1V5PA

Solution structure of the n-terminal pleckstrin homology domain of tapp2 from mouse
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
126
structure length
126
Chain Sequence
GSSGSSGMPYVDRQNRICGFLDIEDNENSGKFLRRYFILDTQANCLLWYMDNPQNLAVGAGAVGSLQLTYISKVSIATPKQKPKTPFCFVINALSQRYFLQANDQKDLKDWVEALNQASKSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution Structure of the N-terminal Pleckstrin Homology Domain Of TAPP2 from Mouse
rcsb
source organism Mus musculus
molecule tags Signaling protein
molecule keywords pleckstrin homology domain-containing, family A
total genus 13
structure length 126
sequence length 126
ec nomenclature
pdb deposition date 2003-11-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00169 PH PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1v5pA01
1DYNA 1KI1B 2W2XD 4GZUA 3PVLA 1V89A 1W1GA 2Z0QA 2MFQA 4HAWB 5KCVA 2H7DA 4K2OA 1M7EA 3TW1A 3KRWA 5JP4A 2GS0A 2ROZB 5LOPB 2P0FA 1MPHA 1XD4A 1XCGA 1I2HA 1WGUA 3KY9A 4HHVA 2Z0OA 3DXDA 2I5FA 2P0HA 1X1GA 2Z0PA 2L1CA 2HTHB 5KQ1A 2DX1A 3HW2B 5CLLB 5D3WA 1MIXA 2J0JA 2UVMA 3TO1A 2QKMA 3D8DA 5C16A 1DDMA 3F5RA 4C0AA 5FI1A 2N23A 3T06A 4F7GA 2AL6A 2M38A 2RNRB 1FAOA 5C5BB 2Q13A 5L81A 4P7IA 4BBKA 3OANA 4EKUA 5D3XA 3SUZA 2W2XC 3TVVA 2VKIA 1OY2A 3P6AA 1Y19B 4B6HA 2DFKA 1PMSA 4A6FB 1U5DA 4ZRKA 1BAKA 1MIZB 3BINA 2DX5A 2R0DA 4DX8A 2EC1A 4KAXB 3PP2A 5D3VA 1OMWA 3TFMA 2UZSA 2D9VA 1XODA 4KHOA 4YONA 2D4QA 5JLJB 5HE2A 4A6FA 4CHMA 4DX90 1U27A 1Z87A 1BTNA 4HAXB 2NZ8B 2GCJA 2W2WA 4PNKA 3D8EA 4PQ0A 5J3TA 4GN1A 4NY0A 4HB3B 1K5GB 3PG7A 2UZRA 1NI2A 2EMTA 4HB4B 4L6EA 2M14A 2ELBA 5J3QA 1NTVA 3GYOA 2LOZA 3FSSA 2D9XA 4WSFA 2IFSA 2D11A 1U5GA 1V88A 3NSUA 1GG3A 3MPXA 3ML4A 1BTKA 2Y8FA 1Y5OA 3ZVRA 2DKQA 3AU4A 4XWXA 1EVHA 3MDBC 2DYNA 2DYQA 2XQNM 4ZRIA 2Y8GA 3D8FA 4F7HA 2CY4A 1XX0A 2MKRA 2RUKB 1W1HA 4GPTB 1UNPA 1DROA 2G35A 3ULCA 1P5TA 3QBVB 5HE0A 4Z2NA 1EGXA 2GCLA 3VIAA 1U2BA 2Y7BA 4KHBB 3UZTA 5DIFB 4F7UP 1WGQA 2EMSA 4H8SA 3A98B 2YT0A 2RGNB 3RCPA 2COFA 1K5DB 3PEGA 2D9ZA 3PVUA 1SGHA 1WVHA 2DHIA 1E5WA 4ZRJA 3F0WA 4IAPA 4HAZB 1ZC3B 2NMBA 3WA0A 1TXDA 2I1KA 4Y94A 3X23A 1X11A 1UEFA 3G9WA 4GXBA 4D0NB 1KZ7A 1M7RA 4WVFB 4HAYB 3IVFA 1H10A 1FHXA 3TCAA 3N7CA 1MK9B 4EJNA 2DKPA 4MY6A 1V5MA 2DLWA 5CLQB 4DXAB 1XR0B 2KGXB 3HQCA 3AU5A 1PLSA 2ROVA 1EF1A 1X1FA 1I7AA 3ZDTA 1LW3A 1TQZA 5HE3A 4A5KA 3SV1A 3FM8C 1FHWA 1FHOA 4IFSA 2LOXA 1GC6A 2E2XA 1WJ1A 2YS5A 4CYEA 5D27A 2K2JA 2YF0A 1N3HA 1UPRA 2ELAA 2PZ1A 2JP2A 1WJMA 2D10A 2D9WA 1GC7A 3KSYA 3DXCA 2OQBA 2J0MA 5JHGA 2YRYA 3KZ1A 1QC6A 3U8ZA 5JHHA 3LJUX 4HB0B 2VRWB 2HE7A 1LB1A 1V61A 2ADZA 2RSGA 1V5PA 3A8PA 3M1IB 1FOEA 1ISNA 5J3YA 3BJIA 2D2QA 2COAA 2MWNB 4EMOA 4MT7A 3V5WA 2P0DA 4HB2B 2LULA 3SO6A 4K17A 2FJLA 3A8QA 3ODWA 4TKNA 2CRFA 4GMXB 2KCJA 1UNQA 2AEHA 4HATB 2DN6A 1ZC4B 2N0YA 1AWEA 1FGZA 2RLOA 3SYXA 5D3YA 2CODA 2P8VA 1UPQA 3O96A 4A6HA 5C79A 5KQ4A 2X18A 2I1JA 1X86A 5LONB 1Q67A 1MK7B 2YS3A 1OQNA 3DXEA 1UNRA 