1V5PA

Solution structure of the n-terminal pleckstrin homology domain of tapp2 from mouse
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
126
structure length
126
Chain Sequence
b'GSSGSSGMPYVDRQNRICGFLDIEDNENSGKFLRRYFILDTQANCLLWYMDNPQNLAVGAGAVGSLQLTYISKVSIATPKQKPKTPFCFVINALSQRYFLQANDQKDLKDWVEALNQASKSGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords pleckstrin homology domain-containing, family A
molecule tags Signaling protein
source organism Mus musculus
publication title Solution Structure of the N-terminal Pleckstrin Homology Domain Of TAPP2 from Mouse
rcsb
total genus 13
structure length 126
sequence length 126
ec nomenclature
pdb deposition date 2003-11-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00169 PH PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1v5pA01
4D0NB 2EJ8A 4ZRKA 3DXEA 1Y19B 2AL6A 1U2BA 2NMBA 3ULCA 1KZ7A 1DDWA 4YL8A 2I5FA 3SUZA 4K2OA 1OMWA 4Y94A 2D11A 3TCAA 3VOQA 2ELBA 3LJUX 1PFJA 1W1HA 4HB2B 2COCA 5L81A 3MDBC 2K2UA 3QWMA 3UZTA 2RGNB 2OTXA 3D8DA 1U5EA 4GPTB 1MK9B 2W2XD 1AQCA 1DBHA 3PP2A 1TJ6A 2DFKA 5C16A 1FGYA 1V61A 2MFQA 3PSCA 2CY4A 5HE2A 3O96A 2QKLA 4C0AA 4YONA 5DIFB 1J19A 4CHJA 4DX90 2W2XC 1B55A 1BTKA 1GC7A 2VSZA 1WGUA 2D9YA 4TKNA 1P5TA 2D9VA 4IAPA 4F7GA 3NSUA 1MK7B 2RUKB 3MPXA 1N3HA 4HB0B 1BAKA 5D3WA 3BJIA 2M14A 3SO6A 3D8FA 2RNRB 3ODWA 4MY6A 2H7DA 2DLWA 3ODXA 5D3YA 2D9XA 1XCGA 3M1IB 2Q13A 1E5WA 1RRPB 3A8PA 2L2IA 2JP2A 1WG7A 3WA0A 2G35A 5FI1A 1MIZB 2I1KA 4HDOA 4GXBA 4A6HA 5FI0A 1ZVRA 2J0MA 2M38A 3A8QA 5KQ1A 3F0WA 1MAIA 1QQGA 4DBBA 3TFMA 1H4RA 4KHAA 5DHFB 2ROZB 1ZM0A 5JLJB 2DA0A 2HTHB 2R0DA 5LOPB 3PEGA 1GG3A 1GC6A 2E2XA 1EGXA 4HB3B 4NSWA 3PVWA 1W1DA 3X23A 5C6RA 3BINA 1K5GB 3SYXA 4PNKA 5JHGA 5D27A 2DHIA 4GMXB 1UEFA 1Z87A 3AU5A 3HW2B 1K5DB 3DXCA 4HHVA 1FGZA 3FM8C 4XWXA 1ISNA 2ADZA 1J0WA 5C5BB 4K17A 1V5MA 2D2QA 4ZRJA 2D9ZA 4WSFA 2P0HA 2ZPYA 2H7EA 1MPHA 1P3RA 2DYQA 2Z0PA 2COFA 2DHKA 2Y7BA 3D8EA 2ROVA 2J0KA 2COAA 3T06A 5HE1A 2MDXA 3SNHA 2YS1A 4P7IA 1EAZA 2DX1A 4HDQA 2ELAA 2J0JA 1UNRA 5D3XA 2VKIA 4KHBB 4A6FB 4B6HA 2KUPA 5JHHA 2FJLA 4L6EA 2LG1A 3KRXA 1FB8A 1WJMA 3HQCA 2GS0A 1FHWA 4MK0A 1X1FA 2OQBA 4Z2MB 1V88A 4KHOA 2MWNB 4HAZB 5KQ4A 2R09A 2D4QA 2YF0A 4CYEA 3CXBB 1UPRA 5J3YA 5J3TA 1MIXA 5D3VA 1KI1B 2UVMA 1W1GA 4WJ7A 3DXDA 3V5WA 2GCJA 1DDMA 2W2WA 3AU4A 1H10A 4CHMA 2N23A 2LKOA 1M7RA 1P6SA 5J3QA 1FHXA 4IFSA 1U5DA 3TO1A 2VRWB 3FSSA 4PQ0A 4HAVB 2I5CA 2YS5A 1FAOA 3ULBA 1IRSA 2UZSA 2P8VA 1X05A 2D9WA 2X18A 2DKQA 1FOEA 5GOWB 1OQNA 3QIJA 5DH9B 5CLLB 1XD4A 1U5GA 2P0FA 1UPQA 5DI9B 2LOZA 3RCPA 2DHJA 2UZRA 4Z2NA 4IOYX 2RLOA 2Z0OA 1U29A 3TVVA 3U7DA 3VIAA 1U27A 2V76A 1V5PA 2IYBA 3ODOA 1DDVA 2DTCA 2YRYA 3HK0A 4EJNA 4HAXB 4K81A 2LYDA 3FEHA 1XX0A 4MT7A 1AWEA 2YVCA 2J59M 2QKMA 2AEHA 2KCJA 4F7HA 4HAYB 2NZ8B 1I2HA 5LONB 2LOXA 1M7EA 1XR0B 2YT1A 4HB4B 2EMSA 4GMVA 1XODA 1OY2A 4A6KA 4EKUA 1BTNA 2I1JA 2BCJA 1MKEA 2YS3A 4NY0A 1DYNA 2DX5A 5KCVA 3F5RA 