1V5PA

Solution structure of the n-terminal pleckstrin homology domain of tapp2 from mouse
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
126
structure length
126
Chain Sequence
GSSGSSGMPYVDRQNRICGFLDIEDNENSGKFLRRYFILDTQANCLLWYMDNPQNLAVGAGAVGSLQLTYISKVSIATPKQKPKTPFCFVINALSQRYFLQANDQKDLKDWVEALNQASKSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords pleckstrin homology domain-containing, family A
publication title Solution Structure of the N-terminal Pleckstrin Homology Domain Of TAPP2 from Mouse
rcsb
source organism Mus musculus
molecule tags Signaling protein
total genus 13
structure length 126
sequence length 126
ec nomenclature
pdb deposition date 2003-11-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00169 PH PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1v5pA01
1W1DA 2W2WA 5LONB 1UNQA 2CRFA 1Z87A 1UNPA 4EMOA 3QWMA 2DX1A 5HE0A 3KY9A 2K2UA 4HB3B 1UPRA 2HE7A 3SNHA 1NI2A 3FSSA 1Q67A 4KHAA 2YS3A 2ELBA 4IAPA 1ISNA 2BCJA 1EGXA 1LB1A 3PVWA 3HQCA 2ROZB 3FM8C 4EKUA 1IRSA 2D11A 3O96A 3U8ZA 1MPHA 3DXDA 3ULBA 1KZ7A 5DI9B 2X18A 3VIAA 4CHJA 1KZGA 3HW2B 2KUPA 3ULCA 4GPTB 2D9YA 2R09A 2VRWB 4K2OA 1X86A 5D3WA 2DA0A 3SYXA 4WJ7A 1Y19B 5C5BB 1J19A 3DXEA 2KGXB 2RSGA 3NSUA 2EMSA 2COAA 2RUKB 1NTYA 2HTHB 4HAWB 4A6FB 1FAOA 2GS0A 5D27A 3BINA 4ZRKA 1DDWA 1QQGA 4L6EA 5CLLB 1UPQA 3AU5A 5D3VA 4B6HA 2D10A 4HB4B 1BAKA 2YRYA 1J0WA 1DYNA 2DYNA 1EAZA 1K5GB 3G9WA 2W2XD 5DH9B 2DLWA 4NSWA 3TO1A 5C5BA 1XKEA 3FEHA 3TCAA 4HAVB 3D8DA 3ODWA 4H8SA 3CXBB 1BWNA 4A6KA 1N3HA 1X05A 2L2IA 1H4RA 5JHHA 3KRWA 2IYBA 1ZSQA 2YT0A 2Y8GA 2CODA 4DXAB 3SV1A 2NZ8B 2D9WA 3PP2A 4IFSA 2MWNB 1WI1A 3D8EA 3PVUA 2P0DA 2LULA 5J3YA 2D4QA 1LW3A 1XX0A 1DDVA 3KZ1A 5FI0A 1M7EA 2KCJA 4K2PA 3F0WA 2UZRA 5HE1A 3OANA 2YSZA 1P6SA 3PG7A 1QC6A 1U29A 4PQ0A 1EF1A 2Z0QA 1AWEA 1V61A 2DHJA 2J0JA 3M1IB 3PEGA 1BTNA 2G35A 3RCPA 2L1CA 1WVHA 1OQNA 1OY2A 1MK9B 1WGQA 5D3YA 2XQNM 1U5DA 2IFSA 3GYPA 4YL8A 1FHXA 4WVFB 2ZPYA 2DX5A 2P8VA 2K2JA 1P5TA 1PLSA 2YS5A 1RRPB 1SGHA 2QKLA 2ROVA 1ZC3B 2DKQA 2ELAA 2DHKA 4GMVA 4GXBA 3SUZA 2GCLA 5HE3A 2D9XA 2RGNB 2I1KA 5J3TA 1M7RA 2P0HA 4PNKA 1GC7A 3D8FA 4K81A 2CAYA 2OQBA 4TYZA 5JHGA 2EC1A 4HAZB 4A6HA 1W1GA 3MDBC 3DXCA 2OTXA 4TKNA 5KQ1A 5C79A 2MKRA 2I5FA 4CHMA 2VKIA 2AL6A 3QBVB 1ZVRA 1GG3A 4MY6A 4YONA 3X23A 1XODA 5DHFB 1UNRA 2J0KA 3A8PA 3TFMA 3CIKA 1V88A 2YT1A 1MK7B 1XR0B 4IOYX 2YVCA 1K5DB 4ZRJA 1TJ6A 4EJNA 4XWXA 1FB8A 4GMXB 1E5WA 3KSYA 2LYDA 2Z0OA 1MAIA 1PFJA 2D9ZA 3ML4A 3SO6A 4HB0B 1X1FA 1XCGA 4BBKA 1X1GA 5DIFB 2RVBB 1U5EA 2YS1A 5C16A 1V89A 2N23A 5HE2A 4MT7A 1FGYA 2D2QA 4GZUA 3ODOA 4HHVA 2MFQA 1U27A 1KI1B 4HAUB 4HAYB 2LG1A 1WG7A 4ZRIA 3PSCA 5L81A 1DROA 3PVLA 2DTCA 2K00A 3HK0A 3T06A 3WYFB 3KRXA 2VSZA 2LKOA 5J3QA 5FI1A 2UZSA 4DX8A 1DBHA 3WA0A 4NY0A 4KHOA 4Y94A 5DHAB 1I7AA 3LJUX 1V5PA 1B55A 1ZC4B 2EJ8A 2RNRB 3VOQA 1RJ2A 2Z0PA 2N0YA 5D3XA 2Q13A 4D0NB 3ZDTA 2CY4A 2DN6A 3ODXA 3MPXA 5JP4A 5CLQB 1WJ1A 1FHOA 