 5KCVA 2G35A 3DXCA 2P0DA 4EKUA 2AEHA 1RRPB 3DXEA 4MK0A 1ZYIA 4K81A 2K2JA 4HAVB 1V61A 1WG7A 4OT1A 3A58A 2LYDA 5IRSA 2ROVA 4D6WA 1X11A 1UNQA 5JLJB 1SGHA 2D10A 3OANA 2RVBB 4GN1A 3AJ4A 3P7ZA 2KIGA 1OQNA 2H7DA 1X05A 2Y7BA 1DDVA 5L81A 3D8EA 2NBVA 2K00A 2ROZB 3F5RA 1EF1A 2J59M 2DTCA 3A8QA 1XKEA 1TJ6A 1U5FA 1FAOA 1XCGA 4KHOA 5KQ1A 1X1FA 4DBBA 3QBVB 5HE0A 3OHMB 3X23A 1BWNA 4DIXA 1MPHA 2RGNB 2Z0PA 1ISNA 4A6KA 4QXAB 1Z87A 2RLOA 2DYNA 3ULBA 3WYFB 4CHMA 1WJMA 1TQZA 4KHBA 3ODXA 3DXDA 3TO1A 2IFSA 2QKLA 2DKQA 2Y8GA 2YS1A 4HAZB 3T06A 4YONA 3ZVRA 4DXAB 1U5DA 5D3VA 4WVFB 3TW1A 3KRXA 1B55A 3ODWA 4IAPA 1ZC3B 1WGQA 2D9YA 2J0JA 1UPRA 4A5KA 4EJNA 2LKOA 4TYZA 3G9WA 5HE3A 4F7GA 2UVMA 1V5PA 3FSSA 1NI2A 2J0KA 2Z4DA 2ELBA 1FHOA 1U5EA 2DKPA 5JP4A 2HTHB 3IVFA 2YT0A 2W2XD 1AWEA 2DA0A 2CRFA 1U27A 2HE7A 5DH9B 1AQCA 4Z2NA 5KQ4A 1UPQA 2N23A 1MK7B 2FJLA 2XQNM 2UZRA 4GZUA 3PEGA 1DROA 2D9XA 4GXBA 1K5DB 2GCLA 4HHVA 4HAYB 3WA0A 4F7UP 2KUPA 1RJ2A 4HSIA 2Z13A 3BINA 1FHXA 1XD4A 2ELAA 2K49A 1XR0B 2W2WA 2EJ8A 4QJ5B 4HAWB 1X1GA 4CYEA 3LJUX 1P6SA 4B6HA 2Z0QA 4BBKA 1FGYA 2UZSA 3DCXA 2DFKA 5JHHA 4GMVA 4WJ7A 2OQBA 5LONB 3ZDTA 2KR0A 2CY4A 5D3WA 1U5GA 3TCAA 1PFJA 1MAIA 2D9WA 5FI0A 4HAUB 2ZPYA 4K2PA 1V88A 2RUKB 4C0AA 2GJYA 1WGUA 3HK0A 1T77A 3NWDA 4D0NB 1NTVA 2P8VA 2YVCA 4DX8A 2ADZA 2KIEA 2BCJA 4L1RA 4HB0B 2LG1A 2MKRA 2QKMA 1I7AA 2I5CA 3N7CA 3TFMA 1UNRA 5DI9B 4CHJA 1J0WA 1NU2A 3PVUA 5D3XA 1TXDA 1MI1A 4GMXB 1UEFA 2YT2A 3O96A 1ZC4B 2FJUB 1KZGA 2JP2A 3B77A 3V5WA 2VSZA 1QQGA 1MIZB 1MK9B 5DHAB 3BJIA 2Z0OA 4DX90 1K5GB 2OTXA 3F0WA 4Y94A 2DHJA 3PVWA 1XX0A 4PQ0A 5FI1A 1FB8A 5C5BB 4OSNA 1OY2A 5GOWB 4QJ3B 5LOPB 1IRSA 4H8SA 5I2SA 1OMWA 2X18A 5HE1A 4CSQA 1DDWA 1ZVRA 3NWAA 3PZDA 4MY6A 3RCPA 1J19A 3SYXA 1Y5OA 3AU4A 2RSGA 2RRFA 4WSFA 4K2OA 1GC6A 2D9VA 4A6HA 2PZ1A 2YS5A 4QJ4B 4HDQA 2I1JA 3ML4A 4HDOA 2I1KA 1BTKA 1PLSA 1M7EA 1XODA 3HW2B 5M4YB 2R0DA 5C79A 1EGXA 2D11A 1H4RA 1NTYA 2P0FA 4YL8A 3NSUA 2L1CA 2MFQA 1FOEA 4ZRKA 2J0MA 5J3YA 3ODOA 4ZRJA 2L2IA 5I2MA 2V76A 5D3YA 2Z59A 1WVHA 2W2XC 2GCJA 4MT7A 3CXBB 2DHIA 1WI1A 1W1HA 1EVHA 1Q67A 1E5WA 2VRWB 3QIJA 4IFSA 3NWFA 2NMBA 3KRWA 5DIFB 4EMOA 1GG3A 2RNRB 2EC1A 4ZRIA 2ZKMX 5J3TA 2YT1A 3FVCA 1M7RA 2D9ZA 2KUQA 3GYOA 5C5BA 2DHKA 5CLLB 1P5TA 4IOYX 4KVGB 5J3QA 2GS0A 1I2HA 2R09A 2COFA 2I5FA 4P7IA 4NY0A 5JHGA 2H7EA 1U29A 2D4QA 2CY5A 2D2QA 3M1IB 3VOQA 3PSCA 4GPTB 4HAXB 3MPXA 1FGZA 3KY9A 4L6EA 2K8EA 2LOXA 1UNPA 1V5MA 2VKIA 4A6FB 1LW3A 1P3RA 2DLWA 2R2YA 5LG4B 5C16A 3SUZA 2CODA 2Z14A 2K2UA 2CAYA 4Z2MB 3A8PA 3D8DA 1V5UA 2LULA 2AL6A
