5DHFB

Crystal structure of hrio2 nes peptide in complex with crm1-ran-ranbp1
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
136
structure length
127
Chain Sequence
FEPVTMEEDEEVLYKVRAKLFRFDADAKEWKERGTGDCKFLKNKKTNKVRILMRRDKTLKICANHIIAPEYTLKPNVGSDRSWVYACTADIAEGEAEAFTFAIRFGSKENADKFKEEFEKAQEINKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural determinants of nuclear export signal orientation in binding to exportin CRM1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transport protein
molecule keywords GTP-binding nuclear protein Ran
total genus 35
structure length 127
sequence length 136
ec nomenclature
pdb deposition date 2015-08-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00638 Ran_BP1 RanBP1 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 5dhfB00
3SUZA 4F7GA 2CAYA 1K5GB 2DHJA 2DTCA 4MK0A 1U29A 1V5UA 2GCJA 1W1GA 5EFXA 4Z2MB 5J3TA 1UNRA 3SNHA 2COAA 4TKNA 4DBBA 1MIXA 1RJ2A 2DN6A 4ZRIA 4F7UP 2YVCA 3SV1A 2RGNB 2YT0A 3AJ4A 1UPRA 2XQNM 1B55A 4HAXB 3O96A 5DHAB 1X86A 1U5FA 3LJUX 3RCPA 2JP2A 3PVLA 3VOQA 2MKRA 1QC6A 4KHAA 3A8PA 3QWMA 1AWEA 5D3YA 1ZVRA 2MDXA 3DXEA 1MIZB 2V76A 2RSGA 5C5BB 5LOPB 2KCJA 2MWNB 2P8VA 4GXBA 3ODWA 2YS3A 1I2HA 1Y19B 1EAZA 3FSSA 1OQNA 3SYXA 4ZRKA 5D3XA 5DHFB 1Z87A 4DX90 1LW3A 4BBKA 4A6FB 5D3WA 1V89A 1J19A 2K2UA 2W2WA 5JLJB 1RRPB 2W2XC 1DDMA 4Z2NA 4HB2B 2ROZB 3QBVB 2N23A 2CRFA 3WYFB 5CLQB 3WA0A 1KZ7A 2COCA 1ISNA 2I5FA 2LKOA 5DH9B 1H10A 1SGHA 3PZDA 4IAPA 2VSZA 5FI0A 1EVHA 2NMBA 3T06A 1U5DA 1MPHA 2QKLA 3PG7A 5C79A 2DHIA 1MAIA 2K2JA 1BTKA 1GC6A 1PLSA 1V5MA 2D9YA 3DXCA 3DXDA 3TFMA 2H7DA 1UEFA 1K5DB 3U7DA 1XD4A 3BJIA 1DROA 4PQ0A 1GG3A 3MPXA 1GC7A 4XWXA 3D8FA 1FB8A 2LOZA 1FHOA 4C0AA 3BINA 3GYPA 2K00A 2I5CA 2OQBA 2ELBA 2CODA 2ROVA 4ZRJA 4KAXB 1U2BA 2IYBA 2J0KA 2LG1A 2P0HA 3A98B 1ZC3B 3P7ZA 1ZM0A 2RNRB 1WJMA 2J59M 2GCLA 2KUPA 2Q13A 4P7IA 4GMVA 4CYEA 1OY2A 2D10A 4EKUA 2DA0A 1V61A 1DDVA 2N0YA 1TXDA 1UNPA 3KRXA 3X23A 1OMWA 5JHHA 2UVMA 2ADZA 2P0FA 4EMOA 4IFSA 2NZ8B 4L6EA 1DYNA 3NSUA 3FM8C 2D11A 3F0WA 1FHWA 5HE2A 1XX0A 1MK7B 1XODA 2D9ZA 3HQCA 2DYNA 1XCGA 3KY9A 1NTVA 2DLWA 2J0JA 1FAOA 2Y8GA 3M1IB 1FHXA 2R0DA 4GMXB 2RUKB 5HE0A 4IOYX 2I1JA 2ZPYA 5KQ4A 4HB3B 3OANA 2EJ8A 2D9XA 2L2IA 2LULA 4KHBB 3PSCA 3D8EA 2YF0A 1LB1A 3PVWA 1AQCA 3CXBB 2HE7A 2VKIA 3TW1A 1WGQA 3FEHA 2AEHA 3IVFA 2CY4A 3V5WA 4H8SA 1KI1B 2COFA 4PNKA 1QQGA 3P6AA 2D9WA 2W2XD 2E2XA 2YRYA 4WVFB 4EJNA 1I7AA 4TYZA 1NI2A 3AU4A 5D27A 1TJ6A 1WGUA 1X1GA 4HAUB 5D3VA 5DIFB 2KGXB 2Z0OA 2I1KA 2YT1A 4HAVB 4HHVA 1WJ1A 1DBHA 1BAKA 1WVHA 5C5BA 5KQ1A 4F7HA 3F5RA 1FGZA 5HE3A 3ZDTA 2L1CA 1EF1A 4WSFA 5C16A 1H4RA 1P5TA 1N3HA 1U5GA 4HAZB 3CIKA 2D2QA 2VRWB 2Z0QA 4B6HA 1X11A 4A5KA 4KHOA 4WJ7A 5HE1A 1NTYA 4MT7A 1WG7A 4DX8A 3ULCA 5J3QA 4Y94A 2M38A 3TVVA 3PEGA 4A6HA 1E5WA 1ZC4B 2EMTA 4HB0B 2LYDA 4YONA 2EC1A 2YSZA 4K81A 1W1DA 1X1FA 5GOWB 4KVGB 3SO6A 1M7EA 2YS5A 1U5EA 4K17A 1SHCA 1U27A 1WI1A 3HW2B 3KZ1A 1V5PA 