5DHFB

Crystal structure of hrio2 nes peptide in complex with crm1-ran-ranbp1
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
136
structure length
127
Chain Sequence
FEPVTMEEDEEVLYKVRAKLFRFDADAKEWKERGTGDCKFLKNKKTNKVRILMRRDKTLKICANHIIAPEYTLKPNVGSDRSWVYACTADIAEGEAEAFTFAIRFGSKENADKFKEEFEKAQEINKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords GTP-binding nuclear protein Ran
publication title Structural determinants of nuclear export signal orientation in binding to exportin CRM1.
pubmed doi rcsb
source organism Homo sapiens
total genus 35
structure length 127
sequence length 136
ec nomenclature
pdb deposition date 2015-08-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00638 Ran_BP1 RanBP1 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 5dhfB00
5DH9B 4ZRJA 2RLOA 1WG7A 4K2PA 3SUZA 3UZTA 4GN1A 1AQCA 2PZ1A 4HAZB 2L2IA 4NY0A 3T06A 1QQGA 4IOYX 4HDOA 2H7DA 4D0NB 4WSFA 1WVHA 4KAXB 1Y19B 1AWEA 3AJ4A 2KGXB 2DKQA 1V61A 4IAPA 2MKRA 1KZ7A 2L1CA 5HE1A 3ODWA 2Y7BA 1P5TA 2I5CA 5C79A 5DIFB 3OANA 1ZVRA 4EJNA 1NTVA 2AL6A 1DDWA 1KI1B 4A5KA 4ZRKA 2D9YA 2GS0A 1PFJA 1FHWA 4HAYB 3HQCA 1M7EA 2DX5A 1DBHA 2K2UA 3V5WA 5DHAB 3ODOA 1Q67A 2DYNA 2W2XC 3PVLA 5JLJB 1X11A 1BTKA 4PQ0A 2D9VA 1TJ6A 2JP2A 3NSUA 2EMSA 3X23A 2YS1A 2D9WA 3PZDA 3PEGA 1NU2A 4HAUB 3ODXA 4KHOA 4PNKA 2AEHA 2CODA 4DX90 3CXBB 1XD4A 4Z2MB 4GPTB 1H4RA 1FHXA 3BJIA 2OTXA 1P6SA 2W2XD 1BAKA 1V89A 4B6HA 1U29A 1U5GA 2RUKB 3D8EA 3M1IB 4HB2B 4XWXA 5J3YA 1PMSA 1MPHA 2DA0A 2QKLA 5JP4A 2LOZA 5CLQB 1J0WA 2DKPA 5D3WA 5JHHA 4ZRIA 2D10A 3AU5A 1XKEA 4TKNA 4F7UP 1ZC4B 3QWMA 1U5DA 1PLSA 1N3HA 2VKIA 2Y8FA 4L6EA 4GMXB 2GCJA 2VSZA 3GYPA 3KRWA 2OQBA 3BINA 3TO1A 4DXAB 2CY5A 2J59M 5FI0A 3KSYA 4MY6A 3PG7A 1TXDA 3HW2B 1SHCA 2RNRB 2RVBB 4KHAA 2P8VA 2I1JA 3CIKA 4KVGB 4Y94A 4IFSA 2HTHB 1DDVA 4DX8A 2N23A 2LG1A 2DLWA 2W2WA 1RJ2A 3TFMA 5KQ1A 4F7HA 2LKOA 1P3RA 4HAXB 5D3XA 1GC7A 2BCJA 2XQNM 3ULBA 2EJ8A 2KCJA 2D9ZA 2EC1A 3TW1A 2DYQA 4K81A 1UEFA 3KY9A 1FGYA 2NMBA 3P7ZA 1DROA 1LB1A 4HAWB 2QKMA 4CHJA 1Z87A 2Y8GA 1BWNA 1FHOA 4HAVB 2YT0A 3U7DA 1X1GA 5D27A 1XX0A 2K00A 3AU4A 4YL8A 4WVFB 5D3YA 2LYDA 4GXBA 1U2BA 2UZRA 1E5WA 2R09A 3D8FA 5LONB 1ISNA 4GMVA 2RSGA 2M38A 2MFQA 2YS3A 1U5EA 1UNRA 1DDMA 2KUPA 1FGZA 2P0DA 3F0WA 3QBVB 5J3QA 2ZPYA 2DN6A 1IRSA 1NTYA 1X86A 2FJLA 1WJ1A 5L81A 3TCAA 5KQ4A 3SV1A 1RRPB 1WGUA 4GZUA 1EAZA 1XCGA 2EMTA 2YT1A 1V88A 2COAA 2LULA 1FB8A 5JHGA 3O96A 4KHBB 4A6HA 2DHIA 4A6KA 4TYZA 3MPXA 1W1DA 2GJYA 1V5PA 4P7IA 3MDBC 1I7AA 1H10A 2D9XA 1KZGA 4WJ7A 1B55A 1NI2A 4K17A 4HB4B 1J19A 4F7GA 1K5DB 2V76A 5C6RA 2UZSA 3N7CA 1OY2A 4HB3B 5HE2A 2RGNB 3D8DA 2D11A 2DFKA 1EVHA 4HDQA 5KCVA 1MAIA 5C5BB 1EGXA 4HB0B 2YVCA 4DBBA 2YF0A 1SGHA 5FI1A 1Y5OA 3PVWA 2M14A 1EF1A 3SO6A 1MKEA 1DYNA 2ADZA 1I2HA 2MWNB 4MT7A 1OMWA 2H7EA 1ZC3B 4NSWA 3DXDA 2DHJA 3PVUA 2ROZB 3FEHA 2Q13A 2Z0OA 2MDXA 3HK0A 4EKUA 2P0FA 3DXEA 5D3VA 2G35A 2DTCA 4CYEA 3F5RA 4A6FB 1UPQA 2J0KA 5C5BA 