2NMBA 1FOEA 2RLOA 3AJ4A 3P7ZA 4KVGB 1I2HA 1U5GA 4K17A 4WSFA 2DFKA 1W1HA 1EVHA 2I1JA 3N7CA 1NU2A 3A98B 2CY5A 1OMWA 2YF0A 2H7EA 1TQZA 4C0AA 2DHIA 1AQCA 2EMTA 1TXDA 3PZDA 4F7GA 3QIJA 2LOXA 4KHBB 4HDQA 3AU4A 5JLJB 1P3RA 1DDMA 4Z2NA 2E2XA 4Z2MB 2PZ1A 5EFXA 2P0FA 1MIXA 2M14A 4F7UP 1NTVA 2COCA 3U7DA 2FJLA 2MDXA 1WGUA 2AEHA 5LOPB 4KAXB 2ADZA 2GJYA 1V5MA 3P6AA 2GCJA 1ZM0A 3F5RA 4F7HA 2JP2A 2COFA 2UVMA 5C6RA 3IVFA 2QKMA 4DBBA 1GC6A 1SHCA 3A8QA 2LOZA 1U5FA 4HB2B 2I5CA 1XD4A 4MK0A 4GN1A 4P7IA 1MKEA 3TW1A 1X11A 5KCVA 2Y7BA 4DX90 4A6FA 1U2BA 1PMSA 2W2XC 3V5WA 4A5KA 5KQ4A 2H7DA 3TVVA 2J0MA 1WJMA 4HDOA 1MIZB 1Y5OA 1V5UA 4HATB 4HAXB 2Y8FA 2DKPA 3BJIA 3ZVRA 3GYOA 1FGZA 1H10A 2D9VA 5GOWB 4CYEA 3UZTA 2M38A 1FHWA 1UEFA 2V76A 2J59M 2DYQA 2R0DA 1BTKA
chains in the Genus database with same CATH superfamily
1W1DA 3NW8A 2W2WA 5LONB 1UNQA 2CRFA 1Z87A 3NWAA 1UNPA 4EMOA 3NWDA 3QWMA 2DX1A 5HE0A 3KY9A 2K2UA 4HSIA 4HB3B 1UPRA 2HE7A 2GUMA 3HSAA 3SNHA 1NI2A 1ZYIA 3FSSA 1Q67A 4KHAA 2YS3A 2ELBA 4IAPA 1ISNA 2BCJA 1EGXA 1LB1A 3PVWA 4QJ5B 3HQCA 2ROZB 3A58A 3FM8C 4EKUA 1IRSA 2D11A 3O96A 3U8ZA 1MPHA 3DXDA 3ULBA 1KZ7A 5DI9B 2X18A 3VIAA 4CHJA 1KZGA 3HW2B 2KUPA 3ULCA 4GPTB 2D9YA 4OT1A 2R09A 2VRWB 4K2OA 1X86A 5D3WA 2DA0A 3SYXA 4WJ7A 1Y19B 5C5BB 1J19A 3DXEA 2KGXB 2RSGA 3NSUA 2EMSA 2COAA 2RUKB 1NTYA 2HTHB 4HAWB 4A6FB 1FAOA 5I2SA 4D6WA 3NWFA 2GS0A 2Z13A 5D27A 3BINA 4ZRKA 1DDWA 1QQGA 4L6EA 5CLLB 1UPQA 3AU5A 5D3VA 4B6HA 2D10A 4HB4B 1BAKA 2YRYA 1J0WA 1DYNA 2DYNA 1EAZA 1K5GB 2ZKMX 3G9WA 2Z14A 2W2XD 2NBVA 2DLWA 5DH9B 4NSWA 3TO1A 5C5BA 1XKEA 2KR0A 3FEHA 3TCAA 4HAVB 3D8DA 3ODWA 4H8SA 3CXBB 1BWNA 4A6KA 1N3HA 1X05A 2L2IA 1H4RA 5JHHA 3KRWA 2IYBA 1ZSQA 2YT0A 2Y8GA 2CODA 4DXAB 5IRSA 3SV1A 2NZ8B 2D9WA 3PP2A 4IFSA 2MWNB 1WI1A 3D8EA 3PVUA 2P0DA 2LULA 5J3YA 2D4QA 1LW3A 1XX0A 1DDVA 3OHMB 3KZ1A 5FI0A 1M7EA 2KCJA 1MI1A 4K2PA 3F0WA 2UZRA 5HE1A 3OANA 2YSZA 1P6SA 3PG7A 1QC6A 3U12A 1U29A 4PQ0A 1EF1A 2Z0QA 1AWEA 1V61A 2DHJA 2J0JA 3M1IB 3PEGA 1BTNA 2G35A 3RCPA 2L1CA 1WVHA 1OQNA 1OY2A 1MK9B 1WGQA 5D3YA 2XQNM 1U5DA 2IFSA 3GYPA 4YL8A 4GNKB 1FHXA 4WVFB 2ZPYA 2DX5A 2P8VA 2K2JA 1P5TA 1PLSA 2YS5A 2R2YA 1RRPB 1SGHA 2YT2A 2QKLA 2ROVA 1ZC3B 2DKQA 2ELAA 2DHKA 4GMVA 4GXBA 3SUZA 2GCLA 4QJ3B 5HE3A 2D9XA 2RGNB 2I1KA 5J3TA 1M7RA 2P0HA 4PNKA 1GC7A 3D8FA 4K81A 2CAYA 2OQBA 4TYZA 5JHGA 2EC1A 4HAZB 4A6HA 1W1GA 3MDBC 3DXCA 2OTXA 4TKNA 5KQ1A 5C79A 2MKRA 2I5FA 4CHMA 2FJUB 2VKIA 2AL6A 3QBVB 1ZVRA 1GG3A 4MY6A 4YONA 3X23A 1XODA 5DHFB 1UNRA 2J0KA 3A8PA 3TFMA 3CIKA 1V88A 2YT1A 1MK7B 1XR0B 4IOYX 2YVCA 1K5DB 4L1RA 4ZRJA 1TJ6A 4EJNA 4KHBA 4XWXA 1FB8A 4GMXB 1E5WA 3KSYA 5M4YB 2LYDA 2Z0OA 1MAIA 1PFJA 2D9ZA 3ML4A 3SO6A 4HB0B 5LG4B 1X1FA 1XCGA 1T77A 4BBKA 1X1GA 5DIFB 2RVBB 1U5EA 2YS1A 2KIEA 5C16A 1V89A 2N23A 5HE2A 4MT7A 1FGYA 2D2QA 4GZUA 3FVCA 3ODOA 4HHVA 2MFQA 1U27A 1KI1B 4HAUB 4HAYB 2LG1A 1WG7A 4ZRIA 3PSCA 5L81A 4DIXA 1DROA 3PVLA 4QJ4B 2DTCA 2K00A 3HK0A 3T06A 3WYFB 3KRXA 