2Z0PA 1P3RA 1V88A 2GS0A 5CLLB 3UZTA 3ULBA 4D0NB 1TQZA 4K2OA 1FGYA 3TCAA 3ZVRA 3MDBC 3PVUA 5J3YA 2DX5A 3AU5A 1XKEA 4A6FA 4CHMA 3D8DA 3PP2A 3VIAA 4HB4B 3KSYA 2DHKA 3ML4A 3ODXA 4YL8A 2ELAA 2Y8FA 2Y7BA 2DX1A 2UZRA 1PMSA 2CY5A 1EGXA 2OTXA 5JP4A 2RVBB 4HDQA 1W1HA 4NSWA 4HDOA 2FJLA 3G9WA 1BWNA 4K2PA 1MK9B 1UNQA 4GPTB 2R09A 2MFQA 5C6RA 4DXAB 3GYOA 2YS1A 2HTHB 5FI1A 1Y5OA 1IRSA 4A6KA 1XR0B 4HATB 1J0WA 2BCJA 2D9VA 4NY0A 4HAYB 1P6SA 1BTNA 1Q67A 1ZSQA 2RLOA 2DYQA 1KZGA 2DKPA 2UZSA 1NU2A 1MKEA 1PFJA 1M7RA 2D4QA 4MY6A 2QKMA 5L81A 5KCVA 3HK0A 3A8QA 4GN1A 3U8ZA 2G35A 2LOXA 2P0DA 3N7CA 2EMSA 1X05A 2H7EA 2DFKA 4GZUA 3ODOA 4HAWB 2J0MA 5DI9B 3QIJA 1DDWA 1UPQA 2X18A 2DKQA 2GJYA 1FOEA 2AL6A 2PZ1A 5JHGA 4CHJA 5LONB 2IFSA 3TO1A 3KRWA 2M14A
chains in the Genus database with same CATH superfamily
3SUZA 4F7GA 2CAYA 1K5GB 2DHJA 3NW8A 2DTCA 4MK0A 1U29A 1V5UA 2GCJA 1W1GA 5EFXA 4Z2MB 5J3TA 1UNRA 3SNHA 5LG4B 2COAA 4TKNA 4DBBA 1MIXA 1RJ2A 2DN6A 4ZRIA 4F7UP 2YVCA 3SV1A 2RGNB 2YT0A 3AJ4A 1UPRA 2XQNM 1B55A 2KIEA 4HAXB 3O96A 5DHAB 4QJ5B 4KHBA 1X86A 1U5FA 3LJUX 3RCPA 2JP2A 3PVLA 3VOQA 2MKRA 1QC6A 4KHAA 3A8PA 3QWMA 1AWEA 5D3YA 1ZVRA 3DXEA 2MDXA 1MIZB 2V76A 2RSGA 5C5BB 2K8EA 5LOPB 2KCJA 2MWNB 2P8VA 4GXBA 3ODWA 2YS3A 1I2HA 1Y19B 1EAZA 3FSSA 1OQNA 3SYXA 4ZRKA 5D3XA 5DHFB 1Z87A 4DX90 2Z13A 1LW3A 4BBKA 4A6FB 5D3WA 1V89A 1J19A 4QXAB 2K2UA 2W2WA 5JLJB 1RRPB 2W2XC 1DDMA 4Z2NA 4HB2B 2ROZB 3QBVB 2N23A 2CRFA 3WYFB 5CLQB 3WA0A 1KZ7A 2COCA 1ISNA 2I5FA 2LKOA 5DH9B 4HSIA 1H10A 1SGHA 3PZDA 4IAPA 3OHMB 2VSZA 5FI0A 1EVHA 2NMBA 3T06A 5IRSA 1U5DA 2YT2A 1MPHA 2QKLA 3PG7A 5C79A 2DHIA 1MAIA 2K2JA 1BTKA 1GC6A 1PLSA 1V5MA 2D9YA 3DXCA 3DXDA 4GNKB 3TFMA 2H7DA 1UEFA 1K5DB 3U7DA 3U12A 1XD4A 3BJIA 1DROA 4PQ0A 1GG3A 3MPXA 1GC7A 4XWXA 3D8FA 1FB8A 2ZKMX 2LOZA 1FHOA 4C0AA 3BINA 3GYPA 2K00A 2I5CA 2OQBA 3B77A 2ELBA 2CODA 2ROVA 4ZRJA 4KAXB 1U2BA 2IYBA 2J0KA 3HIEA 2LG1A 2P0HA 2Z4DA 3A98B 1ZC3B 3P7ZA 2RRFA 4OSNA 1ZM0A 2RNRB 1WJMA 2J59M 2GCLA 2KUPA 2Q13A 4P7IA 4GMVA 4CYEA 1OY2A 2D10A 4EKUA 2DA0A 1V61A 1DDVA 2N0YA 1TXDA 1UNPA 3KRXA 3X23A 1OMWA 5JHHA 2UVMA 2ADZA 2P0FA 4EMOA 4IFSA 2NZ8B 4L6EA 1DYNA 3NSUA 3FM8C 2D11A 3F0WA 1FHWA 5HE2A 1XX0A 1MK7B 1XODA 2D9ZA 2KUQA 3HQCA 2DYNA 3NWAA 1XCGA 3KY9A 1NTVA 2DLWA 2J0JA 1FAOA 2Y8GA 3M1IB 1FHXA 2R0DA 4GMXB 2RUKB 5HE0A 4IOYX 2I1JA 2ZPYA 5KQ4A 4HB3B 3OANA 2EJ8A 2D9XA 1T77A 2L2IA 2LULA 4KHBB 3PSCA 3D8EA 2YF0A 1LB1A 3PVWA 1AQCA 3CXBB 2HE7A 2VKIA 3TW1A 1WGQA 3FEHA 2AEHA 3IVFA 2CY4A 3V5WA 4H8SA 1KI1B 2COFA 4PNKA 1QQGA 3P6AA 2D9WA 2W2XD 2E2XA 2YRYA 4WVFB 4EJNA 1I7AA 4TYZA 1NI2A 3AU4A 5D27A 2Z14A 1TJ6A 3NWFA 2GUMA 3NWDA 1WGUA 1X1GA 4HAUB 5D3VA 5DIFB 2KGXB 2Z0OA 2I1KA 2R2YA 2YT1A 4HAVB 4HHVA 1WJ1A 1DBHA 1BAKA 1WVHA 5C5BA 5KQ1A 4F7HA 3F5RA 1FGZA 5HE3A 3ZDTA 2L1CA 1EF1A 3DCXA 4WSFA 5C16A 1H4RA 1P5TA 1N3HA 1U5GA 4HAZB 3CIKA 2D2QA 2VRWB 2Z0QA 4B6HA 4GOUA 1X11A 4A5KA 4KHOA 2K49A 4WJ7A 5HE1A 1NTYA 4MT7A 1WG7A 4DX8A 3ULCA 