chains in the Genus database with same CATH topology
1H10A 2E2XA 3FM8C 2YF0A 5HE2A 1W1DA 2YSZA 3MDBC 2M14A 1BTNA 3FEHA 2MWNB 2LOZA 4PNKA 3D8FA 1BAKA 4HB4B 1ZSQA 3GYPA 1U2BA 3A98B 5C6RA 2COCA 5CLQB 1WJ1A 4HATB 1DBHA 4XWXA 1KZ7A 2DYQA 1QC6A 2Q13A 3CIKA 5D27A 2COAA 5DHFB 4HB3B 3KZ1A 4KAXB 2P0HA 3UZTA 1N3HA 2MDXA 3QWMA 3PP2A 1DDMA 1ZM0A 4K17A 2DN6A 4HB2B 3TVVA 3ULCA 2EMTA 3SO6A 1GC7A 2YS3A 1DYNA 2EMSA 2KGXB 3KSYA 3SV1A 2Y8FA 3AU5A 2N0YA 3P6AA 1KI1B 4KHBB 3U7DA 3PVLA 1LB1A 3HQCA 4F7HA 1Y19B 4TKNA 1FHWA 1MKEA 4NSWA 3U8ZA 1EAZA 3PG7A 1MIXA 2KCJA 1SHCA 1V89A 1W1GA 2M38A 2NZ8B 2YRYA 3SNHA 5EFXA 4A6FA 1PMSA 2DX5A 1X86A 2IYBA 2DX1A 3VIAA 4KHAA 5KCVA 2G35A 3DXCA 2P0DA 4EKUA 2AEHA 1RRPB 3DXEA 4MK0A 4K81A 2K2JA 4HAVB 1V61A 1WG7A 2LYDA 2ROVA 1X11A 1UNQA 5JLJB 1SGHA 2D10A 3OANA 2RVBB 4GN1A 3AJ4A 3P7ZA 1OQNA 2H7DA 1X05A 2Y7BA 1DDVA 5L81A 3D8EA 2K00A 2ROZB 3F5RA 1EF1A 2J59M 2DTCA 3A8QA 1XKEA 1TJ6A 1U5FA 1FAOA 1XCGA 4KHOA 5KQ1A 1X1FA 4DBBA 3QBVB 5HE0A 3X23A 1BWNA 1MPHA 2RGNB 2Z0PA 1ISNA 4A6KA 1Z87A 2RLOA 2DYNA 3ULBA 3WYFB 4CHMA 1WJMA 1TQZA 3ODXA 3DXDA 3TO1A 2IFSA 2QKLA 2DKQA 2Y8GA 2YS1A 4HAZB 3T06A 4YONA 3ZVRA 4DXAB 1U5DA 5D3VA 4WVFB 3TW1A 3KRXA 1B55A 3ODWA 4IAPA 1ZC3B 1WGQA 2D9YA 2J0JA 1UPRA 4A5KA 4EJNA 2LKOA 4TYZA 3G9WA 5HE3A 4F7GA 2UVMA 1V5PA 3FSSA 1NI2A 2J0KA 1FHOA 2ELBA 1U5EA 2DKPA 5JP4A 2HTHB 3IVFA 2YT0A 2W2XD 1AWEA 2DA0A 2CRFA 1U27A 2HE7A 5DH9B 1AQCA 4Z2NA 5KQ4A 1UPQA 2N23A 1MK7B 2FJLA 2XQNM 2UZRA 4GZUA 3PEGA 1DROA 2D9XA 4GXBA 1K5DB 2GCLA 4HHVA 4HAYB 3WA0A 4F7UP 2KUPA 1RJ2A 3BINA 1FHXA 1XD4A 2ELAA 1XR0B 2W2WA 2EJ8A 4HAWB 1X1GA 4CYEA 3LJUX 1P6SA 4B6HA 2Z0QA 4BBKA 1FGYA 2UZSA 2DFKA 5JHHA 4GMVA 4WJ7A 2OQBA 5LONB 3ZDTA 2CY4A 5D3WA 1U5GA 3TCAA 1PFJA 1MAIA 2D9WA 5FI0A 4HAUB 2ZPYA 4K2PA 1V88A 2RUKB 4C0AA 2GJYA 1WGUA 3HK0A 4D0NB 1NTVA 2P8VA 2YVCA 4DX8A 2ADZA 2BCJA 4HB0B 2LG1A 2MKRA 2QKMA 1I7AA 2I5CA 3N7CA 3TFMA 1UNRA 5DI9B 4CHJA 1J0WA 1NU2A 3PVUA 5D3XA 1TXDA 4GMXB 1UEFA 3O96A 1ZC4B 1KZGA 2JP2A 3V5WA 2VSZA 1QQGA 1MIZB 1MK9B 5DHAB 3BJIA 2Z0OA 4DX90 1K5GB 2OTXA 3F0WA 4Y94A 2DHJA 3PVWA 1XX0A 4PQ0A 5FI1A 1FB8A 5C5BB 1OY2A 5GOWB 5LOPB 1IRSA 4H8SA 1OMWA 2X18A 5HE1A 1DDWA 1ZVRA 3PZDA 4MY6A 3RCPA 1J19A 3SYXA 1Y5OA 3AU4A 2RSGA 4WSFA 4K2OA 