3AJ4A 4K81A 1U5FA 3ODXA 3KRXA 1W1DA 2H7EA 1EAZA 5EFXA 1X05A 2LKOA 1RJ2A 1FB8A 5FI0A 1ZSQA 2D9YA 4GMVA 1WG7A 1PFJA 2YVCA 1U5EA 5C5BA 1J0WA 3GYPA 2J0KA 1U29A 3CIKA 4HAVB 3SNHA 1H4RA 3PSCA 1P6SA 2CAYA 2J59M 3U7DA 1AQCA 1IRSA 2I5CA 1MKEA 4K2PA 1NU2A 2EJ8A 2DHJA 4HAUB 4KVGB 2YS1A 4CHJA 3P7ZA 5DI9B 5DH9B 2LG1A 1BWNA 2ZPYA 2COCA 4A6KA 2L2IA 2MDXA 4KHAA 4YL8A 5GOWB 2CY5A 3PZDA 1P3RA 1MAIA 2LYDA 4HDOA 1ZM0A 4Z2MB 2DTCA 2DHKA 2YSZA 2V76A 1TJ6A 4DBBA 2YT1A 3CXBB 1B55A 1RRPB 2R09A 1KZGA 2IYBA 2OTXA 3FEHA 2K2UA 1XKEA 2VSZA 1DDWA 3WYFB 3VOQA 5DHAB 1NTYA 1DDVA 1V5UA 1DBHA 1QQGA 3ODOA 2RVBB 4TYZA 2GJYA 2QKLA 3HK0A 3ULBA 3QWMA 4NSWA 5HE1A 5DHFB 2DA0A 5C6RA 1J19A 1SHCA 4IOYX 4WJ7A 4HDQA 4MK0A 2KUPA 3QIJA 2K00A 1ZVRA 2BCJA 3PVWA 1WI1A 1FGYA
chains in the Genus database with same CATH superfamily
1DYNA 1KI1B 2W2XD 4GZUA 3PVLA 1V89A 1W1GA 2Z0QA 2MFQA 4HAWB 5KCVA 2K8EA 2H7DA 4K2OA 1M7EA 3TW1A 3KRWA 5JP4A 2GS0A 2ROZB 5LOPB 2P0FA 1MPHA 1XD4A 1XCGA 2R2YA 2Z4DA 1I2HA 1WGUA 3KY9A 4HHVA 2Z0OA 3DXDA 2I5FA 2P0HA 1X1GA 2Z0PA 2L1CA 2HTHB 5KQ1A 2DX1A 3HW2B 3NWFA 5CLLB 5D3WA 1MIXA 2J0JA 2UVMA 3TO1A 5I2SA 2QKMA 3D8DA 5C16A 1DDMA 3F5RA 4C0AA 5FI1A 4D6WA 2N23A 3T06A 4F7GA 2AL6A 2M38A 2RNRB 1FAOA 5C5BB 2Q13A 5L81A 4P7IA 4BBKA 3OANA 4EKUA 3NW8A 5D3XA 2NBVA 3SUZA 2W2XC 3TVVA 2VKIA 1OY2A 3P6AA 1Y19B 4B6HA 2DFKA 1PMSA 4A6FB 4QJ3B 1U5DA 3B77A 4ZRKA 1BAKA 1MIZB 3BINA 2DX5A 2R0DA 4DX8A 1MI1A 2EC1A 4KAXB 3PP2A 3DCXA 5D3VA 1OMWA 3TFMA 2UZSA 2D9VA 1XODA 4KHOA 4QJ5B 4YONA 2D4QA 5JLJB 5HE2A 4A6FA 4CHMA 4DX90 1U27A 1Z87A 1BTNA 2KIEA 4HAXB 2NZ8B 2GCJA 2W2WA 4PNKA 3D8EA 4QJ4B 5LG4B 4PQ0A 5J3TA 4GN1A 4NY0A 4HB3B 3PG7A 1K5GB 2UZRA 1NI2A 2EMTA 4HB4B 4L6EA 2M14A 2ELBA 5J3QA 1NTVA 3GYOA 2LOZA 3FSSA 3OHMB 2D9XA 4WSFA 2IFSA 2D11A 1U5GA 1V88A 3NSUA 1GG3A 3MPXA 3ML4A 2RRFA 1BTKA 2Y8FA 1Y5OA 2Z14A 3ZVRA 2DKQA 3AU4A 4XWXA 1EVHA 2KR0A 3MDBC 2DYNA 2DYQA 2XQNM 4ZRIA 2Y8GA 3D8FA 4F7HA 2CY4A 1XX0A 2Z59A 2MKRA 2RUKB 2K49A 1W1HA 2YT2A 4GPTB 1UNPA 1DROA 2G35A 3ULCA 1P5TA 3QBVB 5HE0A 4Z2NA 1EGXA 2GCLA 3VIAA 1U2BA 2Y7BA 4KHBB 3UZTA 5DIFB 4F7UP 1WGQA 2EMSA 4H8SA 3A98B 2YT0A 2RGNB 3RCPA 2COFA 1K5DB 3PEGA 2D9ZA 3PVUA 1SGHA 1WVHA 2DHIA 1ZYIA 1E5WA 4ZRJA 3U12A 3F0WA 4IAPA 4HAZB 1ZC3B 2NMBA 3WA0A 1TXDA 2I1KA 4Y94A 2FJUB 2ZKMX 3X23A 1X11A 1UEFA 3G9WA 4GXBA 4D0NB 1KZ7A 1M7RA 4WVFB 4HAYB 3HIEA 3IVFA 1H10A 1FHXA 3TCAA 3N7CA 1MK9B 4EJNA 2DKPA 4MY6A 4KHBA 1V5MA 2DLWA 5CLQB 4DXAB 1XR0B 2KGXB 3HQCA 3AU5A 1PLSA 2ROVA 1EF1A 1X1FA 1I7AA 3ZDTA 1LW3A 1TQZA 5HE3A 4A5KA 3SV1A 3FM8C 1FHWA 1FHOA 4IFSA 2LOXA 1GC6A 2E2XA 1WJ1A 2YS5A 4CYEA 5D27A 2K2JA 3A58A 2YF0A 1N3HA 1UPRA 2ELAA 2PZ1A 2JP2A 1WJMA 2D10A 2D9WA 1GC7A 4L1RA 3KSYA 3DXCA 2GUMA 2OQBA 2J0MA 5JHGA 2YRYA 3KZ1A 1QC6A 3U8ZA 5JHHA 3LJUX 4HB0B 2VRWB 2HE7A 1LB1A 1V61A 2ADZA 2RSGA 1V5PA 3A8PA 3M1IB 1FOEA 1ISNA 5J3YA 3BJIA 2D2QA 2COAA 2MWNB 4EMOA 4MT7A 3V5WA 2P0DA 4HB2B 2LULA 3SO6A 4K17A 2FJLA 3A8QA 3ODWA 4QXAB 