5J3QA 4Y94A 4D6WA 3A58A 2M38A 3TVVA 2Z59A 3PEGA 4A6HA 1E5WA 1ZC4B 2EMTA 4HB0B 2LYDA 4YONA 2EC1A 2YSZA 4K81A 1W1DA 1X1FA 5GOWB 4KVGB 3SO6A 1M7EA 2YS5A 5M4YB 1U5EA 4K17A 2KR0A 1SHCA 1U27A 1WI1A 3HW2B 3KZ1A 1V5PA 2Z0PA 1P3RA 1V88A 2GS0A 5CLLB 3UZTA 3ULBA 4D0NB 1TQZA 4K2OA 1FGYA 3TCAA 3ZVRA 3MDBC 3FVCA 3PVUA 5J3YA 2DX5A 3AU5A 1XKEA 4A6FA 4CHMA 3D8DA 3PP2A 3VIAA 4HB4B 3KSYA 2DHKA 3ML4A 3ODXA 4YL8A 2ELAA 2Y8FA 2Y7BA 5I2MA 4L1RA 2DX1A 2UZRA 1PMSA 2CY5A 1EGXA 2OTXA 5JP4A 2RVBB 4HDQA 4DIXA 1W1HA 4NSWA 4QJ4B 4HDOA 2FJLA 3G9WA 1BWNA 4K2PA 1MK9B 1UNQA 4GPTB 2FJUB 2R09A 2MFQA 5C6RA 4DXAB 3GYOA 2YS1A 2HTHB 5FI1A 1Y5OA 1IRSA 4A6KA 1XR0B 4HATB 1J0WA 2BCJA 2D9VA 4NY0A 4HAYB 1P6SA 1BTNA 1Q67A 1ZSQA 2RLOA 2DYQA 1MI1A 1KZGA 2DKPA 2KIGA 2UZSA 1NU2A 4OT1A 3HSAA 1MKEA 1PFJA 1M7RA 2D4QA 4MY6A 2QKMA 5L81A 5KCVA 3HK0A 3A8QA 4GN1A 4QJ3B 3U8ZA 2G35A 2LOXA 2P0DA 3N7CA 2EMSA 1X05A 2H7EA 2DFKA 3ODOA 4GZUA 4HAWB 2J0MA 5DI9B 3QIJA 1DDWA 1UPQA 2X18A 2DKQA 1ZYIA 2GJYA 1FOEA 4CSQA 2AL6A 2PZ1A 5JHGA 4CHJA 5LONB 2IFSA 5I2SA 3TO1A 3KRWA 2NBVA 2M14A
chains in the Genus database with same CATH topology
3SUZA 4F7GA 2CAYA 1K5GB 2DHJA 2DTCA 4MK0A 1U29A 1V5UA 2GCJA 1W1GA 5EFXA 4Z2MB 5J3TA 1UNRA 3SNHA 2COAA 4TKNA 4DBBA 1MIXA 1RJ2A 2DN6A 4ZRIA 4F7UP 2YVCA 3SV1A 2RGNB 2YT0A 3AJ4A 1UPRA 2XQNM 1B55A 4HAXB 3O96A 5DHAB 1X86A 1U5FA 3LJUX 3RCPA 2JP2A 3PVLA 3VOQA 2MKRA 1QC6A 4KHAA 3A8PA 3QWMA 1AWEA 5D3YA 1ZVRA 2MDXA 3DXEA 1MIZB 2V76A 2RSGA 5C5BB 5LOPB 2KCJA 2MWNB 2P8VA 4GXBA 3ODWA 2YS3A 1I2HA 1Y19B 1EAZA 3FSSA 1OQNA 3SYXA 4ZRKA 5D3XA 5DHFB 1Z87A 4DX90 1LW3A 4BBKA 4A6FB 5D3WA 1V89A 1J19A 2K2UA 2W2WA 5JLJB 1RRPB 2W2XC 1DDMA 4Z2NA 4HB2B 2ROZB 3QBVB 2N23A 2CRFA 3WYFB 5CLQB 3WA0A 1KZ7A 2COCA 1ISNA 2I5FA 2LKOA 5DH9B 1H10A 1SGHA 3PZDA 4IAPA 2VSZA 5FI0A 1EVHA 2NMBA 3T06A 1U5DA 1MPHA 2QKLA 3PG7A 5C79A 2DHIA 1MAIA 2K2JA 1BTKA 1GC6A 1PLSA 1V5MA 2D9YA 3DXCA 3DXDA 3TFMA 2H7DA 1UEFA 1K5DB 3U7DA 1XD4A 3BJIA 1DROA 4PQ0A 1GG3A 3MPXA 1GC7A 4XWXA 3D8FA 1FB8A 2LOZA 1FHOA 4C0AA 3BINA 3GYPA 2K00A 2I5CA 2OQBA 2ELBA 2CODA 2ROVA 4ZRJA 4KAXB 1U2BA 2IYBA 2J0KA 2LG1A 2P0HA 3A98B 1ZC3B 3P7ZA 1ZM0A 2RNRB 1WJMA 2J59M 2GCLA 2KUPA 2Q13A 4P7IA 4GMVA 4CYEA 1OY2A 2D10A 4EKUA 2DA0A 1V61A 1DDVA 2N0YA 1TXDA 1UNPA 3KRXA 3X23A 1OMWA 5JHHA 2UVMA 2ADZA 2P0FA 4EMOA 4IFSA 2NZ8B 4L6EA 1DYNA 3NSUA 3FM8C 2D11A 3F0WA 1FHWA 5HE2A 1XX0A 1MK7B 1XODA 2D9ZA 3HQCA 2DYNA 1XCGA 3KY9A 1NTVA 2DLWA 2J0JA 1FAOA 2Y8GA 3M1IB 1FHXA 2R0DA 4GMXB 2RUKB 5HE0A 4IOYX 2I1JA 2ZPYA 5KQ4A 4HB3B 3OANA 2EJ8A 2D9XA 2L2IA 2LULA 4KHBB 3PSCA 3D8EA 2YF0A 1LB1A 3PVWA 1AQCA 3CXBB 2HE7A 2VKIA 3TW1A 1WGQA 3FEHA 2AEHA 3IVFA 2CY4A 3V5WA 4H8SA 1KI1B 2COFA 4PNKA 1QQGA 3P6AA 2D9WA 2W2XD 2E2XA 2YRYA 4WVFB 4EJNA 1I7AA 4TYZA 1NI2A 3AU4A 5D27A 1TJ6A 1WGUA 1X1GA 4HAUB 5D3VA 5DIFB 2KGXB 2Z0OA 2I1KA 2YT1A 4HAVB 4HHVA 1WJ1A 1DBHA 1BAKA 1WVHA 5C5BA 5KQ1A 4F7HA 3F5RA 1FGZA 5HE3A 3ZDTA 2L1CA 1EF1A 4WSFA 5C16A 1H4RA 