3RCPA 1V5MA 1OQNA 1WJMA 3WYFB 3A98B 2ELAA 3TVVA 3GYOA 3SYXA 3U8ZA 2VRWB 2J0JA 3VOQA 5DHFB 1LW3A 2E2XA 3KRXA 1W1GA 2R0DA 1MIZB 4MK0A 1XR0B 4HATB 3A8QA 2NZ8B 1BTNA 1TQZA 5HE0A 4C0AA 2IFSA 2IYBA 1QC6A 5EFXA 3P6AA 4A6FA 4YONA 1WI1A 1V5UA 3ZDTA 2COCA 3KZ1A 2CRFA 1FAOA 1W1HA 2COFA 1U5FA 3ML4A 1U27A 4BBKA 1MIXA 1ZSQA 3LJUX 3FSSA 4CHMA 2J0MA 5CLLB 2YRYA 4K2OA 1ZM0A 3PP2A 2UVMA 2D4QA 4HHVA 2Z0QA 4H8SA 5HE3A 3A8PA 2LOXA 1X05A 2K2JA 2YSZA 2DHKA 2Z0PA 2HE7A 1UNPA 3PSCA 3ZVRA 1MK9B 1UNQA 3VIAA 1UPRA 3WA0A 5J3TA 5GOWB 2N0YA 2CAYA 1FOEA 2ROVA 3FM8C 2D2QA 2YS5A 2P0HA 1X1FA 2DX1A 3DXCA 5C16A 3IVFA 4EMOA 1GG3A 2CY4A 5DI9B 1XODA 1K5GB 2ELBA 3SNHA 2I5FA 4Z2NA 2X18A 2I1KA 1MK7B 3QIJA 1WGQA 2GCLA 1GC6A 3ULCA 5LOPB 1M7RA 3G9WA
chains in the Genus database with same CATH superfamily
5DH9B 4ZRJA 3HSAA 2RLOA 1WG7A 4K2PA 3SUZA 3UZTA 4GN1A 1AQCA 2PZ1A 4HAZB 3NW8A 2L2IA 4NY0A 3T06A 1QQGA 4IOYX 4HDOA 2H7DA 4D0NB 4WSFA 1WVHA 4KAXB 1Y19B 1AWEA 3AJ4A 2KGXB 2DKQA 1V61A 4IAPA 2MKRA 1KZ7A 2L1CA 5HE1A 3ODWA 2Y7BA 1P5TA 2I5CA 5C79A 5DIFB 3OANA 1ZVRA 2Z4DA 3DCXA 4EJNA 1NTVA 2AL6A 4L1RA 1DDWA 1KI1B 4A5KA 4ZRKA 2D9YA 2GS0A 1PFJA 1FHWA 4HAYB 3HQCA 1M7EA 2DX5A 1DBHA 2K2UA 3V5WA 5DHAB 3ODOA 1Q67A 2KUQA 2DYNA 4QJ3B 4QJ4B 2W2XC 3PVLA 5JLJB 1X11A 1BTKA 4PQ0A 2D9VA 1TJ6A 2JP2A 2EMSA 3NSUA 3X23A 2YS1A 2D9WA 3PZDA 3PEGA 1NU2A 4HAUB 3ODXA 4KHOA 4PNKA 2AEHA 2CODA 4DX90 3CXBB 1XD4A 4Z2MB 4GPTB 1H4RA 1FHXA 3BJIA 2OTXA 1P6SA 2W2XD 5IRSA 1BAKA 1V89A 4B6HA 1U29A 1U5GA 2RUKB 3D8EA 3M1IB 4HB2B 4XWXA 5J3YA 1PMSA 1MPHA 2DA0A 2QKLA 5JP4A 2LOZA 5CLQB 1J0WA 2DKPA 5D3WA 5JHHA 4ZRIA 2D10A 3AU5A 1XKEA 4QXAB 4TKNA 4F7UP 1ZC4B 3QWMA 1U5DA 1PLSA 1N3HA 2VKIA 2Y8FA 4L6EA 4GMXB 2GCJA 2VSZA 3GYPA 3KRWA 2OQBA 3BINA 3TO1A 4DXAB 2CY5A 2J59M 5FI0A 3KSYA 4MY6A 3PG7A 1TXDA 3HW2B 1SHCA 2RNRB 2RVBB 4KHAA 2P8VA 4QJ5B 2I1JA 3CIKA 4KVGB 4Y94A 4IFSA 2HTHB 1DDVA 4DX8A 2N23A 2LG1A 2R2YA 2DLWA 2W2WA 1RJ2A 3TFMA 5KQ1A 4F7HA 2LKOA 1P3RA 2K8EA 4HAXB 5D3XA 1GC7A 2BCJA 2XQNM 3ULBA 2EJ8A 2KCJA 2D9ZA 2EC1A 3TW1A 2DYQA 4K81A 1ZYIA 1UEFA 3KY9A 1FGYA 2NMBA 3P7ZA 1DROA 1LB1A 2KR0A 4HAWB 2QKMA 4CHJA 1Z87A 2Y8GA 1BWNA 1FHOA 4HAVB 2YT0A 3U7DA 1X1GA 5D27A 1XX0A 2K00A 3AU4A 4YL8A 4WVFB 5D3YA 2LYDA 4GXBA 1U2BA 2UZRA 1E5WA 2R09A 3D8FA 5LONB 4HSIA 1ISNA 3A58A 4GMVA 2RSGA 2M38A 2MFQA 2YS3A 1U5EA 1UNRA 1DDMA 2KUPA 1FGZA 2P0DA 3F0WA 3FVCA 4DIXA 5LG4B 3QBVB 5J3QA 2ZPYA 2DN6A 1IRSA 1NTYA 1X86A 3OHMB 2FJLA 1WJ1A 5L81A 3TCAA 5KQ4A 3SV1A 1RRPB 1WGUA 3NWFA 4GZUA 1EAZA 1XCGA 2EMTA 2YT1A 1T77A 1V88A 2COAA 2LULA 1FB8A 5JHGA 3O96A 4KHBB 3NWAA 4A6HA 2DHIA 4A6KA 4TYZA 3MPXA 1W1DA 2GJYA 1V5PA 4P7IA 3MDBC 1I7AA 1H10A 2D9XA 1KZGA 4WJ7A 1B55A 1NI2A 4K17A 4HB4B 1J19A 4F7GA 1K5DB 4GNKB 2V76A 5C6RA 2UZSA 3N7CA 1OY2A 4HB3B 5HE2A 2RGNB 3D8DA 2D11A 2DFKA 1EVHA 4HDQA 4KHBA 5KCVA 2NBVA 1MAIA 5C5BB 1EGXA 4HB0B 2Z13A 2YVCA 4DBBA 4GOUA 2YF0A 1SGHA 5FI1A 1Y5OA 3PVWA 2M14A 1EF1A 3SO6A 1MKEA 1DYNA 