5DHFB

Crystal structure of hrio2 nes peptide in complex with crm1-ran-ranbp1
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
136
structure length
127
Chain Sequence
b'FEPVTMEEDEEVLYKVRAKLFRFDADAKEWKERGTGDCKFLKNKKTNKVRILMRRDKTLKICANHIIAPEYTLKPNVGSDRSWVYACTADIAEGEAEAFTFAIRFGSKENADKFKEEFEKAQEINKK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GTP-binding nuclear protein Ran
publication title Structural determinants of nuclear export signal orientation in binding to exportin CRM1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transport protein
total genus 35
structure length 127
sequence length 136
ec nomenclature
pdb deposition date 2015-08-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00638 Ran_BP1 RanBP1 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 5dhfB00
2LG1A 3O96A 5KQ1A 3SUZA 1W1HA 4ZRJA 5DHFB 2YRYA 1ISNA 1U2BA 2D9XA 1EVHA 1X05A 2LOXA 5HE3A 1ZC4B 2D4QA 2VSZA 5J3TA 2HTHB 3KRWA 4K17A 5C5BB 1BTKA 4A6HA 3U7DA 1KI1B 2ROVA 3AJ4A 1WG7A 1DYNA 5JLJB 4A6KA 1GC7A 2YVCA 4C0AA 2K2JA 2YT0A 3U8ZA 1P3RA 3T06A 4NY0A 3CXBB 4HHVA 2Y8GA 1H10A 2J0KA 2K00A 4MY6A 1XD4A 5JHGA 1X1FA 1M7EA 1GG3A 3HK0A 3AU4A 2IFSA 3PP2A 1Y5OA 2EMTA 3HQCA 2LULA 4A6FA 2I5FA 5FI0A 2XQNM 4K2PA 2RLOA 5HE1A 4CHJA 1PLSA 1WJ1A 5KQ4A 4EKUA 3TO1A 2Q13A 3D8DA 4PNKA 1AWEA 2CODA 1OY2A 3ULBA 4Z2NA 3TCAA 5D3XA 2N0YA 2D9ZA 2DA0A 2MDXA 4ZRKA 2DKPA 3DXEA 3FEHA 1FHOA 1BTNA 2UVMA 3A8PA 2R0DA 2RUKB 1P6SA 1DROA 5D3VA 2D11A 3D8EA 3FSSA 2COAA 1FAOA 2VRWB 4HATB 4CYEA 2CY5A 2ZPYA 2YS3A 3NSUA 1X1GA 5J3QA 2GCJA 2YS1A 3F0WA 4HAZB 2GS0A 1U5DA 2DLWA 5JHHA 2D10A 1MPHA 4DX8A 2KCJA 3PG7A 4WJ7A 3ODOA 4WVFB 2Z0QA 3MDBC 2L2IA 4D0NB 2EJ8A 5EFXA 2ELAA 1IRSA 2G35A 2D9VA 2DX1A 1V61A 1MK9B 3KY9A 2LKOA 2RNRB 2P0DA 1FHWA 2RGNB 4L6EA 2CY4A 5D3WA 1ZC3B 3SNHA 3TW1A 2Y7BA 1I7AA 2I1JA 3X23A 4HAUB 1W1GA 2W2XC 3A8QA 1FHXA 5CLLB 4KHOA 4A6FB 3TVVA 3ULCA 4YONA 1WI1A 2LYDA 2D9WA 2I5CA 1DDWA 1UNRA 3AU5A 5DH9B 3RCPA 4HAXB 3ODXA 1DDMA 3ML4A 2I1KA 2DHJA 1U5GA 1E5WA 2N23A 4KVGB 1P5TA 3WA0A 5DI9B 5JP4A 1EF1A 1FGZA 1ZM0A 1K5GB 1V88A 2K2UA 1Z87A 4HB3B 2DN6A 3VOQA 1XODA 1UNPA 2V76A 1BAKA 5D27A 2HE7A 3SV1A 2J0JA 1XCGA 3IVFA 4GN1A 4HB2B 1UPQA 1SGHA 1GC6A 1QC6A 1V5UA 3KRXA 2Y8FA 3P6AA 1N3HA 3UZTA 2RSGA 1KZ7A 4IOYX 1XKEA 4KAXB 2ROZB 4Z2MB 2D9YA 2DKQA 4EMOA 4F7GA 3SYXA 1QQGA 2VKIA 4HAYB 1BWNA 4GPTB 2P8VA 2P0HA 1TJ6A 2GJYA 2OTXA 1NTVA 4BBKA 3WYFB 4EJNA 1EAZA 2DHKA 1FB8A 2LOZA 2IYBA 4MK0A 1X86A 1MKEA 1X11A 4P7IA 3ODWA 5GOWB 1LB1A 3VIAA 1NTYA 3PVWA 2CRFA 4XWXA 1DDVA 1MIZB 1K5DB 4F7UP 3GYPA 3FM8C 4HDQA 4MT7A 1U5EA 1U29A 2MWNB 2JP2A 4HAVB 1B55A 1I2HA 3KZ1A 1OQNA 1RJ2A 1WGQA 2L1CA 3OANA 4HAWB 2DX5A 2P0FA 5L81A 3M1IB 4KHBB 4A5KA 4GZUA 2CAYA 3MPXA 1PMSA 2E2XA 2OQBA 4HDOA 2DTCA 1ZVRA 3SO6A 2X18A 1W1DA 2DYQA 5LOPB 2YF0A 3G9WA 1V5PA 2PZ1A 2M38A 2QKMA 1UEFA 5DHAB 1V5MA 1M7RA 4WSFA 5DIFB 1J19A 3BINA 1FOEA 2M14A 4GXBA 2NMBA 2QKLA 4K81A 2Z0PA 2YSZA 1RRPB 