1P5TA 1N3HA 1U5GA 4HAZB 3CIKA 2D2QA 2VRWB 2Z0QA 4B6HA 1X11A 4A5KA 4KHOA 4WJ7A 5HE1A 1NTYA 4MT7A 1WG7A 4DX8A 3ULCA 5J3QA 4Y94A 2M38A 3TVVA 3PEGA 4A6HA 1E5WA 1ZC4B 2EMTA 4HB0B 2LYDA 4YONA 2EC1A 2YSZA 4K81A 1W1DA 1X1FA 5GOWB 4KVGB 3SO6A 1M7EA 2YS5A 1U5EA 4K17A 1SHCA 1U27A 1WI1A 3HW2B 3KZ1A 1V5PA 2Z0PA 1P3RA 1V88A 2GS0A 5CLLB 3UZTA 3ULBA 4D0NB 1TQZA 4K2OA 1FGYA 3TCAA 3ZVRA 3MDBC 3PVUA 5J3YA 2DX5A 3AU5A 1XKEA 4A6FA 4CHMA 3D8DA 3PP2A 3VIAA 4HB4B 3KSYA 2DHKA 3ML4A 3ODXA 4YL8A 2ELAA 2Y8FA 2Y7BA 2DX1A 2UZRA 1PMSA 2CY5A 1EGXA 2OTXA 5JP4A 2RVBB 4HDQA 1W1HA 4NSWA 4HDOA 2FJLA 3G9WA 1BWNA 4K2PA 1MK9B 1UNQA 4GPTB 2R09A 2MFQA 5C6RA 4DXAB 3GYOA 2YS1A 2HTHB 5FI1A 1Y5OA 1IRSA 4A6KA 1XR0B 4HATB 1J0WA 2BCJA 2D9VA 4NY0A 4HAYB 1P6SA 1BTNA 1Q67A 1ZSQA 2RLOA 2DYQA 1KZGA 2DKPA 2UZSA 1NU2A 1MKEA 1PFJA 1M7RA 2D4QA 4MY6A 2QKMA 5L81A 5KCVA 3HK0A 3A8QA 4GN1A 3U8ZA 2G35A 2LOXA 2P0DA 3N7CA 2EMSA 1X05A 2H7EA 2DFKA 4GZUA 3ODOA 4HAWB 2J0MA 5DI9B 3QIJA 1DDWA 1UPQA 2X18A 2DKQA 2GJYA 1FOEA 2AL6A 2PZ1A 5JHGA 4CHJA 5LONB 2IFSA 3TO1A 3KRWA 2M14A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SUZ A;  4F7G A;  2CAY A;  1K5G B;  2DHJ A;  2DTC A;  4MK0 A;  1U29 A;  1V5U A;  2GCJ A;  1W1G A;  5EFX A;  4Z2M B;  5J3T A;  1UNR A;  3SNH A;  2COA A;  4TKN A;  4DBB A;  1MIX A;  1RJ2 A;  2DN6 A;  4ZRI A;  4F7U P;  2YVC A;  3SV1 A;  2RGN B;  2YT0 A;  3AJ4 A;  1UPR A;  2XQN M;  1B55 A;  4HAX B;  3O96 A;  5DHA B;  1X86 A;  1U5F A;  3LJU X;  3RCP A;  2JP2 A;  3PVL A;  3VOQ A;  2MKR A;  1QC6 A;  4KHA A;  3A8P A;  3QWM A;  1AWE A;  5D3Y A;  1ZVR A;  2MDX A;  3DXE A;  1MIZ B;  2V76 A;  2RSG A;  5C5B B;  5LOP B;  2KCJ A;  2MWN B;  2P8V A;  4GXB A;  3ODW A;  2YS3 A;  1I2H A;  1Y19 B;  1EAZ A;  3FSS A;  1OQN A;  3SYX A;  4ZRK A;  5D3X A;  5DHF B;  1Z87 A;  4DX9 0;  1LW3 A;  4BBK A;  4A6F B;  5D3W A;  1V89 A;  1J19 A;  2K2U A;  2W2W A;  5JLJ B;  1RRP B;  2W2X C;  1DDM A;  4Z2N A;  4HB2 B;  2ROZ B;  3QBV B;  2N23 A;  2CRF A;  3WYF B;  5CLQ B;  3WA0 A;  1KZ7 A;  2COC A;  1ISN A;  2I5F A;  2LKO A;  5DH9 B;  1H10 A;  1SGH A;  3PZD A;  4IAP A;  2VSZ A;  5FI0 A;  1EVH A;  2NMB A;  3T06 A;  1U5D A;  1MPH A;  2QKL A;  3PG7 A;  5C79 A;  2DHI A;  1MAI A;  2K2J A;  1BTK A;  1GC6 A;  1PLS A;  1V5M A;  2D9Y A;  3DXC A;  3DXD A;  3TFM A;  2H7D A;  1UEF A;  1K5D B;  3U7D A;  1XD4 A;  3BJI A;  1DRO A;  4PQ0 A;  1GG3 A;  3MPX A;  1GC7 A;  4XWX A;  3D8F A;  1FB8 A;  2LOZ A;  1FHO A;  4C0A A;  3BIN A;  3GYP A;  2K00 A;  2I5C A;  2OQB A;  2ELB A;  2COD A;  2ROV A;  4ZRJ A;  4KAX B;  1U2B A;  2IYB A;  2J0K A;  2LG1 A;  2P0H A;  3A98 B;  1ZC3 B;  3P7Z A;  1ZM0 A;  2RNR B;  1WJM A;  2J59 M;  2GCL A;  2KUP A;  2Q13 A;  4P7I A;  4GMV A;  4CYE A;  1OY2 A;  2D10 A;  4EKU A;  2DA0 A;  1V61 A;  1DDV A;  2N0Y A;  1TXD A;  1UNP A;  3KRX A;  3X23 A;  1OMW A;  5JHH A;  2UVM A;  2ADZ A;  2P0F A;  4EMO A;  4IFS A;  2NZ8 B;  4L6E A;  1DYN A;  3NSU A;  3FM8 C;  