2KGXB 2P0DA 1EF1A 1SHCA 3P7ZA 3PVLA 3QBVB 4EMOA 3ZDTA 1PLSA 3A98B 4K2PA 2DKPA 4H8SA 1WJ1A 2IFSA 5CLQB 3P6AA 2CY5A 4F7UP 3CIKA 3KZ1A 3G9WA 4GN1A 2GJYA 3AJ4A 1RJ2A 1X11A 1NTVA 4DX8A 5C5BA 3KY9A 1UNPA 3N7CA 5EFXA 1TXDA 1ZSQA 1EVHA 3TW1A 1WVHA 3PVUA 2CODA 5C79A 1NTYA 2Y8GA 3GYOA 4KAXB 2PZ1A 5HE3A 3U8ZA 2CAYA 4GZUA 1DROA 4KVGB 2RSGA 3GYPA 1U5FA 1UNQA 4WVFB 1PMSA 1I7AA 4HAWB 2CRFA 4A6FA 2GCLA 2N0YA 2D10A 1Y5OA 1NU2A 2Y8FA 2Z0QA 2YT0A 3PZDA 1KZGA 2K2JA 1XKEA 1V5UA 2K00A 3PG7A 4ZRIA 1QC6A 2DYNA 2LULA 1TQZA 1ZC3B 1NI2A 1LB1A 3KRWA 3SV1A 2EMTA 5JP4A 3ML4A 1LW3A 4HATB 4TYZA 1FHOA 2L1CA 4HAUB 1V89A 2HE7A 1Q67A 1WGQA 1X86A 4BBKA 5HE0A 3WYFB 1BWNA 2DN6A 1SGHA 4A5KA 2MKRA 1ZC4B 1WI1A 3ZVRA 3KSYA 2YSZA 3OANA 2RVBB 5DHAB 1X1GA 2XQNM 3IVFA 2EC1A 4DXAB
chains in the Genus database with same CATH superfamily
4D0NB 2EJ8A 3OHMB 4ZRKA 5I2SA 3DXEA 1Y19B 2AL6A 2NBVA 1U2BA 2NMBA 3ULCA 1KZ7A 1DDWA 4YL8A 2I5FA 3SUZA 4K2OA 1OMWA 4CSQA 4Y94A 2D11A 3TCAA 3VOQA 2ELBA 3LJUX 1PFJA 1W1HA 4HB2B 3NWFA 2COCA 5L81A 3MDBC 2K2UA 3QWMA 3UZTA 2RGNB 2OTXA 3D8DA 1U5EA 4GPTB 1MK9B 2W2XD 1AQCA 1DBHA 3PP2A 1TJ6A 2DFKA 5C16A 1FGYA 1V61A 2MFQA 3PSCA 2CY4A 5HE2A 3O96A 2QKLA 4C0AA 4YONA 5DIFB 4GOUA 1J19A 4CHJA 4DX90 2W2XC 1B55A 1BTKA 1GC7A 2VSZA 1WGUA 2D9YA 4TKNA 1P5TA 2D9VA 4IAPA 4F7GA 3NSUA 1MK7B 2RUKB 3MPXA 1N3HA 4HB0B 1BAKA 5D3WA 3BJIA 2M14A 3SO6A 3D8FA 2RNRB 3ODWA 4MY6A 2H7DA 2DLWA 3ODXA 5D3YA 2D9XA 1XCGA 3M1IB 2Q13A 1E5WA 1RRPB 3A8PA 2L2IA 2JP2A 1WG7A 3WA0A 2G35A 5LG4B 5FI1A 3B77A 1MIZB 2I1KA 4HDOA 4GXBA 4A6HA 5FI0A 1ZVRA 2J0MA 2M38A 3A8QA 5KQ1A 3F0WA 1MAIA 1QQGA 4DBBA 3TFMA 1H4RA 4KHAA 5DHFB 2ROZB 1ZM0A 5JLJB 2DA0A 2HTHB 2R0DA 5LOPB 5IRSA 3PEGA 1GG3A 2Z59A 1GC6A 2E2XA 4QJ5B 1EGXA 4HB3B 3U12A 4NSWA 3PVWA 1W1DA 3FVCA 3X23A 5C6RA 3BINA 1K5GB 3SYXA 4PNKA 5JHGA 5D27A 2DHIA 4GMXB 1UEFA 1Z87A 3AU5A 3HW2B 3DCXA 1K5DB 3DXCA 4HHVA 1FGZA 3FM8C 4XWXA 1ISNA 2ADZA 3A58A 1MI1A 1J0WA 5C5BB 4K17A 1V5MA 2D2QA 4ZRJA 2D9ZA 4WSFA 2P0HA 2ZPYA 2H7EA 1MPHA 1P3RA 2DYQA 2Z0PA 2COFA 2DHKA 2Y7BA 3D8EA 2ROVA 2J0KA 2COAA 5I2MA 3NW8A 3T06A 5HE1A 1T77A 2MDXA 3SNHA 2YS1A 2K49A 4P7IA 1EAZA 2DX1A 4HDQA 2ELAA 2J0JA 1UNRA 5D3XA 2VKIA 4KHBB 4A6FB 4B6HA 2KIEA 2KUPA 5JHHA 2FJLA 4L6EA 2LG1A 3KRXA 1FB8A 1WJMA 3HQCA 2GS0A 1FHWA 4MK0A 1X1FA 2OQBA 4Z2MB 1V88A 4KHOA 2K8EA 2MWNB 4HAZB 5KQ4A 2R09A 2D4QA 2YF0A 4L1RA 4CYEA 3CXBB 1UPRA 5J3YA 5J3TA 1MIXA 5D3VA 1KI1B 2UVMA 1W1GA 4WJ7A 2Z14A 3DXDA 3V5WA 2GCJA 1DDMA 4QJ3B 2W2WA 3AU4A 1H10A 4CHMA 2N23A 4D6WA 2LKOA 1M7RA 4QJ4B 2GUMA 1P6SA 5J3QA 4DIXA 1FHXA 4IFSA 1U5DA 4HSIA 3TO1A 2VRWB 3FSSA 4PQ0A 4HAVB 2I5CA 2YS5A 1FAOA 2FJUB 3NWAA 3ULBA 1IRSA 2UZSA 2P8VA 1X05A 2D9WA 2X18A 2DKQA 1FOEA 5GOWB 1OQNA 3QIJA 5DH9B 5CLLB 1XD4A 1U5GA 2P0FA 1UPQA 5DI9B 2LOZA 3RCPA 2DHJA 2UZRA 4Z2NA 4IOYX 2RLOA 2Z0OA 1U29A 3TVVA 3U7DA 3VIAA 1U27A 2V76A 1V5PA 2IYBA 3ODOA 1DDVA 2DTCA 2YRYA 3HK0A 4EJNA 4HAXB 4K81A 2LYDA 3FEHA 1XX0A 3NWDA 4MT7A 2Z4DA 