1GC6A 2D9VA 4A6HA 2PZ1A 2YS5A 4HDQA 2I1JA 3ML4A 4HDOA 2I1KA 1BTKA 1PLSA 1M7EA 1XODA 3HW2B 2R0DA 5C79A 1EGXA 2D11A 1H4RA 1NTYA 2P0FA 4YL8A 3NSUA 2L1CA 2MFQA 1FOEA 4ZRKA 2J0MA 5J3YA 3ODOA 4ZRJA 2L2IA 2V76A 5D3YA 1WVHA 2W2XC 2GCJA 4MT7A 3CXBB 2DHIA 1WI1A 1W1HA 1EVHA 1Q67A 1E5WA 2VRWB 3QIJA 4IFSA 2NMBA 3KRWA 5DIFB 4EMOA 1GG3A 2RNRB 2EC1A 4ZRIA 5J3TA 2YT1A 1M7RA 2D9ZA 3GYOA 5C5BA 2DHKA 5CLLB 1P5TA 4IOYX 4KVGB 5J3QA 2GS0A 1I2HA 2R09A 2COFA 2I5FA 4P7IA 4NY0A 5JHGA 2H7EA 1U29A 2D4QA 2CY5A 2D2QA 3M1IB 3VOQA 3PSCA 4GPTB 4HAXB 3MPXA 1FGZA 3KY9A 4L6EA 2LOXA 1UNPA 1V5MA 2VKIA 4A6FB 1LW3A 1P3RA 2DLWA 5C16A 3SUZA 2CODA 2K2UA 2CAYA 4Z2MB 3A8PA 3D8DA 1V5UA 2LULA 2AL6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1H10 A;  2E2X A;  3FM8 C;  2YF0 A;  5HE2 A;  1W1D A;  2YSZ A;  3MDB C;  2M14 A;  1BTN A;  3FEH A;  2MWN B;  2LOZ A;  4PNK A;  3D8F A;  1BAK A;  4HB4 B;  1ZSQ A;  3GYP A;  1U2B A;  3A98 B;  5C6R A;  2COC A;  5CLQ B;  1WJ1 A;  4HAT B;  1DBH A;  4XWX A;  1KZ7 A;  2DYQ A;  1QC6 A;  2Q13 A;  3CIK A;  5D27 A;  2COA A;  5DHF B;  4HB3 B;  3KZ1 A;  4KAX B;  2P0H A;  3UZT A;  1N3H A;  2MDX A;  3QWM A;  3PP2 A;  1DDM A;  1ZM0 A;  4K17 A;  2DN6 A;  4HB2 B;  3TVV A;  3ULC A;  2EMT A;  3SO6 A;  1GC7 A;  2YS3 A;  1DYN A;  2EMS A;  2KGX B;  3KSY A;  3SV1 A;  2Y8F A;  3AU5 A;  2N0Y A;  3P6A A;  1KI1 B;  4KHB B;  3U7D A;  3PVL A;  1LB1 A;  3HQC A;  4F7H A;  1Y19 B;  4TKN A;  1FHW A;  1MKE A;  4NSW A;  3U8Z A;  1EAZ A;  3PG7 A;  1MIX A;  2KCJ A;  1SHC A;  1V89 A;  1W1G A;  2M38 A;  2NZ8 B;  2YRY A;  3SNH A;  5EFX A;  4A6F A;  1PMS A;  2DX5 A;  1X86 A;  2IYB A;  2DX1 A;  3VIA A;  4KHA A;  5KCV A;  2G35 A;  3DXC A;  2P0D A;  4EKU A;  2AEH A;  1RRP B;  3DXE A;  4MK0 A;  4K81 A;  2K2J A;  4HAV B;  1V61 A;  1WG7 A;  2LYD A;  2ROV A;  1X11 A;  1UNQ A;  5JLJ B;  1SGH A;  2D10 A;  3OAN A;  2RVB B;  4GN1 A;  3AJ4 A;  3P7Z A;  1OQN A;  2H7D A;  1X05 A;  2Y7B A;  1DDV A;  5L81 A;  3D8E A;  2K00 A;  2ROZ B;  3F5R A;  1EF1 A;  2J59 M;  2DTC A;  3A8Q A;  1XKE A;  1TJ6 A;  1U5F A;  1FAO A;  1XCG A;  4KHO A;  5KQ1 A;  1X1F A;  4DBB A;  3QBV B;  5HE0 A;  3X23 A;  1BWN A;  1MPH A;  2RGN B;  2Z0P A;  1ISN A;  4A6K A;  1Z87 A;  2RLO A;  2DYN A;  3ULB A;  3WYF B;  4CHM A;  1WJM A;  1TQZ A;  3ODX A;  3DXD A;  3TO1 A;  2IFS A;  2QKL A;  2DKQ A;  2Y8G A;  2YS1 A;  4HAZ B;  3T06 A;  4YON A;  