4TKNA 2CRFA 4GMXB 4CSQA 2KCJA 1UNQA 2AEHA 4HATB 2DN6A 1ZC4B 3NWDA 5M4YB 2N0YA 1AWEA 1FGZA 2RLOA 3SYXA 5D3YA 2CODA 2P8VA 1UPQA 3O96A 4A6HA 5C79A 5KQ4A 2X18A 2I1JA 1X86A 5LONB 1Q67A 1MK7B 3FVCA 2YS3A 1OQNA 3DXEA 1UNRA 3AJ4A 4K81A 1U5FA 3ODXA 3KRXA 1W1DA 2H7EA 2KIGA 1EAZA 5IRSA 5EFXA 1X05A 2LKOA 3HSAA 1RJ2A 1FB8A 5FI0A 1ZSQA 2D9YA 4GMVA 1WG7A 1PFJA 2YVCA 1U5EA 5C5BA 1J0WA 3GYPA 2J0KA 1U29A 3CIKA 4HAVB 3SNHA 1H4RA 3PSCA 1P6SA 2CAYA 2J59M 3U7DA 1AQCA 1IRSA 2I5CA 1MKEA 4K2PA 1NU2A 2EJ8A 2DHJA 4HAUB 5I2MA 4KVGB 2YS1A 4CHJA 3P7ZA 5DI9B 3NWAA 5DH9B 2LG1A 1BWNA 2ZPYA 2COCA 4A6KA 2L2IA 2MDXA 4KHAA 4YL8A 5GOWB 2CY5A 3PZDA 1P3RA 4GOUA 1MAIA 2LYDA 4HDOA 1ZM0A 4Z2MB 2DTCA 2DHKA 2YSZA 2V76A 1TJ6A 4DBBA 2YT1A 3CXBB 1B55A 2KUQA 1RRPB 2Z13A 2R09A 1KZGA 2IYBA 4HSIA 2OTXA 3FEHA 2K2UA 1XKEA 2VSZA 1DDWA 3WYFB 3VOQA 5DHAB 1NTYA 1DDVA 1V5UA 4OSNA 1DBHA 4DIXA 1QQGA 3ODOA 2RVBB 4TYZA 2GJYA 2QKLA 3HK0A 3ULBA 3QWMA 4NSWA 5HE1A 1T77A 5DHFB 2DA0A 5C6RA 1J19A 1SHCA 4IOYX 4OT1A 4WJ7A 4GNKB 4HDQA 4MK0A 2KUPA 3QIJA 2K00A 1ZVRA 2BCJA 3PVWA 1WI1A 1FGYA
chains in the Genus database with same CATH topology
1DYNA 1KI1B 2W2XD 4GZUA 3PVLA 1V89A 1W1GA 2Z0QA 2MFQA 4HAWB 5KCVA 2H7DA 4K2OA 1M7EA 3TW1A 3KRWA 5JP4A 2GS0A 2ROZB 5LOPB 2P0FA 1MPHA 1XD4A 1XCGA 1I2HA 1WGUA 3KY9A 4HHVA 2Z0OA 3DXDA 2I5FA 2P0HA 1X1GA 2Z0PA 2L1CA 2HTHB 5KQ1A 2DX1A 3HW2B 5CLLB 5D3WA 1MIXA 2J0JA 2UVMA 3TO1A 2QKMA 3D8DA 5C16A 1DDMA 3F5RA 4C0AA 5FI1A 2N23A 3T06A 4F7GA 2AL6A 2M38A 2RNRB 1FAOA 5C5BB 2Q13A 5L81A 4P7IA 4BBKA 3OANA 4EKUA 5D3XA 3SUZA 2W2XC 3TVVA 2VKIA 1OY2A 3P6AA 1Y19B 4B6HA 2DFKA 1PMSA 4A6FB 1U5DA 4ZRKA 1BAKA 1MIZB 3BINA 2DX5A 2R0DA 4DX8A 2EC1A 4KAXB 3PP2A 5D3VA 1OMWA 3TFMA 2UZSA 2D9VA 1XODA 4KHOA 4YONA 2D4QA 5JLJB 5HE2A 4A6FA 4CHMA 4DX90 1U27A 1Z87A 1BTNA 4HAXB 2NZ8B 2GCJA 2W2WA 4PNKA 3D8EA 4PQ0A 5J3TA 4GN1A 4NY0A 4HB3B 1K5GB 3PG7A 2UZRA 1NI2A 2EMTA 4HB4B 4L6EA 2M14A 2ELBA 5J3QA 1NTVA 3GYOA 2LOZA 3FSSA 2D9XA 4WSFA 2IFSA 2D11A 1U5GA 1V88A 3NSUA 1GG3A 3MPXA 3ML4A 1BTKA 2Y8FA 1Y5OA 3ZVRA 2DKQA 3AU4A 4XWXA 1EVHA 3MDBC 2DYNA 2DYQA 2XQNM 4ZRIA 2Y8GA 3D8FA 4F7HA 2CY4A 1XX0A 2MKRA 2RUKB 1W1HA 4GPTB 1UNPA 1DROA 2G35A 3ULCA 1P5TA 3QBVB 5HE0A 4Z2NA 1EGXA 2GCLA 3VIAA 1U2BA 2Y7BA 4KHBB 3UZTA 5DIFB 4F7UP 1WGQA 2EMSA 4H8SA 3A98B 2YT0A 2RGNB 3RCPA 2COFA 1K5DB 3PEGA 2D9ZA 3PVUA 1SGHA 1WVHA 2DHIA 1E5WA 4ZRJA 3F0WA 4IAPA 4HAZB 1ZC3B 2NMBA 3WA0A 1TXDA 2I1KA 4Y94A 3X23A 1X11A 1UEFA 3G9WA 4GXBA 4D0NB 1KZ7A 1M7RA 4WVFB 4HAYB 3IVFA 1H10A 1FHXA 3TCAA 3N7CA 1MK9B 4EJNA 2DKPA 4MY6A 1V5MA 2DLWA 5CLQB 4DXAB 1XR0B 2KGXB 3HQCA 3AU5A 1PLSA 2ROVA 1EF1A 1X1FA 1I7AA 3ZDTA 1LW3A 1TQZA 5HE3A 4A5KA 3SV1A 3FM8C 1FHWA 1FHOA 4IFSA 2LOXA 1GC6A 2E2XA 1WJ1A 2YS5A 4CYEA 5D27A 2K2JA 2YF0A 1N3HA 1UPRA 2ELAA 2PZ1A 2JP2A 1WJMA 2D10A 2D9WA 1GC7A 3KSYA 3DXCA 2OQBA 2J0MA 5JHGA 2YRYA 3KZ1A 1QC6A 3U8ZA 5JHHA 3LJUX 4HB0B 2VRWB 2HE7A 1LB1A 1V61A 2ADZA 2RSGA 1V5PA 3A8PA 3M1IB 1FOEA 1ISNA 