2VSZA 2LKOA 5J3QA 5FI1A 2UZSA 4DX8A 1DBHA 3WA0A 4NY0A 4KHOA 4Y94A 5DHAB 1I7AA 3LJUX 1V5PA 4GOUA 1B55A 1ZC4B 2EJ8A 2RNRB 3VOQA 1RJ2A 2Z0PA 2N0YA 5D3XA 2Q13A 4D0NB 3ZDTA 2CY4A 2DN6A 3DCXA 3ODXA 3MPXA 5JP4A 5CLQB 1WJ1A 2Z4DA 1FHOA 2NMBA 1FOEA 2RLOA 3AJ4A 3P7ZA 4KVGB 1I2HA 1U5GA 4K17A 4WSFA 2DFKA 1W1HA 1EVHA 2RRFA 2I1JA 3N7CA 1NU2A 3A98B 2CY5A 1OMWA 2YF0A 2H7EA 3HIEA 1TQZA 4C0AA 2DHIA 1AQCA 2EMTA 1TXDA 3PZDA 4F7GA 3QIJA 4OSNA 2LOXA 4KHBB 4HDQA 3AU4A 5JLJB 1P3RA 1DDMA 4Z2NA 2E2XA 4Z2MB 2PZ1A 5EFXA 2P0FA 1MIXA 2M14A 4F7UP 1NTVA 2COCA 2KUQA 3U7DA 2FJLA 2MDXA 1WGUA 2AEHA 5LOPB 4KAXB 2ADZA 2GJYA 1V5MA 3P6AA 2GCJA 1ZM0A 3F5RA 4F7HA 2JP2A 4QXAB 2KIGA 2COFA 2UVMA 5C6RA 3IVFA 2QKMA 4DBBA 1GC6A 1SHCA 3A8QA 2LOZA 1U5FA 4HB2B 2I5CA 1XD4A 4MK0A 4GN1A 4P7IA 1MKEA 2Z59A 3TW1A 1X11A 5KCVA 2Y7BA 4DX90 4A6FA 1U2BA 1PMSA 2W2XC 3V5WA 2K49A 4A5KA 5KQ4A 2H7DA 3TVVA 2J0MA 1WJMA 4HDOA 1MIZB 1Y5OA 4CSQA 5I2MA 1V5UA 3B77A 4HATB 4HAXB 2Y8FA 2DKPA 3BJIA 3ZVRA 3GYOA 1FGZA 1H10A 2D9VA 5GOWB 4CYEA 3UZTA 2M38A 1FHWA 1UEFA 2V76A 2J59M 2DYQA 2K8EA 2R0DA 1BTKA
chains in the Genus database with same CATH topology
1W1DA 2W2WA 5LONB 1UNQA 2CRFA 1Z87A 1UNPA 4EMOA 3QWMA 2DX1A 5HE0A 3KY9A 2K2UA 4HB3B 1UPRA 2HE7A 3SNHA 1NI2A 3FSSA 1Q67A 4KHAA 2YS3A 2ELBA 4IAPA 1ISNA 2BCJA 1EGXA 1LB1A 3PVWA 3HQCA 2ROZB 3FM8C 4EKUA 1IRSA 2D11A 3O96A 3U8ZA 1MPHA 3DXDA 3ULBA 1KZ7A 5DI9B 2X18A 3VIAA 4CHJA 1KZGA 3HW2B 2KUPA 3ULCA 4GPTB 2D9YA 2R09A 2VRWB 4K2OA 1X86A 5D3WA 2DA0A 3SYXA 4WJ7A 1Y19B 5C5BB 1J19A 3DXEA 2KGXB 2RSGA 3NSUA 2EMSA 2COAA 2RUKB 1NTYA 2HTHB 4HAWB 4A6FB 1FAOA 2GS0A 5D27A 3BINA 4ZRKA 1DDWA 1QQGA 4L6EA 5CLLB 1UPQA 3AU5A 5D3VA 4B6HA 2D10A 4HB4B 1BAKA 2YRYA 1J0WA 1DYNA 2DYNA 1EAZA 1K5GB 3G9WA 2W2XD 5DH9B 2DLWA 4NSWA 3TO1A 5C5BA 1XKEA 3FEHA 3TCAA 4HAVB 3D8DA 3ODWA 4H8SA 3CXBB 1BWNA 4A6KA 1N3HA 1X05A 2L2IA 1H4RA 5JHHA 3KRWA 2IYBA 1ZSQA 2YT0A 2Y8GA 2CODA 4DXAB 3SV1A 2NZ8B 2D9WA 3PP2A 4IFSA 2MWNB 1WI1A 3D8EA 3PVUA 2P0DA 2LULA 5J3YA 2D4QA 1LW3A 1XX0A 1DDVA 3KZ1A 5FI0A 1M7EA 2KCJA 4K2PA 3F0WA 2UZRA 5HE1A 3OANA 2YSZA 1P6SA 3PG7A 1QC6A 1U29A 4PQ0A 1EF1A 2Z0QA 1AWEA 1V61A 2DHJA 2J0JA 3M1IB 3PEGA 1BTNA 2G35A 3RCPA 2L1CA 1WVHA 1OQNA 1OY2A 1MK9B 1WGQA 5D3YA 2XQNM 1U5DA 2IFSA 3GYPA 4YL8A 1FHXA 4WVFB 2ZPYA 2DX5A 2P8VA 2K2JA 1P5TA 1PLSA 2YS5A 1RRPB 1SGHA 2QKLA 2ROVA 1ZC3B 2DKQA 2ELAA 2DHKA 4GMVA 4GXBA 3SUZA 2GCLA 5HE3A 2D9XA 2RGNB 2I1KA 5J3TA 1M7RA 2P0HA 4PNKA 1GC7A 3D8FA 4K81A 2CAYA 2OQBA 4TYZA 5JHGA 2EC1A 4HAZB 4A6HA 1W1GA 3MDBC 3DXCA 2OTXA 4TKNA 5KQ1A 5C79A 2MKRA 2I5FA 4CHMA 2VKIA 2AL6A 3QBVB 1ZVRA 1GG3A 4MY6A 4YONA 3X23A 1XODA 5DHFB 1UNRA 2J0KA 3A8PA 3TFMA 3CIKA 1V88A 2YT1A 1MK7B 1XR0B 4IOYX 2YVCA 1K5DB 4ZRJA 1TJ6A 4EJNA 4XWXA 1FB8A 4GMXB 1E5WA 3KSYA 2LYDA 2Z0OA 1MAIA 1PFJA 2D9ZA 3ML4A 3SO6A 4HB0B 1X1FA 1XCGA 4BBKA 1X1GA 5DIFB 2RVBB 1U5EA 2YS1A 5C16A 1V89A 2N23A 5HE2A 4MT7A 1FGYA 2D2QA 4GZUA 3ODOA 4HHVA 2MFQA 1U27A 1KI1B 4HAUB 4HAYB 