3ZVR A;  4DXA B;  1U5D A;  5D3V A;  4WVF B;  3TW1 A;  3KRX A;  1B55 A;  3ODW A;  4IAP A;  1ZC3 B;  1WGQ A;  2D9Y A;  2J0J A;  1UPR A;  4A5K A;  4EJN A;  2LKO A;  4TYZ A;  3G9W A;  5HE3 A;  4F7G A;  2UVM A;  1V5P A;  3FSS A;  1NI2 A;  2J0K A;  1FHO A;  2ELB A;  1U5E A;  2DKP A;  5JP4 A;  2HTH B;  3IVF A;  2YT0 A;  2W2X D;  1AWE A;  2DA0 A;  2CRF A;  1U27 A;  2HE7 A;  5DH9 B;  1AQC A;  4Z2N A;  5KQ4 A;  1UPQ A;  2N23 A;  1MK7 B;  2FJL A;  2XQN M;  2UZR A;  4GZU A;  3PEG A;  1DRO A;  2D9X A;  4GXB A;  1K5D B;  2GCL A;  4HHV A;  4HAY B;  3WA0 A;  4F7U P;  2KUP A;  1RJ2 A;  3BIN A;  1FHX A;  1XD4 A;  2ELA A;  1XR0 B;  2W2W A;  2EJ8 A;  4HAW B;  1X1G A;  4CYE A;  3LJU X;  1P6S A;  4B6H A;  2Z0Q A;  4BBK A;  1FGY A;  2UZS A;  2DFK A;  5JHH A;  4GMV A;  4WJ7 A;  2OQB A;  5LON B;  3ZDT A;  2CY4 A;  5D3W A;  1U5G A;  3TCA A;  1PFJ A;  1MAI A;  2D9W A;  5FI0 A;  4HAU B;  2ZPY A;  4K2P A;  1V88 A;  2RUK B;  4C0A A;  2GJY A;  1WGU A;  3HK0 A;  4D0N B;  1NTV A;  2P8V A;  2YVC A;  4DX8 A;  2ADZ A;  2BCJ A;  4HB0 B;  2LG1 A;  2MKR A;  2QKM A;  1I7A A;  2I5C A;  3N7C A;  3TFM A;  1UNR A;  5DI9 B;  4CHJ A;  1J0W A;  1NU2 A;  3PVU A;  5D3X A;  1TXD A;  4GMX B;  1UEF A;  3O96 A;  1ZC4 B;  1KZG A;  2JP2 A;  3V5W A;  2VSZ A;  1QQG A;  1MIZ B;  1MK9 B;  5DHA B;  3BJI A;  2Z0O A;  4DX9 0;  1K5G B;  2OTX A;  3F0W A;  4Y94 A;  2DHJ A;  3PVW A;  1XX0 A;  4PQ0 A;  5FI1 A;  1FB8 A;  5C5B B;  1OY2 A;  5GOW B;  5LOP B;  1IRS A;  4H8S A;  1OMW A;  2X18 A;  5HE1 A;  1DDW A;  1ZVR A;  3PZD A;  4MY6 A;  3RCP A;  1J19 A;  3SYX A;  1Y5O A;  3AU4 A;  2RSG A;  4WSF A;  4K2O A;  1GC6 A;  2D9V A;  4A6H A;  2PZ1 A;  2YS5 A;  4HDQ A;  2I1J A;  3ML4 A;  4HDO A;  2I1K A;  1BTK A;  1PLS A;  1M7E A;  1XOD A;  3HW2 B;  2R0D A;  5C79 A;  1EGX A;  2D11 A;  1H4R A;  1NTY A;  2P0F A;  4YL8 A;  3NSU A;  2L1C A;  2MFQ A;  1FOE A;  4ZRK A;  2J0M A;  5J3Y A;  3ODO A;  4ZRJ A;  2L2I A;  2V76 A;  5D3Y A;  1WVH A;  2W2X C;  2GCJ A;  4MT7 A;  3CXB B;  2DHI A;  1WI1 A;  1W1H A;  1EVH A;  1Q67 A;  1E5W A;  2VRW B;  3QIJ A;  4IFS A;  2NMB A;  3KRW A;  5DIF B;  4EMO A;  1GG3 A;  2RNR B;  2EC1 A;  4ZRI A;  5J3T A;  2YT1 A;  1M7R A;  2D9Z A;  3GYO A;  5C5B A;  2DHK A;  5CLL B;  1P5T A;  4IOY X;  4KVG B;  5J3Q A;  2GS0 A;  1I2H A;  2R09 A;  2COF A;  2I5F A;  4P7I A;  4NY0 A;  5JHG A;  2H7E A;  1U29 A;  2D4Q A;  2CY5 A;  2D2Q A;  3M1I B;  3VOQ A;  3PSC A;  4GPT B;  4HAX B;  3MPX A;  1FGZ A;  3KY9 A;  4L6E A;  2LOX A;  1UNP A;  1V5M A;  2VKI A;  4A6F B;  1LW3 A;  1P3R A;  2DLW A;  5C16 A;  3SUZ A;  2COD A;  2K2U A;  2CAY A;  4Z2M B;  3A8P A;  3D8D A;  1V5U A;  2LUL A;  2AL6 A; 
