1V5PA

Solution structure of the n-terminal pleckstrin homology domain of tapp2 from mouse
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
126
structure length
126
Chain Sequence
GSSGSSGMPYVDRQNRICGFLDIEDNENSGKFLRRYFILDTQANCLLWYMDNPQNLAVGAGAVGSLQLTYISKVSIATPKQKPKTPFCFVINALSQRYFLQANDQKDLKDWVEALNQASKSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords pleckstrin homology domain-containing, family A
publication title Solution Structure of the N-terminal Pleckstrin Homology Domain Of TAPP2 from Mouse
rcsb
source organism Mus musculus
total genus 13
structure length 126
sequence length 126
ec nomenclature
pdb deposition date 2003-11-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00169 PH PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1v5pA01
3QBVB 2L1CA 1OMWA 1MK9B 3LJUX 1I2HA 2D10A 2RUKB 4WJ7A 1U5FA 2COAA 4MT7A 1DROA 3DXDA 4GPTB 4KHAA 1U27A 1X1FA 3GYPA 2MKRA 5HE0A 1XCGA 1KI1B 1DBHA 1I7AA 3NSUA 3DXEA 1K5DB 2Z0QA 4D0NB 4ZRKA 5D3YA 3SUZA 1GG3A 2FJLA 1NU2A 1SHCA 3ODXA 2ELAA 1FGZA 5JHHA 1UNQA 4HDQA 2RLOA 1Y19B 4HHVA 4KVGB 3X23A 2IFSA 2DHKA 5GOWB 5J3TA 4A5KA 1P3RA 4EKUA 1U29A 2YT1A 4CHMA 1LW3A 1XD4A 1Q67A 3U7DA 3F0WA 1XR0B 5D3XA 2IYBA 1N3HA 5JHGA 5DHAB 5LONB 1DDWA 3WYFB 2NMBA 4GXBA 4DXAB 1H10A 3BINA 1DYNA 2CRFA 3FEHA 3GYOA 1V5MA 1MPHA 1FB8A 1K5GB 2YF0A 3U8ZA 2RNRB 1WGQA 5KQ1A 2W2XC 2D9XA 2Q13A 1X11A 2YSZA 1W1GA 4ZRJA 3TW1A 1XKEA 1WJ1A 2D9WA 2YT0A 3DXCA 2ZPYA 1J0WA 4Z2MB 1AWEA 5J3QA 5CLQB 2N23A 3PVLA 4K2PA 4HDOA 1E5WA 4K17A 2H7EA 1NTVA 1EF1A 2Y8GA 4HAWB 4HAYB 5JP4A 1MIZB 2LKOA 4A6FA 2L2IA 2KGXB 4KHBB 1UPRA 1X05A 3IVFA 1V89A 3D8DA 2CAYA 2G35A 5C79A 4EJNA 2K2UA 1BAKA 3WA0A 2Z0PA 3HQCA 1U2BA 4B6HA 1OY2A 4GMXB 5C5BA 4HATB 1MAIA 4YONA 4NSWA 4HAVB 2K2JA 5HE2A 3ZVRA 3VIAA 4PQ0A 1V5UA 2EMSA 1FHXA 2LOZA 1IRSA 1ZVRA 5J3YA 3PEGA 3ML4A 3ULCA 3M1IB 2BCJA 2H7DA 2VSZA 2EMTA 1U5EA 2DTCA 2DYNA 3PVUA 1PFJA 1M7EA 1ZM0A 2UZRA 3KSYA 2D9ZA 3OANA 5JLJB 1QC6A 1GC7A 3AU4A 2I5CA 1KZGA 3ODOA 2MDXA 1WGUA 4L6EA 4HB2B 3KRWA 3T06A 4TKNA 1ZSQA 2I1JA 1B55A 1U5GA 2CY4A 2RSGA 4KHOA 3PZDA 2YVCA 2QKLA 3F5RA 2NZ8B 1V61A 2KCJA 1SGHA 2J0KA 2DKQA 4KAXB 4DBBA 2ELBA 5DH9B 3TFMA 1ISNA 1UPQA 5KCVA 4HB3B 4GZUA 2LG1A 3V5WA 1AQCA 3MPXA 2R0DA 2RVBB 2UZSA 5D3VA 2D4QA 4HB0B 4Z2NA 2DHJA 2DA0A 2W2XD 4K2OA 2J0MA 2LOXA 4IFSA 5DHFB 3VOQA 4GN1A 3FSSA 1ZC4B 4PNKA 2UVMA 2HE7A 3AU5A 3SYXA 1UEFA 3ZDTA 1M7RA 1BTNA 2R09A 1U5DA 1WG7A 4DX90 1FOEA 3ODWA 1MIXA 1FHOA 4MK0A 2YS5A 3AJ4A 2M38A 2MWNB 2ROVA 2W2WA 4A6FB 1FHWA 2GCLA 4C0AA 5HE3A 1P6SA 2I5FA 2AEHA 4WSFA 1PMSA 1XODA 2D2QA 1DDMA 1PLSA 2YS3A 3TVVA 4K81A 1W1DA 3A98B 4DX8A 1OQNA 4XWXA 5FI1A 2LULA 3QIJA 5DIFB 1NI2A 4HB4B 2P0HA 4CYEA 1RJ2A 3CXBB 2J0JA 1FGYA 2Y8FA 1EGXA 4HAXB 3KZ1A 3HW2B 3N7CA 2VRWB 3BJIA 4GMVA 5L81A 2YS1A 2LYDA 5D27A 4P7IA 2JP2A 3P7ZA 1KZ7A 1V88A 4YL8A 1RRPB 1EVHA 2RGNB 2VKIA 1Y5OA 1TJ6A 2DX5A 1MK7B 3SV1A 2COFA 2HTHB 1W1HA 2E2XA 1GC6A 4EMOA 1ZC3B 