2LG1A 1WG7A 4ZRIA 3PSCA 5L81A 1DROA 3PVLA 2DTCA 2K00A 3HK0A 3T06A 3WYFB 3KRXA 2VSZA 2LKOA 5J3QA 5FI1A 2UZSA 4DX8A 1DBHA 3WA0A 4NY0A 4KHOA 4Y94A 5DHAB 1I7AA 3LJUX 1V5PA 1B55A 1ZC4B 2EJ8A 2RNRB 3VOQA 1RJ2A 2Z0PA 2N0YA 5D3XA 2Q13A 4D0NB 3ZDTA 2CY4A 2DN6A 3ODXA 3MPXA 5JP4A 5CLQB 1WJ1A 1FHOA 2NMBA 1FOEA 2RLOA 3AJ4A 3P7ZA 4KVGB 1I2HA 1U5GA 4K17A 4WSFA 2DFKA 1W1HA 1EVHA 2I1JA 3N7CA 1NU2A 3A98B 2CY5A 1OMWA 2YF0A 2H7EA 1TQZA 4C0AA 2DHIA 1AQCA 2EMTA 1TXDA 3PZDA 4F7GA 3QIJA 2LOXA 4KHBB 4HDQA 3AU4A 5JLJB 1P3RA 1DDMA 4Z2NA 2E2XA 4Z2MB 2PZ1A 5EFXA 2P0FA 1MIXA 2M14A 4F7UP 1NTVA 2COCA 3U7DA 2FJLA 2MDXA 1WGUA 2AEHA 5LOPB 4KAXB 2ADZA 2GJYA 1V5MA 3P6AA 2GCJA 1ZM0A 3F5RA 4F7HA 2JP2A 2COFA 2UVMA 5C6RA 3IVFA 2QKMA 4DBBA 1GC6A 1SHCA 3A8QA 2LOZA 1U5FA 4HB2B 2I5CA 1XD4A 4MK0A 4GN1A 4P7IA 1MKEA 3TW1A 1X11A 5KCVA 2Y7BA 4DX90 4A6FA 1U2BA 1PMSA 2W2XC 3V5WA 4A5KA 5KQ4A 2H7DA 3TVVA 2J0MA 1WJMA 4HDOA 1MIZB 1Y5OA 1V5UA 4HATB 4HAXB 2Y8FA 2DKPA 3BJIA 3ZVRA 3GYOA 1FGZA 1H10A 2D9VA 5GOWB 4CYEA 3UZTA 2M38A 1FHWA 1UEFA 2V76A 2J59M 2DYQA 2R0DA 1BTKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1W1D A;  2W2W A;  5LON B;  1UNQ A;  2CRF A;  1Z87 A;  1UNP A;  4EMO A;  3QWM A;  2DX1 A;  5HE0 A;  3KY9 A;  2K2U A;  4HB3 B;  1UPR A;  2HE7 A;  3SNH A;  1NI2 A;  3FSS A;  1Q67 A;  4KHA A;  2YS3 A;  2ELB A;  4IAP A;  1ISN A;  2BCJ A;  1EGX A;  1LB1 A;  3PVW A;  3HQC A;  2ROZ B;  3FM8 C;  4EKU A;  1IRS A;  2D11 A;  3O96 A;  3U8Z A;  1MPH A;  3DXD A;  3ULB A;  1KZ7 A;  5DI9 B;  2X18 A;  3VIA A;  4CHJ A;  1KZG A;  3HW2 B;  2KUP A;  3ULC A;  4GPT B;  2D9Y A;  2R09 A;  2VRW B;  4K2O A;  1X86 A;  5D3W A;  2DA0 A;  3SYX A;  4WJ7 A;  1Y19 B;  5C5B B;  1J19 A;  3DXE A;  2KGX B;  2RSG A;  3NSU A;  2EMS A;  2COA A;  2RUK B;  1NTY A;  2HTH B;  4HAW B;  4A6F B;  1FAO A;  2GS0 A;  5D27 A;  3BIN A;  4ZRK A;  1DDW A;  1QQG A;  4L6E A;  5CLL B;  1UPQ A;  3AU5 A;  5D3V A;  4B6H A;  2D10 A;  4HB4 B;  1BAK A;  2YRY A;  1J0W A;  1DYN A;  2DYN A;  1EAZ A;  1K5G B;  3G9W A;  2W2X D;  5DH9 B;  2DLW A;  4NSW A;  3TO1 A;  5C5B A;  1XKE A;  3FEH A;  3TCA A;  4HAV B;  3D8D A;  3ODW A;  4H8S A;  3CXB B;  1BWN A;  4A6K A;  1N3H A;  1X05 A;  2L2I A;  1H4R A;  5JHH A;  3KRW A;  2IYB A;  1ZSQ A;  2YT0 A;  2Y8G A;  2COD A;  4DXA B;  3SV1 A;  2NZ8 B;  2D9W A;  3PP2 A;  4IFS A;  2MWN B;  1WI1 A;  3D8E A;  3PVU A;  2P0D A;  2LUL A;  5J3Y A;  2D4Q A;  1LW3 A;  1XX0 A;  1DDV A;  3KZ1 A;  5FI0 A;  1M7E A;  2KCJ A;  4K2P A;  3F0W A;  2UZR A;  5HE1 A;  3OAN A;  2YSZ A;  1P6S A;  3PG7 A;  1QC6 A;  1U29 A;  4PQ0 A;  1EF1 A;  2Z0Q A;  1AWE A;  1V61 A;  2DHJ A;  2J0J A;  3M1I B;  3PEG A;  1BTN A;  2G35 A;  3RCP A;  2L1C A;  1WVH A;  1OQN A;  1OY2 A;  1MK9 B;  1WGQ A;  5D3Y A;  2XQN M;  1U5D A;  2IFS A;  3GYP A;  4YL8 A;  1FHX A;  4WVF B;  2ZPY A;  2DX5 A;  2P8V A;  2K2J A;  1P5T A;  1PLS A;  2YS5 A;  1RRP B;  1SGH A;  2QKL A;  2ROV A;  1ZC3 B;  2DKQ A;  2ELA