2RRFA 2ADZA 1I2HA 2MWNB 4MT7A 1OMWA 2H7EA 1ZC3B 4NSWA 2FJUB 3DXDA 2DHJA 3PVUA 2ROZB 3FEHA 2Q13A 5I2MA 2Z0OA 2MDXA 3HK0A 4EKUA 2P0FA 3DXEA 5D3VA 2G35A 2DTCA 4CYEA 3F5RA 4A6FB 1UPQA 2J0KA 5C5BA 3RCPA 1V5MA 1OQNA 1WJMA 3WYFB 3U12A 3A98B 2ELAA 2Z14A 3TVVA 3GYOA 3SYXA 3U8ZA 2VRWB 2J0JA 3VOQA 5DHFB 1LW3A 2E2XA 2Z59A 3KRXA 1W1GA 2R0DA 1MIZB 4MK0A 1XR0B 4HATB 1MI1A 3A8QA 2NZ8B 1BTNA 1TQZA 5I2SA 5HE0A 4C0AA 2IFSA 2IYBA 1QC6A 5EFXA 3P6AA 3B77A 4A6FA 3HIEA 4YONA 1WI1A 5M4YB 1V5UA 2KIEA 3ZDTA 2COCA 3KZ1A 2CRFA 1FAOA 1W1HA 2COFA 1U5FA 3ML4A 1U27A 4BBKA 1MIXA 1ZSQA 3LJUX 3FSSA 4CHMA 2J0MA 5CLLB 2YRYA 4K2OA 1ZM0A 3PP2A 2UVMA 2D4QA 4HHVA 2Z0QA 3NWDA 4CSQA 4H8SA 5HE3A 3A8PA 2LOXA 1X05A 2K2JA 2YSZA 2KIGA 2DHKA 2Z0PA 4OT1A 2HE7A 1UNPA 3PSCA 3ZVRA 1MK9B 1UNQA 3VIAA 1UPRA 3WA0A 5J3TA 5GOWB 2GUMA 2N0YA 2CAYA 2YT2A 1FOEA 2ROVA 3FM8C 2D2QA 2YS5A 2ZKMX 2P0HA 1X1FA 2K49A 2DX1A 3DXCA 4OSNA 5C16A 3IVFA 4EMOA 1GG3A 2CY4A 5DI9B 1XODA 1K5GB 2ELBA 3SNHA 2I5FA 4Z2NA 2X18A 2I1KA 1MK7B 3QIJA 1WGQA 2GCLA 1GC6A 3ULCA 5LOPB 1M7RA 3G9WA 4D6WA
chains in the Genus database with same CATH topology
5DH9B 4ZRJA 2RLOA 1WG7A 4K2PA 3SUZA 3UZTA 4GN1A 1AQCA 2PZ1A 4HAZB 2L2IA 4NY0A 3T06A 1QQGA 4IOYX 4HDOA 2H7DA 4D0NB 4WSFA 1WVHA 4KAXB 1Y19B 1AWEA 3AJ4A 2KGXB 2DKQA 1V61A 4IAPA 2MKRA 1KZ7A 2L1CA 5HE1A 3ODWA 2Y7BA 1P5TA 2I5CA 5C79A 5DIFB 3OANA 1ZVRA 4EJNA 1NTVA 2AL6A 1DDWA 1KI1B 4A5KA 4ZRKA 2D9YA 2GS0A 1PFJA 1FHWA 4HAYB 3HQCA 1M7EA 2DX5A 1DBHA 2K2UA 3V5WA 5DHAB 3ODOA 1Q67A 2DYNA 2W2XC 3PVLA 5JLJB 1X11A 1BTKA 4PQ0A 2D9VA 1TJ6A 2JP2A 3NSUA 2EMSA 3X23A 2YS1A 2D9WA 3PZDA 3PEGA 1NU2A 4HAUB 3ODXA 4KHOA 4PNKA 2AEHA 2CODA 4DX90 3CXBB 1XD4A 4Z2MB 4GPTB 1H4RA 1FHXA 3BJIA 2OTXA 1P6SA 2W2XD 1BAKA 1V89A 4B6HA 1U29A 1U5GA 2RUKB 3D8EA 3M1IB 4HB2B 4XWXA 5J3YA 1PMSA 1MPHA 2DA0A 2QKLA 5JP4A 2LOZA 5CLQB 1J0WA 2DKPA 5D3WA 5JHHA 4ZRIA 2D10A 3AU5A 1XKEA 4TKNA 4F7UP 1ZC4B 3QWMA 1U5DA 1PLSA 1N3HA 2VKIA 2Y8FA 4L6EA 4GMXB 2GCJA 2VSZA 3GYPA 3KRWA 2OQBA 3BINA 3TO1A 4DXAB 2CY5A 2J59M 5FI0A 3KSYA 4MY6A 3PG7A 1TXDA 3HW2B 1SHCA 2RNRB 2RVBB 4KHAA 2P8VA 2I1JA 3CIKA 4KVGB 4Y94A 4IFSA 2HTHB 1DDVA 4DX8A 2N23A 2LG1A 2DLWA 2W2WA 1RJ2A 3TFMA 5KQ1A 4F7HA 2LKOA 1P3RA 4HAXB 5D3XA 1GC7A 2BCJA 2XQNM 3ULBA 2EJ8A 2KCJA 2D9ZA 2EC1A 3TW1A 2DYQA 4K81A 1UEFA 3KY9A 1FGYA 2NMBA 3P7ZA 1DROA 1LB1A 4HAWB 2QKMA 4CHJA 1Z87A 2Y8GA 1BWNA 1FHOA 4HAVB 2YT0A 3U7DA 1X1GA 5D27A 1XX0A 2K00A 3AU4A 4YL8A 4WVFB 5D3YA 2LYDA 4GXBA 1U2BA 2UZRA 1E5WA 2R09A 3D8FA 5LONB 1ISNA 4GMVA 2RSGA 2M38A 2MFQA 2YS3A 1U5EA 1UNRA 1DDMA 2KUPA 1FGZA 2P0DA 3F0WA 3QBVB 5J3QA 2ZPYA 2DN6A 1IRSA 1NTYA 1X86A 2FJLA 1WJ1A 5L81A 3TCAA 5KQ4A 3SV1A 1RRPB 1WGUA 4GZUA 1EAZA 1XCGA 2EMTA 2YT1A 1V88A 2COAA 2LULA 1FB8A 5JHGA 3O96A 4KHBB 4A6HA 2DHIA 4A6KA 4TYZA 3MPXA 1W1DA 2GJYA 1V5PA 4P7IA 3MDBC 1I7AA 1H10A 2D9XA 1KZGA 4WJ7A 1B55A 1NI2A 4K17A 4HB4B 1J19A 4F7GA 1K5DB 2V76A 5C6RA 2UZSA 3N7CA 1OY2A 4HB3B 5HE2A 2RGNB 3D8DA 2D11A 