#chains in the Genus database with same CATH topology
 1H10 A;  2E2X A;  3FM8 C;  2YF0 A;  5HE2 A;  1W1D A;  2YSZ A;  3MDB C;  2M14 A;  1BTN A;  3FEH A;  2MWN B;  2LOZ A;  4GOU A;  4PNK A;  3D8F A;  1BAK A;  4HB4 B;  1ZSQ A;  3GYP A;  1U2B A;  3A98 B;  5C6R A;  2GUM A;  2COC A;  5CLQ B;  1WJ1 A;  4HAT B;  1DBH A;  4XWX A;  1KZ7 A;  2DYQ A;  1QC6 A;  2Q13 A;  3CIK A;  5D27 A;  2COA A;  5DHF B;  4HB3 B;  3KZ1 A;  4KAX B;  2P0H A;  3UZT A;  1N3H A;  2MDX A;  3QWM A;  3PP2 A;  1DDM A;  3HSA A;  1ZM0 A;  4K17 A;  2DN6 A;  4HB2 B;  3TVV A;  3ULC A;  2EMT A;  3SO6 A;  1GC7 A;  2YS3 A;  1DYN A;  2EMS A;  2KGX B;  3KSY A;  3SV1 A;  3NW8 A;  3U12 A;  2Y8F A;  3AU5 A;  2N0Y A;  3P6A A;  1KI1 B;  4KHB B;  3U7D A;  3PVL A;  1LB1 A;  3HQC A;  4F7H A;  1Y19 B;  4TKN A;  1FHW A;  1MKE A;  4NSW A;  3U8Z A;  1EAZ A;  3PG7 A;  1MIX A;  4GNK B;  2KCJ A;  1SHC A;  1V89 A;  1W1G A;  2M38 A;  2NZ8 B;  2YRY A;  3SNH A;  5EFX A;  4A6F A;  3HIE A;  1PMS A;  2DX5 A;  1X86 A;  2IYB A;  2DX1 A;  3VIA A;  4KHA A;  5KCV A;  2G35 A;  3DXC A;  2P0D A;  4EKU A;  2AEH A;  1RRP B;  3DXE A;  4MK0 A;  1ZYI A;  4K81 A;  2K2J A;  4HAV B;  1V61 A;  1WG7 A;  4OT1 A;  3A58 A;  2LYD A;  5IRS A;  2ROV A;  4D6W A;  1X11 A;  1UNQ A;  5JLJ B;  1SGH A;  2D10 A;  3OAN A;  2RVB B;  4GN1 A;  3AJ4 A;  3P7Z A;  2KIG A;  1OQN A;  2H7D A;  1X05 A;  2Y7B A;  1DDV A;  5L81 A;  3D8E A;  2NBV A;  2K00 A;  2ROZ B;  3F5R A;  1EF1 A;  2J59 M;  2DTC A;  3A8Q A;  1XKE A;  1TJ6 A;  1U5F A;  1FAO A;  1XCG A;  4KHO A;  5KQ1 A;  1X1F A;  4DBB A;  3QBV B;  5HE0 A;  3OHM B;  3X23 A;  1BWN A;  4DIX A;  1MPH A;  2RGN B;  2Z0P A;  1ISN A;  4A6K A;  4QXA B;  1Z87 A;  2RLO A;  2DYN A;  3ULB A;  3WYF B;  4CHM A;  1WJM A;  1TQZ A;  4KHB A;  3ODX A;  3DXD A;  3TO1 A;  2IFS A;  2QKL A;  2DKQ A;  2Y8G A;  2YS1 A;  4HAZ B;  3T06 A;  4YON A;  3ZVR A;  4DXA B;  1U5D A;  5D3V A;  4WVF B;  3TW1 A;  3KRX A;  1B55 A;  3ODW A;  4IAP A;  1ZC3 B;  1WGQ A;  2D9Y A;  2J0J A;  1UPR A;  4A5K A;  4EJN A;  2LKO A;  4TYZ A;  3G9W A;  5HE3 A;  4F7G A;  2UVM A;  1V5P A;  3FSS A;  