A;  2DHK A;  4GMV A;  4GXB A;  3SUZ A;  2GCL A;  5HE3 A;  2D9X A;  2RGN B;  2I1K A;  5J3T A;  1M7R A;  2P0H A;  4PNK A;  1GC7 A;  3D8F A;  4K81 A;  2CAY A;  2OQB A;  4TYZ A;  5JHG A;  2EC1 A;  4HAZ B;  4A6H A;  1W1G A;  3MDB C;  3DXC A;  2OTX A;  4TKN A;  5KQ1 A;  5C79 A;  2MKR A;  2I5F A;  4CHM A;  2VKI A;  2AL6 A;  3QBV B;  1ZVR A;  1GG3 A;  4MY6 A;  4YON A;  3X23 A;  1XOD A;  5DHF B;  1UNR A;  2J0K A;  3A8P A;  3TFM A;  3CIK A;  1V88 A;  2YT1 A;  1MK7 B;  1XR0 B;  4IOY X;  2YVC A;  1K5D B;  4ZRJ A;  1TJ6 A;  4EJN A;  4XWX A;  1FB8 A;  4GMX B;  1E5W A;  3KSY A;  2LYD A;  2Z0O A;  1MAI A;  1PFJ A;  2D9Z A;  3ML4 A;  3SO6 A;  4HB0 B;  1X1F A;  1XCG A;  4BBK A;  1X1G A;  5DIF B;  2RVB B;  1U5E A;  2YS1 A;  5C16 A;  1V89 A;  2N23 A;  5HE2 A;  4MT7 A;  1FGY A;  2D2Q A;  4GZU A;  3ODO A;  4HHV A;  2MFQ A;  1U27 A;  1KI1 B;  4HAU B;  4HAY B;  2LG1 A;  1WG7 A;  4ZRI A;  3PSC A;  5L81 A;  1DRO A;  3PVL A;  2DTC A;  2K00 A;  3HK0 A;  3T06 A;  3WYF B;  3KRX A;  2VSZ A;  2LKO A;  5J3Q A;  5FI1 A;  2UZS A;  4DX8 A;  1DBH A;  3WA0 A;  4NY0 A;  4KHO A;  4Y94 A;  5DHA B;  1I7A A;  3LJU X;  1V5P A;  1B55 A;  1ZC4 B;  2EJ8 A;  2RNR B;  3VOQ A;  1RJ2 A;  2Z0P A;  2N0Y A;  5D3X A;  2Q13 A;  4D0N B;  3ZDT A;  2CY4 A;  2DN6 A;  3ODX A;  3MPX A;  5JP4 A;  5CLQ B;  1WJ1 A;  1FHO A;  2NMB A;  1FOE A;  2RLO A;  3AJ4 A;  3P7Z A;  4KVG B;  1I2H A;  1U5G A;  4K17 A;  4WSF A;  2DFK A;  1W1H A;  1EVH A;  2I1J A;  3N7C A;  1NU2 A;  3A98 B;  2CY5 A;  1OMW A;  2YF0 A;  2H7E A;  1TQZ A;  4C0A A;  2DHI A;  1AQC A;  2EMT A;  1TXD A;  3PZD A;  4F7G A;  3QIJ A;  2LOX A;  4KHB B;  4HDQ A;  3AU4 A;  5JLJ B;  1P3R A;  1DDM A;  4Z2N A;  2E2X A;  4Z2M B;  2PZ1 A;  5EFX A;  2P0F A;  1MIX A;  2M14 A;  4F7U P;  1NTV A;  2COC A;  3U7D A;  2FJL A;  2MDX A;  1WGU A;  2AEH A;  5LOP B;  4KAX B;  2ADZ A;  2GJY A;  1V5M A;  3P6A A;  2GCJ A;  1ZM0 A;  3F5R A;  4F7H A;  2JP2 A;  2COF A;  2UVM A;  5C6R A;  3IVF A;  2QKM A;  4DBB A;  1GC6 A;  1SHC A;  3A8Q A;  2LOZ A;  1U5F A;  4HB2 B;  2I5C A;  1XD4 A;  4MK0 A;  4GN1 A;  4P7I A;  1MKE A;  3TW1 A;  1X11 A;  5KCV A;  2Y7B A;  4DX9 0;  4A6F A;  1U2B A;  1PMS A;  2W2X C;  3V5W A;  4A5K A;  5KQ4 A;  2H7D A;  3TVV A;  2J0M A;  1WJM A;  4HDO A;  1MIZ B;  1Y5O A;  1V5U A;  4HAT B;  4HAX B;  2Y8F A;  2DKP A;  3BJI A;  3ZVR A;  3GYO A;  1FGZ A;  1H10 A;  2D9V A;  5GOW B;  4CYE A;  3UZT A;  2M38 A;  1FHW A;  1UEF A;  2V76 A;  2J59 M;  2DYQ A;  2R0D A;  1BTK A; 
#chains in the Genus database with same CATH topology