5J3YA 3BJIA 2D2QA 2COAA 2MWNB 4EMOA 4MT7A 3V5WA 2P0DA 4HB2B 2LULA 3SO6A 4K17A 2FJLA 3A8QA 3ODWA 4TKNA 2CRFA 4GMXB 2KCJA 1UNQA 2AEHA 4HATB 2DN6A 1ZC4B 2N0YA 1AWEA 1FGZA 2RLOA 3SYXA 5D3YA 2CODA 2P8VA 1UPQA 3O96A 4A6HA 5C79A 5KQ4A 2X18A 2I1JA 1X86A 5LONB 1Q67A 1MK7B 2YS3A 1OQNA 3DXEA 1UNRA 3AJ4A 4K81A 1U5FA 3ODXA 3KRXA 1W1DA 2H7EA 1EAZA 5EFXA 1X05A 2LKOA 1RJ2A 1FB8A 5FI0A 1ZSQA 2D9YA 4GMVA 1WG7A 1PFJA 2YVCA 1U5EA 5C5BA 1J0WA 3GYPA 2J0KA 1U29A 3CIKA 4HAVB 3SNHA 1H4RA 3PSCA 1P6SA 2CAYA 2J59M 3U7DA 1AQCA 1IRSA 2I5CA 1MKEA 4K2PA 1NU2A 2EJ8A 2DHJA 4HAUB 4KVGB 2YS1A 4CHJA 3P7ZA 5DI9B 5DH9B 2LG1A 1BWNA 2ZPYA 2COCA 4A6KA 2L2IA 2MDXA 4KHAA 4YL8A 5GOWB 2CY5A 3PZDA 1P3RA 1MAIA 2LYDA 4HDOA 1ZM0A 4Z2MB 2DTCA 2DHKA 2YSZA 2V76A 1TJ6A 4DBBA 2YT1A 3CXBB 1B55A 1RRPB 2R09A 1KZGA 2IYBA 2OTXA 3FEHA 2K2UA 1XKEA 2VSZA 1DDWA 3WYFB 3VOQA 5DHAB 1NTYA 1DDVA 1V5UA 1DBHA 1QQGA 3ODOA 2RVBB 4TYZA 2GJYA 2QKLA 3HK0A 3ULBA 3QWMA 4NSWA 5HE1A 5DHFB 2DA0A 5C6RA 1J19A 1SHCA 4IOYX 4WJ7A 4HDQA 4MK0A 2KUPA 3QIJA 2K00A 1ZVRA 2BCJA 3PVWA 1WI1A 1FGYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DYN A;  1KI1 B;  2W2X D;  4GZU A;  3PVL A;  1V89 A;  1W1G A;  2Z0Q A;  2MFQ A;  4HAW B;  5KCV A;  2H7D A;  4K2O A;  1M7E A;  3TW1 A;  3KRW A;  5JP4 A;  2GS0 A;  2ROZ B;  5LOP B;  2P0F A;  1MPH A;  1XD4 A;  1XCG A;  1I2H A;  1WGU A;  3KY9 A;  4HHV A;  2Z0O A;  3DXD A;  2I5F A;  2P0H A;  1X1G A;  2Z0P A;  2L1C A;  2HTH B;  5KQ1 A;  2DX1 A;  3HW2 B;  5CLL B;  5D3W A;  1MIX A;  2J0J A;  2UVM A;  3TO1 A;  2QKM A;  3D8D A;  5C16 A;  1DDM A;  3F5R A;  4C0A A;  5FI1 A;  2N23 A;  3T06 A;  4F7G A;  2AL6 A;  2M38 A;  2RNR B;  1FAO A;  5C5B B;  2Q13 A;  5L81 A;  4P7I A;  4BBK A;  3OAN A;  4EKU A;  5D3X A;  3SUZ A;  2W2X C;  3TVV A;  2VKI A;  1OY2 A;  3P6A A;  1Y19 B;  4B6H A;  2DFK A;  1PMS A;  4A6F B;  1U5D A;  4ZRK A;  1BAK A;  1MIZ B;  3BIN A;  2DX5 A;  2R0D A;  4DX8 A;  2EC1 A;  4KAX B;  3PP2 A;  5D3V A;  1OMW A;  3TFM A;  2UZS A;  2D9V A;  1XOD A;  4KHO A;  4YON A;  2D4Q A;  5JLJ B;  5HE2 A;  4A6F A;  4CHM A;  4DX9 0;  1U27 A;  1Z87 A;  1BTN A;  4HAX B;  2NZ8 B;  2GCJ A;  2W2W A;  4PNK A;  3D8E A;  4PQ0 A;  5J3T A;  4GN1 A;  4NY0 A;  4HB3 B;  1K5G B;  3PG7 A;  2UZR A;  1NI2 A;  2EMT A;  4HB4 B;  4L6E A;  2M14 A;  2ELB A;  5J3Q A;  1NTV A;  3GYO A;  2LOZ A;  3FSS A;  2D9X A;  4WSF A;  2IFS A;  2D11 A;  1U5G A;  1V88 A;  3NSU A;  1GG3 A;  3MPX A;  3ML4 A;  1BTK A;  2Y8F A;  1Y5O A;  3ZVR A;  2DKQ A;  3AU4 A;  4XWX A;  1EVH A;  3MDB C;  2DYN A;  2DYQ A;  2XQN M;  4ZRI A;  2Y8G A;  3D8F A;  4F7H A;  2CY4 A;  1XX0 A;  2MKR A;  2RUK B;  1W1H A;  4GPT B;  1UNP A;  1DRO A;  2G35 A;  3ULC A;  1P5T A;  3QBV B;  5HE0 A;  4Z2N A;  1EGX A;  2GCL A;  3VIA A;  1U2B A;  2Y7B A;  4KHB B;  3UZT A;  5DIF B;  4F7U P;  1WGQ A;  2EMS A;  4H8S A;  3A98 B;  2YT0 A;  2RGN B;  3RCP A;  2COF A;  1K5D B;  3PEG A;  2D9Z A;  3PVU A;  1SGH A;  1WVH A;  