2DLWA 2GS0A 3KY9A 3P6AA 2DN6A 1EAZA 4MY6A 5HE1A 2DFKA 2P0DA 4NY0A 2CODA 2AL6A 2ADZA 1BTKA 3TCAA 5KQ4A 3RCPA 2D9VA 5CLLB 4WVFB 1UNPA 1P5TA 4F7HA 3O96A 3SO6A 2PZ1A 3A8PA 2Z0OA 2EC1A 4ZRIA 4TYZA 1MKEA 3D8EA 1V5PA 3FM8C 3SNHA 2MFQA 1WJMA 1UNRA 2XQNM 1X1GA 5EFXA 2I1KA 1FAOA 4HAZB 2N0YA 3MDBC 3D8FA 3PP2A 1J19A 2V76A 2GJYA 3PSCA 5LOPB 5FI0A 4H8SA 4Y94A 2GCJA 2DKPA 2DYQA 5DI9B 2D11A 2X18A 1X86A 2P0FA 4BBKA 2EJ8A 4F7UP 2J59M 2M14A 3G9WA 1TXDA 2Y7BA 3TO1A 1BWNA 2CY5A 2OQBA 1QQGA 1WI1A 2DX1A 3HK0A 3ULBA 1Z87A 2K00A 2YRYA 4IAPA 5D3WA 3QWMA 4A6KA 4F7GA 5C6RA 4IOYX 2DHIA 2OTXA 4HAUB 1NTYA 1DDVA 3UZTA 2QKMA 1XX0A 5C16A 2ROZB 2COCA 3A8QA 2P8VA 3KRXA 3CIKA 2KUPA 1WVHA 3PG7A 5C5BB 3PVWA 1LB1A 1H4RA 4CHJA 2D9YA 4A6HA 1TQZA
chains in the Genus database with same CATH superfamily
3QBVB 2L1CA 1OMWA 1MK9B 3LJUX 1I2HA 2D10A 2RUKB 4WJ7A 4CSQA 1U5FA 2COAA 4MT7A 1DROA 3DXDA 4GPTB 5I2MA 4KHAA 1U27A 1X1FA 3GYPA 2MKRA 5HE0A 1XCGA 1KI1B 1DBHA 1I7AA 3NSUA 3DXEA 1K5DB 2Z0QA 4D0NB 4ZRKA 5D3YA 3SUZA 1GG3A 2FJLA 5LG4B 1SHCA 1NU2A 3ODXA 2ELAA 1FGZA 5JHHA 1UNQA 4HDQA 2K49A 2RLOA 1Y19B 4HHVA 4KVGB 3X23A 2KR0A 2IFSA 2DHKA 3HIEA 5GOWB 5J3TA 3NW8A 4A5KA 1P3RA 4EKUA 1U29A 2YT1A 4CHMA 1LW3A 1XD4A 1Q67A 3U7DA 3F0WA 1XR0B 5D3XA 2IYBA 1N3HA 5JHGA 5DHAB 5LONB 1DDWA 3WYFB 2NMBA 4GXBA 4DXAB 1H10A 3BINA 1DYNA 2CRFA 3FEHA 3GYOA 1V5MA 1MPHA 1FB8A 1K5GB 2YF0A 3U8ZA 4DIXA 2RNRB 1WGQA 5KQ1A 2NBVA 2FJUB 2W2XC 2D9XA 2Q13A 1X11A 2YSZA 1W1GA 4ZRJA 3TW1A 1XKEA 1WJ1A 2D9WA 2YT0A 3DXCA 2ZPYA 1J0WA 4Z2MB 1AWEA 5J3QA 5CLQB 2N23A 3PVLA 4K2PA 4HDOA 2Z13A 2R2YA 1E5WA 4K17A 5I2SA 2H7EA 1NTVA 1EF1A 2Y8GA 4HAWB 4HAYB 5JP4A 1MIZB 2LKOA 4A6FA 2L2IA 2KGXB 4KHBB 1UPRA 1X05A 3IVFA 1V89A 3D8DA 2CAYA 2G35A 5C79A 4EJNA 2K2UA 1ZYIA 1BAKA 4QJ5B 3WA0A 2Z0PA 3HQCA 4QXAB 1U2BA 4B6HA 1OY2A 2YT2A 4GMXB 5C5BA 5M4YB 4HATB 1MAIA 4YONA 4NSWA 4HAVB 2K2JA 5HE2A 3ZVRA 4OT1A 4PQ0A 1V5UA 4L1RA 3VIAA 2EMSA 1FHXA 2LOZA 1IRSA 1ZVRA 5J3YA 3PEGA 3ML4A 2Z4DA 3ULCA 3M1IB 2BCJA 2H7DA 4OSNA 2VSZA 2EMTA 1U5EA 2DTCA 2DYNA 3PVUA 1PFJA 1M7EA 1ZM0A 2UZRA 3KSYA 2D9ZA 3OANA 5JLJB 2ZKMX 1QC6A 1GC7A 3AU4A 2I5CA 1KZGA 3DCXA 3ODOA 2MDXA 1WGUA 4L6EA 4HB2B 3KRWA 3T06A 4TKNA 1ZSQA 2I1JA 1B55A 1U5GA 2CY4A 2RSGA 4KHOA 3PZDA 2YVCA 2RRFA 2QKLA 4QJ3B 3F5RA 2NZ8B 1V61A 2KCJA 1SGHA 2J0KA 2DKQA 4KAXB 4DBBA 2ELBA 5DH9B 3TFMA 1ISNA 1UPQA 5KCVA 4HB3B 4GZUA 2LG1A 3V5WA 1AQCA 3MPXA 2R0DA 2RVBB 2UZSA 5D3VA 2Z59A 2D4QA 4HB0B 3B77A 4Z2NA 2DHJA 2DA0A 2W2XD 4K2OA 2J0MA 2LOXA 5IRSA 3HSAA 4IFSA 5DHFB 3VOQA 4GN1A 3FSSA 1ZC4B 4PNKA 2UVMA 3OHMB 2HE7A 3AU5A 3SYXA 1UEFA 3ZDTA 1M7RA 1BTNA 2R09A 1U5DA 4GOUA 1WG7A 4DX90 1FOEA 3ODWA 1MIXA 1FHOA 4MK0A 2YS5A 3AJ4A 2M38A 2MWNB 2ROVA 2W2WA 4A6FB 1FHWA 2GCLA 4C0AA 5HE3A 1P6SA 2I5FA 4KHBA 2AEHA 4WSFA 1PMSA 1XODA 2D2QA 1DDMA 1PLSA 2YS3A 3TVVA 4K81A 1W1DA 3A98B 4DX8A 1OQNA 4XWXA 3U12A 5FI1A 2LULA 3QIJA 5DIFB 1NI2A 4HB4B 2P0HA 4CYEA 1RJ2A 3CXBB 1MI1A 2J0JA 3A58A 1FGYA 