2D11 A;  3F0W A;  1FHW A;  5HE2 A;  1XX0 A;  1MK7 B;  1XOD A;  2D9Z A;  3HQC A;  2DYN A;  1XCG A;  3KY9 A;  1NTV A;  2DLW A;  2J0J A;  1FAO A;  2Y8G A;  3M1I B;  1FHX A;  2R0D A;  4GMX B;  2RUK B;  5HE0 A;  4IOY X;  2I1J A;  2ZPY A;  5KQ4 A;  4HB3 B;  3OAN A;  2EJ8 A;  2D9X A;  2L2I A;  2LUL A;  4KHB B;  3PSC A;  3D8E A;  2YF0 A;  1LB1 A;  3PVW A;  1AQC A;  3CXB B;  2HE7 A;  2VKI A;  3TW1 A;  1WGQ A;  3FEH A;  2AEH A;  3IVF A;  2CY4 A;  3V5W A;  4H8S A;  1KI1 B;  2COF A;  4PNK A;  1QQG A;  3P6A A;  2D9W A;  2W2X D;  2E2X A;  2YRY A;  4WVF B;  4EJN A;  1I7A A;  4TYZ A;  1NI2 A;  3AU4 A;  5D27 A;  1TJ6 A;  1WGU A;  1X1G A;  4HAU B;  5D3V A;  5DIF B;  2KGX B;  2Z0O A;  2I1K A;  2YT1 A;  4HAV B;  4HHV A;  1WJ1 A;  1DBH A;  1BAK A;  1WVH A;  5C5B A;  5KQ1 A;  4F7H A;  3F5R A;  1FGZ A;  5HE3 A;  3ZDT A;  2L1C A;  1EF1 A;  4WSF A;  5C16 A;  1H4R A;  1P5T A;  1N3H A;  1U5G A;  4HAZ B;  3CIK A;  2D2Q A;  2VRW B;  2Z0Q A;  4B6H A;  1X11 A;  4A5K A;  4KHO A;  4WJ7 A;  5HE1 A;  1NTY A;  4MT7 A;  1WG7 A;  4DX8 A;  3ULC A;  5J3Q A;  4Y94 A;  2M38 A;  3TVV A;  3PEG A;  4A6H A;  1E5W A;  1ZC4 B;  2EMT A;  4HB0 B;  2LYD A;  4YON A;  2EC1 A;  2YSZ A;  4K81 A;  1W1D A;  1X1F A;  5GOW B;  4KVG B;  3SO6 A;  1M7E A;  2YS5 A;  1U5E A;  4K17 A;  1SHC A;  1U27 A;  1WI1 A;  3HW2 B;  3KZ1 A;  1V5P A;  2Z0P A;  1P3R A;  1V88 A;  2GS0 A;  5CLL B;  3UZT A;  3ULB A;  4D0N B;  1TQZ A;  4K2O A;  1FGY A;  3TCA A;  3ZVR A;  3MDB C;  3PVU A;  5J3Y A;  2DX5 A;  3AU5 A;  1XKE A;  4A6F A;  4CHM A;  3D8D A;  3PP2 A;  3VIA A;  4HB4 B;  3KSY A;  2DHK A;  3ML4 A;  3ODX A;  4YL8 A;  2ELA A;  2Y8F A;  2Y7B A;  2DX1 A;  2UZR A;  1PMS A;  2CY5 A;  1EGX A;  2OTX A;  5JP4 A;  2RVB B;  4HDQ A;  1W1H A;  4NSW A;  4HDO A;  2FJL A;  3G9W A;  1BWN A;  4K2P A;  1MK9 B;  1UNQ A;  4GPT B;  2R09 A;  2MFQ A;  5C6R A;  4DXA B;  3GYO A;  2YS1 A;  2HTH B;  5FI1 A;  1Y5O A;  1IRS A;  4A6K A;  1XR0 B;  4HAT B;  1J0W A;  2BCJ A;  2D9V A;  4NY0 A;  4HAY B;  1P6S A;  1BTN A;  1Q67 A;  1ZSQ A;  2RLO A;  2DYQ A;  1KZG A;  2DKP A;  2UZS A;  1NU2 A;  1MKE A;  1PFJ A;  1M7R A;  2D4Q A;  4MY6 A;  2QKM A;  5L81 A;  5KCV A;  3HK0 A;  3A8Q A;  4GN1 A;  3U8Z A;  2G35 A;  2LOX A;  2P0D A;  3N7C A;  2EMS A;  1X05 A;  2H7E A;  2DFK A;  4GZU A;  3ODO A;  4HAW B;  2J0M A;  5DI9 B;  3QIJ A;  1DDW A;  1UPQ A;  2X18 A;  2DKQ A;  2GJY A;  1FOE A;  2AL6 A;  2PZ1 A;  5JHG A;  4CHJ A;  5LON B;  2IFS A;  3TO1 A;  3KRW A;  2M14 A; 
#chains in the Genus database with same CATH topology