2DHI A;  1E5W A;  4ZRJ A;  3F0W A;  4IAP A;  4HAZ B;  1ZC3 B;  2NMB A;  3WA0 A;  1TXD A;  2I1K A;  4Y94 A;  3X23 A;  1X11 A;  1UEF A;  3G9W A;  4GXB A;  4D0N B;  1KZ7 A;  1M7R A;  4WVF B;  4HAY B;  3IVF A;  1H10 A;  1FHX A;  3TCA A;  3N7C A;  1MK9 B;  4EJN A;  2DKP A;  4MY6 A;  1V5M A;  2DLW A;  5CLQ B;  4DXA B;  1XR0 B;  2KGX B;  3HQC A;  3AU5 A;  1PLS A;  2ROV A;  1EF1 A;  1X1F A;  1I7A A;  3ZDT A;  1LW3 A;  1TQZ A;  5HE3 A;  4A5K A;  3SV1 A;  3FM8 C;  1FHW A;  1FHO A;  4IFS A;  2LOX A;  1GC6 A;  2E2X A;  1WJ1 A;  2YS5 A;  4CYE A;  5D27 A;  2K2J A;  2YF0 A;  1N3H A;  1UPR A;  2ELA A;  2PZ1 A;  2JP2 A;  1WJM A;  2D10 A;  2D9W A;  1GC7 A;  3KSY A;  3DXC A;  2OQB A;  2J0M A;  5JHG A;  2YRY A;  3KZ1 A;  1QC6 A;  3U8Z A;  5JHH A;  3LJU X;  4HB0 B;  2VRW B;  2HE7 A;  1LB1 A;  1V61 A;  2ADZ A;  2RSG A;  1V5P A;  3A8P A;  3M1I B;  1FOE A;  1ISN A;  5J3Y A;  3BJI A;  2D2Q A;  2COA A;  2MWN B;  4EMO A;  4MT7 A;  3V5W A;  2P0D A;  4HB2 B;  2LUL A;  3SO6 A;  4K17 A;  2FJL A;  3A8Q A;  3ODW A;  4TKN A;  2CRF A;  4GMX B;  2KCJ A;  1UNQ A;  2AEH A;  4HAT B;  2DN6 A;  1ZC4 B;  2N0Y A;  1AWE A;  1FGZ A;  2RLO A;  3SYX A;  5D3Y A;  2COD A;  2P8V A;  1UPQ A;  3O96 A;  4A6H A;  5C79 A;  5KQ4 A;  2X18 A;  2I1J A;  1X86 A;  5LON B;  1Q67 A;  1MK7 B;  2YS3 A;  1OQN A;  3DXE A;  1UNR A;  3AJ4 A;  4K81 A;  1U5F A;  3ODX A;  3KRX A;  1W1D A;  2H7E A;  1EAZ A;  5EFX A;  1X05 A;  2LKO A;  1RJ2 A;  1FB8 A;  5FI0 A;  1ZSQ A;  2D9Y A;  4GMV A;  1WG7 A;  1PFJ A;  2YVC A;  1U5E A;  5C5B A;  1J0W A;  3GYP A;  2J0K A;  1U29 A;  3CIK A;  4HAV B;  3SNH A;  1H4R A;  3PSC A;  1P6S A;  2CAY A;  2J59 M;  3U7D A;  1AQC A;  1IRS A;  2I5C A;  1MKE A;  4K2P A;  1NU2 A;  2EJ8 A;  2DHJ A;  4HAU B;  4KVG B;  2YS1 A;  4CHJ A;  3P7Z A;  5DI9 B;  5DH9 B;  2LG1 A;  1BWN A;  2ZPY A;  2COC A;  4A6K A;  2L2I A;  2MDX A;  4KHA A;  4YL8 A;  5GOW B;  2CY5 A;  3PZD A;  1P3R A;  1MAI A;  2LYD A;  4HDO A;  1ZM0 A;  4Z2M B;  2DTC A;  2DHK A;  2YSZ A;  2V76 A;  1TJ6 A;  4DBB A;  2YT1 A;  3CXB B;  1B55 A;  1RRP B;  2R09 A;  1KZG A;  2IYB A;  2OTX A;  3FEH A;  2K2U A;  1XKE A;  2VSZ A;  1DDW A;  3WYF B;  3VOQ A;  5DHA B;  1NTY A;  1DDV A;  1V5U A;  1DBH A;  1QQG A;  3ODO A;  2RVB B;  4TYZ A;  2GJY A;  2QKL A;  3HK0 A;  3ULB A;  3QWM A;  4NSW A;  5HE1 A;  5DHF B;  2DA0 A;  5C6R A;  1J19 A;  1SHC A;  4IOY X;  4WJ7 A;  4HDQ A;  4MK0 A;  2KUP A;  3QIJ A;  2K00 A;  1ZVR A;  2BCJ A;  3PVW A;  1WI1 A;  1FGY A; 
#chains in the Genus database with same CATH topology