1ZSQA 2DFKA 2MFQA 4DXAB 4H8SA 1WVHA 1V89A 2COCA 4ZRIA 4NSWA 3DXCA 1Y19B 3CIKA 1Q67A 5HE2A 4B6HA 4KHAA 1TXDA 5J3YA 5C5BA 1KZGA 1AQCA 3TFMA 1DBHA 5C79A 2EMSA 4YL8A 5FI1A 3DXDA 1H4RA 3PZDA 3ZDTA 1LW3A 2W2XD 3QBVB 2ADZA 2BCJA 4PQ0A 2NZ8B 2GCLA 1MIXA 2EC1A 3GYOA 3P7ZA 1OMWA 2YT1A 5D3YA 5HE0A 2KUPA 1EGXA 2R09A 4K2OA 1TQZA 3D8FA 4CHMA 4TKNA 1U5FA 3HW2B 2UZRA 2D2QA 3QWMA 4HB0B 2H7EA 4GMVA 5KCVA 2ELBA 2KGXB 1SHCA 3KSYA 5C6RA 3QIJA 4HB4B 2DYNA 3F5RA 3PSCA 4IFSA 4DBBA 2Z0OA 1XR0B 3LJUX 2J0MA 5C16A 1NI2A 1PFJA 3PVUA 4Y94A 1NU2A 2H7DA 3PVLA 3PEGA 4GMXB 4F7HA 2COFA 1UNQA 4DX90 2W2WA 3ZVRA 3BJIA 1XX0A 5LONB 2J59M 4IAPA 2DHIA 1WGUA 2FJLA 1WJMA 2YS5A 1FGYA 2MKRA 4TYZA 1J0WA 1UPRA 2RVBB 3N7CA 1MK7B 3A98B 2UZSA 2AL6A 1U27A 5CLQB 1MAIA 3V5WA 2AEHA
chains in the Genus database with same CATH superfamily
2LG1A 3O96A 5KQ1A 3SUZA 1W1HA 4ZRJA 5DHFB 2YRYA 1ISNA 1U2BA 2D9XA 1EVHA 1X05A 2LOXA 5HE3A 1ZC4B 2D4QA 2VSZA 5J3TA 2HTHB 3KRWA 4K17A 4QJ3B 4DIXA 5C5BB 1ZYIA 1BTKA 4A6HA 3U7DA 1KI1B 2ROVA 3AJ4A 1WG7A 1DYNA 5JLJB 4A6KA 1GC7A 2YVCA 4C0AA 2K2JA 2YT0A 3U8ZA 1P3RA 3T06A 4NY0A 3CXBB 4HHVA 2Y8GA 1H10A 2J0KA 2K00A 4MY6A 1XD4A 5JHGA 1X1FA 1M7EA 1GG3A 3HK0A 4D6WA 3AU4A 2IFSA 3PP2A 1Y5OA 2EMTA 3HQCA 2NBVA 2LULA 2Z13A 4A6FA 5LG4B 2I5FA 5FI0A 4CSQA 2XQNM 4K2PA 2RLOA 5HE1A 4CHJA 1PLSA 1WJ1A 5KQ4A 4EKUA 2FJUB 3TO1A 2Q13A 3D8DA 4PNKA 1AWEA 2CODA 2KIGA 1OY2A 3ULBA 4Z2NA 3TCAA 5D3XA 2N0YA 2D9ZA 2DA0A 2MDXA 4ZRKA 2DKPA 3DXEA 3U12A 3FEHA 1FHOA 1BTNA 2UVMA 3A8PA 2R0DA 2RUKB 5M4YB 1P6SA 1DROA 5D3VA 4QXAB 2D11A 3D8EA 3FSSA 2COAA 1FAOA 2VRWB 4HATB 4CYEA 2CY5A 2KIEA 2ZPYA 2YS3A 3NSUA 1X1GA 2ZKMX 5J3QA 2GCJA 2YS1A 3F0WA 4HAZB 2GS0A 3FVCA 1U5DA 2DLWA 5JHHA 2D10A 1MPHA 4DX8A 2KCJA 3PG7A 4WJ7A 3ODOA 4WVFB 2Z0QA 3MDBC 2L2IA 4D0NB 2EJ8A 5EFXA 2ELAA 1IRSA 1T77A 2G35A 2D9VA 2DX1A 1V61A 1MK9B 3KY9A 2LKOA 2RNRB 2P0DA 2K8EA 1FHWA 2RRFA 2RGNB 4L6EA 2CY4A 5D3WA 1ZC3B 3SNHA 3TW1A 2Y7BA 1I7AA 2I1JA 3X23A 4HAUB 1W1GA 2W2XC 3A8QA 1FHXA 5CLLB 4KHOA 4A6FB 3HIEA 3TVVA 3ULCA 4KHBA 4YONA 1WI1A 3NW8A 2LYDA 2D9WA 2I5CA 1DDWA 1UNRA 3AU5A 5DH9B 3RCPA 4HAXB 3ODXA 1DDMA 3OHMB 3ML4A 2I1KA 1MI1A 2DHJA 2Z14A 2KUQA 1U5GA 1E5WA 2N23A 4KVGB 1P5TA 3WA0A 3NWFA 5DI9B 5JP4A 1EF1A 1FGZA 1ZM0A 1K5GB 1V88A 2K2UA 1Z87A 4HB3B 2DN6A 3VOQA 1XODA 3NWAA 1UNPA 2V76A 1BAKA 5D27A 2HE7A 3SV1A 2J0JA 1XCGA 3IVFA 4GN1A 4HB2B 1UPQA 1SGHA 1GC6A 1QC6A 1V5UA 3KRXA 2Y8FA 3P6AA 1N3HA 2R2YA 3UZTA 2RSGA 1KZ7A 4IOYX 1XKEA 2KR0A 4KAXB 2YT2A 5I2MA 2ROZB 4Z2MB 2D9YA 2DKQA 4EMOA 4F7GA 3SYXA 1QQGA 2VKIA 4HAYB 1BWNA 4GPTB 2P8VA 2P0HA 1TJ6A 2GJYA 2OTXA 1NTVA 4BBKA 3WYFB 4EJNA 1EAZA 2DHKA 1FB8A 2LOZA 2IYBA 4MK0A 1X86A 4L1RA 1MKEA 1X11A 4P7IA 3ODWA 5GOWB 1LB1A 3VIAA 5IRSA 1NTYA 3NWDA 3PVWA 2CRFA 4XWXA 1DDVA 4GOUA 1MIZB 1K5DB 4F7UP 3GYPA 3FM8C 4HDQA 4MT7A 1U5EA 1U29A 2MWNB 2JP2A 4HAVB 2Z4DA 1B55A 1I2HA 3KZ1A 1OQNA 1RJ2A 1WGQA 2L1CA 3OANA 4HAWB 2DX5A 2GUMA 2P0FA 5L81A 3M1IB 4KHBB 4A5KA 4QJ5B 