 1W1D A;  3NW8 A;  2W2W A;  5LON B;  1UNQ A;  2CRF A;  1Z87 A;  3NWA A;  1UNP A;  4EMO A;  3NWD A;  3QWM A;  2DX1 A;  5HE0 A;  3KY9 A;  2K2U A;  4HSI A;  4HB3 B;  1UPR A;  2HE7 A;  2GUM A;  3HSA A;  3SNH A;  1NI2 A;  1ZYI A;  3FSS A;  1Q67 A;  4KHA A;  2YS3 A;  2ELB A;  4IAP A;  1ISN A;  2BCJ A;  1EGX A;  1LB1 A;  3PVW A;  4QJ5 B;  3HQC A;  2ROZ B;  3A58 A;  3FM8 C;  4EKU A;  1IRS A;  2D11 A;  3O96 A;  3U8Z A;  1MPH A;  3DXD A;  3ULB A;  1KZ7 A;  5DI9 B;  2X18 A;  3VIA A;  4CHJ A;  1KZG A;  3HW2 B;  2KUP A;  3ULC A;  4GPT B;  2D9Y A;  4OT1 A;  2R09 A;  2VRW B;  4K2O A;  1X86 A;  5D3W A;  2DA0 A;  3SYX A;  4WJ7 A;  1Y19 B;  5C5B B;  1J19 A;  3DXE A;  2KGX B;  2RSG A;  3NSU A;  2EMS A;  2COA A;  2RUK B;  1NTY A;  2HTH B;  4HAW B;  4A6F B;  1FAO A;  5I2S A;  4D6W A;  3NWF A;  2GS0 A;  2Z13 A;  5D27 A;  3BIN A;  4ZRK A;  1DDW A;  1QQG A;  4L6E A;  5CLL B;  1UPQ A;  3AU5 A;  5D3V A;  4B6H A;  2D10 A;  4HB4 B;  1BAK A;  2YRY A;  1J0W A;  1DYN A;  2DYN A;  1EAZ A;  1K5G B;  2ZKM X;  3G9W A;  2Z14 A;  2W2X D;  2NBV A;  2DLW A;  5DH9 B;  4NSW A;  3TO1 A;  5C5B A;  1XKE A;  2KR0 A;  3FEH A;  3TCA A;  4HAV B;  3D8D A;  3ODW A;  4H8S A;  3CXB B;  1BWN A;  4A6K A;  1N3H A;  1X05 A;  2L2I A;  1H4R A;  5JHH A;  3KRW A;  2IYB A;  1ZSQ A;  2YT0 A;  2Y8G A;  2COD A;  4DXA B;  5IRS A;  3SV1 A;  2NZ8 B;  2D9W A;  3PP2 A;  4IFS A;  2MWN B;  1WI1 A;  3D8E A;  3PVU A;  2P0D A;  2LUL A;  5J3Y A;  2D4Q A;  1LW3 A;  1XX0 A;  1DDV A;  3OHM B;  3KZ1 A;  5FI0 A;  1M7E A;  2KCJ A;  1MI1 A;  4K2P A;  3F0W A;  2UZR A;  5HE1 A;  3OAN A;  2YSZ A;  1P6S A;  3PG7 A;  1QC6 A;  3U12 A;  1U29 A;  4PQ0 A;  1EF1 A;  2Z0Q A;  1AWE A;  1V61 A;  2DHJ A;  2J0J A;  3M1I B;  3PEG A;  1BTN A;  2G35 A;  3RCP A;  2L1C A;  1WVH A;  1OQN A;  1OY2 A;  1MK9 B;  1WGQ A;  5D3Y A;  2XQN M;  1U5D A;  2IFS A;  3GYP A;  4YL8 A;  4GNK B;  1FHX A;  4WVF B;  2ZPY A;  2DX5 A;  2P8V A;  2K2J A;  1P5T A;  1PLS A;  2YS5 A;  2R2Y A;  1RRP B;  1SGH A;  2YT2 A;  2QKL A;  2ROV A;  1ZC3 B;  2DKQ A;  2ELA A;  2DHK A;  4GMV A;  4GXB A;  3SUZ A;  2GCL A;  4QJ3 B;  5HE3 A;  2D9X A;  2RGN B;  2I1K A;  5J3T A;  1M7R A;  2P0H A;  4PNK A;  1GC7 A;  3D8F A;  4K81 A;  2CAY A;  2OQB A;  4TYZ A;  5JHG A;  2EC1 A;  4HAZ B;  4A6H A;  1W1G A;  3MDB C;  3DXC A;  2OTX A;  4TKN A;  5KQ1 A;  5C79 A;  2MKR A;  2I5F A;  4CHM A;  2FJU B;  2VKI A;  2AL6 A;  3QBV B;  1ZVR A;  1GG3 A;  4MY6 A;  4YON A;  3X23 A;  1XOD A;  5DHF B;  1UNR A;  2J0K A;  3A8P A;  3TFM A;  3CIK A;  1V88 A;  2YT1 A;  1MK7 B;  1XR0 B;  4IOY X;  2YVC A;  1K5D B;  4L1R A;  4ZRJ A;  1TJ6 A;  4EJN A;  4KHB A;  4XWX A;  1FB8 A;  4GMX B;  1E5W A;  3KSY A;  5M4Y B;  2LYD A;  2Z0O A;  1MAI A;  1PFJ A;  2D9Z A;  3ML4 A;  3SO6 A;  4HB0 B;  5LG4 B;  1X1F A;  1XCG A;  1T77 A;  4BBK A;  1X1G A;  5DIF B;  2RVB B;  1U5E A;  2YS1 A;  2KIE A;  5C16 A;  1V89 A;  2N23 A;  5HE2 A;  4MT7 A;  1FGY A;  2D2Q A;  4GZU A;  3FVC A;  3ODO A;  4HHV A;  2MFQ A;  1U27 A;  1KI1 B;  4HAU B;  4HAY B;  2LG1 A;  1WG7 A;  4ZRI A;  3PSC A;  5L81 A;  4DIX A;  1DRO A;  3PVL A;  4QJ4 B;  2DTC A;  2K00 A;  3HK0 A;  3T06 A;  3WYF B;  3KRX A;  2VSZ A;  2LKO A;  5J3Q A;  5FI1 A;  2UZS A;  4DX8 A;  1DBH A;  3WA0 A;  4NY0 A;  4KHO A;  4Y94 A;  5DHA B;  1I7A A;  3LJU X;  1V5P A;  4GOU A;  1B55 A;  1ZC4 