2DFKA 1EVHA 4HDQA 5KCVA 1MAIA 5C5BB 1EGXA 4HB0B 2YVCA 4DBBA 2YF0A 1SGHA 5FI1A 1Y5OA 3PVWA 2M14A 1EF1A 3SO6A 1MKEA 1DYNA 2ADZA 1I2HA 2MWNB 4MT7A 1OMWA 2H7EA 1ZC3B 4NSWA 3DXDA 2DHJA 3PVUA 2ROZB 3FEHA 2Q13A 2Z0OA 2MDXA 3HK0A 4EKUA 2P0FA 3DXEA 5D3VA 2G35A 2DTCA 4CYEA 3F5RA 4A6FB 1UPQA 2J0KA 5C5BA 3RCPA 1V5MA 1OQNA 1WJMA 3WYFB 3A98B 2ELAA 3TVVA 3GYOA 3SYXA 3U8ZA 2VRWB 2J0JA 3VOQA 5DHFB 1LW3A 2E2XA 3KRXA 1W1GA 2R0DA 1MIZB 4MK0A 1XR0B 4HATB 3A8QA 2NZ8B 1BTNA 1TQZA 5HE0A 4C0AA 2IFSA 2IYBA 1QC6A 5EFXA 3P6AA 4A6FA 4YONA 1WI1A 1V5UA 3ZDTA 2COCA 3KZ1A 2CRFA 1FAOA 1W1HA 2COFA 1U5FA 3ML4A 1U27A 4BBKA 1MIXA 1ZSQA 3LJUX 3FSSA 4CHMA 2J0MA 5CLLB 2YRYA 4K2OA 1ZM0A 3PP2A 2UVMA 2D4QA 4HHVA 2Z0QA 4H8SA 5HE3A 3A8PA 2LOXA 1X05A 2K2JA 2YSZA 2DHKA 2Z0PA 2HE7A 1UNPA 3PSCA 3ZVRA 1MK9B 1UNQA 3VIAA 1UPRA 3WA0A 5J3TA 5GOWB 2N0YA 2CAYA 1FOEA 2ROVA 3FM8C 2D2QA 2YS5A 2P0HA 1X1FA 2DX1A 3DXCA 5C16A 3IVFA 4EMOA 1GG3A 2CY4A 5DI9B 1XODA 1K5GB 2ELBA 3SNHA 2I5FA 4Z2NA 2X18A 2I1KA 1MK7B 3QIJA 1WGQA 2GCLA 1GC6A 3ULCA 5LOPB 1M7RA 3G9WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5DH9 B;  4ZRJ A;  2RLO A;  1WG7 A;  4K2P A;  3SUZ A;  3UZT A;  4GN1 A;  1AQC A;  2PZ1 A;  4HAZ B;  2L2I A;  4NY0 A;  3T06 A;  1QQG A;  4IOY X;  4HDO A;  2H7D A;  4D0N B;  4WSF A;  1WVH A;  4KAX B;  1Y19 B;  1AWE A;  3AJ4 A;  2KGX B;  2DKQ A;  1V61 A;  4IAP A;  2MKR A;  1KZ7 A;  2L1C A;  5HE1 A;  3ODW A;  2Y7B A;  1P5T A;  2I5C A;  5C79 A;  5DIF B;  3OAN A;  1ZVR A;  4EJN A;  1NTV A;  2AL6 A;  1DDW A;  1KI1 B;  4A5K A;  4ZRK A;  2D9Y A;  2GS0 A;  1PFJ A;  1FHW A;  4HAY B;  3HQC A;  1M7E A;  2DX5 A;  1DBH A;  2K2U A;  3V5W A;  5DHA B;  3ODO A;  1Q67 A;  2DYN A;  2W2X C;  3PVL A;  5JLJ B;  1X11 A;  1BTK A;  4PQ0 A;  2D9V A;  1TJ6 A;  2JP2 A;  3NSU A;  2EMS A;  3X23 A;  2YS1 A;  2D9W A;  3PZD A;  3PEG A;  1NU2 A;  4HAU B;  3ODX A;  4KHO A;  4PNK A;  2AEH A;  2COD A;  4DX9 0;  3CXB B;  1XD4 A;  4Z2M B;  4GPT B;  1H4R A;  1FHX A;  3BJI A;  2OTX A;  1P6S A;  2W2X D;  1BAK A;  1V89 A;  4B6H A;  1U29 A;  1U5G A;  2RUK B;  3D8E A;  3M1I B;  4HB2 B;  4XWX A;  5J3Y A;  1PMS A;  1MPH A;  2DA0 A;  2QKL A;  5JP4 A;  2LOZ A;  5CLQ B;  1J0W A;  2DKP A;  5D3W A;  5JHH A;  4ZRI A;  2D10 A;  3AU5 A;  1XKE A;  4TKN A;  4F7U P;  1ZC4 B;  3QWM A;  1U5D A;  1PLS A;  1N3H A;  2VKI A;  2Y8F A;  4L6E A;  4GMX B;  2GCJ A;  2VSZ A;  3GYP A;  3KRW A;  2OQB A;  3BIN A;  3TO1 A;  4DXA B;  2CY5 A;  2J59 M;  5FI0 A;  3KSY A;  4MY6 A;  3PG7 A;  1TXD A;  3HW2 B;  1SHC A;  2RNR B;  2RVB B;  4KHA A;  2P8V A;  2I1J A;  3CIK A;  4KVG B;  4Y94 A;  4IFS A;  2HTH B;  1DDV A;  4DX8 A;  2N23 A;  2LG1 A;  2DLW A;  2W2W A;  1RJ2 A;  3TFM A;  5KQ1 A;  4F7H A;  2LKO A;  1P3R A;  4HAX B;  5D3X A;  1GC7 A;  2BCJ A;  2XQN M;  3ULB A;  2EJ8 A;  2KCJ A;  2D9Z A;  2EC1 A;  3TW1 A;  2DYQ A;  4K81 A;  1UEF A;  3KY9 A;  1FGY A;  2NMB A;  3P7Z A;  1DRO A;  1LB1 A;  4HAW B;  2QKM A;  