2Y8FA 1EGXA 4HAXB 3KZ1A 3HW2B 3N7CA 2VRWB 3BJIA 4GMVA 5L81A 2YS1A 2LYDA 5D27A 4P7IA 2JP2A 3P7ZA 1KZ7A 1V88A 4YL8A 1RRPB 1EVHA 2RGNB 2VKIA 2K8EA 1Y5OA 1TJ6A 2DX5A 1MK7B 3SV1A 2COFA 2HTHB 1W1HA 2E2XA 1GC6A 4EMOA 1ZC3B 2DLWA 2GS0A 3KY9A 3P6AA 2DN6A 1EAZA 1T77A 4MY6A 5HE1A 2DFKA 2KIEA 2P0DA 4NY0A 2CODA 4D6WA 2AL6A 2ADZA 1BTKA 3TCAA 5KQ4A 3RCPA 3NWDA 2D9VA 5CLLB 4WVFB 1UNPA 1P5TA 2KIGA 3NWAA 4F7HA 3O96A 3SO6A 2PZ1A 3A8PA 2Z0OA 2EC1A 4ZRIA 4TYZA 1MKEA 3D8EA 1V5PA 3FM8C 3SNHA 2MFQA 1WJMA 1UNRA 2XQNM 1X1GA 5EFXA 2I1KA 4QJ4B 1FAOA 4HAZB 2N0YA 3MDBC 3D8FA 3PP2A 3NWFA 1J19A 2V76A 2GJYA 3PSCA 5LOPB 5FI0A 4H8SA 4Y94A 2GCJA 2DKPA 2DYQA 2GUMA 5DI9B 2D11A 2X18A 1X86A 2P0FA 4BBKA 2EJ8A 4F7UP 2J59M 2M14A 3G9WA 1TXDA 2Y7BA 3TO1A 2Z14A 1BWNA 2CY5A 2OQBA 1QQGA 1WI1A 2DX1A 3HK0A 3ULBA 1Z87A 2K00A 3FVCA 2YRYA 4IAPA 5D3WA 2KUQA 3QWMA 4A6KA 4F7GA 5C6RA 4IOYX 2DHIA 2OTXA 4HAUB 1NTYA 4HSIA 1DDVA 4GNKB 2QKMA 3UZTA 1XX0A 5C16A 2ROZB 2COCA 3A8QA 2P8VA 3KRXA 3CIKA 2KUPA 1WVHA 3PG7A 5C5BB 3PVWA 1LB1A 1H4RA 4CHJA 2D9YA 4A6HA 1TQZA
chains in the Genus database with same CATH topology
3QBVB 2L1CA 1OMWA 1MK9B 3LJUX 1I2HA 2D10A 2RUKB 4WJ7A 1U5FA 2COAA 4MT7A 1DROA 3DXDA 4GPTB 4KHAA 1U27A 1X1FA 3GYPA 2MKRA 5HE0A 1XCGA 1KI1B 1DBHA 1I7AA 3NSUA 3DXEA 1K5DB 2Z0QA 4D0NB 4ZRKA 5D3YA 3SUZA 1GG3A 2FJLA 1NU2A 1SHCA 3ODXA 2ELAA 1FGZA 5JHHA 1UNQA 4HDQA 2RLOA 1Y19B 4HHVA 4KVGB 3X23A 2IFSA 2DHKA 5GOWB 5J3TA 4A5KA 1P3RA 4EKUA 1U29A 2YT1A 4CHMA 1LW3A 1XD4A 1Q67A 3U7DA 3F0WA 1XR0B 5D3XA 2IYBA 1N3HA 5JHGA 5DHAB 5LONB 1DDWA 3WYFB 2NMBA 4GXBA 4DXAB 1H10A 3BINA 1DYNA 2CRFA 3FEHA 3GYOA 1V5MA 1MPHA 1FB8A 1K5GB 2YF0A 3U8ZA 2RNRB 1WGQA 5KQ1A 2W2XC 2D9XA 2Q13A 1X11A 2YSZA 1W1GA 4ZRJA 3TW1A 1XKEA 1WJ1A 2D9WA 2YT0A 3DXCA 2ZPYA 1J0WA 4Z2MB 1AWEA 5J3QA 5CLQB 2N23A 3PVLA 4K2PA 4HDOA 1E5WA 4K17A 2H7EA 1NTVA 1EF1A 2Y8GA 4HAWB 4HAYB 5JP4A 1MIZB 2LKOA 4A6FA 2L2IA 2KGXB 4KHBB 1UPRA 1X05A 3IVFA 1V89A 3D8DA 2CAYA 2G35A 5C79A 4EJNA 2K2UA 1BAKA 3WA0A 2Z0PA 3HQCA 1U2BA 4B6HA 1OY2A 4GMXB 5C5BA 4HATB 1MAIA 4YONA 4NSWA 4HAVB 2K2JA 5HE2A 3ZVRA 3VIAA 4PQ0A 1V5UA 2EMSA 1FHXA 2LOZA 1IRSA 1ZVRA 5J3YA 3PEGA 3ML4A 3ULCA 3M1IB 2BCJA 2H7DA 2VSZA 2EMTA 1U5EA 2DTCA 2DYNA 3PVUA 1PFJA 1M7EA 1ZM0A 2UZRA 3KSYA 2D9ZA 3OANA 5JLJB 1QC6A 1GC7A 3AU4A 2I5CA 1KZGA 3ODOA 2MDXA 1WGUA 4L6EA 4HB2B 3KRWA 3T06A 4TKNA 1ZSQA 2I1JA 1B55A 1U5GA 2CY4A 2RSGA 4KHOA 3PZDA 2YVCA 2QKLA 3F5RA 2NZ8B 1V61A 2KCJA 1SGHA 2J0KA 2DKQA 4KAXB 4DBBA 2ELBA 5DH9B 3TFMA 1ISNA 1UPQA 5KCVA 4HB3B 4GZUA 2LG1A 3V5WA 1AQCA 3MPXA 2R0DA 2RVBB 2UZSA 5D3VA 2D4QA 4HB0B 4Z2NA 2DHJA 2DA0A 2W2XD 4K2OA 2J0MA 2LOXA 4IFSA 5DHFB 3VOQA 4GN1A 3FSSA 1ZC4B 4PNKA 2UVMA 2HE7A 3AU5A 3SYXA 1UEFA 3ZDTA 1M7RA 1BTNA 2R09A 1U5DA 1WG7A 4DX90 1FOEA 3ODWA 1MIXA 1FHOA 4MK0A 2YS5A 3AJ4A 2M38A 2MWNB 2ROVA 2W2WA 4A6FB 1FHWA 2GCLA 4C0AA 5HE3A 1P6SA 2I5FA 2AEHA 4WSFA 1PMSA 1XODA 2D2QA 1DDMA 1PLSA 2YS3A 3TVVA 4K81A 1W1DA 3A98B 4DX8A 