4GZUA 2CAYA 3MPXA 1PMSA 2E2XA 2OQBA 4HDOA 2DTCA 1ZVRA 3SO6A 2X18A 1W1DA 2DYQA 5LOPB 2YF0A 3G9WA 1V5PA 2PZ1A 2M38A 2QKMA 1UEFA 5DHAB 1V5MA 1M7RA 4WSFA 5DIFB 1J19A 3A58A 3BINA 1FOEA 2M14A 4GXBA 2NMBA 2QKLA 4K81A 2Z0PA 2YSZA 1RRPB 1ZSQA 2DFKA 2MFQA 4DXAB 4H8SA 1WVHA 1V89A 2COCA 2Z59A 4ZRIA 4NSWA 3DXCA 1Y19B 3CIKA 1Q67A 5HE2A 4B6HA 4KHAA 1TXDA 5J3YA 5C5BA 5I2SA 1KZGA 1AQCA 3TFMA 1DBHA 5C79A 4GNKB 2EMSA 4YL8A 5FI1A 3DXDA 1H4RA 3PZDA 3ZDTA 1LW3A 2W2XD 3QBVB 2ADZA 2BCJA 4HSIA 4PQ0A 2NZ8B 2GCLA 1MIXA 2EC1A 3GYOA 3P7ZA 1OMWA 2YT1A 5D3YA 5HE0A 2KUPA 1EGXA 2R09A 4K2OA 1TQZA 3D8FA 4CHMA 4TKNA 1U5FA 3HSAA 3HW2B 2UZRA 2D2QA 3QWMA 4HB0B 2H7EA 4GMVA 5KCVA 2ELBA 2KGXB 1SHCA 3KSYA 5C6RA 3QIJA 4HB4B 2DYNA 3F5RA 4OSNA 3PSCA 4IFSA 4DBBA 2Z0OA 1XR0B 3LJUX 3DCXA 2J0MA 5C16A 1NI2A 1PFJA 3PVUA 3B77A 4Y94A 1NU2A 2H7DA 3PVLA 3PEGA 4OT1A 4GMXB 4F7HA 2COFA 1UNQA 4DX90 2W2WA 3ZVRA 3BJIA 1XX0A 5LONB 2J59M 4IAPA 2DHIA 1WGUA 2FJLA 1WJMA 2YS5A 1FGYA 2MKRA 4TYZA 1J0WA 1UPRA 2RVBB 2K49A 3N7CA 4QJ4B 1MK7B 3A98B 2UZSA 2AL6A 1U27A 5CLQB 1MAIA 3V5WA 2AEHA
chains in the Genus database with same CATH topology
2LG1A 3O96A 5KQ1A 3SUZA 1W1HA 4ZRJA 5DHFB 2YRYA 1ISNA 1U2BA 2D9XA 1EVHA 1X05A 2LOXA 5HE3A 1ZC4B 2D4QA 2VSZA 5J3TA 2HTHB 3KRWA 4K17A 5C5BB 1BTKA 4A6HA 3U7DA 1KI1B 2ROVA 3AJ4A 1WG7A 1DYNA 5JLJB 4A6KA 1GC7A 2YVCA 4C0AA 2K2JA 2YT0A 3U8ZA 1P3RA 3T06A 4NY0A 3CXBB 4HHVA 2Y8GA 1H10A 2J0KA 2K00A 4MY6A 1XD4A 5JHGA 1X1FA 1M7EA 1GG3A 3HK0A 3AU4A 2IFSA 3PP2A 1Y5OA 2EMTA 3HQCA 2LULA 4A6FA 2I5FA 5FI0A 2XQNM 4K2PA 2RLOA 5HE1A 4CHJA 1PLSA 1WJ1A 5KQ4A 4EKUA 3TO1A 2Q13A 3D8DA 4PNKA 1AWEA 2CODA 1OY2A 3ULBA 4Z2NA 3TCAA 5D3XA 2N0YA 2D9ZA 2DA0A 2MDXA 4ZRKA 2DKPA 3DXEA 3FEHA 1FHOA 1BTNA 2UVMA 3A8PA 2R0DA 2RUKB 1P6SA 1DROA 5D3VA 2D11A 3D8EA 3FSSA 2COAA 1FAOA 2VRWB 4HATB 4CYEA 2CY5A 2ZPYA 2YS3A 3NSUA 1X1GA 5J3QA 2GCJA 2YS1A 3F0WA 4HAZB 2GS0A 1U5DA 2DLWA 5JHHA 2D10A 1MPHA 4DX8A 2KCJA 3PG7A 4WJ7A 3ODOA 4WVFB 2Z0QA 3MDBC 2L2IA 4D0NB 2EJ8A 5EFXA 2ELAA 1IRSA 2G35A 2D9VA 2DX1A 1V61A 1MK9B 3KY9A 2LKOA 2RNRB 2P0DA 1FHWA 2RGNB 4L6EA 2CY4A 5D3WA 1ZC3B 3SNHA 3TW1A 2Y7BA 1I7AA 2I1JA 3X23A 4HAUB 1W1GA 2W2XC 3A8QA 1FHXA 5CLLB 4KHOA 4A6FB 3TVVA 3ULCA 4YONA 1WI1A 2LYDA 2D9WA 2I5CA 1DDWA 1UNRA 3AU5A 5DH9B 3RCPA 4HAXB 3ODXA 1DDMA 3ML4A 2I1KA 2DHJA 1U5GA 1E5WA 2N23A 4KVGB 1P5TA 3WA0A 5DI9B 5JP4A 1EF1A 1FGZA 1ZM0A 1K5GB 1V88A 2K2UA 1Z87A 4HB3B 2DN6A 3VOQA 1XODA 1UNPA 2V76A 1BAKA 5D27A 2HE7A 3SV1A 2J0JA 1XCGA 3IVFA 4GN1A 4HB2B 1UPQA 1SGHA 1GC6A 1QC6A 1V5UA 3KRXA 2Y8FA 3P6AA 1N3HA 3UZTA 2RSGA 1KZ7A 4IOYX 1XKEA 4KAXB 2ROZB 4Z2MB 2D9YA 2DKQA 4EMOA 4F7GA 3SYXA 1QQGA 2VKIA 4HAYB 1BWNA 4GPTB 2P8VA 2P0HA 1TJ6A 2GJYA 2OTXA 1NTVA 4BBKA 3WYFB 4EJNA 1EAZA 2DHKA 1FB8A 2LOZA 2IYBA 4MK0A 1X86A 1MKEA 1X11A 4P7IA 3ODWA 5GOWB 1LB1A 3VIAA 1NTYA 3PVWA 2CRFA 4XWXA 1DDVA 1MIZB 1K5DB 4F7UP 3GYPA 3FM8C 4HDQA 4MT7A 1U5EA 1U29A 2MWNB 2JP2A 4HAVB 1B55A 1I2HA 3KZ1A 1OQNA 