 3SUZ A;  4F7G A;  2CAY A;  1K5G B;  2DHJ A;  3NW8 A;  2DTC A;  4MK0 A;  1U29 A;  1V5U A;  2GCJ A;  1W1G A;  5EFX A;  4Z2M B;  5J3T A;  1UNR A;  3SNH A;  5LG4 B;  2COA A;  4TKN A;  4DBB A;  1MIX A;  1RJ2 A;  2DN6 A;  4ZRI A;  4F7U P;  2YVC A;  3SV1 A;  2RGN B;  2YT0 A;  3AJ4 A;  1UPR A;  2XQN M;  1B55 A;  2KIE A;  4HAX B;  3O96 A;  5DHA B;  4QJ5 B;  4KHB A;  1X86 A;  1U5F A;  3LJU X;  3RCP A;  2JP2 A;  3PVL A;  3VOQ A;  2MKR A;  1QC6 A;  4KHA A;  3A8P A;  3QWM A;  1AWE A;  5D3Y A;  1ZVR A;  3DXE A;  2MDX A;  1MIZ B;  2V76 A;  2RSG A;  5C5B B;  2K8E A;  5LOP B;  2KCJ A;  2MWN B;  2P8V A;  4GXB A;  3ODW A;  2YS3 A;  1I2H A;  1Y19 B;  1EAZ A;  3FSS A;  1OQN A;  3SYX A;  4ZRK A;  5D3X A;  5DHF B;  1Z87 A;  4DX9 0;  2Z13 A;  1LW3 A;  4BBK A;  4A6F B;  5D3W A;  1V89 A;  1J19 A;  4QXA B;  2K2U A;  2W2W A;  5JLJ B;  1RRP B;  2W2X C;  1DDM A;  4Z2N A;  4HB2 B;  2ROZ B;  3QBV B;  2N23 A;  2CRF A;  3WYF B;  5CLQ B;  3WA0 A;  1KZ7 A;  2COC A;  1ISN A;  2I5F A;  2LKO A;  5DH9 B;  4HSI A;  1H10 A;  1SGH A;  3PZD A;  4IAP A;  3OHM B;  2VSZ A;  5FI0 A;  1EVH A;  2NMB A;  3T06 A;  5IRS A;  1U5D A;  2YT2 A;  1MPH A;  2QKL A;  3PG7 A;  5C79 A;  2DHI A;  1MAI A;  2K2J A;  1BTK A;  1GC6 A;  1PLS A;  1V5M A;  2D9Y A;  3DXC A;  3DXD A;  4GNK B;  3TFM A;  2H7D A;  1UEF A;  1K5D B;  3U7D A;  3U12 A;  1XD4 A;  3BJI A;  1DRO A;  4PQ0 A;  1GG3 A;  3MPX A;  1GC7 A;  4XWX A;  3D8F A;  1FB8 A;  2ZKM X;  2LOZ A;  1FHO A;  4C0A A;  3BIN A;  3GYP A;  2K00 A;  2I5C A;  2OQB A;  3B77 A;  2ELB A;  2COD A;  2ROV A;  4ZRJ A;  4KAX B;  1U2B A;  2IYB A;  2J0K A;  3HIE A;  2LG1 A;  2P0H A;  2Z4D A;  3A98 B;  1ZC3 B;  3P7Z A;  2RRF A;  4OSN A;  1ZM0 A;  2RNR B;  1WJM A;  2J59 M;  2GCL A;  2KUP A;  2Q13 A;  4P7I A;  4GMV A;  4CYE A;  1OY2 A;  2D10 A;  4EKU A;  2DA0 A;  1V61 A;  1DDV A;  2N0Y A;  1TXD A;  1UNP A;  3KRX A;  3X23 A;  1OMW A;  5JHH A;  2UVM A;  2ADZ A;  2P0F A;  4EMO A;  4IFS A;  2NZ8 B;  4L6E A;  1DYN A;  3NSU A;  3FM8 C;  2D11 A;  3F0W A;  1FHW A;  5HE2 A;  1XX0 A;  1MK7 B;  1XOD A;  2D9Z A;  2KUQ A;  3HQC A;  2DYN A;  3NWA A;  1XCG A;  3KY9 A;  1NTV A;  2DLW A;  2J0J A;  1FAO A;  2Y8G A;  3M1I B;  1FHX A;  2R0D A;  4GMX B;  2RUK B;  5HE0 A;  4IOY X;  2I1J A;  2ZPY A;  5KQ4 A;  4HB3 B;  3OAN A;  2EJ8 A;  2D9X A;  1T77 A;  2L2I A;  2LUL A;  4KHB B;  3PSC A;  3D8E A;  2YF0 A;  1LB1 A;  3PVW A;  1AQC A;  3CXB B;  2HE7 A;  2VKI A;  3TW1 A;  1WGQ A;  3FEH A;  2AEH A;  3IVF A;  2CY4 A;  3V5W A;  4H8S A;  1KI1 B;  2COF A;  4PNK A;  1QQG A;  3P6A A;  2D9W A;  2W2X D;  2E2X A;  2YRY A;  4WVF B;  4EJN A;  1I7A A;  4TYZ A;  1NI2 A;  3AU4 A;  5D27 A;  2Z14 A;  1TJ6 A;  3NWF A;  2GUM A;  3NWD A;  1WGU A;  1X1G A;  4HAU B;  5D3V A;  5DIF B;  2KGX B;  2Z0O A;  2I1K A;  2R2Y A;  2YT1 A;  4HAV B;  4HHV A;  1WJ1 A;  1DBH A;  1BAK A;  1WVH A;  5C5B A;  5KQ1 A;  4F7H A;  3F5R A;  1FGZ A;  5HE3 A;  3ZDT A;  2L1C A;  1EF1 A;  3DCX A;  4WSF A;  5C16 A;  1H4R A;  1P5T A;  1N3H A;  1U5G A;  4HAZ B;  3CIK A;  2D2Q A;  2VRW B;  2Z0Q A;  4B6H A;  4GOU A;  1X11 A;  4A5K A;  4KHO A;  2K49 A;  4WJ7 A;  5HE1 A;  1NTY A;  4MT7 A;  1WG7 A;  4DX8 A;  3ULC A;  5J3Q A;  4Y94 A;  4D6W A;  3A58 A;  2M38 A;  3TVV A;  2Z59 A;  3PEG A;  4A6H A;  1E5W A;  1ZC4 B;  2EMT A;  4HB0 B;  2LYD A;  4YON A;  2EC1 A;  