1OQNA 4XWXA 5FI1A 2LULA 3QIJA 5DIFB 1NI2A 4HB4B 2P0HA 4CYEA 1RJ2A 3CXBB 2J0JA 1FGYA 2Y8FA 1EGXA 4HAXB 3KZ1A 3HW2B 3N7CA 2VRWB 3BJIA 4GMVA 5L81A 2YS1A 2LYDA 5D27A 4P7IA 2JP2A 3P7ZA 1KZ7A 1V88A 4YL8A 1RRPB 1EVHA 2RGNB 2VKIA 1Y5OA 1TJ6A 2DX5A 1MK7B 3SV1A 2COFA 2HTHB 1W1HA 2E2XA 1GC6A 4EMOA 1ZC3B 2DLWA 2GS0A 3KY9A 3P6AA 2DN6A 1EAZA 4MY6A 5HE1A 2DFKA 2P0DA 4NY0A 2CODA 2AL6A 2ADZA 1BTKA 3TCAA 5KQ4A 3RCPA 2D9VA 5CLLB 4WVFB 1UNPA 1P5TA 4F7HA 3O96A 3SO6A 2PZ1A 3A8PA 2Z0OA 2EC1A 4ZRIA 4TYZA 1MKEA 3D8EA 1V5PA 3FM8C 3SNHA 2MFQA 1WJMA 1UNRA 2XQNM 1X1GA 5EFXA 2I1KA 1FAOA 4HAZB 2N0YA 3MDBC 3D8FA 3PP2A 1J19A 2V76A 2GJYA 3PSCA 5LOPB 5FI0A 4H8SA 4Y94A 2GCJA 2DKPA 2DYQA 5DI9B 2D11A 2X18A 1X86A 2P0FA 4BBKA 2EJ8A 4F7UP 2J59M 2M14A 3G9WA 1TXDA 2Y7BA 3TO1A 1BWNA 2CY5A 2OQBA 1QQGA 1WI1A 2DX1A 3HK0A 3ULBA 1Z87A 2K00A 2YRYA 4IAPA 5D3WA 3QWMA 4A6KA 4F7GA 5C6RA 4IOYX 2DHIA 2OTXA 4HAUB 1NTYA 1DDVA 3UZTA 2QKMA 1XX0A 5C16A 2ROZB 2COCA 3A8QA 2P8VA 3KRXA 3CIKA 2KUPA 1WVHA 3PG7A 5C5BB 3PVWA 1LB1A 1H4RA 4CHJA 2D9YA 4A6HA 1TQZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QBV B;  2L1C A;  1OMW A;  1MK9 B;  3LJU X;  1I2H A;  2D10 A;  2RUK B;  4WJ7 A;  1U5F A;  2COA A;  4MT7 A;  1DRO A;  3DXD A;  4GPT B;  4KHA A;  1U27 A;  1X1F A;  3GYP A;  2MKR A;  5HE0 A;  1XCG A;  1KI1 B;  1DBH A;  1I7A A;  3NSU A;  3DXE A;  1K5D B;  2Z0Q A;  4D0N B;  4ZRK A;  5D3Y A;  3SUZ A;  1GG3 A;  2FJL A;  1NU2 A;  1SHC A;  3ODX A;  2ELA A;  1FGZ A;  5JHH A;  1UNQ A;  4HDQ A;  2RLO A;  1Y19 B;  4HHV A;  4KVG B;  3X23 A;  2IFS A;  2DHK A;  5GOW B;  5J3T A;  4A5K A;  1P3R A;  4EKU A;  1U29 A;  2YT1 A;  4CHM A;  1LW3 A;  1XD4 A;  1Q67 A;  3U7D A;  3F0W A;  1XR0 B;  5D3X A;  2IYB A;  1N3H A;  5JHG A;  5DHA B;  5LON B;  1DDW A;  3WYF B;  2NMB A;  4GXB A;  4DXA B;  1H10 A;  3BIN A;  1DYN A;  2CRF A;  3FEH A;  3GYO A;  1V5M A;  1MPH A;  1FB8 A;  1K5G B;  2YF0 A;  3U8Z A;  2RNR B;  1WGQ A;  5KQ1 A;  2W2X C;  2D9X A;  2Q13 A;  1X11 A;  2YSZ A;  1W1G A;  4ZRJ A;  3TW1 A;  1XKE A;  1WJ1 A;  2D9W A;  2YT0 A;  3DXC A;  2ZPY A;  1J0W A;  4Z2M B;  1AWE A;  5J3Q A;  5CLQ B;  2N23 A;  3PVL A;  4K2P A;  4HDO A;  1E5W A;  4K17 A;  2H7E A;  1NTV A;  1EF1 A;  2Y8G A;  4HAW B;  4HAY B;  5JP4 A;  1MIZ B;  2LKO A;  4A6F A;  2L2I A;  2KGX B;  4KHB B;  1UPR A;  1X05 A;  3IVF A;  1V89 A;  3D8D A;  2CAY A;  2G35 A;  5C79 A;  4EJN A;  2K2U A;  1BAK A;  3WA0 A;  2Z0P A;  3HQC A;  1U2B A;  4B6H A;  1OY2 A;  4GMX B;  5C5B A;  4HAT B;  1MAI A;  4YON A;  4NSW A;  4HAV B;  2K2J A;  5HE2 A;  3ZVR A;  3VIA A;  4PQ0 A;  1V5U A;  2EMS A;  1FHX A;  2LOZ A;  1IRS A;  1ZVR A;  5J3Y A;  3PEG A;  3ML4 A;  3ULC A;  3M1I B;  2BCJ A;  2H7D A;  2VSZ A;  2EMT A;  1U5E A;  2DTC A;  2DYN A;  3PVU A;  1PFJ A;  1M7E A;  1ZM0 A;  2UZR A;  3KSY A;  2D9Z A;  3OAN A;  5JLJ B;  1QC6 A;  1GC7 A;  3AU4 A;  2I5C A;  1KZG A;  3ODO A;  2MDX A;  1WGU A;  4L6E A;  4HB2 B;  3KRW A;  