4CHJ A;  1Z87 A;  2Y8G A;  1BWN A;  1FHO A;  4HAV B;  2YT0 A;  3U7D A;  1X1G A;  5D27 A;  1XX0 A;  2K00 A;  3AU4 A;  4YL8 A;  4WVF B;  5D3Y A;  2LYD A;  4GXB A;  1U2B A;  2UZR A;  1E5W A;  2R09 A;  3D8F A;  5LON B;  1ISN A;  4GMV A;  2RSG A;  2M38 A;  2MFQ A;  2YS3 A;  1U5E A;  1UNR A;  1DDM A;  2KUP A;  1FGZ A;  2P0D A;  3F0W A;  3QBV B;  5J3Q A;  2ZPY A;  2DN6 A;  1IRS A;  1NTY A;  1X86 A;  2FJL A;  1WJ1 A;  5L81 A;  3TCA A;  5KQ4 A;  3SV1 A;  1RRP B;  1WGU A;  4GZU A;  1EAZ A;  1XCG A;  2EMT A;  2YT1 A;  1V88 A;  2COA A;  2LUL A;  1FB8 A;  5JHG A;  3O96 A;  4KHB B;  4A6H A;  2DHI A;  4A6K A;  4TYZ A;  3MPX A;  1W1D A;  2GJY A;  1V5P A;  4P7I A;  3MDB C;  1I7A A;  1H10 A;  2D9X A;  1KZG A;  4WJ7 A;  1B55 A;  1NI2 A;  4K17 A;  4HB4 B;  1J19 A;  4F7G A;  1K5D B;  2V76 A;  5C6R A;  2UZS A;  3N7C A;  1OY2 A;  4HB3 B;  5HE2 A;  2RGN B;  3D8D A;  2D11 A;  2DFK A;  1EVH A;  4HDQ A;  5KCV A;  1MAI A;  5C5B B;  1EGX A;  4HB0 B;  2YVC A;  4DBB A;  2YF0 A;  1SGH A;  5FI1 A;  1Y5O A;  3PVW A;  2M14 A;  1EF1 A;  3SO6 A;  1MKE A;  1DYN A;  2ADZ A;  1I2H A;  2MWN B;  4MT7 A;  1OMW A;  2H7E A;  1ZC3 B;  4NSW A;  3DXD A;  2DHJ A;  3PVU A;  2ROZ B;  3FEH A;  2Q13 A;  2Z0O A;  2MDX A;  3HK0 A;  4EKU A;  2P0F A;  3DXE A;  5D3V A;  2G35 A;  2DTC A;  4CYE A;  3F5R A;  4A6F B;  1UPQ A;  2J0K A;  5C5B A;  3RCP A;  1V5M A;  1OQN A;  1WJM A;  3WYF B;  3A98 B;  2ELA A;  3TVV A;  3GYO A;  3SYX A;  3U8Z A;  2VRW B;  2J0J A;  3VOQ A;  5DHF B;  1LW3 A;  2E2X A;  3KRX A;  1W1G A;  2R0D A;  1MIZ B;  4MK0 A;  1XR0 B;  4HAT B;  3A8Q A;  2NZ8 B;  1BTN A;  1TQZ A;  5HE0 A;  4C0A A;  2IFS A;  2IYB A;  1QC6 A;  5EFX A;  3P6A A;  4A6F A;  4YON A;  1WI1 A;  1V5U A;  3ZDT A;  2COC A;  3KZ1 A;  2CRF A;  1FAO A;  1W1H A;  2COF A;  1U5F A;  3ML4 A;  1U27 A;  4BBK A;  1MIX A;  1ZSQ A;  3LJU X;  3FSS A;  4CHM A;  2J0M A;  5CLL B;  2YRY A;  4K2O A;  1ZM0 A;  3PP2 A;  2UVM A;  2D4Q A;  4HHV A;  2Z0Q A;  4H8S A;  5HE3 A;  3A8P A;  2LOX A;  1X05 A;  2K2J A;  2YSZ A;  2DHK A;  2Z0P A;  2HE7 A;  1UNP A;  3PSC A;  3ZVR A;  1MK9 B;  1UNQ A;  3VIA A;  1UPR A;  3WA0 A;  5J3T A;  5GOW B;  2N0Y A;  2CAY A;  1FOE A;  2ROV A;  3FM8 C;  2D2Q A;  2YS5 A;  2P0H A;  1X1F A;  2DX1 A;  3DXC A;  5C16 A;  3IVF A;  4EMO A;  1GG3 A;  2CY4 A;  5DI9 B;  1XOD A;  1K5G B;  2ELB A;  3SNH A;  2I5F A;  4Z2N A;  2X18 A;  2I1K A;  1MK7 B;  3QIJ A;  1WGQ A;  2GCL A;  1GC6 A;  3ULC A;  5LOP B;  1M7R A;  3G9W A; 
#chains in the Genus database with same CATH topology