1AWEA 2YVCA 2J59M 2QKMA 2AEHA 2KCJA 4F7HA 4HAYB 2NZ8B 1I2HA 5LONB 2LOXA 1M7EA 1XR0B 2YT1A 4HB4B 2EMSA 4GMVA 1XODA 1OY2A 4A6KA 4OT1A 4EKUA 1BTNA 2I1JA 2BCJA 1MKEA 2YS3A 2Z13A 4NY0A 2YT2A 2ZKMX 1DYNA 2DX5A 5KCVA 3F5RA 2KGXB 2P0DA 1EF1A 1SHCA 3P7ZA 3PVLA 3QBVB 4EMOA 4GNKB 4KHBA 3ZDTA 1PLSA 3A98B 4K2PA 2DKPA 4H8SA 1WJ1A 2IFSA 5CLQB 3P6AA 2CY5A 4F7UP 3CIKA 3KZ1A 3G9WA 4GN1A 2GJYA 3AJ4A 1RJ2A 1X11A 2KIGA 1NTVA 4DX8A 5C5BA 3KY9A 1UNPA 3N7CA 5EFXA 1TXDA 1ZSQA 1EVHA 3TW1A 1WVHA 3PVUA 2CODA 5C79A 1NTYA 2R2YA 2Y8GA 2KUQA 3GYOA 4KAXB 2PZ1A 5HE3A 1ZYIA 3U8ZA 2CAYA 2KR0A 3HSAA 4GZUA 1DROA 4KVGB 2RSGA 3GYPA 1U5FA 1UNQA 4WVFB 5M4YB 1PMSA 1I7AA 4HAWB 2CRFA 4A6FA 2GCLA 4OSNA 2N0YA 2D10A 1Y5OA 1NU2A 2Y8FA 2Z0QA 2YT0A 3PZDA 1KZGA 2K2JA 1XKEA 1V5UA 2K00A 3PG7A 4ZRIA 1QC6A 2DYNA 2LULA 1TQZA 1ZC3B 1NI2A 1LB1A 3KRWA 3SV1A 2EMTA 5JP4A 3ML4A 1LW3A 4HATB 4TYZA 1FHOA 2L1CA 4HAUB 1V89A 2HE7A 1Q67A 1WGQA 1X86A 4BBKA 5HE0A 3WYFB 1BWNA 2DN6A 1SGHA 4A5KA 2MKRA 1ZC4B 4QXAB 1WI1A 3ZVRA 3KSYA 2YSZA 3OANA 2RVBB 2RRFA 5DHAB 1X1GA 2XQNM 3IVFA 2EC1A 3HIEA 4DXAB
chains in the Genus database with same CATH topology
4D0NB 2EJ8A 4ZRKA 3DXEA 1Y19B 2AL6A 1U2BA 2NMBA 3ULCA 1KZ7A 1DDWA 4YL8A 2I5FA 3SUZA 4K2OA 1OMWA 4Y94A 2D11A 3TCAA 3VOQA 2ELBA 3LJUX 1PFJA 1W1HA 4HB2B 2COCA 5L81A 3MDBC 2K2UA 3QWMA 3UZTA 2RGNB 2OTXA 3D8DA 1U5EA 4GPTB 1MK9B 2W2XD 1AQCA 1DBHA 3PP2A 1TJ6A 2DFKA 5C16A 1FGYA 1V61A 2MFQA 3PSCA 2CY4A 5HE2A 3O96A 2QKLA 4C0AA 4YONA 5DIFB 1J19A 4CHJA 4DX90 2W2XC 1B55A 1BTKA 1GC7A 2VSZA 1WGUA 2D9YA 4TKNA 1P5TA 2D9VA 4IAPA 4F7GA 3NSUA 1MK7B 2RUKB 3MPXA 1N3HA 4HB0B 1BAKA 5D3WA 3BJIA 2M14A 3SO6A 3D8FA 2RNRB 3ODWA 4MY6A 2H7DA 2DLWA 3ODXA 5D3YA 2D9XA 1XCGA 3M1IB 2Q13A 1E5WA 1RRPB 3A8PA 2L2IA 2JP2A 1WG7A 3WA0A 2G35A 5FI1A 1MIZB 2I1KA 4HDOA 4GXBA 4A6HA 5FI0A 1ZVRA 2J0MA 2M38A 3A8QA 5KQ1A 3F0WA 1MAIA 1QQGA 4DBBA 3TFMA 1H4RA 4KHAA 5DHFB 2ROZB 1ZM0A 5JLJB 2DA0A 2HTHB 2R0DA 5LOPB 3PEGA 1GG3A 1GC6A 2E2XA 1EGXA 4HB3B 4NSWA 3PVWA 1W1DA 3X23A 5C6RA 3BINA 1K5GB 3SYXA 4PNKA 5JHGA 5D27A 2DHIA 4GMXB 1UEFA 1Z87A 3AU5A 3HW2B 1K5DB 3DXCA 4HHVA 1FGZA 3FM8C 4XWXA 1ISNA 2ADZA 1J0WA 5C5BB 4K17A 1V5MA 2D2QA 4ZRJA 2D9ZA 4WSFA 2P0HA 2ZPYA 2H7EA 1MPHA 1P3RA 2DYQA 2Z0PA 2COFA 2DHKA 2Y7BA 3D8EA 2ROVA 2J0KA 2COAA 3T06A 5HE1A 2MDXA 3SNHA 2YS1A 4P7IA 1EAZA 2DX1A 4HDQA 2ELAA 2J0JA 1UNRA 5D3XA 2VKIA 4KHBB 4A6FB 4B6HA 2KUPA 5JHHA 2FJLA 4L6EA 2LG1A 3KRXA 1FB8A 1WJMA 3HQCA 2GS0A 1FHWA 4MK0A 1X1FA 2OQBA 4Z2MB 1V88A 4KHOA 2MWNB 4HAZB 5KQ4A 2R09A 2D4QA 2YF0A 4CYEA 3CXBB 1UPRA 5J3YA 5J3TA 1MIXA 5D3VA 1KI1B 2UVMA 1W1GA 4WJ7A 3DXDA 3V5WA 2GCJA 1DDMA 2W2WA 3AU4A 1H10A 4CHMA 2N23A 2LKOA 1M7RA 1P6SA 5J3QA 1FHXA 4IFSA 1U5DA 3TO1A 2VRWB 3FSSA 4PQ0A 4HAVB 2I5CA 2YS5A 1FAOA 3ULBA 1IRSA 2UZSA 2P8VA 1X05A 2D9WA 2X18A 2DKQA 1FOEA 5GOWB 1OQNA 3QIJA 5DH9B 5CLLB 1XD4A 1U5GA 2P0FA 1UPQA 5DI9B 2LOZA 3RCPA 2DHJA 2UZRA 4Z2NA 4IOYX 2RLOA 2Z0OA 1U29A 3TVVA 3U7DA 3VIAA 1U27A 