3T06 A;  4TKN A;  1ZSQ A;  2I1J A;  1B55 A;  1U5G A;  2CY4 A;  2RSG A;  4KHO A;  3PZD A;  2YVC A;  2QKL A;  3F5R A;  2NZ8 B;  1V61 A;  2KCJ A;  1SGH A;  2J0K A;  2DKQ A;  4KAX B;  4DBB A;  2ELB A;  5DH9 B;  3TFM A;  1ISN A;  1UPQ A;  5KCV A;  4HB3 B;  4GZU A;  2LG1 A;  3V5W A;  1AQC A;  3MPX A;  2R0D A;  2RVB B;  2UZS A;  5D3V A;  2D4Q A;  4HB0 B;  4Z2N A;  2DHJ A;  2DA0 A;  2W2X D;  4K2O A;  2J0M A;  2LOX A;  4IFS A;  5DHF B;  3VOQ A;  4GN1 A;  3FSS A;  1ZC4 B;  4PNK A;  2UVM A;  2HE7 A;  3AU5 A;  3SYX A;  1UEF A;  3ZDT A;  1M7R A;  1BTN A;  2R09 A;  1U5D A;  1WG7 A;  4DX9 0;  1FOE A;  3ODW A;  1MIX A;  1FHO A;  4MK0 A;  2YS5 A;  3AJ4 A;  2M38 A;  2MWN B;  2ROV A;  2W2W A;  4A6F B;  1FHW A;  2GCL A;  4C0A A;  5HE3 A;  1P6S A;  2I5F A;  2AEH A;  4WSF A;  1PMS A;  1XOD A;  2D2Q A;  1DDM A;  1PLS A;  2YS3 A;  3TVV A;  4K81 A;  1W1D A;  3A98 B;  4DX8 A;  1OQN A;  4XWX A;  5FI1 A;  2LUL A;  3QIJ A;  5DIF B;  1NI2 A;  4HB4 B;  2P0H A;  4CYE A;  1RJ2 A;  3CXB B;  2J0J A;  1FGY A;  2Y8F A;  1EGX A;  4HAX B;  3KZ1 A;  3HW2 B;  3N7C A;  2VRW B;  3BJI A;  4GMV A;  5L81 A;  2YS1 A;  2LYD A;  5D27 A;  4P7I A;  2JP2 A;  3P7Z A;  1KZ7 A;  1V88 A;  4YL8 A;  1RRP B;  1EVH A;  2RGN B;  2VKI A;  1Y5O A;  1TJ6 A;  2DX5 A;  1MK7 B;  3SV1 A;  2COF A;  2HTH B;  1W1H A;  2E2X A;  1GC6 A;  4EMO A;  1ZC3 B;  2DLW A;  2GS0 A;  3KY9 A;  3P6A A;  2DN6 A;  1EAZ A;  4MY6 A;  5HE1 A;  2DFK A;  2P0D A;  4NY0 A;  2COD A;  2AL6 A;  2ADZ A;  1BTK A;  3TCA A;  5KQ4 A;  3RCP A;  2D9V A;  5CLL B;  4WVF B;  1UNP A;  1P5T A;  4F7H A;  3O96 A;  3SO6 A;  2PZ1 A;  3A8P A;  2Z0O A;  2EC1 A;  4ZRI A;  4TYZ A;  1MKE A;  3D8E A;  1V5P A;  3FM8 C;  3SNH A;  2MFQ A;  1WJM A;  1UNR A;  2XQN M;  1X1G A;  5EFX A;  2I1K A;  1FAO A;  4HAZ B;  2N0Y A;  3MDB C;  3D8F A;  3PP2 A;  1J19 A;  2V76 A;  2GJY A;  3PSC A;  5LOP B;  5FI0 A;  4H8S A;  4Y94 A;  2GCJ A;  2DKP A;  2DYQ A;  5DI9 B;  2D11 A;  2X18 A;  1X86 A;  2P0F A;  4BBK A;  2EJ8 A;  4F7U P;  2J59 M;  2M14 A;  3G9W A;  1TXD A;  2Y7B A;  3TO1 A;  1BWN A;  2CY5 A;  2OQB A;  1QQG A;  1WI1 A;  2DX1 A;  3HK0 A;  3ULB A;  1Z87 A;  2K00 A;  2YRY A;  4IAP A;  5D3W A;  3QWM A;  4A6K A;  4F7G A;  5C6R A;  4IOY X;  2DHI A;  2OTX A;  4HAU B;  1NTY A;  1DDV A;  3UZT A;  2QKM A;  1XX0 A;  5C16 A;  2ROZ B;  2COC A;  3A8Q A;  2P8V A;  3KRX A;  3CIK A;  2KUP A;  1WVH A;  3PG7 A;  5C5B B;  3PVW A;  1LB1 A;  1H4R A;  4CHJ A;  2D9Y A;  4A6H A;  1TQZ A; 
#chains in the Genus database with same CATH topology