1NI2 A;  2J0K A;  2Z4D A;  2ELB A;  1FHO A;  1U5E A;  2DKP A;  5JP4 A;  2HTH B;  3IVF A;  2YT0 A;  2W2X D;  1AWE A;  2DA0 A;  2CRF A;  1U27 A;  2HE7 A;  5DH9 B;  1AQC A;  4Z2N A;  5KQ4 A;  1UPQ A;  2N23 A;  1MK7 B;  2FJL A;  2XQN M;  2UZR A;  4GZU A;  3PEG A;  1DRO A;  2D9X A;  4GXB A;  1K5D B;  2GCL A;  4HHV A;  4HAY B;  3WA0 A;  4F7U P;  2KUP A;  1RJ2 A;  4HSI A;  2Z13 A;  3BIN A;  1FHX A;  1XD4 A;  2ELA A;  2K49 A;  1XR0 B;  2W2W A;  2EJ8 A;  4QJ5 B;  4HAW B;  1X1G A;  4CYE A;  3LJU X;  1P6S A;  4B6H A;  2Z0Q A;  4BBK A;  1FGY A;  2UZS A;  3DCX A;  2DFK A;  5JHH A;  4GMV A;  4WJ7 A;  2OQB A;  5LON B;  3ZDT A;  2KR0 A;  2CY4 A;  5D3W A;  1U5G A;  3TCA A;  1PFJ A;  1MAI A;  2D9W A;  5FI0 A;  4HAU B;  2ZPY A;  4K2P A;  1V88 A;  2RUK B;  4C0A A;  2GJY A;  1WGU A;  3HK0 A;  1T77 A;  3NWD A;  4D0N B;  1NTV A;  2P8V A;  2YVC A;  4DX8 A;  2ADZ A;  2KIE A;  2BCJ A;  4L1R A;  4HB0 B;  2LG1 A;  2MKR A;  2QKM A;  1I7A A;  2I5C A;  3N7C A;  3TFM A;  1UNR A;  5DI9 B;  4CHJ A;  1J0W A;  1NU2 A;  3PVU A;  5D3X A;  1TXD A;  1MI1 A;  4GMX B;  1UEF A;  2YT2 A;  3O96 A;  1ZC4 B;  2FJU B;  1KZG A;  2JP2 A;  3B77 A;  3V5W A;  2VSZ A;  1QQG A;  1MIZ B;  1MK9 B;  5DHA B;  3BJI A;  2Z0O A;  4DX9 0;  1K5G B;  2OTX A;  3F0W A;  4Y94 A;  2DHJ A;  3PVW A;  1XX0 A;  4PQ0 A;  5FI1 A;  1FB8 A;  5C5B B;  4OSN A;  1OY2 A;  5GOW B;  4QJ3 B;  5LOP B;  1IRS A;  4H8S A;  5I2S A;  1OMW A;  2X18 A;  5HE1 A;  4CSQ A;  1DDW A;  1ZVR A;  3NWA A;  3PZD A;  4MY6 A;  3RCP A;  1J19 A;  3SYX A;  1Y5O A;  3AU4 A;  2RSG A;  2RRF A;  4WSF A;  4K2O A;  1GC6 A;  2D9V A;  4A6H A;  2PZ1 A;  2YS5 A;  4QJ4 B;  4HDQ A;  2I1J A;  3ML4 A;  4HDO A;  2I1K A;  1BTK A;  1PLS A;  1M7E A;  1XOD A;  3HW2 B;  5M4Y B;  2R0D A;  5C79 A;  1EGX A;  2D11 A;  1H4R A;  1NTY A;  2P0F A;  4YL8 A;  3NSU A;  2L1C A;  2MFQ A;  1FOE A;  4ZRK A;  2J0M A;  5J3Y A;  3ODO A;  4ZRJ A;  2L2I A;  5I2M A;  2V76 A;  5D3Y A;  2Z59 A;  1WVH A;  2W2X C;  2GCJ A;  4MT7 A;  3CXB B;  2DHI A;  1WI1 A;  1W1H A;  1EVH A;  1Q67 A;  1E5W A;  2VRW B;  3QIJ A;  4IFS A;  3NWF A;  2NMB A;  3KRW A;  5DIF B;  4EMO A;  1GG3 A;  2RNR B;  2EC1 A;  4ZRI A;  2ZKM X;  5J3T A;  2YT1 A;  3FVC A;  1M7R A;  2D9Z A;  2KUQ A;  3GYO A;  5C5B A;  2DHK A;  5CLL B;  1P5T A;  4IOY X;  4KVG B;  5J3Q A;  2GS0 A;  1I2H A;  2R09 A;  2COF A;  2I5F A;  4P7I A;  4NY0 A;  5JHG A;  2H7E A;  1U29 A;  2D4Q A;  2CY5 A;  2D2Q A;  3M1I B;  3VOQ A;  3PSC A;  4GPT B;  4HAX B;  3MPX A;  1FGZ A;  3KY9 A;  4L6E A;  2K8E A;  2LOX A;  1UNP A;  1V5M A;  2VKI A;  4A6F B;  1LW3 A;  1P3R A;  2DLW A;  2R2Y A;  5LG4 B;  5C16 A;  3SUZ A;  2COD A;  2Z14 A;  2K2U A;  2CAY A;  4Z2M B;  3A8P A;  3D8D A;  1V5U A;  2LUL A;  2AL6 A; 