 5DH9 B;  4ZRJ A;  3HSA A;  2RLO A;  1WG7 A;  4K2P A;  3SUZ A;  3UZT A;  4GN1 A;  1AQC A;  2PZ1 A;  4HAZ B;  3NW8 A;  2L2I A;  4NY0 A;  3T06 A;  1QQG A;  4IOY X;  4HDO A;  2H7D A;  4D0N B;  4WSF A;  1WVH A;  4KAX B;  1Y19 B;  1AWE A;  3AJ4 A;  2KGX B;  2DKQ A;  1V61 A;  4IAP A;  2MKR A;  1KZ7 A;  2L1C A;  5HE1 A;  3ODW A;  2Y7B A;  1P5T A;  2I5C A;  5C79 A;  5DIF B;  3OAN A;  1ZVR A;  2Z4D A;  3DCX A;  4EJN A;  1NTV A;  2AL6 A;  4L1R A;  1DDW A;  1KI1 B;  4A5K A;  4ZRK A;  2D9Y A;  2GS0 A;  1PFJ A;  1FHW A;  4HAY B;  3HQC A;  1M7E A;  2DX5 A;  1DBH A;  2K2U A;  3V5W A;  5DHA B;  3ODO A;  1Q67 A;  2KUQ A;  2DYN A;  4QJ3 B;  4QJ4 B;  2W2X C;  3PVL A;  5JLJ B;  1X11 A;  1BTK A;  4PQ0 A;  2D9V A;  1TJ6 A;  2JP2 A;  2EMS A;  3NSU A;  3X23 A;  2YS1 A;  2D9W A;  3PZD A;  3PEG A;  1NU2 A;  4HAU B;  3ODX A;  4KHO A;  4PNK A;  2AEH A;  2COD A;  4DX9 0;  3CXB B;  1XD4 A;  4Z2M B;  4GPT B;  1H4R A;  1FHX A;  3BJI A;  2OTX A;  1P6S A;  2W2X D;  5IRS A;  1BAK A;  1V89 A;  4B6H A;  1U29 A;  1U5G A;  2RUK B;  3D8E A;  3M1I B;  4HB2 B;  4XWX A;  5J3Y A;  1PMS A;  1MPH A;  2DA0 A;  2QKL A;  5JP4 A;  2LOZ A;  5CLQ B;  1J0W A;  2DKP A;  5D3W A;  5JHH A;  4ZRI A;  2D10 A;  3AU5 A;  1XKE A;  4QXA B;  4TKN A;  4F7U P;  1ZC4 B;  3QWM A;  1U5D A;  1PLS A;  1N3H A;  2VKI A;  2Y8F A;  4L6E A;  4GMX B;  2GCJ A;  2VSZ A;  3GYP A;  3KRW A;  2OQB A;  3BIN A;  3TO1 A;  4DXA B;  2CY5 A;  2J59 M;  5FI0 A;  3KSY A;  4MY6 A;  3PG7 A;  1TXD A;  3HW2 B;  1SHC A;  2RNR B;  2RVB B;  4KHA A;  2P8V A;  4QJ5 B;  2I1J A;  3CIK A;  4KVG B;  4Y94 A;  4IFS A;  2HTH B;  1DDV A;  4DX8 A;  2N23 A;  2LG1 A;  2R2Y A;  2DLW A;  2W2W A;  1RJ2 A;  3TFM A;  5KQ1 A;  4F7H A;  2LKO A;  1P3R A;  2K8E A;  4HAX B;  5D3X A;  1GC7 A;  2BCJ A;  2XQN M;  3ULB A;  2EJ8 A;  2KCJ A;  2D9Z A;  2EC1 A;  3TW1 A;  2DYQ A;  4K81 A;  1ZYI A;  1UEF A;  3KY9 A;  1FGY A;  2NMB A;  3P7Z A;  1DRO A;  1LB1 A;  2KR0 A;  4HAW B;  2QKM A;  4CHJ A;  1Z87 A;  2Y8G A;  1BWN A;  1FHO A;  4HAV B;  2YT0 A;  3U7D A;  1X1G A;  5D27 A;  1XX0 A;  2K00 A;  3AU4 A;  4YL8 A;  4WVF B;  5D3Y A;  2LYD A;  4GXB A;  1U2B A;  2UZR A;  1E5W A;  2R09 A;  3D8F A;  5LON B;  4HSI A;  1ISN A;  3A58 A;  4GMV A;  2RSG A;  2M38 A;  2MFQ A;  2YS3 A;  1U5E A;  1UNR A;  1DDM A;  2KUP A;  1FGZ A;  2P0D A;  3F0W A;  3FVC A;  4DIX A;  5LG4 B;  3QBV B;  5J3Q A;  2ZPY A;  2DN6 A;  1IRS A;  1NTY A;  1X86 A;  3OHM B;  2FJL A;  1WJ1 A;  5L81 A;  3TCA A;  5KQ4 A;  3SV1 A;  1RRP B;  1WGU A;  3NWF A;  4GZU A;  1EAZ A;  1XCG A;  2EMT A;  2YT1 A;  1T77 A;  1V88 A;  2COA A;  2LUL A;  1FB8 A;  5JHG A;  3O96 A;  4KHB B;  3NWA A;  4A6H A;  2DHI A;  4A6K A;  4TYZ A;  3MPX A;  1W1D A;  2GJY A;  1V5P A;  4P7I A;  3MDB C;  1I7A A;  1H10 A;  2D9X A;  1KZG A;  4WJ7 A;  1B55 A;  1NI2 A;  4K17 A;  4HB4 B;  1J19 A;  4F7G A;  1K5D B;  4GNK B;  2V76 A;  5C6R A;  2UZS A;  3N7C A;  1OY2 A;  4HB3 B;  5HE2 A;  2RGN B;  3D8D A;  2D11 A;  2DFK A;  1EVH A;  4HDQ A;  4KHB A;  5KCV A;  2NBV A;  1MAI A;  5C5B B;  1EGX A;  4HB0 B;  2Z13 A;  2YVC A;  4DBB A;  4GOU A;  2YF0 A;  1SGH A;  5FI1 A;  1Y5O A;  3PVW A;  2M14 A;  1EF1 A;  3SO6 A;  1MKE A;  1DYN A;  2RRF A;  2ADZ A;  1I2H A;  2MWN B;  4MT7 A;  1OMW A;  2H7E A;  1ZC3 B;  4NSW A;  2FJU B;  3DXD A;  2DHJ A;  3PVU A;  2ROZ B;  3FEH A;  