 3QBV B;  2L1C A;  1OMW A;  1MK9 B;  3LJU X;  1I2H A;  2D10 A;  2RUK B;  4WJ7 A;  4CSQ A;  1U5F A;  2COA A;  4MT7 A;  1DRO A;  3DXD A;  4GPT B;  5I2M A;  4KHA A;  1U27 A;  1X1F A;  3GYP A;  2MKR A;  5HE0 A;  1XCG A;  1KI1 B;  1DBH A;  1I7A A;  3NSU A;  3DXE A;  1K5D B;  2Z0Q A;  4D0N B;  4ZRK A;  5D3Y A;  3SUZ A;  1GG3 A;  2FJL A;  5LG4 B;  1SHC A;  1NU2 A;  3ODX A;  2ELA A;  1FGZ A;  5JHH A;  1UNQ A;  4HDQ A;  2K49 A;  2RLO A;  1Y19 B;  4HHV A;  4KVG B;  3X23 A;  2KR0 A;  2IFS A;  2DHK A;  3HIE A;  5GOW B;  5J3T A;  3NW8 A;  4A5K A;  1P3R A;  4EKU A;  1U29 A;  2YT1 A;  4CHM A;  1LW3 A;  1XD4 A;  1Q67 A;  3U7D A;  3F0W A;  1XR0 B;  5D3X A;  2IYB A;  1N3H A;  5JHG A;  5DHA B;  5LON B;  1DDW A;  3WYF B;  2NMB A;  4GXB A;  4DXA B;  1H10 A;  3BIN A;  1DYN A;  2CRF A;  3FEH A;  3GYO A;  1V5M A;  1MPH A;  1FB8 A;  1K5G B;  2YF0 A;  3U8Z A;  4DIX A;  2RNR B;  1WGQ A;  5KQ1 A;  2NBV A;  2FJU B;  2W2X C;  2D9X A;  2Q13 A;  1X11 A;  2YSZ A;  1W1G A;  4ZRJ A;  3TW1 A;  1XKE A;  1WJ1 A;  2D9W A;  2YT0 A;  3DXC A;  2ZPY A;  1J0W A;  4Z2M B;  1AWE A;  5J3Q A;  5CLQ B;  2N23 A;  3PVL A;  4K2P A;  4HDO A;  2Z13 A;  2R2Y A;  1E5W A;  4K17 A;  5I2S A;  2H7E A;  1NTV A;  1EF1 A;  2Y8G A;  4HAW B;  4HAY B;  5JP4 A;  1MIZ B;  2LKO A;  4A6F A;  2L2I A;  2KGX B;  4KHB B;  1UPR A;  1X05 A;  3IVF A;  1V89 A;  3D8D A;  2CAY A;  2G35 A;  5C79 A;  4EJN A;  2K2U A;  1ZYI A;  1BAK A;  4QJ5 B;  3WA0 A;  2Z0P A;  3HQC A;  4QXA B;  1U2B A;  4B6H A;  1OY2 A;  2YT2 A;  4GMX B;  5C5B A;  5M4Y B;  4HAT B;  1MAI A;  4YON A;  4NSW A;  4HAV B;  2K2J A;  5HE2 A;  3ZVR A;  4OT1 A;  4PQ0 A;  1V5U A;  4L1R A;  3VIA A;  2EMS A;  1FHX A;  2LOZ A;  1IRS A;  1ZVR A;  5J3Y A;  3PEG A;  3ML4 A;  2Z4D A;  3ULC A;  3M1I B;  2BCJ A;  2H7D A;  4OSN A;  2VSZ A;  2EMT A;  1U5E A;  2DTC A;  2DYN A;  3PVU A;  1PFJ A;  1M7E A;  1ZM0 A;  2UZR A;  3KSY A;  2D9Z A;  3OAN A;  5JLJ B;  2ZKM X;  1QC6 A;  1GC7 A;  3AU4 A;  2I5C A;  1KZG A;  3DCX A;  3ODO A;  2MDX A;  1WGU A;  4L6E A;  4HB2 B;  3KRW A;  3T06 A;  4TKN A;  1ZSQ A;  2I1J A;  1B55 A;  1U5G A;  2CY4 A;  2RSG A;  4KHO A;  3PZD A;  2YVC A;  2RRF A;  2QKL A;  4QJ3 B;  3F5R A;  2NZ8 B;  1V61 A;  2KCJ A;  1SGH A;  2J0K A;  2DKQ A;  4KAX B;  4DBB A;  2ELB A;  5DH9 B;  3TFM A;  1ISN A;  1UPQ A;  5KCV A;  4HB3 B;  4GZU A;  2LG1 A;  3V5W A;  1AQC A;  3MPX A;  2R0D A;  2RVB B;  2UZS A;  5D3V A;  2Z59 A;  2D4Q A;  4HB0 B;  3B77 A;  4Z2N A;  2DHJ A;  2DA0 A;  2W2X D;  4K2O A;  2J0M A;  2LOX A;  5IRS A;  3HSA A;  4IFS A;  5DHF B;  3VOQ A;  4GN1 A;  3FSS A;  1ZC4 B;  4PNK A;  2UVM A;  3OHM B;  2HE7 A;  3AU5 A;  3SYX A;  1UEF A;  3ZDT A;  1M7R A;  1BTN A;  2R09 A;  1U5D A;  4GOU A;  1WG7 A;  4DX9 0;  1FOE A;  3ODW A;  1MIX A;  1FHO A;  4MK0 A;  2YS5 A;  3AJ4 A;  2M38 A;  2MWN B;  2ROV A;  2W2W A;  4A6F B;  1FHW A;  2GCL A;  4C0A A;  5HE3 A;  1P6S A;  2I5F A;  4KHB A;  2AEH A;  4WSF A;  1PMS A;  1XOD A;  2D2Q A;  1DDM A;  1PLS A;  2YS3 A;  3TVV A;  4K81 A;  1W1D A;  3A98 B;  4DX8 A;  1OQN A;  4XWX A;  3U12 A;  5FI1 A;  2LUL A;  3QIJ A;  5DIF B;  1NI2 A;  4HB4 B;  2P0H A;  4CYE A;  1RJ2 A;  3CXB B;  1MI1 A;  2J0J A;  3A58 A;  1FGY A;  2Y8F A;  1EGX A;  4HAX B;  3KZ1 A;  3HW2 B;  3N7C A;  2VRW B;  3BJI A;  4GMV A;  5L81 A;  2YS1 A;  2LYD A;  5D27 A;  4P7I A;  2JP2 