1RJ2A 1WGQA 2L1CA 3OANA 4HAWB 2DX5A 2P0FA 5L81A 3M1IB 4KHBB 4A5KA 4GZUA 2CAYA 3MPXA 1PMSA 2E2XA 2OQBA 4HDOA 2DTCA 1ZVRA 3SO6A 2X18A 1W1DA 2DYQA 5LOPB 2YF0A 3G9WA 1V5PA 2PZ1A 2M38A 2QKMA 1UEFA 5DHAB 1V5MA 1M7RA 4WSFA 5DIFB 1J19A 3BINA 1FOEA 2M14A 4GXBA 2NMBA 2QKLA 4K81A 2Z0PA 2YSZA 1RRPB 1ZSQA 2DFKA 2MFQA 4DXAB 4H8SA 1WVHA 1V89A 2COCA 4ZRIA 4NSWA 3DXCA 1Y19B 3CIKA 1Q67A 5HE2A 4B6HA 4KHAA 1TXDA 5J3YA 5C5BA 1KZGA 1AQCA 3TFMA 1DBHA 5C79A 2EMSA 4YL8A 5FI1A 3DXDA 1H4RA 3PZDA 3ZDTA 1LW3A 2W2XD 3QBVB 2ADZA 2BCJA 4PQ0A 2NZ8B 2GCLA 1MIXA 2EC1A 3GYOA 3P7ZA 1OMWA 2YT1A 5D3YA 5HE0A 2KUPA 1EGXA 2R09A 4K2OA 1TQZA 3D8FA 4CHMA 4TKNA 1U5FA 3HW2B 2UZRA 2D2QA 3QWMA 4HB0B 2H7EA 4GMVA 5KCVA 2ELBA 2KGXB 1SHCA 3KSYA 5C6RA 3QIJA 4HB4B 2DYNA 3F5RA 3PSCA 4IFSA 4DBBA 2Z0OA 1XR0B 3LJUX 2J0MA 5C16A 1NI2A 1PFJA 3PVUA 4Y94A 1NU2A 2H7DA 3PVLA 3PEGA 4GMXB 4F7HA 2COFA 1UNQA 4DX90 2W2WA 3ZVRA 3BJIA 1XX0A 5LONB 2J59M 4IAPA 2DHIA 1WGUA 2FJLA 1WJMA 2YS5A 1FGYA 2MKRA 4TYZA 1J0WA 1UPRA 2RVBB 3N7CA 1MK7B 3A98B 2UZSA 2AL6A 1U27A 5CLQB 1MAIA 3V5WA 2AEHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LG1 A;  3O96 A;  5KQ1 A;  3SUZ A;  1W1H A;  4ZRJ A;  5DHF B;  2YRY A;  1ISN A;  1U2B A;  2D9X A;  1EVH A;  1X05 A;  2LOX A;  5HE3 A;  1ZC4 B;  2D4Q A;  2VSZ A;  5J3T A;  2HTH B;  3KRW A;  4K17 A;  5C5B B;  1BTK A;  4A6H A;  3U7D A;  1KI1 B;  2ROV A;  3AJ4 A;  1WG7 A;  1DYN A;  5JLJ B;  4A6K A;  1GC7 A;  2YVC A;  4C0A A;  2K2J A;  2YT0 A;  3U8Z A;  1P3R A;  3T06 A;  4NY0 A;  3CXB B;  4HHV A;  2Y8G A;  1H10 A;  2J0K A;  2K00 A;  4MY6 A;  1XD4 A;  5JHG A;  1X1F A;  1M7E A;  1GG3 A;  3HK0 A;  3AU4 A;  2IFS A;  3PP2 A;  1Y5O A;  2EMT A;  3HQC A;  2LUL A;  4A6F A;  2I5F A;  5FI0 A;  2XQN M;  4K2P A;  2RLO A;  5HE1 A;  4CHJ A;  1PLS A;  1WJ1 A;  5KQ4 A;  4EKU A;  3TO1 A;  2Q13 A;  3D8D A;  4PNK A;  1AWE A;  2COD A;  1OY2 A;  3ULB A;  4Z2N A;  3TCA A;  5D3X A;  2N0Y A;  2D9Z A;  2DA0 A;  2MDX A;  4ZRK A;  2DKP A;  3DXE A;  3FEH A;  1FHO A;  1BTN A;  2UVM A;  3A8P A;  2R0D A;  2RUK B;  1P6S A;  1DRO A;  5D3V A;  2D11 A;  3D8E A;  3FSS A;  2COA A;  1FAO A;  2VRW B;  4HAT B;  4CYE A;  2CY5 A;  2ZPY A;  2YS3 A;  3NSU A;  1X1G A;  5J3Q A;  2GCJ A;  2YS1 A;  3F0W A;  4HAZ B;  2GS0 A;  1U5D A;  2DLW A;  5JHH A;  2D10 A;  1MPH A;  4DX8 A;  2KCJ A;  3PG7 A;  4WJ7 A;  3ODO A;  4WVF B;  2Z0Q A;  3MDB C;  2L2I A;  4D0N B;  2EJ8 A;  5EFX A;  2ELA A;  1IRS A;  2G35 A;  2D9V A;  2DX1 A;  1V61 A;  1MK9 B;  3KY9 A;  2LKO A;  2RNR B;  2P0D A;  1FHW A;  2RGN B;  4L6E A;  2CY4 A;  5D3W A;  1ZC3 B;  3SNH A;  3TW1 A;  2Y7B A;  1I7A A;  2I1J A;  3X23 A;  4HAU B;  1W1G A;  2W2X C;  3A8Q A;  1FHX A;  5CLL B;  4KHO A;  4A6F B;  3TVV A;  3ULC A;  4YON A;  1WI1 A;  2LYD A;  2D9W A;  2I5C A;  1DDW A;  1UNR A;  3AU5 A;  5DH9 B;  3RCP A;  4HAX B;  3ODX A;  1DDM A;  3ML4 A;  2I1K A;  2DHJ A;  1U5G A;  1E5W A;  2N23 A;  4KVG B;  1P5T A;  3WA0 A;  5DI9 