#chains in the Genus database with same CATH homology
 1H10 A;  2E2X A;  3FM8 C;  2YF0 A;  5HE2 A;  1W1D A;  2YSZ A;  3MDB C;  2M14 A;  1BTN A;  3FEH A;  2MWN B;  2LOZ A;  4PNK A;  3D8F A;  1BAK A;  4HB4 B;  1ZSQ A;  3GYP A;  1U2B A;  3A98 B;  5C6R A;  2COC A;  5CLQ B;  1WJ1 A;  4HAT B;  1DBH A;  4XWX A;  1KZ7 A;  2DYQ A;  1QC6 A;  2Q13 A;  3CIK A;  5D27 A;  2COA A;  5DHF B;  4HB3 B;  3KZ1 A;  4KAX B;  2P0H A;  3UZT A;  1N3H A;  2MDX A;  3QWM A;  3PP2 A;  1DDM A;  1ZM0 A;  4K17 A;  2DN6 A;  4HB2 B;  3TVV A;  3ULC A;  2EMT A;  3SO6 A;  1GC7 A;  2YS3 A;  1DYN A;  2EMS A;  2KGX B;  3KSY A;  3SV1 A;  2Y8F A;  3AU5 A;  2N0Y A;  3P6A A;  1KI1 B;  4KHB B;  3U7D A;  3PVL A;  1LB1 A;  3HQC A;  4F7H A;  1Y19 B;  4TKN A;  1FHW A;  1MKE A;  4NSW A;  3U8Z A;  1EAZ A;  3PG7 A;  1MIX A;  2KCJ A;  1SHC A;  1V89 A;  1W1G A;  2M38 A;  2NZ8 B;  2YRY A;  3SNH A;  5EFX A;  4A6F A;  1PMS A;  2DX5 A;  1X86 A;  2IYB A;  2DX1 A;  3VIA A;  4KHA A;  5KCV A;  2G35 A;  3DXC A;  2P0D A;  4EKU A;  2AEH A;  1RRP B;  3DXE A;  4MK0 A;  4K81 A;  2K2J A;  4HAV B;  1V61 A;  1WG7 A;  2LYD A;  2ROV A;  1X11 A;  1UNQ A;  5JLJ B;  1SGH A;  2D10 A;  3OAN A;  2RVB B;  4GN1 A;  3AJ4 A;  3P7Z A;  1OQN A;  2H7D A;  1X05 A;  2Y7B A;  1DDV A;  5L81 A;  3D8E A;  2K00 A;  2ROZ B;  3F5R A;  1EF1 A;  2J59 M;  2DTC A;  3A8Q A;  1XKE A;  1TJ6 A;  1U5F A;  1FAO A;  1XCG A;  4KHO A;  5KQ1 A;  1X1F A;  4DBB A;  3QBV B;  5HE0 A;  3X23 A;  1BWN A;  1MPH A;  2RGN B;  2Z0P A;  1ISN A;  4A6K A;  1Z87 A;  2RLO A;  2DYN A;  3ULB A;  3WYF B;  4CHM A;  1WJM A;  1TQZ A;  3ODX A;  3DXD A;  3TO1 A;  2IFS A;  2QKL A;  2DKQ A;  2Y8G A;  2YS1 A;  4HAZ B;  3T06 A;  4YON A;  3ZVR A;  4DXA B;  1U5D A;  5D3V A;  4WVF B;  3TW1 A;  3KRX A;  1B55 A;  3ODW A;  4IAP A;  1ZC3 B;  1WGQ A;  2D9Y A;  2J0J A;  1UPR A;  4A5K A;  4EJN A;  2LKO A;  4TYZ A;  3G9W A;  5HE3 A;  4F7G A;  2UVM A;  1V5P A;  3FSS A;  1NI2 A;  2J0K A;  1FHO A;  2ELB A;  1U5E A;  2DKP A;  5JP4 A;  2HTH B;  3IVF A;  2YT0 A;  2W2X