2YSZ A;  4K81 A;  1W1D A;  1X1F A;  5GOW B;  4KVG B;  3SO6 A;  1M7E A;  2YS5 A;  5M4Y B;  1U5E A;  4K17 A;  2KR0 A;  1SHC A;  1U27 A;  1WI1 A;  3HW2 B;  3KZ1 A;  1V5P A;  2Z0P A;  1P3R A;  1V88 A;  2GS0 A;  5CLL B;  3UZT A;  3ULB A;  4D0N B;  1TQZ A;  4K2O A;  1FGY A;  3TCA A;  3ZVR A;  3MDB C;  3FVC A;  3PVU A;  5J3Y A;  2DX5 A;  3AU5 A;  1XKE A;  4A6F A;  4CHM A;  3D8D A;  3PP2 A;  3VIA A;  4HB4 B;  3KSY A;  2DHK A;  3ML4 A;  3ODX A;  4YL8 A;  2ELA A;  2Y8F A;  2Y7B A;  5I2M A;  4L1R A;  2DX1 A;  2UZR A;  1PMS A;  2CY5 A;  1EGX A;  2OTX A;  5JP4 A;  2RVB B;  4HDQ A;  4DIX A;  1W1H A;  4NSW A;  4QJ4 B;  4HDO A;  2FJL A;  3G9W A;  1BWN A;  4K2P A;  1MK9 B;  1UNQ A;  4GPT B;  2FJU B;  2R09 A;  2MFQ A;  5C6R A;  4DXA B;  3GYO A;  2YS1 A;  2HTH B;  5FI1 A;  1Y5O A;  1IRS A;  4A6K A;  1XR0 B;  4HAT B;  1J0W A;  2BCJ A;  2D9V A;  4NY0 A;  4HAY B;  1P6S A;  1BTN A;  1Q67 A;  1ZSQ A;  2RLO A;  2DYQ A;  1MI1 A;  1KZG A;  2DKP A;  2KIG A;  2UZS A;  1NU2 A;  4OT1 A;  3HSA A;  1MKE A;  1PFJ A;  1M7R A;  2D4Q A;  4MY6 A;  2QKM A;  5L81 A;  5KCV A;  3HK0 A;  3A8Q A;  4GN1 A;  4QJ3 B;  3U8Z A;  2G35 A;  2LOX A;  2P0D A;  3N7C A;  2EMS A;  1X05 A;  2H7E A;  2DFK A;  3ODO A;  4GZU A;  4HAW B;  2J0M A;  5DI9 B;  3QIJ A;  1DDW A;  1UPQ A;  2X18 A;  2DKQ A;  1ZYI A;  2GJY A;  1FOE A;  4CSQ A;  2AL6 A;  2PZ1 A;  5JHG A;  4CHJ A;  5LON B;  2IFS A;  5I2S A;  3TO1 A;  3KRW A;  2NBV A;  2M14 A; 
#chains in the Genus database with same CATH homology
 3SUZ A;  4F7G A;  2CAY A;  1K5G B;  2DHJ A;  2DTC A;  4MK0 A;  1U29 A;  1V5U A;  2GCJ A;  1W1G A;  5EFX A;  4Z2M B;  5J3T A;  1UNR A;  3SNH A;  2COA A;  4TKN A;  4DBB A;  1MIX A;  1RJ2 A;  2DN6 A;  4ZRI A;  4F7U P;  2YVC A;  3SV1 A;  2RGN B;  2YT0 A;  3AJ4 A;  1UPR A;  2XQN M;  1B55 A;  4HAX B;  3O96 A;  5DHA B;  1X86 A;  1U5F A;  3LJU X;  3RCP A;  2JP2 A;  3PVL A;  3VOQ A;  2MKR A;  1QC6 A;  4KHA A;  3A8P A;  3QWM A;  1AWE A;  5D3Y A;  1ZVR A;  2MDX A;  3DXE A;  1MIZ B;  2V76 A;  2RSG A;  5C5B B;  5LOP B;  2KCJ A;  2MWN B;  2P8V A;  4GXB A;  3ODW A;  2YS3 A;  1I2H A;  1Y19 B;  1EAZ A;  3FSS A;  1OQN A;  3SYX A;  4ZRK A;  5D3X A;  5DHF B;  1Z87 A;  4DX9 0;  1LW3 A;  4BBK A;  4A6F B;  5D3W A;  1V89 A;  1J19 A;  2K2U A;  2W2W A;  5JLJ B;  1RRP B;  2W2X C;  1DDM A;  4Z2N A;  4HB2 B;  2ROZ B;  3QBV B;  2N23 A;  2CRF A;  3WYF B;  5CLQ B;  3WA0 A;  1KZ7 A;  2COC A;  1ISN A;  2I5F A;  2LKO A;  5DH9 B;  1H10 A;  1SGH A;  3PZD A;  4IAP A;  2VSZ A;  5FI0 A;  1EVH A;  2NMB A;  3T06 A;  1U5D A;  1MPH A;  2QKL A;  3PG7 A;  5C79 A;  2DHI A;  1MAI A;  2K2J A;  1BTK A;  1GC6 A;  1PLS A;  1V5M A;  2D9Y A;  3DXC A;  3DXD A;  3TFM A;  2H7D A;  1UEF A;  1K5D B;  3U7D A;  1XD4 A;  3BJI A;  1DRO A;  4PQ0 A;  1GG3 A;  3MPX A;  1GC7 A;  4XWX A;  3D8F A;  1FB8 A;  2LOZ A;  1FHO A;  4C0A A;  3BIN A;  3GYP A;  2K00 A;  2I5C A;  2OQB A;  2ELB A;  2COD A;  2ROV A;  4ZRJ A;  