B;  5JP4 A;  1EF1 A;  1FGZ A;  1ZM0 A;  1K5G B;  1V88 A;  2K2U A;  1Z87 A;  4HB3 B;  2DN6 A;  3VOQ A;  1XOD A;  1UNP A;  2V76 A;  1BAK A;  5D27 A;  2HE7 A;  3SV1 A;  2J0J A;  1XCG A;  3IVF A;  4GN1 A;  4HB2 B;  1UPQ A;  1SGH A;  1GC6 A;  1QC6 A;  1V5U A;  3KRX A;  2Y8F A;  3P6A A;  1N3H A;  3UZT A;  2RSG A;  1KZ7 A;  4IOY X;  1XKE A;  4KAX B;  2ROZ B;  4Z2M B;  2D9Y A;  2DKQ A;  4EMO A;  4F7G A;  3SYX A;  1QQG A;  2VKI A;  4HAY B;  1BWN A;  4GPT B;  2P8V A;  2P0H A;  1TJ6 A;  2GJY A;  2OTX A;  1NTV A;  4BBK A;  3WYF B;  4EJN A;  1EAZ A;  2DHK A;  1FB8 A;  2LOZ A;  2IYB A;  4MK0 A;  1X86 A;  1MKE A;  1X11 A;  4P7I A;  3ODW A;  5GOW B;  1LB1 A;  3VIA A;  1NTY A;  3PVW A;  2CRF A;  4XWX A;  1DDV A;  1MIZ B;  1K5D B;  4F7U P;  3GYP A;  3FM8 C;  4HDQ A;  4MT7 A;  1U5E A;  1U29 A;  2MWN B;  2JP2 A;  4HAV B;  1B55 A;  1I2H A;  3KZ1 A;  1OQN A;  1RJ2 A;  1WGQ A;  2L1C A;  3OAN A;  4HAW B;  2DX5 A;  2P0F A;  5L81 A;  3M1I B;  4KHB B;  4A5K A;  4GZU A;  2CAY A;  3MPX A;  1PMS A;  2E2X A;  2OQB A;  4HDO A;  2DTC A;  1ZVR A;  3SO6 A;  2X18 A;  1W1D A;  2DYQ A;  5LOP B;  2YF0 A;  3G9W A;  1V5P A;  2PZ1 A;  2M38 A;  2QKM A;  1UEF A;  5DHA B;  1V5M A;  1M7R A;  4WSF A;  5DIF B;  1J19 A;  3BIN A;  1FOE A;  2M14 A;  4GXB A;  2NMB A;  2QKL A;  4K81 A;  2Z0P A;  2YSZ A;  1RRP B;  1ZSQ A;  2DFK A;  2MFQ A;  4DXA B;  4H8S A;  1WVH A;  1V89 A;  2COC A;  4ZRI A;  4NSW A;  3DXC A;  1Y19 B;  3CIK A;  1Q67 A;  5HE2 A;  4B6H A;  4KHA A;  1TXD A;  5J3Y A;  5C5B A;  1KZG A;  1AQC A;  3TFM A;  1DBH A;  5C79 A;  2EMS A;  4YL8 A;  5FI1 A;  3DXD A;  1H4R A;  3PZD A;  3ZDT A;  1LW3 A;  2W2X D;  3QBV B;  2ADZ A;  2BCJ A;  4PQ0 A;  2NZ8 B;  2GCL A;  1MIX A;  2EC1 A;  3GYO A;  3P7Z A;  1OMW A;  2YT1 A;  5D3Y A;  5HE0 A;  2KUP A;  1EGX A;  2R09 A;  4K2O A;  1TQZ A;  3D8F A;  4CHM A;  4TKN A;  1U5F A;  3HW2 B;  2UZR A;  2D2Q A;  3QWM A;  4HB0 B;  2H7E A;  4GMV A;  5KCV A;  2ELB A;  2KGX B;  1SHC A;  3KSY A;  5C6R A;  3QIJ A;  4HB4 B;  2DYN A;  3F5R A;  3PSC A;  4IFS A;  4DBB A;  2Z0O A;  1XR0 B;  3LJU X;  2J0M A;  5C16 A;  1NI2 A;  1PFJ A;  3PVU A;  4Y94 A;  1NU2 A;  2H7D A;  3PVL A;  3PEG A;  4GMX B;  4F7H A;  2COF A;  1UNQ A;  4DX9 0;  2W2W A;  3ZVR A;  3BJI A;  1XX0 A;  5LON B;  2J59 M;  4IAP A;  2DHI A;  1WGU A;  2FJL A;  1WJM A;  2YS5 A;  1FGY A;  2MKR A;  4TYZ A;  1J0W A;  1UPR A;  2RVB B;  3N7C A;  1MK7 B;  3A98 B;  2UZS A;  2AL6 A;  1U27 A;  5CLQ B;  1MAI A;  3V5W A;  2AEH A; 
#chains in the Genus database with same CATH topology