 1DYN A;  1KI1 B;  2W2X D;  4GZU A;  3PVL A;  1V89 A;  1W1G A;  2Z0Q A;  2MFQ A;  4HAW B;  5KCV A;  2K8E A;  2H7D A;  4K2O A;  1M7E A;  3TW1 A;  3KRW A;  5JP4 A;  2GS0 A;  2ROZ B;  5LOP B;  2P0F A;  1MPH A;  1XD4 A;  1XCG A;  2R2Y A;  2Z4D A;  1I2H A;  1WGU A;  3KY9 A;  4HHV A;  2Z0O A;  3DXD A;  2I5F A;  2P0H A;  1X1G A;  2Z0P A;  2L1C A;  2HTH B;  5KQ1 A;  2DX1 A;  3HW2 B;  3NWF A;  5CLL B;  5D3W A;  1MIX A;  2J0J A;  2UVM A;  3TO1 A;  5I2S A;  2QKM A;  3D8D A;  5C16 A;  1DDM A;  3F5R A;  4C0A A;  5FI1 A;  4D6W A;  2N23 A;  3T06 A;  4F7G A;  2AL6 A;  2M38 A;  2RNR B;  1FAO A;  5C5B B;  2Q13 A;  5L81 A;  4P7I A;  4BBK A;  3OAN A;  4EKU A;  3NW8 A;  5D3X A;  2NBV A;  3SUZ A;  2W2X C;  3TVV A;  2VKI A;  1OY2 A;  3P6A A;  1Y19 B;  4B6H A;  2DFK A;  1PMS A;  4A6F B;  4QJ3 B;  1U5D A;  3B77 A;  4ZRK A;  1BAK A;  1MIZ B;  3BIN A;  2DX5 A;  2R0D A;  4DX8 A;  1MI1 A;  2EC1 A;  4KAX B;  3PP2 A;  3DCX A;  5D3V A;  1OMW A;  3TFM A;  2UZS A;  2D9V A;  1XOD A;  4KHO A;  4QJ5 B;  4YON A;  2D4Q A;  5JLJ B;  5HE2 A;  4A6F A;  4CHM A;  4DX9 0;  1U27 A;  1Z87 A;  1BTN A;  2KIE A;  4HAX B;  2NZ8 B;  2GCJ A;  2W2W A;  4PNK A;  3D8E A;  4QJ4 B;  5LG4 B;  4PQ0 A;  5J3T A;  4GN1 A;  4NY0 A;  4HB3 B;  3PG7 A;  1K5G B;  2UZR A;  1NI2 A;  2EMT A;  4HB4 B;  4L6E A;  2M14 A;  2ELB A;  5J3Q A;  1NTV A;  3GYO A;  2LOZ A;  3FSS A;  3OHM B;  2D9X A;  4WSF A;  2IFS A;  2D11 A;  1U5G A;  1V88 A;  3NSU A;  1GG3 A;  3MPX A;  3ML4 A;  2RRF A;  1BTK A;  2Y8F A;  1Y5O A;  2Z14 A;  3ZVR A;  2DKQ A;  3AU4 A;  4XWX A;  1EVH A;  2KR0 A;  3MDB C;  2DYN A;  2DYQ A;  2XQN M;  4ZRI A;  2Y8G A;  3D8F A;  4F7H A;  2CY4 A;  1XX0 A;  2Z59 A;  2MKR A;  2RUK B;  2K49 A;  1W1H A;  2YT2 A;  4GPT B;  1UNP A;  1DRO A;  2G35 A;  3ULC A;  1P5T A;  3QBV B;  5HE0 A;  4Z2N A;  1EGX A;  2GCL A;  3VIA A;  1U2B A;  2Y7B A;  4KHB B;  3UZT A;  5DIF B;  4F7U P;  1WGQ A;  2EMS A;  4H8S A;  3A98 B;  2YT0 A;  2RGN B;  3RCP A;  2COF A;  1K5D B;  3PEG A;  2D9Z A;  3PVU A;  1SGH A;  1WVH A;  2DHI A;  1ZYI A;  1E5W A;  4ZRJ A;  3U12 A;  3F0W A;  4IAP A;  4HAZ B;  1ZC3 B;  2NMB A;  3WA0 A;  1TXD A;  2I1K A;  4Y94 A;  2FJU B;  2ZKM X;  3X23 A;  1X11 A;  1UEF A;  3G9W A;  4GXB A;  4D0N B;  1KZ7 A;  1M7R A;  4WVF B;  4HAY B;  3HIE A;  3IVF A;  1H10 A;  1FHX A;  3TCA A;  3N7C A;  1MK9 B;  4EJN A;  2DKP A;  4MY6 A;  4KHB A;  1V5M A;  2DLW A;  5CLQ B;  4DXA B;  1XR0 B;  2KGX B;  3HQC A;  3AU5 A;  1PLS A;  2ROV A;  1EF1 A;  1X1F A;  1I7A A;  3ZDT A;  1LW3 A;  1TQZ A;  5HE3 A;  4A5K A;  3SV1 A;  3FM8 C;  1FHW A;  1FHO A;  4IFS A;  2LOX A;  1GC6 A;  2E2X A;  1WJ1 A;  2YS5 A;  4CYE A;  5D27 A;  2K2J A;  3A58 A;  2YF0 A;  1N3H A;  1UPR A;  2ELA A;  2PZ1 A;  2JP2 A;  1WJM A;  2D10 A;  2D9W A;  1GC7 A;  4L1R A;  3KSY A;  3DXC A;  2GUM A;  2OQB A;  2J0M A;  5JHG A;  2YRY A;  3KZ1 A;  1QC6 A;  3U8Z A;  5JHH A;  3LJU X;  4HB0 B;  2VRW B;  2HE7 A;  1LB1 A;  1V61 A;  2ADZ A;  2RSG A;  1V5P A;  3A8P A;  3M1I B;  1FOE A;  1ISN A;  5J3Y A;  3BJI A;  2D2Q A;  2COA A;  2MWN B;  4EMO A;  4MT7 A;  3V5W A;  2P0D A;  4HB2 B;  2LUL A;  3SO6 A;  4K17 A;  2FJL A;  3A8Q A;  3ODW A;  4QXA B;  4TKN A;  2CRF A;  4GMX B;  4CSQ A;  2KCJ A;  1UNQ A;  2AEH A;  4HAT B;  2DN6 A;  1ZC4 B;  3NWD A;  5M4Y B;  2N0Y A;  1AWE A;  1FGZ A;  2RLO A;  3SYX