2Q13 A;  5I2M A;  2Z0O A;  2MDX A;  3HK0 A;  4EKU A;  2P0F A;  3DXE A;  5D3V A;  2G35 A;  2DTC A;  4CYE A;  3F5R A;  4A6F B;  1UPQ A;  2J0K A;  5C5B A;  3RCP A;  1V5M A;  1OQN A;  1WJM A;  3WYF B;  3U12 A;  3A98 B;  2ELA A;  2Z14 A;  3TVV A;  3GYO A;  3SYX A;  3U8Z A;  2VRW B;  2J0J A;  3VOQ A;  5DHF B;  1LW3 A;  2E2X A;  2Z59 A;  3KRX A;  1W1G A;  2R0D A;  1MIZ B;  4MK0 A;  1XR0 B;  4HAT B;  1MI1 A;  3A8Q A;  2NZ8 B;  1BTN A;  1TQZ A;  5I2S A;  5HE0 A;  4C0A A;  2IFS A;  2IYB A;  1QC6 A;  5EFX A;  3P6A A;  3B77 A;  4A6F A;  3HIE A;  4YON A;  1WI1 A;  5M4Y B;  1V5U A;  2KIE A;  3ZDT A;  2COC A;  3KZ1 A;  2CRF A;  1FAO A;  1W1H A;  2COF A;  1U5F A;  3ML4 A;  1U27 A;  4BBK A;  1MIX A;  1ZSQ A;  3LJU X;  3FSS A;  4CHM A;  2J0M A;  5CLL B;  2YRY A;  4K2O A;  1ZM0 A;  3PP2 A;  2UVM A;  2D4Q A;  4HHV A;  2Z0Q A;  3NWD A;  4CSQ A;  4H8S A;  5HE3 A;  3A8P A;  2LOX A;  1X05 A;  2K2J A;  2YSZ A;  2KIG A;  2DHK A;  2Z0P A;  4OT1 A;  2HE7 A;  1UNP A;  3PSC A;  3ZVR A;  1MK9 B;  1UNQ A;  3VIA A;  1UPR A;  3WA0 A;  5J3T A;  5GOW B;  2GUM A;  2N0Y A;  2CAY A;  2YT2 A;  1FOE A;  2ROV A;  3FM8 C;  2D2Q A;  2YS5 A;  2ZKM X;  2P0H A;  1X1F A;  2K49 A;  2DX1 A;  3DXC A;  4OSN A;  5C16 A;  3IVF A;  4EMO A;  1GG3 A;  2CY4 A;  5DI9 B;  1XOD A;  1K5G B;  2ELB A;  3SNH A;  2I5F A;  4Z2N A;  2X18 A;  2I1K A;  1MK7 B;  3QIJ A;  1WGQ A;  2GCL A;  1GC6 A;  3ULC A;  5LOP B;  1M7R A;  3G9W A;  4D6W A; 
#chains in the Genus database with same CATH homology
 5DH9 B;  4ZRJ A;  2RLO A;  1WG7 A;  4K2P A;  3SUZ A;  3UZT A;  4GN1 A;  1AQC A;  2PZ1 A;  4HAZ B;  2L2I A;  4NY0 A;  3T06 A;  1QQG A;  4IOY X;  4HDO A;  2H7D A;  4D0N B;  4WSF A;  1WVH A;  4KAX B;  1Y19 B;  1AWE A;  3AJ4 A;  2KGX B;  2DKQ A;  1V61 A;  4IAP A;  2MKR A;  1KZ7 A;  2L1C A;  5HE1 A;  3ODW A;  2Y7B A;  1P5T A;  2I5C A;  5C79 A;  5DIF B;  3OAN A;  1ZVR A;  4EJN A;  1NTV A;  2AL6 A;  1DDW A;  1KI1 B;  4A5K A;  4ZRK A;  2D9Y A;  2GS0 A;  1PFJ A;  1FHW A;  4HAY B;  3HQC A;  1M7E A;  2DX5 A;  1DBH A;  2K2U A;  3V5W A;  5DHA B;  3ODO A;  1Q67 A;  2DYN A;  2W2X C;  3PVL A;  5JLJ B;  1X11 A;  1BTK A;  4PQ0 A;  2D9V A;  1TJ6 A;  2JP2 A;  3NSU A;  2EMS A;  3X23 A;  2YS1 A;  2D9W A;  3PZD A;  3PEG A;  1NU2 A;  4HAU B;  3ODX A;  4KHO A;  4PNK A;  2AEH A;  2COD A;  4DX9 0;  3CXB B;  1XD4 A;  4Z2M B;  4GPT B;  1H4R A;  1FHX A;  3BJI A;  2OTX A;  1P6S A;  2W2X D;  1BAK A;  1V89 A;  4B6H A;  1U29 A;  1U5G A;  2RUK B;  3D8E A;  3M1I B;  4HB2 B;  4XWX A;  5J3Y A;  1PMS A;  1MPH A;  2DA0 A;  2QKL A;  5JP4 A;  2LOZ A;  5CLQ B;  1J0W A;  2DKP A;  5D3W A;  5JHH A;  4ZRI A;  2D10 A;  3AU5 A;  1XKE A;  4TKN A;  4F7U P;  1ZC4 B;  3QWM A;  1U5D A;  1PLS A;  1N3H A;  2VKI A;  2Y8F A;  4L6E A;  4GMX B;  2GCJ A;  2VSZ A;  3GYP A;  3KRW A;  2OQB A;  3BIN A;  3TO1 A;  4DXA B;  2CY5 A;  2J59 M;  5FI0 A;  3KSY A;  4MY6 A;  3PG7 A;  1TXD A;  3HW2 B;  1SHC A;  2RNR B;  