A;  3P7Z A;  1KZ7 A;  1V88 A;  4YL8 A;  1RRP B;  1EVH A;  2RGN B;  2VKI A;  2K8E A;  1Y5O A;  1TJ6 A;  2DX5 A;  1MK7 B;  3SV1 A;  2COF A;  2HTH B;  1W1H A;  2E2X A;  1GC6 A;  4EMO A;  1ZC3 B;  2DLW A;  2GS0 A;  3KY9 A;  3P6A A;  2DN6 A;  1EAZ A;  1T77 A;  4MY6 A;  5HE1 A;  2DFK A;  2KIE A;  2P0D A;  4NY0 A;  2COD A;  4D6W A;  2AL6 A;  2ADZ A;  1BTK A;  3TCA A;  5KQ4 A;  3RCP A;  3NWD A;  2D9V A;  5CLL B;  4WVF B;  1UNP A;  1P5T A;  2KIG A;  3NWA A;  4F7H A;  3O96 A;  3SO6 A;  2PZ1 A;  3A8P A;  2Z0O A;  2EC1 A;  4ZRI A;  4TYZ A;  1MKE A;  3D8E A;  1V5P A;  3FM8 C;  3SNH A;  2MFQ A;  1WJM A;  1UNR A;  2XQN M;  1X1G A;  5EFX A;  2I1K A;  4QJ4 B;  1FAO A;  4HAZ B;  2N0Y A;  3MDB C;  3D8F A;  3PP2 A;  3NWF A;  1J19 A;  2V76 A;  2GJY A;  3PSC A;  5LOP B;  5FI0 A;  4H8S A;  4Y94 A;  2GCJ A;  2DKP A;  2DYQ A;  2GUM A;  5DI9 B;  2D11 A;  2X18 A;  1X86 A;  2P0F A;  4BBK A;  2EJ8 A;  4F7U P;  2J59 M;  2M14 A;  3G9W A;  1TXD A;  2Y7B A;  3TO1 A;  2Z14 A;  1BWN A;  2CY5 A;  2OQB A;  1QQG A;  1WI1 A;  2DX1 A;  3HK0 A;  3ULB A;  1Z87 A;  2K00 A;  3FVC A;  2YRY A;  4IAP A;  5D3W A;  2KUQ A;  3QWM A;  4A6K A;  4F7G A;  5C6R A;  4IOY X;  2DHI A;  2OTX A;  4HAU B;  1NTY A;  4HSI A;  1DDV A;  4GNK B;  2QKM A;  3UZT A;  1XX0 A;  5C16 A;  2ROZ B;  2COC A;  3A8Q A;  2P8V A;  3KRX A;  3CIK A;  2KUP A;  1WVH A;  3PG7 A;  5C5B B;  3PVW A;  1LB1 A;  1H4R A;  4CHJ A;  2D9Y A;  4A6H A;  1TQZ A; 
#chains in the Genus database with same CATH homology
 3QBV B;  2L1C A;  1OMW A;  1MK9 B;  3LJU X;  1I2H A;  2D10 A;  2RUK B;  4WJ7 A;  1U5F A;  2COA A;  4MT7 A;  1DRO A;  3DXD A;  4GPT B;  4KHA A;  1U27 A;  1X1F A;  3GYP A;  2MKR A;  5HE0 A;  1XCG A;  1KI1 B;  1DBH A;  1I7A A;  3NSU A;  3DXE A;  1K5D B;  2Z0Q A;  4D0N B;  4ZRK A;  5D3Y A;  3SUZ A;  1GG3 A;  2FJL A;  1NU2 A;  1SHC A;  3ODX A;  2ELA A;  1FGZ A;  5JHH A;  1UNQ A;  4HDQ A;  2RLO A;  1Y19 B;  4HHV A;  4KVG B;  3X23 A;  2IFS A;  2DHK A;  5GOW B;  5J3T A;  4A5K A;  1P3R A;  4EKU A;  1U29 A;  2YT1 A;  4CHM A;  1LW3 A;  1XD4 A;  1Q67 A;  3U7D A;  3F0W A;  1XR0 B;  5D3X A;  2IYB A;  1N3H A;  5JHG A;  5DHA B;  5LON B;  1DDW A;  3WYF B;  2NMB A;  4GXB A;  4DXA B;  1H10 A;  3BIN A;  1DYN A;  2CRF A;  3FEH A;  3GYO A;  1V5M A;  1MPH A;  1FB8 A;  1K5G B;  2YF0 A;  3U8Z A;  2RNR B;  1WGQ A;  5KQ1 A;  2W2X C;  2D9X A;  2Q13 A;  1X11 A;  2YSZ A;  1W1G A;  4ZRJ A;  3TW1 A;  1XKE A;  1WJ1 A;  2D9W A;  2YT0 A;  3DXC A;  2ZPY A;  1J0W A;  4Z2M B;  1AWE A;  5J3Q A;  5CLQ B;  2N23 A;  3PVL A;  4K2P A;  4HDO A;  1E5W A;  4K17 A;  2H7E A;  1NTV A;  1EF1 A;  2Y8G A;  4HAW B;  4HAY B;  5JP4 A;  1MIZ B;  2LKO A;  4A6F A;  2L2I A;  2KGX B;  4KHB B;  1UPR A;  1X05 A;  3IVF A;  1V89 A;  3D8D A;  2CAY A;  2G35 A;  5C79 A;  4EJN A;  2K2U A;  1BAK A;  3WA0 A;  2Z0P A;  3HQC A;  1U2B A;  4B6H A;  1OY2 A;  4GMX B;  5C5B A;  4HAT B;  1MAI A;  4YON A;  4NSW A;  4HAV B;  