 2LG1 A;  3O96 A;  5KQ1 A;  3SUZ A;  1W1H A;  4ZRJ A;  5DHF B;  2YRY A;  1ISN A;  1U2B A;  2D9X A;  1EVH A;  1X05 A;  2LOX A;  5HE3 A;  1ZC4 B;  2D4Q A;  2VSZ A;  5J3T A;  2HTH B;  3KRW A;  4K17 A;  4QJ3 B;  4DIX A;  5C5B B;  1ZYI A;  1BTK A;  4A6H A;  3U7D A;  1KI1 B;  2ROV A;  3AJ4 A;  1WG7 A;  1DYN A;  5JLJ B;  4A6K A;  1GC7 A;  2YVC A;  4C0A A;  2K2J A;  2YT0 A;  3U8Z A;  1P3R A;  3T06 A;  4NY0 A;  3CXB B;  4HHV A;  2Y8G A;  1H10 A;  2J0K A;  2K00 A;  4MY6 A;  1XD4 A;  5JHG A;  1X1F A;  1M7E A;  1GG3 A;  3HK0 A;  4D6W A;  3AU4 A;  2IFS A;  3PP2 A;  1Y5O A;  2EMT A;  3HQC A;  2NBV A;  2LUL A;  2Z13 A;  4A6F A;  5LG4 B;  2I5F A;  5FI0 A;  4CSQ A;  2XQN M;  4K2P A;  2RLO A;  5HE1 A;  4CHJ A;  1PLS A;  1WJ1 A;  5KQ4 A;  4EKU A;  2FJU B;  3TO1 A;  2Q13 A;  3D8D A;  4PNK A;  1AWE A;  2COD A;  2KIG A;  1OY2 A;  3ULB A;  4Z2N A;  3TCA A;  5D3X A;  2N0Y A;  2D9Z A;  2DA0 A;  2MDX A;  4ZRK A;  2DKP A;  3DXE A;  3U12 A;  3FEH A;  1FHO A;  1BTN A;  2UVM A;  3A8P A;  2R0D A;  2RUK B;  5M4Y B;  1P6S A;  1DRO A;  5D3V A;  4QXA B;  2D11 A;  3D8E A;  3FSS A;  2COA A;  1FAO A;  2VRW B;  4HAT B;  4CYE A;  2CY5 A;  2KIE A;  2ZPY A;  2YS3 A;  3NSU A;  1X1G A;  2ZKM X;  5J3Q A;  2GCJ A;  2YS1 A;  3F0W A;  4HAZ B;  2GS0 A;  3FVC A;  1U5D A;  2DLW A;  5JHH A;  2D10 A;  1MPH A;  4DX8 A;  2KCJ A;  3PG7 A;  4WJ7 A;  3ODO A;  4WVF B;  2Z0Q A;  3MDB C;  2L2I A;  4D0N B;  2EJ8 A;  5EFX A;  2ELA A;  1IRS A;  1T77 A;  2G35 A;  2D9V A;  2DX1 A;  1V61 A;  1MK9 B;  3KY9 A;  2LKO A;  2RNR B;  2P0D A;  2K8E A;  1FHW A;  2RRF A;  2RGN B;  4L6E A;  2CY4 A;  5D3W A;  1ZC3 B;  3SNH A;  3TW1 A;  2Y7B A;  1I7A A;  2I1J A;  3X23 A;  4HAU B;  1W1G A;  2W2X C;  3A8Q A;  1FHX A;  5CLL B;  4KHO A;  4A6F B;  3HIE A;  3TVV A;  3ULC A;  4KHB A;  4YON A;  1WI1 A;  3NW8 A;  2LYD A;  2D9W A;  2I5C A;  1DDW A;  1UNR A;  3AU5 A;  5DH9 B;  3RCP A;  4HAX B;  3ODX A;  1DDM A;  3OHM B;  3ML4 A;  2I1K A;  1MI1 A;  2DHJ A;  2Z14 A;  2KUQ A;  1U5G A;  1E5W A;  2N23 A;  4KVG B;  1P5T A;  3WA0 A;  3NWF A;  5DI9 B;  5JP4 A;  1EF1 A;  1FGZ A;  1ZM0 A;  1K5G B;  1V88 A;  2K2U A;  1Z87 A;  4HB3 B;  2DN6 A;  3VOQ A;  1XOD A;  3NWA A;  1UNP A;  2V76 A;  1BAK A;  5D27 A;  2HE7 A;  3SV1 A;  2J0J A;  1XCG A;  3IVF A;  4GN1 A;  4HB2 B;  1UPQ A;  1SGH A;  1GC6 A;  1QC6 A;  1V5U A;  3KRX A;  2Y8F A;  3P6A A;  1N3H A;  2R2Y A;  3UZT A;  2RSG A;  1KZ7 A;  4IOY X;  1XKE A;  2KR0 A;  4KAX B;  2YT2 A;  5I2M A;  2ROZ B;  4Z2M B;  2D9Y A;  2DKQ A;  4EMO A;  4F7G A;  3SYX A;  1QQG A;  2VKI A;  4HAY B;  1BWN A;  4GPT B;  2P8V A;  2P0H A;  1TJ6 A;  2GJY A;  2OTX A;  1NTV A;  4BBK A;  3WYF B;  4EJN A;  1EAZ A;  2DHK A;  1FB8 A;  2LOZ A;  2IYB A;  4MK0 A;  1X86 A;  4L1R A;  1MKE A;  1X11 A;  4P7I A;  3ODW A;  5GOW B;  1LB1 A;  3VIA A;  5IRS A;  1NTY A;  3NWD A;  3PVW A;  2CRF A;  4XWX A;  1DDV A;  4GOU A;  1MIZ B;  1K5D B;  4F7U P;  3GYP A;  3FM8 C;  4HDQ A;  4MT7 A;  1U5E A;  1U29 A;  2MWN B;  2JP2 A;  4HAV B;  2Z4D A;  1B55 A;  1I2H A;  3KZ1 A;  1OQN A;  1RJ2 A;  1WGQ A;  2L1C A;  3OAN A;  4HAW B;  2DX5 A;  2GUM A;  2P0F A;  5L81 A;  3M1I B;  4KHB B;  4A5K A;  4QJ5 B;  4GZU A;  2CAY A;  3MPX A;  1PMS A;  2E2X A;  2OQB A;  4HDO A;  2DTC A;  1ZVR A;  3SO6 A;  2X18 A;  1W1D A;  2DYQ A;  5LOP B;  2YF0 A;  3G9W A;  1V5P