2V76A 1V5PA 2IYBA 3ODOA 1DDVA 2DTCA 2YRYA 3HK0A 4EJNA 4HAXB 4K81A 2LYDA 3FEHA 1XX0A 4MT7A 1AWEA 2YVCA 2J59M 2QKMA 2AEHA 2KCJA 4F7HA 4HAYB 2NZ8B 1I2HA 5LONB 2LOXA 1M7EA 1XR0B 2YT1A 4HB4B 2EMSA 4GMVA 1XODA 1OY2A 4A6KA 4EKUA 1BTNA 2I1JA 2BCJA 1MKEA 2YS3A 4NY0A 1DYNA 2DX5A 5KCVA 3F5RA 2KGXB 2P0DA 1EF1A 1SHCA 3P7ZA 3PVLA 3QBVB 4EMOA 3ZDTA 1PLSA 3A98B 4K2PA 2DKPA 4H8SA 1WJ1A 2IFSA 5CLQB 3P6AA 2CY5A 4F7UP 3CIKA 3KZ1A 3G9WA 4GN1A 2GJYA 3AJ4A 1RJ2A 1X11A 1NTVA 4DX8A 5C5BA 3KY9A 1UNPA 3N7CA 5EFXA 1TXDA 1ZSQA 1EVHA 3TW1A 1WVHA 3PVUA 2CODA 5C79A 1NTYA 2Y8GA 3GYOA 4KAXB 2PZ1A 5HE3A 3U8ZA 2CAYA 4GZUA 1DROA 4KVGB 2RSGA 3GYPA 1U5FA 1UNQA 4WVFB 1PMSA 1I7AA 4HAWB 2CRFA 4A6FA 2GCLA 2N0YA 2D10A 1Y5OA 1NU2A 2Y8FA 2Z0QA 2YT0A 3PZDA 1KZGA 2K2JA 1XKEA 1V5UA 2K00A 3PG7A 4ZRIA 1QC6A 2DYNA 2LULA 1TQZA 1ZC3B 1NI2A 1LB1A 3KRWA 3SV1A 2EMTA 5JP4A 3ML4A 1LW3A 4HATB 4TYZA 1FHOA 2L1CA 4HAUB 1V89A 2HE7A 1Q67A 1WGQA 1X86A 4BBKA 5HE0A 3WYFB 1BWNA 2DN6A 1SGHA 4A5KA 2MKRA 1ZC4B 1WI1A 3ZVRA 3KSYA 2YSZA 3OANA 2RVBB 5DHAB 1X1GA 2XQNM 3IVFA 2EC1A 4DXAB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4D0N B;  2EJ8 A;  4ZRK A;  3DXE A;  1Y19 B;  2AL6 A;  1U2B A;  2NMB A;  3ULC A;  1KZ7 A;  1DDW A;  4YL8 A;  2I5F A;  3SUZ A;  4K2O A;  1OMW A;  4Y94 A;  2D11 A;  3TCA A;  3VOQ A;  2ELB A;  3LJU X;  1PFJ A;  1W1H A;  4HB2 B;  2COC A;  5L81 A;  3MDB C;  2K2U A;  3QWM A;  3UZT A;  2RGN B;  2OTX A;  3D8D A;  1U5E A;  4GPT B;  1MK9 B;  2W2X D;  1AQC A;  1DBH A;  3PP2 A;  1TJ6 A;  2DFK A;  5C16 A;  1FGY A;  1V61 A;  2MFQ A;  3PSC A;  2CY4 A;  5HE2 A;  3O96 A;  2QKL A;  4C0A A;  4YON A;  5DIF B;  1J19 A;  4CHJ A;  4DX9 0;  2W2X C;  1B55 A;  1BTK A;  1GC7 A;  2VSZ A;  1WGU A;  2D9Y A;  4TKN A;  1P5T A;  2D9V A;  4IAP A;  4F7G A;  3NSU A;  1MK7 B;  2RUK B;  3MPX A;  1N3H A;  4HB0 B;  1BAK A;  5D3W A;  3BJI A;  2M14 A;  3SO6 A;  3D8F A;  2RNR B;  3ODW A;  4MY6 A;  2H7D A;  2DLW A;  3ODX A;  5D3Y A;  2D9X A;  1XCG A;  3M1I B;  2Q13 A;  1E5W A;  1RRP B;  3A8P A;  2L2I A;  2JP2 A;  1WG7 A;  3WA0 A;  2G35 A;  5FI1 A;  1MIZ B;  2I1K A;  4HDO A;  4GXB A;  4A6H A;  5FI0 A;  1ZVR A;  2J0M A;  2M38 A;  3A8Q A;  5KQ1 A;  3F0W A;  1MAI A;  1QQG A;  4DBB A;  3TFM A;  1H4R A;  4KHA A;  5DHF B;  2ROZ B;  1ZM0 A;  5JLJ B;  2DA0 A;  2HTH B;  2R0D A;  5LOP B;  3PEG A;  1GG3 A;  1GC6 A;  2E2X A;  1EGX A;  4HB3 B;  4NSW A;  3PVW A;  1W1D A;  3X23 A;  5C6R A;  3BIN A;  1K5G B;  3SYX A;  4PNK A;  5JHG A;  5D27 A;  2DHI A;  4GMX B;  1UEF A;  1Z87 A;  3AU5 A;  3HW2 B;  1K5D B;  3DXC A;  4HHV A;  1FGZ A;  3FM8 C;  4XWX A;  1ISN A;  2ADZ A;  1J0W A;  5C5B B;  4K17 A;  1V5M A;  2D2Q A;  4ZRJ A;  2D9Z A;  4WSF A;  2P0H A;  2ZPY A;  2H7E A;  1MPH A;  1P3R A;  2DYQ A;  2Z0P A;  2COF A;  2DHK A;  2Y7B A;  3D8E A;  2ROV A;  2J0K A;  2COA A;  3T06 A;  5HE1 A;  2MDX A;  3SNH A;  2YS1 A;  4P7I A;  1EAZ A;  2DX1 A;  4HDQ A;  2ELA A;  2J0J A;  1UNR A;  5D3X A;  2VKI A;  4KHB B;  4A6F B;  4B6H A;  2KUP A;  5JHH A;  2FJL A;  4L6E A;  2LG1 A;  3KRX A;  1FB8 A;  1WJM A;  3HQC A;  2GS0 A;  1FHW A;  4MK0 A;  1X1F A;  2OQB A;  4Z2M B;  1V88 A;  4KHO A;  2MWN B;  4HAZ B;  5KQ4 A;  2R09 A;  2D4Q A;  2YF0 A;  4CYE A;  3CXB B;  1UPR A;  5J3Y A;  5J3T A;  1MIX A;  5D3V A;  1KI1 B;  2UVM A;  1W1G A;  4WJ7 A;  3DXD A;  3V5W A;  2GCJ A;  1DDM A;  2W2W A;  3AU4 A;  1H10 A;  4CHM A;  2N23 A;  2LKO A;  1M7R A;  1P6S A;  5J3Q A;  1FHX A;  4IFS A;  1U5D A;  3TO1 A;  2VRW B;  3FSS A;  4PQ0 A;  4HAV B;  2I5C A;  2YS5 A;  1FAO A;  3ULB A;  1IRS A;  2UZS A;  2P8V A;  1X05 A;  2D9W A;  2X18 A;  2DKQ A;  1FOE A;  5GOW B;  1OQN A;  3QIJ A;  5DH9 B;  5CLL B;  1XD4 A;  1U5G A;  2P0F A;  1UPQ A;  5DI9 B;  2LOZ A;  3RCP A;  2DHJ A;  2UZR A;  4Z2N A;  4IOY X;  2RLO A;  2Z0O A;  1U29 A;  3TVV A;  3U7D A;  3VIA A;  1U27 A;  2V76 A;  1V5P A;  2IYB A;  3ODO A;  1DDV A;  2DTC A;  2YRY A;  3HK0 A;  4EJN A;  4HAX B;  4K81 A;  2LYD A;  3FEH A;  1XX0 A;  4MT7 A;  1AWE A;  2YVC A;  2J59 M;  2QKM A;  2AEH A;  2KCJ A;  4F7H A;  4HAY B;  2NZ8 B;  1I2H A;  5LON B;  2LOX A;  1M7E A;  1XR0 B;  2YT1 A;  4HB4 B;  2EMS A;  4GMV A;  1XOD A;  1OY2 A;  4A6K A;  4EKU A;  1BTN A;  2I1J A;  2BCJ A;  1MKE A;  2YS3 A;  4NY0 A;  1DYN A;  2DX5 A;  5KCV A;  3F5R A;  2KGX B;  2P0D A;  1EF1 A;  1SHC A;  3P7Z A;  3PVL A;  3QBV B;  4EMO A;  3ZDT A;  1PLS A;  3A98 B;  4K2P A;  2DKP A;  4H8S A;  1WJ1 A;  2IFS A;  5CLQ B;  3P6A A;  2CY5 A;  4F7U P;  3CIK A;  3KZ1 A;  3G9W A;  4GN1 A;  2GJY A;  3AJ4 A;  1RJ2 A;  1X11 A;  1NTV A;  4DX8 A;  5C5B A;  3KY9 A;  1UNP A;  3N7C A;  5EFX A;  1TXD A;  1ZSQ A;  1EVH A;  3TW1 A;  1WVH A;  3PVU A;  2COD A;  5C79 A;  1NTY A;  2Y8G A;  3GYO A;  4KAX B;  2PZ1 A;  5HE3 A;  3U8Z A;  2CAY A;  4GZU A;  1DRO A;  4KVG B;  2RSG A;  3GYP A;  1U5F A;  1UNQ A;  4WVF B;  1PMS A;  1I7A A;  4HAW B;  2CRF A;  4A6F A;  2GCL A;  2N0Y A;  2D10 A;  1Y5O A;  1NU2 A;  2Y8F A;  2Z0Q A;  2YT0 A;  3PZD A;  1KZG A;  2K2J A;  1XKE A;  1V5U A;  2K00 A;  3PG7 A;  4ZRI A;  1QC6 A;  2DYN A;  2LUL A;  1TQZ A;  1ZC3 B;  1NI2 A;  1LB1 A;  3KRW A;  3SV1 A;  2EMT A;  5JP4 A;  3ML4 A;  1LW3 A;  4HAT B;  4TYZ A;  1FHO A;  2L1C A;  4HAU B;  1V89 A;  2HE7 A;  1Q67 A;  1WGQ A;  1X86 A;  4BBK A;  5HE0 A;  3WYF B;  1BWN A;  2DN6 A;  1SGH A;  4A5K A;  2MKR A;  1ZC4 B;  1WI1 A;  3ZVR A;  3KSY A;  2YSZ A;  3OAN A;  2RVB B;  5DHA B;  1X1G A;  2XQN M;  3IVF A;  2EC1 A;  4DXA B; 
#chains in the Genus database with same CATH topology