B;  2EJ8 A;  2RNR B;  3VOQ A;  1RJ2 A;  2Z0P A;  2N0Y A;  5D3X A;  2Q13 A;  4D0N B;  3ZDT A;  2CY4 A;  2DN6 A;  3DCX A;  3ODX A;  3MPX A;  5JP4 A;  5CLQ B;  1WJ1 A;  2Z4D A;  1FHO A;  2NMB A;  1FOE A;  2RLO A;  3AJ4 A;  3P7Z A;  4KVG B;  1I2H A;  1U5G A;  4K17 A;  4WSF A;  2DFK A;  1W1H A;  1EVH A;  2RRF A;  2I1J A;  3N7C A;  1NU2 A;  3A98 B;  2CY5 A;  1OMW A;  2YF0 A;  2H7E A;  3HIE A;  1TQZ A;  4C0A A;  2DHI A;  1AQC A;  2EMT A;  1TXD A;  3PZD A;  4F7G A;  3QIJ A;  4OSN A;  2LOX A;  4KHB B;  4HDQ A;  3AU4 A;  5JLJ B;  1P3R A;  1DDM A;  4Z2N A;  2E2X A;  4Z2M B;  2PZ1 A;  5EFX A;  2P0F A;  1MIX A;  2M14 A;  4F7U P;  1NTV A;  2COC A;  2KUQ A;  3U7D A;  2FJL A;  2MDX A;  1WGU A;  2AEH A;  5LOP B;  4KAX B;  2ADZ A;  2GJY A;  1V5M A;  3P6A A;  2GCJ A;  1ZM0 A;  3F5R A;  4F7H A;  2JP2 A;  4QXA B;  2KIG A;  2COF A;  2UVM A;  5C6R A;  3IVF A;  2QKM A;  4DBB A;  1GC6 A;  1SHC A;  3A8Q A;  2LOZ A;  1U5F A;  4HB2 B;  2I5C A;  1XD4 A;  4MK0 A;  4GN1 A;  4P7I A;  1MKE A;  2Z59 A;  3TW1 A;  1X11 A;  5KCV A;  2Y7B A;  4DX9 0;  4A6F A;  1U2B A;  1PMS A;  2W2X C;  3V5W A;  2K49 A;  4A5K A;  5KQ4 A;  2H7D A;  3TVV A;  2J0M A;  1WJM A;  4HDO A;  1MIZ B;  1Y5O A;  4CSQ A;  5I2M A;  1V5U A;  3B77 A;  4HAT B;  4HAX B;  2Y8F A;  2DKP A;  3BJI A;  3ZVR A;  3GYO A;  1FGZ A;  1H10 A;  2D9V A;  5GOW B;  4CYE A;  3UZT A;  2M38 A;  1FHW A;  1UEF A;  2V76 A;  2J59 M;  2DYQ A;  2K8E A;  2R0D A;  1BTK A; 
#chains in the Genus database with same CATH homology
 1W1D A;  2W2W A;  5LON B;  1UNQ A;  2CRF A;  1Z87 A;  1UNP A;  4EMO A;  3QWM A;  2DX1 A;  5HE0 A;  3KY9 A;  2K2U A;  4HB3 B;  1UPR A;  2HE7 A;  3SNH A;  1NI2 A;  3FSS A;  1Q67 A;  4KHA A;  2YS3 A;  2ELB A;  4IAP A;  1ISN A;  2BCJ A;  1EGX A;  1LB1 A;  3PVW A;  3HQC A;  2ROZ B;  3FM8 C;  4EKU A;  1IRS A;  2D11 A;  3O96 A;  3U8Z A;  1MPH A;  3DXD A;  3ULB A;  1KZ7 A;  5DI9 B;  2X18 A;  3VIA A;  4CHJ A;  1KZG A;  3HW2 B;  2KUP A;  3ULC A;  4GPT B;  2D9Y A;  2R09 A;  2VRW B;  4K2O A;  1X86 A;  5D3W A;  2DA0 A;  3SYX A;  4WJ7 A;  1Y19 B;  5C5B B;  1J19 A;  3DXE A;  2KGX B;  2RSG A;  3NSU A;  2EMS A;  2COA A;  2RUK B;  1NTY A;  2HTH B;  4HAW B;  4A6F B;  1FAO A;  2GS0 A;  5D27 A;  3BIN A;  4ZRK A;  1DDW A;  1QQG A;  4L6E A;  5CLL B;  1UPQ A;  3AU5 A;  5D3V A;  4B6H A;  2D10 A;  4HB4 B;  1BAK A;  2YRY A;  1J0W A;  1DYN A;  2DYN A;  1EAZ A;  1K5G B;  3G9W A;  2W2X D;  5DH9 B;  2DLW A;  4NSW A;  3TO1 A;  5C5B A;  1XKE A;  3FEH A;  3TCA A;  4HAV B;  3D8D A;  3ODW A;  4H8S A;  3CXB B;  1BWN A;  4A6K A;  1N3H A;  1X05 A;  2L2I A;  1H4R A;  5JHH A;  3KRW A;  2IYB A;  1ZSQ A;  2YT0 A;  2Y8G A;  2COD A;  4DXA B;  3SV1 A;  2NZ8 B;  2D9W A;  3PP2 A;  4IFS A;  2MWN B;  1WI1 A;  3D8E A;  3PVU A;  2P0D A;  2LUL A;  5J3Y A;  2D4Q A;  1LW3 A;  1XX0 A;  1DDV A;  3KZ1 A;  5FI0 A;  1M7E A;  2KCJ A;  4K2P A;  3F0W A;  2UZR A;  5HE1 A;  3OAN A;  2YSZ A;  1P6S A;  3PG7 