A;  2PZ1 A;  2M38 A;  2QKM A;  1UEF A;  5DHA B;  1V5M A;  1M7R A;  4WSF A;  5DIF B;  1J19 A;  3A58 A;  3BIN A;  1FOE A;  2M14 A;  4GXB A;  2NMB A;  2QKL A;  4K81 A;  2Z0P A;  2YSZ A;  1RRP B;  1ZSQ A;  2DFK A;  2MFQ A;  4DXA B;  4H8S A;  1WVH A;  1V89 A;  2COC A;  2Z59 A;  4ZRI A;  4NSW A;  3DXC A;  1Y19 B;  3CIK A;  1Q67 A;  5HE2 A;  4B6H A;  4KHA A;  1TXD A;  5J3Y A;  5C5B A;  5I2S A;  1KZG A;  1AQC A;  3TFM A;  1DBH A;  5C79 A;  4GNK B;  2EMS A;  4YL8 A;  5FI1 A;  3DXD A;  1H4R A;  3PZD A;  3ZDT A;  1LW3 A;  2W2X D;  3QBV B;  2ADZ A;  2BCJ A;  4HSI A;  4PQ0 A;  2NZ8 B;  2GCL A;  1MIX A;  2EC1 A;  3GYO A;  3P7Z A;  1OMW A;  2YT1 A;  5D3Y A;  5HE0 A;  2KUP A;  1EGX A;  2R09 A;  4K2O A;  1TQZ A;  3D8F A;  4CHM A;  4TKN A;  1U5F A;  3HSA A;  3HW2 B;  2UZR A;  2D2Q A;  3QWM A;  4HB0 B;  2H7E A;  4GMV A;  5KCV A;  2ELB A;  2KGX B;  1SHC A;  3KSY A;  5C6R A;  3QIJ A;  4HB4 B;  2DYN A;  3F5R A;  4OSN A;  3PSC A;  4IFS A;  4DBB A;  2Z0O A;  1XR0 B;  3LJU X;  3DCX A;  2J0M A;  5C16 A;  1NI2 A;  1PFJ A;  3PVU A;  3B77 A;  4Y94 A;  1NU2 A;  2H7D A;  3PVL A;  3PEG A;  4OT1 A;  4GMX B;  4F7H A;  2COF A;  1UNQ A;  4DX9 0;  2W2W A;  3ZVR A;  3BJI A;  1XX0 A;  5LON B;  2J59 M;  4IAP A;  2DHI A;  1WGU A;  2FJL A;  1WJM A;  2YS5 A;  1FGY A;  2MKR A;  4TYZ A;  1J0W A;  1UPR A;  2RVB B;  2K49 A;  3N7C A;  4QJ4 B;  1MK7 B;  3A98 B;  2UZS A;  2AL6 A;  1U27 A;  5CLQ B;  1MAI A;  3V5W A;  2AEH A; 
#chains in the Genus database with same CATH homology
 2LG1 A;  3O96 A;  5KQ1 A;  3SUZ A;  1W1H A;  4ZRJ A;  5DHF B;  2YRY A;  1ISN A;  1U2B A;  2D9X A;  1EVH A;  1X05 A;  2LOX A;  5HE3 A;  1ZC4 B;  2D4Q A;  2VSZ A;  5J3T A;  2HTH B;  3KRW A;  4K17 A;  5C5B B;  1BTK A;  4A6H A;  3U7D A;  1KI1 B;  2ROV A;  3AJ4 A;  1WG7 A;  1DYN A;  5JLJ B;  4A6K A;  1GC7 A;  2YVC A;  4C0A A;  2K2J A;  2YT0 A;  3U8Z A;  1P3R A;  3T06 A;  4NY0 A;  3CXB B;  4HHV A;  2Y8G A;  1H10 A;  2J0K A;  2K00 A;  4MY6 A;  1XD4 A;  5JHG A;  1X1F A;  1M7E A;  1GG3 A;  3HK0 A;  3AU4 A;  2IFS A;  3PP2 A;  1Y5O A;  2EMT A;  3HQC A;  2LUL A;  4A6F A;  2I5F A;  5FI0 A;  2XQN M;  4K2P A;  2RLO A;  5HE1 A;  4CHJ A;  1PLS A;  1WJ1 A;  5KQ4 A;  4EKU A;  3TO1 A;  2Q13 A;  3D8D A;  4PNK A;  1AWE A;  2COD A;  1OY2 A;  3ULB A;  4Z2N A;  3TCA A;  5D3X A;  2N0Y A;  2D9Z A;  2DA0 A;  2MDX A;  4ZRK A;  2DKP A;  3DXE A;  3FEH A;  1FHO A;  1BTN A;  2UVM A;  3A8P A;  2R0D A;  2RUK B;  1P6S A;  1DRO A;  5D3V A;  2D11 A;  3D8E A;  3FSS A;  2COA A;  1FAO A;  2VRW B;  4HAT B;  4CYE A;  2CY5 A;  2ZPY A;  2YS3 A;  3NSU A;  1X1G A;  5J3Q A;  2GCJ A;  2YS1 A;  3F0W A;  4HAZ B;  2GS0 A;  1U5D A;  2DLW A;  5JHH A;  2D10 A;  1MPH A;  4DX8 A;  2KCJ A;  3PG7 A;  4WJ7 A;  3ODO A;  4WVF B;  2Z0Q A;  3MDB C;  2L2I A;  4D0N B;  2EJ8 A;  5EFX A;  2ELA A;  1IRS A;  2G35 A;  2D9V A;  2DX1 A;  1V61 A;  1MK9 B;  3KY9 A;  2LKO A;  2RNR B;  2P0D A;  1FHW A;  2RGN B;  4L6E