2K2J A;  5HE2 A;  3ZVR A;  3VIA A;  4PQ0 A;  1V5U A;  2EMS A;  1FHX A;  2LOZ A;  1IRS A;  1ZVR A;  5J3Y A;  3PEG A;  3ML4 A;  3ULC A;  3M1I B;  2BCJ A;  2H7D A;  2VSZ A;  2EMT A;  1U5E A;  2DTC A;  2DYN A;  3PVU A;  1PFJ A;  1M7E A;  1ZM0 A;  2UZR A;  3KSY A;  2D9Z A;  3OAN A;  5JLJ B;  1QC6 A;  1GC7 A;  3AU4 A;  2I5C A;  1KZG A;  3ODO A;  2MDX A;  1WGU A;  4L6E A;  4HB2 B;  3KRW A;  3T06 A;  4TKN A;  1ZSQ A;  2I1J A;  1B55 A;  1U5G A;  2CY4 A;  2RSG A;  4KHO A;  3PZD A;  2YVC A;  2QKL A;  3F5R A;  2NZ8 B;  1V61 A;  2KCJ A;  1SGH A;  2J0K A;  2DKQ A;  4KAX B;  4DBB A;  2ELB A;  5DH9 B;  3TFM A;  1ISN A;  1UPQ A;  5KCV A;  4HB3 B;  4GZU A;  2LG1 A;  3V5W A;  1AQC A;  3MPX A;  2R0D A;  2RVB B;  2UZS A;  5D3V A;  2D4Q A;  4HB0 B;  4Z2N A;  2DHJ A;  2DA0 A;  2W2X D;  4K2O A;  2J0M A;  2LOX A;  4IFS A;  5DHF B;  3VOQ A;  4GN1 A;  3FSS A;  1ZC4 B;  4PNK A;  2UVM A;  2HE7 A;  3AU5 A;  3SYX A;  1UEF A;  3ZDT A;  1M7R A;  1BTN A;  2R09 A;  1U5D A;  1WG7 A;  4DX9 0;  1FOE A;  3ODW A;  1MIX A;  1FHO A;  4MK0 A;  2YS5 A;  3AJ4 A;  2M38 A;  2MWN B;  2ROV A;  2W2W A;  4A6F B;  1FHW A;  2GCL A;  4C0A A;  5HE3 A;  1P6S A;  2I5F A;  2AEH A;  4WSF A;  1PMS A;  1XOD A;  2D2Q A;  1DDM A;  1PLS A;  2YS3 A;  3TVV A;  4K81 A;  1W1D A;  3A98 B;  4DX8 A;  1OQN A;  4XWX A;  5FI1 A;  2LUL A;  3QIJ A;  5DIF B;  1NI2 A;  4HB4 B;  2P0H A;  4CYE A;  1RJ2 A;  3CXB B;  2J0J A;  1FGY A;  2Y8F A;  1EGX A;  4HAX B;  3KZ1 A;  3HW2 B;  3N7C A;  2VRW B;  3BJI A;  4GMV A;  5L81 A;  2YS1 A;  2LYD A;  5D27 A;  4P7I A;  2JP2 A;  3P7Z A;  1KZ7 A;  1V88 A;  4YL8 A;  1RRP B;  1EVH A;  2RGN B;  2VKI A;  1Y5O A;  1TJ6 A;  2DX5 A;  1MK7 B;  3SV1 A;  2COF A;  2HTH B;  1W1H A;  2E2X A;  1GC6 A;  4EMO A;  1ZC3 B;  2DLW A;  2GS0 A;  3KY9 A;  3P6A A;  2DN6 A;  1EAZ A;  4MY6 A;  5HE1 A;  2DFK A;  2P0D A;  4NY0 A;  2COD A;  2AL6 A;  2ADZ A;  1BTK A;  3TCA A;  5KQ4 A;  3RCP A;  2D9V A;  5CLL B;  4WVF B;  1UNP A;  1P5T A;  4F7H A;  3O96 A;  3SO6 A;  2PZ1 A;  3A8P A;  2Z0O A;  2EC1 A;  4ZRI A;  4TYZ A;  1MKE A;  3D8E A;  1V5P A;  3FM8 C;  3SNH A;  2MFQ A;  1WJM A;  1UNR A;  2XQN M;  1X1G A;  5EFX A;  2I1K A;  1FAO A;  4HAZ B;  2N0Y A;  3MDB C;  3D8F A;  3PP2 A;  1J19 A;  2V76 A;  2GJY A;  3PSC A;  5LOP B;  5FI0 A;  4H8S A;  4Y94 A;  2GCJ A;  2DKP A;  2DYQ A;  5DI9 B;  2D11 A;  2X18 A;  1X86 A;  2P0F A;  4BBK A;  2EJ8 A;  4F7U P;  2J59 M;  2M14 A;  3G9W A;  1TXD A;  2Y7B A;  3TO1 A;  1BWN A;  2CY5 A;  2OQB A;  1QQG A;  1WI1 A;  2DX1 A;  3HK0 A;  3ULB A;  1Z87 A;  2K00 A;  2YRY A;  4IAP A;  5D3W A;  3QWM A;  4A6K A;  4F7G A;  5C6R A;  4IOY X;  2DHI A;  2OTX A;  4HAU B;  1NTY A;  1DDV A;  3UZT A;  2QKM A;  1XX0 A;  5C16 A;  2ROZ B;  2COC A;  3A8Q A;  2P8V A;  3KRX A;  3CIK A;  2KUP A;  1WVH A;  3PG7 A;  5C5B B;  3PVW A;  1LB1 A;  1H4R A;  4CHJ A;  2D9Y A;  4A6H A;  1TQZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...