A;  1QC6 A;  1U29 A;  4PQ0 A;  1EF1 A;  2Z0Q A;  1AWE A;  1V61 A;  2DHJ A;  2J0J A;  3M1I B;  3PEG A;  1BTN A;  2G35 A;  3RCP A;  2L1C A;  1WVH A;  1OQN A;  1OY2 A;  1MK9 B;  1WGQ A;  5D3Y A;  2XQN M;  1U5D A;  2IFS A;  3GYP A;  4YL8 A;  1FHX A;  4WVF B;  2ZPY A;  2DX5 A;  2P8V A;  2K2J A;  1P5T A;  1PLS A;  2YS5 A;  1RRP B;  1SGH A;  2QKL A;  2ROV A;  1ZC3 B;  2DKQ A;  2ELA A;  2DHK A;  4GMV A;  4GXB A;  3SUZ A;  2GCL A;  5HE3 A;  2D9X A;  2RGN B;  2I1K A;  5J3T A;  1M7R A;  2P0H A;  4PNK A;  1GC7 A;  3D8F A;  4K81 A;  2CAY A;  2OQB A;  4TYZ A;  5JHG A;  2EC1 A;  4HAZ B;  4A6H A;  1W1G A;  3MDB C;  3DXC A;  2OTX A;  4TKN A;  5KQ1 A;  5C79 A;  2MKR A;  2I5F A;  4CHM A;  2VKI A;  2AL6 A;  3QBV B;  1ZVR A;  1GG3 A;  4MY6 A;  4YON A;  3X23 A;  1XOD A;  5DHF B;  1UNR A;  2J0K A;  3A8P A;  3TFM A;  3CIK A;  1V88 A;  2YT1 A;  1MK7 B;  1XR0 B;  4IOY X;  2YVC A;  1K5D B;  4ZRJ A;  1TJ6 A;  4EJN A;  4XWX A;  1FB8 A;  4GMX B;  1E5W A;  3KSY A;  2LYD A;  2Z0O A;  1MAI A;  1PFJ A;  2D9Z A;  3ML4 A;  3SO6 A;  4HB0 B;  1X1F A;  1XCG A;  4BBK A;  1X1G A;  5DIF B;  2RVB B;  1U5E A;  2YS1 A;  5C16 A;  1V89 A;  2N23 A;  5HE2 A;  4MT7 A;  1FGY A;  2D2Q A;  4GZU A;  3ODO A;  4HHV A;  2MFQ A;  1U27 A;  1KI1 B;  4HAU B;  4HAY B;  2LG1 A;  1WG7 A;  4ZRI A;  3PSC A;  5L81 A;  1DRO A;  3PVL A;  2DTC A;  2K00 A;  3HK0 A;  3T06 A;  3WYF B;  3KRX A;  2VSZ A;  2LKO A;  5J3Q A;  5FI1 A;  2UZS A;  4DX8 A;  1DBH A;  3WA0 A;  4NY0 A;  4KHO A;  4Y94 A;  5DHA B;  1I7A A;  3LJU X;  1V5P A;  1B55 A;  1ZC4 B;  2EJ8 A;  2RNR B;  3VOQ A;  1RJ2 A;  2Z0P A;  2N0Y A;  5D3X A;  2Q13 A;  4D0N B;  3ZDT A;  2CY4 A;  2DN6 A;  3ODX A;  3MPX A;  5JP4 A;  5CLQ B;  1WJ1 A;  1FHO A;  2NMB A;  1FOE A;  2RLO A;  3AJ4 A;  3P7Z A;  4KVG B;  1I2H A;  1U5G A;  4K17 A;  4WSF A;  2DFK A;  1W1H A;  1EVH A;  2I1J A;  3N7C A;  1NU2 A;  3A98 B;  2CY5 A;  1OMW A;  2YF0 A;  2H7E A;  1TQZ A;  4C0A A;  2DHI A;  1AQC A;  2EMT A;  1TXD A;  3PZD A;  4F7G A;  3QIJ A;  2LOX A;  4KHB B;  4HDQ A;  3AU4 A;  5JLJ B;  1P3R A;  1DDM A;  4Z2N A;  2E2X A;  4Z2M B;  2PZ1 A;  5EFX A;  2P0F A;  1MIX A;  2M14 A;  4F7U P;  1NTV A;  2COC A;  3U7D A;  2FJL A;  2MDX A;  1WGU A;  2AEH A;  5LOP B;  4KAX B;  2ADZ A;  2GJY A;  1V5M A;  3P6A A;  2GCJ A;  1ZM0 A;  3F5R A;  4F7H A;  2JP2 A;  2COF A;  2UVM A;  5C6R A;  3IVF A;  2QKM A;  4DBB A;  1GC6 A;  1SHC A;  3A8Q A;  2LOZ A;  1U5F A;  4HB2 B;  2I5C A;  1XD4 A;  4MK0 A;  4GN1 A;  4P7I A;  1MKE A;  3TW1 A;  1X11 A;  5KCV A;  2Y7B A;  4DX9 0;  4A6F A;  1U2B A;  1PMS A;  2W2X C;  3V5W A;  4A5K A;  5KQ4 A;  2H7D A;  3TVV A;  2J0M A;  1WJM A;  4HDO A;  1MIZ B;  1Y5O A;  1V5U A;  4HAT B;  4HAX B;  2Y8F A;  2DKP A;  3BJI A;  3ZVR A;  3GYO A;  1FGZ A;  1H10 A;  2D9V A;  5GOW B;  4CYE A;  3UZT A;  2M38 A;  1FHW A;  1UEF A;  2V76 A;  2J59 M;  2DYQ A;  2R0D A;  1BTK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...