A;  2CY4 A;  5D3W A;  1ZC3 B;  3SNH A;  3TW1 A;  2Y7B A;  1I7A A;  2I1J A;  3X23 A;  4HAU B;  1W1G A;  2W2X C;  3A8Q A;  1FHX A;  5CLL B;  4KHO A;  4A6F B;  3TVV A;  3ULC A;  4YON A;  1WI1 A;  2LYD A;  2D9W A;  2I5C A;  1DDW A;  1UNR A;  3AU5 A;  5DH9 B;  3RCP A;  4HAX B;  3ODX A;  1DDM A;  3ML4 A;  2I1K A;  2DHJ A;  1U5G A;  1E5W A;  2N23 A;  4KVG B;  1P5T A;  3WA0 A;  5DI9 B;  5JP4 A;  1EF1 A;  1FGZ A;  1ZM0 A;  1K5G B;  1V88 A;  2K2U A;  1Z87 A;  4HB3 B;  2DN6 A;  3VOQ A;  1XOD A;  1UNP A;  2V76 A;  1BAK A;  5D27 A;  2HE7 A;  3SV1 A;  2J0J A;  1XCG A;  3IVF A;  4GN1 A;  4HB2 B;  1UPQ A;  1SGH A;  1GC6 A;  1QC6 A;  1V5U A;  3KRX A;  2Y8F A;  3P6A A;  1N3H A;  3UZT A;  2RSG A;  1KZ7 A;  4IOY X;  1XKE A;  4KAX B;  2ROZ B;  4Z2M B;  2D9Y A;  2DKQ A;  4EMO A;  4F7G A;  3SYX A;  1QQG A;  2VKI A;  4HAY B;  1BWN A;  4GPT B;  2P8V A;  2P0H A;  1TJ6 A;  2GJY A;  2OTX A;  1NTV A;  4BBK A;  3WYF B;  4EJN A;  1EAZ A;  2DHK A;  1FB8 A;  2LOZ A;  2IYB A;  4MK0 A;  1X86 A;  1MKE A;  1X11 A;  4P7I A;  3ODW A;  5GOW B;  1LB1 A;  3VIA A;  1NTY A;  3PVW A;  2CRF A;  4XWX A;  1DDV A;  1MIZ B;  1K5D B;  4F7U P;  3GYP A;  3FM8 C;  4HDQ A;  4MT7 A;  1U5E A;  1U29 A;  2MWN B;  2JP2 A;  4HAV B;  1B55 A;  1I2H A;  3KZ1 A;  1OQN A;  1RJ2 A;  1WGQ A;  2L1C A;  3OAN A;  4HAW B;  2DX5 A;  2P0F A;  5L81 A;  3M1I B;  4KHB B;  4A5K A;  4GZU A;  2CAY A;  3MPX A;  1PMS A;  2E2X A;  2OQB A;  4HDO A;  2DTC A;  1ZVR A;  3SO6 A;  2X18 A;  1W1D A;  2DYQ A;  5LOP B;  2YF0 A;  3G9W A;  1V5P A;  2PZ1 A;  2M38 A;  2QKM A;  1UEF A;  5DHA B;  1V5M A;  1M7R A;  4WSF A;  5DIF B;  1J19 A;  3BIN A;  1FOE A;  2M14 A;  4GXB A;  2NMB A;  2QKL A;  4K81 A;  2Z0P A;  2YSZ A;  1RRP B;  1ZSQ A;  2DFK A;  2MFQ A;  4DXA B;  4H8S A;  1WVH A;  1V89 A;  2COC A;  4ZRI A;  4NSW A;  3DXC A;  1Y19 B;  3CIK A;  1Q67 A;  5HE2 A;  4B6H A;  4KHA A;  1TXD A;  5J3Y A;  5C5B A;  1KZG A;  1AQC A;  3TFM A;  1DBH A;  5C79 A;  2EMS A;  4YL8 A;  5FI1 A;  3DXD A;  1H4R A;  3PZD A;  3ZDT A;  1LW3 A;  2W2X D;  3QBV B;  2ADZ A;  2BCJ A;  4PQ0 A;  2NZ8 B;  2GCL A;  1MIX A;  2EC1 A;  3GYO A;  3P7Z A;  1OMW A;  2YT1 A;  5D3Y A;  5HE0 A;  2KUP A;  1EGX A;  2R09 A;  4K2O A;  1TQZ A;  3D8F A;  4CHM A;  4TKN A;  1U5F A;  3HW2 B;  2UZR A;  2D2Q A;  3QWM A;  4HB0 B;  2H7E A;  4GMV A;  5KCV A;  2ELB A;  2KGX B;  1SHC A;  3KSY A;  5C6R A;  3QIJ A;  4HB4 B;  2DYN A;  3F5R A;  3PSC A;  4IFS A;  4DBB A;  2Z0O A;  1XR0 B;  3LJU X;  2J0M A;  5C16 A;  1NI2 A;  1PFJ A;  3PVU A;  4Y94 A;  1NU2 A;  2H7D A;  3PVL A;  3PEG A;  4GMX B;  4F7H A;  2COF A;  1UNQ A;  4DX9 0;  2W2W A;  3ZVR A;  3BJI A;  1XX0 A;  5LON B;  2J59 M;  4IAP A;  2DHI A;  1WGU A;  2FJL A;  1WJM A;  2YS5 A;  1FGY A;  2MKR A;  4TYZ A;  1J0W A;  1UPR A;  2RVB B;  3N7C A;  1MK7 B;  3A98 B;  2UZS A;  2AL6 A;  1U27 A;  5CLQ B;  1MAI A;  3V5W A;  2AEH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...