D;  1AWE A;  2DA0 A;  2CRF A;  1U27 A;  2HE7 A;  5DH9 B;  1AQC A;  4Z2N A;  5KQ4 A;  1UPQ A;  2N23 A;  1MK7 B;  2FJL A;  2XQN M;  2UZR A;  4GZU A;  3PEG A;  1DRO A;  2D9X A;  4GXB A;  1K5D B;  2GCL A;  4HHV A;  4HAY B;  3WA0 A;  4F7U P;  2KUP A;  1RJ2 A;  3BIN A;  1FHX A;  1XD4 A;  2ELA A;  1XR0 B;  2W2W A;  2EJ8 A;  4HAW B;  1X1G A;  4CYE A;  3LJU X;  1P6S A;  4B6H A;  2Z0Q A;  4BBK A;  1FGY A;  2UZS A;  2DFK A;  5JHH A;  4GMV A;  4WJ7 A;  2OQB A;  5LON B;  3ZDT A;  2CY4 A;  5D3W A;  1U5G A;  3TCA A;  1PFJ A;  1MAI A;  2D9W A;  5FI0 A;  4HAU B;  2ZPY A;  4K2P A;  1V88 A;  2RUK B;  4C0A A;  2GJY A;  1WGU A;  3HK0 A;  4D0N B;  1NTV A;  2P8V A;  2YVC A;  4DX8 A;  2ADZ A;  2BCJ A;  4HB0 B;  2LG1 A;  2MKR A;  2QKM A;  1I7A A;  2I5C A;  3N7C A;  3TFM A;  1UNR A;  5DI9 B;  4CHJ A;  1J0W A;  1NU2 A;  3PVU A;  5D3X A;  1TXD A;  4GMX B;  1UEF A;  3O96 A;  1ZC4 B;  1KZG A;  2JP2 A;  3V5W A;  2VSZ A;  1QQG A;  1MIZ B;  1MK9 B;  5DHA B;  3BJI A;  2Z0O A;  4DX9 0;  1K5G B;  2OTX A;  3F0W A;  4Y94 A;  2DHJ A;  3PVW A;  1XX0 A;  4PQ0 A;  5FI1 A;  1FB8 A;  5C5B B;  1OY2 A;  5GOW B;  5LOP B;  1IRS A;  4H8S A;  1OMW A;  2X18 A;  5HE1 A;  1DDW A;  1ZVR A;  3PZD A;  4MY6 A;  3RCP A;  1J19 A;  3SYX A;  1Y5O A;  3AU4 A;  2RSG A;  4WSF A;  4K2O A;  1GC6 A;  2D9V A;  4A6H A;  2PZ1 A;  2YS5 A;  4HDQ A;  2I1J A;  3ML4 A;  4HDO A;  2I1K A;  1BTK A;  1PLS A;  1M7E A;  1XOD A;  3HW2 B;  2R0D A;  5C79 A;  1EGX A;  2D11 A;  1H4R A;  1NTY A;  2P0F A;  4YL8 A;  3NSU A;  2L1C A;  2MFQ A;  1FOE A;  4ZRK A;  2J0M A;  5J3Y A;  3ODO A;  4ZRJ A;  2L2I A;  2V76 A;  5D3Y A;  1WVH A;  2W2X C;  2GCJ A;  4MT7 A;  3CXB B;  2DHI A;  1WI1 A;  1W1H A;  1EVH A;  1Q67 A;  1E5W A;  2VRW B;  3QIJ A;  4IFS A;  2NMB A;  3KRW A;  5DIF B;  4EMO A;  1GG3 A;  2RNR B;  2EC1 A;  4ZRI A;  5J3T A;  2YT1 A;  1M7R A;  2D9Z A;  3GYO A;  5C5B A;  2DHK A;  5CLL B;  1P5T A;  4IOY X;  4KVG B;  5J3Q A;  2GS0 A;  1I2H A;  2R09 A;  2COF A;  2I5F A;  4P7I A;  4NY0 A;  5JHG A;  2H7E A;  1U29 A;  2D4Q A;  2CY5 A;  2D2Q A;  3M1I B;  3VOQ A;  3PSC A;  4GPT B;  4HAX B;  3MPX A;  1FGZ A;  3KY9 A;  4L6E A;  2LOX A;  1UNP A;  1V5M A;  2VKI A;  4A6F B;  1LW3 A;  1P3R A;  2DLW A;  5C16 A;  3SUZ A;  2COD A;  2K2U A;  2CAY A;  4Z2M B;  3A8P A;  3D8D A;  1V5U A;  2LUL A;  2AL6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...