2RVB B;  4KHA A;  2P8V A;  2I1J A;  3CIK A;  4KVG B;  4Y94 A;  4IFS A;  2HTH B;  1DDV A;  4DX8 A;  2N23 A;  2LG1 A;  2DLW A;  2W2W A;  1RJ2 A;  3TFM A;  5KQ1 A;  4F7H A;  2LKO A;  1P3R A;  4HAX B;  5D3X A;  1GC7 A;  2BCJ A;  2XQN M;  3ULB A;  2EJ8 A;  2KCJ A;  2D9Z A;  2EC1 A;  3TW1 A;  2DYQ A;  4K81 A;  1UEF A;  3KY9 A;  1FGY A;  2NMB A;  3P7Z A;  1DRO A;  1LB1 A;  4HAW B;  2QKM A;  4CHJ A;  1Z87 A;  2Y8G A;  1BWN A;  1FHO A;  4HAV B;  2YT0 A;  3U7D A;  1X1G A;  5D27 A;  1XX0 A;  2K00 A;  3AU4 A;  4YL8 A;  4WVF B;  5D3Y A;  2LYD A;  4GXB A;  1U2B A;  2UZR A;  1E5W A;  2R09 A;  3D8F A;  5LON B;  1ISN A;  4GMV A;  2RSG A;  2M38 A;  2MFQ A;  2YS3 A;  1U5E A;  1UNR A;  1DDM A;  2KUP A;  1FGZ A;  2P0D A;  3F0W A;  3QBV B;  5J3Q A;  2ZPY A;  2DN6 A;  1IRS A;  1NTY A;  1X86 A;  2FJL A;  1WJ1 A;  5L81 A;  3TCA A;  5KQ4 A;  3SV1 A;  1RRP B;  1WGU A;  4GZU A;  1EAZ A;  1XCG A;  2EMT A;  2YT1 A;  1V88 A;  2COA A;  2LUL A;  1FB8 A;  5JHG A;  3O96 A;  4KHB B;  4A6H A;  2DHI A;  4A6K A;  4TYZ A;  3MPX A;  1W1D A;  2GJY A;  1V5P A;  4P7I A;  3MDB C;  1I7A A;  1H10 A;  2D9X A;  1KZG A;  4WJ7 A;  1B55 A;  1NI2 A;  4K17 A;  4HB4 B;  1J19 A;  4F7G A;  1K5D B;  2V76 A;  5C6R A;  2UZS A;  3N7C A;  1OY2 A;  4HB3 B;  5HE2 A;  2RGN B;  3D8D A;  2D11 A;  2DFK A;  1EVH A;  4HDQ A;  5KCV A;  1MAI A;  5C5B B;  1EGX A;  4HB0 B;  2YVC A;  4DBB A;  2YF0 A;  1SGH A;  5FI1 A;  1Y5O A;  3PVW A;  2M14 A;  1EF1 A;  3SO6 A;  1MKE A;  1DYN A;  2ADZ A;  1I2H A;  2MWN B;  4MT7 A;  1OMW A;  2H7E A;  1ZC3 B;  4NSW A;  3DXD A;  2DHJ A;  3PVU A;  2ROZ B;  3FEH A;  2Q13 A;  2Z0O A;  2MDX A;  3HK0 A;  4EKU A;  2P0F A;  3DXE A;  5D3V A;  2G35 A;  2DTC A;  4CYE A;  3F5R A;  4A6F B;  1UPQ A;  2J0K A;  5C5B A;  3RCP A;  1V5M A;  1OQN A;  1WJM A;  3WYF B;  3A98 B;  2ELA A;  3TVV A;  3GYO A;  3SYX A;  3U8Z A;  2VRW B;  2J0J A;  3VOQ A;  5DHF B;  1LW3 A;  2E2X A;  3KRX A;  1W1G A;  2R0D A;  1MIZ B;  4MK0 A;  1XR0 B;  4HAT B;  3A8Q A;  2NZ8 B;  1BTN A;  1TQZ A;  5HE0 A;  4C0A A;  2IFS A;  2IYB A;  1QC6 A;  5EFX A;  3P6A A;  4A6F A;  4YON A;  1WI1 A;  1V5U A;  3ZDT A;  2COC A;  3KZ1 A;  2CRF A;  1FAO A;  1W1H A;  2COF A;  1U5F A;  3ML4 A;  1U27 A;  4BBK A;  1MIX A;  1ZSQ A;  3LJU X;  3FSS A;  4CHM A;  2J0M A;  5CLL B;  2YRY A;  4K2O A;  1ZM0 A;  3PP2 A;  2UVM A;  2D4Q A;  4HHV A;  2Z0Q A;  4H8S A;  5HE3 A;  3A8P A;  2LOX A;  1X05 A;  2K2J A;  2YSZ A;  2DHK A;  2Z0P A;  2HE7 A;  1UNP A;  3PSC A;  3ZVR A;  1MK9 B;  1UNQ A;  3VIA A;  1UPR A;  3WA0 A;  5J3T A;  5GOW B;  2N0Y A;  2CAY A;  1FOE A;  2ROV A;  3FM8 C;  2D2Q A;  2YS5 A;  2P0H A;  1X1F A;  2DX1 A;  3DXC A;  5C16 A;  3IVF A;  4EMO A;  1GG3 A;  2CY4 A;  5DI9 B;  1XOD A;  1K5G B;  2ELB A;  3SNH A;  2I5F A;  4Z2N A;  2X18 A;  2I1K A;  1MK7 B;  3QIJ A;  1WGQ A;  2GCL A;  1GC6 A;  3ULC A;  5LOP B;  1M7R A;  3G9W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...