 4D0N B;  2EJ8 A;  3OHM B;  4ZRK A;  5I2S A;  3DXE A;  1Y19 B;  2AL6 A;  2NBV A;  1U2B A;  2NMB A;  3ULC A;  1KZ7 A;  1DDW A;  4YL8 A;  2I5F A;  3SUZ A;  4K2O A;  1OMW A;  4CSQ A;  4Y94 A;  2D11 A;  3TCA A;  3VOQ A;  2ELB A;  3LJU X;  1PFJ A;  1W1H A;  4HB2 B;  3NWF A;  2COC A;  5L81 A;  3MDB C;  2K2U A;  3QWM A;  3UZT A;  2RGN B;  2OTX A;  3D8D A;  1U5E A;  4GPT B;  1MK9 B;  2W2X D;  1AQC A;  1DBH A;  3PP2 A;  1TJ6 A;  2DFK A;  5C16 A;  1FGY A;  1V61 A;  2MFQ A;  3PSC A;  2CY4 A;  5HE2 A;  3O96 A;  2QKL A;  4C0A A;  4YON A;  5DIF B;  4GOU A;  1J19 A;  4CHJ A;  4DX9 0;  2W2X C;  1B55 A;  1BTK A;  1GC7 A;  2VSZ A;  1WGU A;  2D9Y A;  4TKN A;  1P5T A;  2D9V A;  4IAP A;  4F7G A;  3NSU A;  1MK7 B;  2RUK B;  3MPX A;  1N3H A;  4HB0 B;  1BAK A;  5D3W A;  3BJI A;  2M14 A;  3SO6 A;  3D8F A;  2RNR B;  3ODW A;  4MY6 A;  2H7D A;  2DLW A;  3ODX A;  5D3Y A;  2D9X A;  1XCG A;  3M1I B;  2Q13 A;  1E5W A;  1RRP B;  3A8P A;  2L2I A;  2JP2 A;  1WG7 A;  3WA0 A;  2G35 A;  5LG4 B;  5FI1 A;  3B77 A;  1MIZ B;  2I1K A;  4HDO A;  4GXB A;  4A6H A;  5FI0 A;  1ZVR A;  2J0M A;  2M38 A;  3A8Q A;  5KQ1 A;  3F0W A;  1MAI A;  1QQG A;  4DBB A;  3TFM A;  1H4R A;  4KHA A;  5DHF B;  2ROZ B;  1ZM0 A;  5JLJ B;  2DA0 A;  2HTH B;  2R0D A;  5LOP B;  5IRS A;  3PEG A;  1GG3 A;  2Z59 A;  1GC6 A;  2E2X A;  4QJ5 B;  1EGX A;  4HB3 B;  3U12 A;  4NSW A;  3PVW A;  1W1D A;  3FVC A;  3X23 A;  5C6R A;  3BIN A;  1K5G B;  3SYX A;  4PNK A;  5JHG A;  5D27 A;  2DHI A;  4GMX B;  1UEF A;  1Z87 A;  3AU5 A;  3HW2 B;  3DCX A;  1K5D B;  3DXC A;  4HHV A;  1FGZ A;  3FM8 C;  4XWX A;  1ISN A;  2ADZ A;  3A58 A;  1MI1 A;  1J0W A;  5C5B B;  4K17 A;  1V5M A;  2D2Q A;  4ZRJ A;  2D9Z A;  4WSF A;  2P0H A;  2ZPY A;  2H7E A;  1MPH A;  1P3R A;  2DYQ A;  2Z0P A;  2COF A;  2DHK A;  2Y7B A;  3D8E A;  2ROV A;  2J0K A;  2COA A;  5I2M A;  3NW8 A;  3T06 A;  5HE1 A;  1T77 A;  2MDX A;  3SNH A;  2YS1 A;  2K49 A;  4P7I A;  1EAZ A;  2DX1 A;  4HDQ A;  2ELA A;  2J0J A;  1UNR A;  5D3X A;  2VKI A;  4KHB B;  4A6F B;  4B6H A;  2KIE A;  2KUP A;  5JHH A;  2FJL A;  4L6E A;  2LG1 A;  3KRX A;  1FB8 A;  1WJM A;  3HQC A;  2GS0 A;  1FHW A;  4MK0 A;  1X1F A;  2OQB A;  4Z2M B;  1V88 A;  4KHO A;  2K8E A;  2MWN B;  4HAZ B;  5KQ4 A;  2R09 A;  2D4Q A;  2YF0 A;  4L1R A;  4CYE A;  3CXB B;  1UPR A;  5J3Y A;  5J3T A;  1MIX A;  5D3V A;  1KI1 B;  2UVM A;  1W1G A;  4WJ7 A;  2Z14 A;  3DXD A;  3V5W A;  2GCJ A;  1DDM A;  4QJ3 B;  2W2W A;  3AU4 A;  1H10 A;  4CHM A;  2N23 A;  4D6W A;  2LKO A;  1M7R A;  4QJ4 B;  2GUM A;  1P6S A;  5J3Q A;  4DIX A;  1FHX A;  4IFS A;  1U5D A;  4HSI A;  3TO1 A;  2VRW B;  3FSS A;  4PQ0 A;  4HAV B;  2I5C A;  2YS5 A;  1FAO A;  2FJU B;  3NWA A;  3ULB A;  1IRS A;  2UZS A;  2P8V A;  1X05 A;  2D9W A;  2X18 A;  2DKQ A;  1FOE A;  5GOW B;  1OQN A;  3QIJ A;  5DH9 B;  5CLL B;  1XD4 A;  1U5G A;  2P0F A;  1UPQ A;  5DI9 B;  2LOZ A;  3RCP A;  2DHJ A;  2UZR A;  4Z2N A;  4IOY X;  2RLO A;  2Z0O A;  1U29 A;  3TVV A;  3U7D A;  3VIA A;  1U27 A;  2V76 A;  1V5P A;  2IYB A;  3ODO A;  1DDV A;  2DTC A;  2YRY A;  3HK0 A;  4EJN A;  4HAX B;  4K81 A;  2LYD A;  3FEH A;  1XX0 A;  3NWD A;  4MT7 A;  2Z4D A;  1AWE A;  2YVC A;  2J59 M;  2QKM A;  2AEH A;  2KCJ A;  4F7H A;  4HAY B;  2NZ8 B;  1I2H A;  5LON B;  2LOX A;  1M7E A;  1XR0 B;  2YT1 A;  4HB4 B;  2EMS A;  4GMV