A;  5D3Y A;  2COD A;  2P8V A;  1UPQ A;  3O96 A;  4A6H A;  5C79 A;  5KQ4 A;  2X18 A;  2I1J A;  1X86 A;  5LON B;  1Q67 A;  1MK7 B;  3FVC A;  2YS3 A;  1OQN A;  3DXE A;  1UNR A;  3AJ4 A;  4K81 A;  1U5F A;  3ODX A;  3KRX A;  1W1D A;  2H7E A;  2KIG A;  1EAZ A;  5IRS A;  5EFX A;  1X05 A;  2LKO A;  3HSA A;  1RJ2 A;  1FB8 A;  5FI0 A;  1ZSQ A;  2D9Y A;  4GMV A;  1WG7 A;  1PFJ A;  2YVC A;  1U5E A;  5C5B A;  1J0W A;  3GYP A;  2J0K A;  1U29 A;  3CIK A;  4HAV B;  3SNH A;  1H4R A;  3PSC A;  1P6S A;  2CAY A;  2J59 M;  3U7D A;  1AQC A;  1IRS A;  2I5C A;  1MKE A;  4K2P A;  1NU2 A;  2EJ8 A;  2DHJ A;  4HAU B;  5I2M A;  4KVG B;  2YS1 A;  4CHJ A;  3P7Z A;  5DI9 B;  3NWA A;  5DH9 B;  2LG1 A;  1BWN A;  2ZPY A;  2COC A;  4A6K A;  2L2I A;  2MDX A;  4KHA A;  4YL8 A;  5GOW B;  2CY5 A;  3PZD A;  1P3R A;  4GOU A;  1MAI A;  2LYD A;  4HDO A;  1ZM0 A;  4Z2M B;  2DTC A;  2DHK A;  2YSZ A;  2V76 A;  1TJ6 A;  4DBB A;  2YT1 A;  3CXB B;  1B55 A;  2KUQ A;  1RRP B;  2Z13 A;  2R09 A;  1KZG A;  2IYB A;  4HSI A;  2OTX A;  3FEH A;  2K2U A;  1XKE A;  2VSZ A;  1DDW A;  3WYF B;  3VOQ A;  5DHA B;  1NTY A;  1DDV A;  1V5U A;  4OSN A;  1DBH A;  4DIX A;  1QQG A;  3ODO A;  2RVB B;  4TYZ A;  2GJY A;  2QKL A;  3HK0 A;  3ULB A;  3QWM A;  4NSW A;  5HE1 A;  1T77 A;  5DHF B;  2DA0 A;  5C6R A;  1J19 A;  1SHC A;  4IOY X;  4OT1 A;  4WJ7 A;  4GNK B;  4HDQ A;  4MK0 A;  2KUP A;  3QIJ A;  2K00 A;  1ZVR A;  2BCJ A;  3PVW A;  1WI1 A;  1FGY A; 
#chains in the Genus database with same CATH homology
 1DYN A;  1KI1 B;  2W2X D;  4GZU A;  3PVL A;  1V89 A;  1W1G A;  2Z0Q A;  2MFQ A;  4HAW B;  5KCV A;  2H7D A;  4K2O A;  1M7E A;  3TW1 A;  3KRW A;  5JP4 A;  2GS0 A;  2ROZ B;  5LOP B;  2P0F A;  1MPH A;  1XD4 A;  1XCG A;  1I2H A;  1WGU A;  3KY9 A;  4HHV A;  2Z0O A;  3DXD A;  2I5F A;  2P0H A;  1X1G A;  2Z0P A;  2L1C A;  2HTH B;  5KQ1 A;  2DX1 A;  3HW2 B;  5CLL B;  5D3W A;  1MIX A;  2J0J A;  2UVM A;  3TO1 A;  2QKM A;  3D8D A;  5C16 A;  1DDM A;  3F5R A;  4C0A A;  5FI1 A;  2N23 A;  3T06 A;  4F7G A;  2AL6 A;  2M38 A;  2RNR B;  1FAO A;  5C5B B;  2Q13 A;  5L81 A;  4P7I A;  4BBK A;  3OAN A;  4EKU A;  5D3X A;  3SUZ A;  2W2X C;  3TVV A;  2VKI A;  1OY2 A;  3P6A A;  1Y19 B;  4B6H A;  2DFK A;  1PMS A;  4A6F B;  1U5D A;  4ZRK A;  1BAK A;  1MIZ B;  3BIN A;  2DX5 A;  2R0D A;  4DX8 A;  2EC1 A;  4KAX B;  3PP2 A;  5D3V A;  1OMW A;  3TFM A;  2UZS A;  2D9V A;  1XOD A;  4KHO A;  4YON A;  2D4Q A;  5JLJ B;  5HE2 A;  4A6F A;  4CHM A;  4DX9 0;  1U27 A;  1Z87 A;  1BTN A;  4HAX B;  2NZ8 B;  2GCJ A;  2W2W A;  4PNK A;  3D8E A;  4PQ0 A;  5J3T A;  4GN1 A;  4NY0 A;  4HB3 B;  1K5G B;  3PG7 A;  2UZR A;  1NI2 A;  2EMT A;  4HB4 B;  4L6E A;  2M14 A;  2ELB A;  5J3Q A;  1NTV A;  3GYO A;  2LOZ A;  3FSS A;  2D9X A;  4WSF A;  2IFS A;  2D11 A;  1U5G A;  1V88 A;  3NSU A;  1GG3 A;  3MPX A;  3ML4 A;  1BTK A;  2Y8F A;  1Y5O A;  3ZVR A;  2DKQ A;  3AU4 A;  4XWX A;  1EVH A;  3MDB C;  2DYN A;  2DYQ A;  2XQN M;  4ZRI A;  2Y8G A;  3D8F A;  4F7H A;  2CY4 A;  1XX0 A;  2MKR A;  2RUK B;  1W1H A;  4GPT B;  1UNP A;  1DRO A;  2G35 A;  3ULC A;  1P5T A;  3QBV B;  5HE0 A;  4Z2N A;  1EGX A;  2GCL A;  3VIA A;  1U2B A;  2Y7B A;  4KHB B;  3UZT A;  5DIF B;  4F7U P;  1WGQ A;  2EMS A;  4H8S A;  3A98 B;  2YT0 A;  2RGN B;  3RCP A;  2COF A;  1K5D B;  3PEG A;  2D9Z A;  3PVU A;  1SGH A;  1WVH A;  2DHI A;  1E5W A;  4ZRJ A;  3F0W A;  4IAP A;  4HAZ B;  1ZC3 B;  2NMB A;  3WA0 A;  1TXD A;  2I1K A;  4Y94 A;  3X23 A;  1X11 A;  1UEF A;  3G9W A;  4GXB A;  4D0N B;  1KZ7 A;  1M7R A;  4WVF B;  4HAY B;  3IVF A;  1H10 A;  1FHX A;  3TCA A;  3N7C A;  1MK9 B;  4EJN A;  2DKP A;  4MY6 A;  1V5M A;  2DLW A;  5CLQ B;  4DXA B;  1XR0 B;  2KGX B;  3HQC A;  3AU5 A;  1PLS A;  2ROV A;  1EF1 A;  1X1F A;  1I7A A;  3ZDT A;  1LW3 A;  1TQZ A;  5HE3 A;  4A5K A;  3SV1 A;  3FM8 C;  1FHW A;  1FHO A;  4IFS A;  2LOX A;  1GC6 A;  2E2X A;  1WJ1 A;  2YS5 A;  4CYE A;  5D27 A;  2K2J A;  2YF0 A;  1N3H A;  1UPR A;  2ELA A;  2PZ1 A;  2JP2 A;  1WJM A;  2D10 A;  2D9W A;  1GC7 A;  3KSY A;  3DXC A;  2OQB A;  2J0M A;  5JHG A;  2YRY A;  3KZ1 A;  1QC6 A;  3U8Z A;  5JHH A;  3LJU X;  4HB0 B;  2VRW B;  2HE7 A;  1LB1 A;  1V61 A;  2ADZ A;  2RSG A;  1V5P A;  3A8P A;  3M1I B;  1FOE A;  1ISN A;  5J3Y A;  3BJI A;  2D2Q A;  2COA A;  2MWN B;  4EMO A;  4MT7 A;  3V5W A;  2P0D A;  4HB2 B;  2LUL A;  3SO6 A;  4K17 A;  2FJL A;  3A8Q A;  3ODW A;  4TKN A;  2CRF A;  4GMX B;  2KCJ A;  1UNQ A;  2AEH A;  4HAT B;  2DN6 A;  1ZC4 B;  2N0Y A;  1AWE A;  1FGZ A;  2RLO A;  3SYX A;  5D3Y A;  2COD A;  2P8V A;  1UPQ A;  3O96 A;  4A6H A;  5C79 A;  5KQ4 A;  2X18 A;  2I1J A;  1X86 A;  5LON B;  1Q67 A;  1MK7 B;  2YS3 A;  1OQN A;  3DXE A;  1UNR A;  3AJ4 A;  4K81 A;  1U5F A;  3ODX A;  3KRX A;  1W1D A;  2H7E A;  1EAZ A;  5EFX A;  1X05 A;  2LKO A;  1RJ2 A;  1FB8 A;  5FI0 A;  1ZSQ A;  2D9Y A;  4GMV A;  1WG7 A;  1PFJ A;  2YVC A;  1U5E A;  5C5B A;  1J0W A;  3GYP A;  2J0K A;  1U29 A;  3CIK A;  4HAV B;  3SNH A;  1H4R A;  3PSC A;  1P6S A;  2CAY A;  2J59 M;  3U7D A;  1AQC A;  1IRS A;  2I5C A;  1MKE A;  4K2P A;  1NU2 A;  2EJ8 A;  2DHJ A;  4HAU B;  4KVG B;  2YS1 A;  4CHJ A;  3P7Z A;  5DI9 B;  5DH9 B;  2LG1 A;  1BWN A;  2ZPY A;  2COC A;  4A6K A;  2L2I A;  2MDX A;  4KHA A;  4YL8 A;  5GOW B;  2CY5 A;  3PZD A;  1P3R A;  1MAI A;  2LYD A;  4HDO A;  1ZM0 A;  4Z2M B;  2DTC A;  2DHK A;  2YSZ A;  2V76 A;  1TJ6 A;  4DBB A;  2YT1 A;  3CXB B;  1B55 A;  1RRP B;  2R09 A;  1KZG A;  2IYB A;  2OTX A;  3FEH A;  2K2U A;  1XKE A;  2VSZ A;  1DDW A;  3WYF B;  3VOQ A;  5DHA B;  1NTY A;  1DDV A;  1V5U A;  1DBH A;  1QQG A;  3ODO A;  2RVB B;  4TYZ A;  2GJY A;  2QKL A;  3HK0 A;  3ULB A;  3QWM A;  4NSW A;  5HE1 A;  5DHF B;  2DA0 A;  5C6R A;  1J19 A;  1SHC A;  4IOY X;  4WJ7 A;  4HDQ A;  4MK0 A;  2KUP A;  3QIJ A;  2K00 A;  1ZVR A;  2BCJ A;  3PVW A;  1WI1 A;  1FGY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...