4KAX B;  1U2B A;  2IYB A;  2J0K A;  2LG1 A;  2P0H A;  3A98 B;  1ZC3 B;  3P7Z A;  1ZM0 A;  2RNR B;  1WJM A;  2J59 M;  2GCL A;  2KUP A;  2Q13 A;  4P7I A;  4GMV A;  4CYE A;  1OY2 A;  2D10 A;  4EKU A;  2DA0 A;  1V61 A;  1DDV A;  2N0Y A;  1TXD A;  1UNP A;  3KRX A;  3X23 A;  1OMW A;  5JHH A;  2UVM A;  2ADZ A;  2P0F A;  4EMO A;  4IFS A;  2NZ8 B;  4L6E A;  1DYN A;  3NSU A;  3FM8 C;  2D11 A;  3F0W A;  1FHW A;  5HE2 A;  1XX0 A;  1MK7 B;  1XOD A;  2D9Z A;  3HQC A;  2DYN A;  1XCG A;  3KY9 A;  1NTV A;  2DLW A;  2J0J A;  1FAO A;  2Y8G A;  3M1I B;  1FHX A;  2R0D A;  4GMX B;  2RUK B;  5HE0 A;  4IOY X;  2I1J A;  2ZPY A;  5KQ4 A;  4HB3 B;  3OAN A;  2EJ8 A;  2D9X A;  2L2I A;  2LUL A;  4KHB B;  3PSC A;  3D8E A;  2YF0 A;  1LB1 A;  3PVW A;  1AQC A;  3CXB B;  2HE7 A;  2VKI A;  3TW1 A;  1WGQ A;  3FEH A;  2AEH A;  3IVF A;  2CY4 A;  3V5W A;  4H8S A;  1KI1 B;  2COF A;  4PNK A;  1QQG A;  3P6A A;  2D9W A;  2W2X D;  2E2X A;  2YRY A;  4WVF B;  4EJN A;  1I7A A;  4TYZ A;  1NI2 A;  3AU4 A;  5D27 A;  1TJ6 A;  1WGU A;  1X1G A;  4HAU B;  5D3V A;  5DIF B;  2KGX B;  2Z0O A;  2I1K A;  2YT1 A;  4HAV B;  4HHV A;  1WJ1 A;  1DBH A;  1BAK A;  1WVH A;  5C5B A;  5KQ1 A;  4F7H A;  3F5R A;  1FGZ A;  5HE3 A;  3ZDT A;  2L1C A;  1EF1 A;  4WSF A;  5C16 A;  1H4R A;  1P5T A;  1N3H A;  1U5G A;  4HAZ B;  3CIK A;  2D2Q A;  2VRW B;  2Z0Q A;  4B6H A;  1X11 A;  4A5K A;  4KHO A;  4WJ7 A;  5HE1 A;  1NTY A;  4MT7 A;  1WG7 A;  4DX8 A;  3ULC A;  5J3Q A;  4Y94 A;  2M38 A;  3TVV A;  3PEG A;  4A6H A;  1E5W A;  1ZC4 B;  2EMT A;  4HB0 B;  2LYD A;  4YON A;  2EC1 A;  2YSZ A;  4K81 A;  1W1D A;  1X1F A;  5GOW B;  4KVG B;  3SO6 A;  1M7E A;  2YS5 A;  1U5E A;  4K17 A;  1SHC A;  1U27 A;  1WI1 A;  3HW2 B;  3KZ1 A;  1V5P A;  2Z0P A;  1P3R A;  1V88 A;  2GS0 A;  5CLL B;  3UZT A;  3ULB A;  4D0N B;  1TQZ A;  4K2O A;  1FGY A;  3TCA A;  3ZVR A;  3MDB C;  3PVU A;  5J3Y A;  2DX5 A;  3AU5 A;  1XKE A;  4A6F A;  4CHM A;  3D8D A;  3PP2 A;  3VIA A;  4HB4 B;  3KSY A;  2DHK A;  3ML4 A;  3ODX A;  4YL8 A;  2ELA A;  2Y8F A;  2Y7B A;  2DX1 A;  2UZR A;  1PMS A;  2CY5 A;  1EGX A;  2OTX A;  5JP4 A;  2RVB B;  4HDQ A;  1W1H A;  4NSW A;  4HDO A;  2FJL A;  3G9W A;  1BWN A;  4K2P A;  1MK9 B;  1UNQ A;  4GPT B;  2R09 A;  2MFQ A;  5C6R A;  4DXA B;  3GYO A;  2YS1 A;  2HTH B;  5FI1 A;  1Y5O A;  1IRS A;  4A6K A;  1XR0 B;  4HAT B;  1J0W A;  2BCJ A;  2D9V A;  4NY0 A;  4HAY B;  1P6S A;  1BTN A;  1Q67 A;  1ZSQ A;  2RLO A;  2DYQ A;  1KZG A;  2DKP A;  2UZS A;  1NU2 A;  1MKE A;  1PFJ A;  1M7R A;  2D4Q A;  4MY6 A;  2QKM A;  5L81 A;  5KCV A;  3HK0 A;  3A8Q A;  4GN1 A;  3U8Z A;  2G35 A;  2LOX A;  2P0D A;  3N7C A;  2EMS A;  1X05 A;  2H7E A;  2DFK A;  4GZU A;  3ODO A;  4HAW B;  2J0M A;  5DI9 B;  3QIJ A;  1DDW A;  1UPQ A;  2X18 A;  2DKQ A;  2GJY A;  1FOE A;  2AL6 A;  2PZ1 A;  5JHG A;  4CHJ A;  5LON B;  2IFS A;  3TO1 A;  3KRW A;  2M14 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...