A;  1XOD A;  1OY2 A;  4A6K A;  4OT1 A;  4EKU A;  1BTN A;  2I1J A;  2BCJ A;  1MKE A;  2YS3 A;  2Z13 A;  4NY0 A;  2YT2 A;  2ZKM X;  1DYN A;  2DX5 A;  5KCV A;  3F5R A;  2KGX B;  2P0D A;  1EF1 A;  1SHC A;  3P7Z A;  3PVL A;  3QBV B;  4EMO A;  4GNK B;  4KHB A;  3ZDT A;  1PLS A;  3A98 B;  4K2P A;  2DKP A;  4H8S A;  1WJ1 A;  2IFS A;  5CLQ B;  3P6A A;  2CY5 A;  4F7U P;  3CIK A;  3KZ1 A;  3G9W A;  4GN1 A;  2GJY A;  3AJ4 A;  1RJ2 A;  1X11 A;  2KIG A;  1NTV A;  4DX8 A;  5C5B A;  3KY9 A;  1UNP A;  3N7C A;  5EFX A;  1TXD A;  1ZSQ A;  1EVH A;  3TW1 A;  1WVH A;  3PVU A;  2COD A;  5C79 A;  1NTY A;  2R2Y A;  2Y8G A;  2KUQ A;  3GYO A;  4KAX B;  2PZ1 A;  5HE3 A;  1ZYI A;  3U8Z A;  2CAY A;  2KR0 A;  3HSA A;  4GZU A;  1DRO A;  4KVG B;  2RSG A;  3GYP A;  1U5F A;  1UNQ A;  4WVF B;  5M4Y B;  1PMS A;  1I7A A;  4HAW B;  2CRF A;  4A6F A;  2GCL A;  4OSN A;  2N0Y A;  2D10 A;  1Y5O A;  1NU2 A;  2Y8F A;  2Z0Q A;  2YT0 A;  3PZD A;  1KZG A;  2K2J A;  1XKE A;  1V5U A;  2K00 A;  3PG7 A;  4ZRI A;  1QC6 A;  2DYN A;  2LUL A;  1TQZ A;  1ZC3 B;  1NI2 A;  1LB1 A;  3KRW A;  3SV1 A;  2EMT A;  5JP4 A;  3ML4 A;  1LW3 A;  4HAT B;  4TYZ A;  1FHO A;  2L1C A;  4HAU B;  1V89 A;  2HE7 A;  1Q67 A;  1WGQ A;  1X86 A;  4BBK A;  5HE0 A;  3WYF B;  1BWN A;  2DN6 A;  1SGH A;  4A5K A;  2MKR A;  1ZC4 B;  4QXA B;  1WI1 A;  3ZVR A;  3KSY A;  2YSZ A;  3OAN A;  2RVB B;  2RRF A;  5DHA B;  1X1G A;  2XQN M;  3IVF A;  2EC1 A;  3HIE A;  4DXA B; 
#chains in the Genus database with same CATH homology
 4D0N B;  2EJ8 A;  4ZRK A;  3DXE A;  1Y19 B;  2AL6 A;  1U2B A;  2NMB A;  3ULC A;  1KZ7 A;  1DDW A;  4YL8 A;  2I5F A;  3SUZ A;  4K2O A;  1OMW A;  4Y94 A;  2D11 A;  3TCA A;  3VOQ A;  2ELB A;  3LJU X;  1PFJ A;  1W1H A;  4HB2 B;  2COC A;  5L81 A;  3MDB C;  2K2U A;  3QWM A;  3UZT A;  2RGN B;  2OTX A;  3D8D A;  1U5E A;  4GPT B;  1MK9 B;  2W2X D;  1AQC A;  1DBH A;  3PP2 A;  1TJ6 A;  2DFK A;  5C16 A;  1FGY A;  1V61 A;  2MFQ A;  3PSC A;  2CY4 A;  5HE2 A;  3O96 A;  2QKL A;  4C0A A;  4YON A;  5DIF B;  1J19 A;  4CHJ A;  4DX9 0;  2W2X C;  1B55 A;  1BTK A;  1GC7 A;  2VSZ A;  1WGU A;  2D9Y A;  4TKN A;  1P5T A;  2D9V A;  4IAP A;  4F7G A;  3NSU A;  1MK7 B;  2RUK B;  3MPX A;  1N3H A;  4HB0 B;  1BAK A;  5D3W A;  3BJI A;  2M14 A;  3SO6 A;  3D8F A;  2RNR B;  3ODW A;  4MY6 A;  2H7D A;  2DLW A;  3ODX A;  5D3Y A;  2D9X A;  1XCG A;  3M1I B;  2Q13 A;  1E5W A;  1RRP B;  3A8P A;  2L2I A;  2JP2 A;  1WG7 A;  3WA0 A;  2G35 A;  5FI1 A;  1MIZ B;  2I1K A;  4HDO A;  4GXB A;  4A6H A;  5FI0 A;  1ZVR A;  2J0M A;  2M38 A;  3A8Q A;  5KQ1 A;  3F0W A;  1MAI A;  1QQG A;  4DBB A;  3TFM A;  1H4R A;  4KHA A;  5DHF B;  2ROZ B;  1ZM0 A;  5JLJ B;  2DA0 A;  2HTH B;  2R0D A;  5LOP B;  3PEG A;  1GG3 A;  1GC6 A;  2E2X A;  1EGX A;  4HB3 B;  4NSW A;  3PVW A;  1W1D A;  3X23 A;  5C6R A;  3BIN A;  1K5G B;  3SYX A;  4PNK A;  5JHG A;  5D27 A;  2DHI A;  4GMX B;  1UEF A;  1Z87 A;  3AU5 A;  3HW2 B;  1K5D B;  3DXC A;  4HHV A;  1FGZ A;  3FM8 C;  4XWX A;  1ISN A;  2ADZ A;  1J0W A;  5C5B B;  4K17 A;  1V5M A;  2D2Q A;  4ZRJ A;  2D9Z A;  4WSF A;  2P0H A;  2ZPY A;  2H7E A;  1MPH A;  1P3R A;  2DYQ A;  2Z0P A;  2COF A;  2DHK A;  2Y7B A;  3D8E A;  2ROV A;  2J0K A;  2COA A;  3T06 A;  5HE1 A;  2MDX A;  3SNH A;  2YS1 A;  4P7I A;  1EAZ A;  2DX1 A;  4HDQ A;  2ELA A;  2J0J A;  1UNR A;  5D3X A;  2VKI A;  4KHB B;  4A6F B;  4B6H A;  2KUP A;  5JHH A;  2FJL A;  4L6E A;  2LG1 A;  3KRX A;  1FB8 A;  1WJM A;  3HQC A;  2GS0 A;  1FHW A;  4MK0 A;  1X1F A;  2OQB A;  4Z2M B;  1V88 A;  4KHO A;  2MWN B;  4HAZ B;  5KQ4 A;  2R09 A;  2D4Q A;  2YF0 A;  4CYE A;  3CXB B;  1UPR A;  5J3Y A;  5J3T A;  1MIX A;  5D3V A;  1KI1 B;  2UVM A;  1W1G A;  4WJ7 A;  3DXD A;  3V5W A;  2GCJ A;  1DDM A;  2W2W A;  3AU4 A;  1H10 A;  4CHM A;  2N23 A;  2LKO A;  1M7R A;  1P6S A;  5J3Q A;  1FHX A;  4IFS A;  1U5D A;  3TO1 A;  2VRW B;  3FSS A;  4PQ0 A;  4HAV B;  2I5C A;  2YS5 A;  1FAO A;  3ULB A;  1IRS A;  2UZS A;  2P8V A;  1X05 A;  2D9W A;  2X18 A;  2DKQ A;  1FOE A;  5GOW B;  1OQN A;  3QIJ A;  5DH9 B;  5CLL B;  1XD4 A;  1U5G A;  2P0F A;  1UPQ A;  5DI9 B;  2LOZ A;  3RCP A;  2DHJ A;  2UZR A;  4Z2N A;  4IOY X;  2RLO A;  2Z0O A;  1U29 A;  3TVV A;  3U7D A;  3VIA A;  1U27 A;  2V76 A;  1V5P A;  2IYB A;  3ODO A;  1DDV A;  2DTC A;  2YRY A;  3HK0 A;  4EJN A;  4HAX B;  4K81 A;  2LYD A;  3FEH A;  1XX0 A;  4MT7 A;  1AWE A;  2YVC A;  2J59 M;  2QKM A;  2AEH A;  2KCJ A;  4F7H A;  4HAY B;  2NZ8 B;  1I2H A;  5LON B;  2LOX A;  1M7E A;  1XR0 B;  2YT1 A;  4HB4 B;  2EMS A;  4GMV A;  1XOD A;  1OY2 A;  4A6K A;  4EKU A;  1BTN A;  2I1J A;  2BCJ A;  1MKE A;  2YS3 A;  4NY0 A;  1DYN A;  2DX5 A;  5KCV A;  3F5R A;  2KGX B;  2P0D A;  1EF1 A;  1SHC A;  3P7Z A;  3PVL A;  3QBV B;  4EMO A;  3ZDT A;  1PLS A;  3A98 B;  4K2P A;  2DKP A;  4H8S A;  1WJ1 A;  2IFS A;  5CLQ B;  3P6A A;  2CY5 A;  4F7U P;  3CIK A;  3KZ1 A;  3G9W A;  4GN1 A;  2GJY A;  3AJ4 A;  1RJ2 A;  1X11 A;  1NTV A;  4DX8 A;  5C5B A;  3KY9 A;  1UNP A;  3N7C A;  5EFX A;  1TXD A;  1ZSQ A;  1EVH A;  3TW1 A;  1WVH A;  3PVU A;  2COD A;  5C79 A;  1NTY A;  2Y8G A;  3GYO A;  4KAX B;  2PZ1 A;  5HE3 A;  3U8Z A;  2CAY A;  4GZU A;  1DRO A;  4KVG B;  2RSG A;  3GYP A;  1U5F A;  1UNQ A;  4WVF B;  1PMS A;  1I7A A;  4HAW B;  2CRF A;  4A6F A;  2GCL A;  2N0Y A;  2D10 A;  1Y5O A;  1NU2 A;  2Y8F A;  2Z0Q A;  2YT0 A;  3PZD A;  1KZG A;  2K2J A;  1XKE A;  1V5U A;  2K00 A;  3PG7 A;  4ZRI A;  1QC6 A;  2DYN A;  2LUL A;  1TQZ A;  1ZC3 B;  1NI2 A;  1LB1 A;  3KRW A;  3SV1 A;  2EMT A;  5JP4 A;  3ML4 A;  1LW3 A;  4HAT B;  4TYZ A;  1FHO A;  2L1C A;  4HAU B;  1V89 A;  2HE7 A;  1Q67 A;  1WGQ A;  1X86 A;  4BBK A;  5HE0 A;  3WYF B;  1BWN A;  2DN6 A;  1SGH A;  4A5K A;  2MKR A;  1ZC4 B;  1WI1 A;  3ZVR A;  3KSY A;  2YSZ A;  3OAN A;  2RVB B;  5DHA B;  1X1G A;  2XQN M;  3IVF A;  2EC1 A;  4DXA B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...