4HB4B

Crystal structure of crm1 inhibitor leptomycin b in complex with crm1(537dltvk541/glceq)-ran-ranbp1
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
121
structure length
121
Chain Sequence
b'EEDEEVLYKVRAKLFRFDKDAKEWKERGTGDCKFLKNKKTNKVRILMRRDKTLKICANHIIAPEYTLKPNVGSDRSWVYACTADIAEGEAEAFTFAIRFGSKENADKFKEEFEKAQEINKK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GTP-binding nuclear protein Ran
molecule tags Protein transport/antibiotic
source organism Homo sapiens
publication title Nuclear export inhibition through covalent conjugation and hydrolysis of Leptomycin B by CRM1.
pubmed doi rcsb
total genus 33
structure length 121
sequence length 121
ec nomenclature
pdb deposition date 2012-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00638 Ran_BP1 RanBP1 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 4hb4B00
4TYZA 1I2HA 2LYDA 2EJ8A 4IFSA 3V5WA 1XR0B 5JP4A 2D9XA 1V61A 5D3YA 1FGZA 3ULCA 3O96A 4F7UP 4HAYB 2N0YA 1U2BA 4Y94A 3IVFA 2YRYA 3SYXA 2DHKA 3SO6A 4TKNA 4ZRIA 4C0AA 2CODA 2DFKA 2DHJA 1WI1A 2K00A 3RCPA 5D27A 1E5WA 3WA0A 1DYNA 3FM8C 4ZRJA 3TW1A 1DDWA 1PFJA 2Y8GA 2YF0A 4B6HA 1FHXA 2OTXA 1XD4A 2QKMA 5CLQB 1FGYA 1MK7B 4EKUA 4HATB 2J0KA 1ZC4B 1UNQA 2MKRA 4MK0A 1PLSA 3ODXA 4HAXB 2GJYA 1ZC3B 2YS5A 3SNHA 3HQCA 1EAZA 3D8FA 2N23A 2W2XD 3KRWA 4GN1A 2D2QA 2PZ1A 3HK0A 1NTVA 1TXDA 3TCAA 2YT0A 3F0WA 2LOZA 2Y7BA 2DN6A 1WGUA 2DTCA 1ZM0A 4HB3B 3AU4A 1OY2A 4HHVA 3AJ4A 4EJNA 2P0DA 1KZGA 2K2UA 1XX0A 2UVMA 4F7GA 5DIFB 1KI1B 3ZDTA 4HB2B 2J0MA 1DDVA 1U29A 4HB0B 4HAUB 3SV1A 2RUKB 2GCJA 4L6EA 2FJLA 1V88A 2D9YA 1RJ2A 2AEHA 2W2XC 1V89A 3QWMA 3VIAA 3M1IB 2EC1A 4WSFA 1V5UA 2KUPA 1U5FA 1SGHA 4P7IA 1W1DA 2BCJA 1WGQA 1GC7A 2DA0A 4KHOA 3KZ1A 1GC6A 3LJUX 3MPXA 1MIXA 4DX90 2COCA 2CRFA 4A6KA 4PNKA 1MAIA 2NMBA 5D3VA 3ZVRA 2L1CA 2IFSA 1EGXA 3KSYA 1W1GA 1ISNA 5C5BB 1BTNA 1SHCA 1KZ7A 2CY5A 5J3YA 5L81A 2DHIA 3A8PA 4IAPA 5LOPB 5JHGA 4WVFB 2Z0OA 4GMVA 2CAYA 1AWEA 2CY4A 3PVWA 2H7DA 2D9VA 3DXCA 4NY0A 1K5GB 2KCJA 3ML4A 1NTYA 1FOEA 1U5EA 4A6FA 3VOQA 3D8DA 2GS0A 4HAZB 2Z0PA 5D3WA 4GPTB 5KQ4A 2G35A 1RRPB 2RNRB 5LONB 1I7AA 3PG7A 2YSZA 2H7EA 2LKOA 4CHMA 2ELAA 1AQCA 2UZSA 4XWXA 4HDOA 2AL6A 3BINA 3KY9A 3PP2A 1W1HA 4K2PA 1MIZB 3WYFB 2YVCA 2YT1A 2I1KA 2P0FA 2VRWB 1UPQA 1QQGA 4YONA 1X1FA 2I5CA 2YS3A 4YL8A 2RVBB 2QKLA 2M14A 3CIKA 3NSUA 3U8ZA 2K2JA 1EVHA 4DX8A 3HW2B 3P7ZA 3ULBA 2E2XA 3P6AA 3BJIA 1MPHA 3TFMA 5DH9B 2OQBA 2MDXA 4K2OA 3ODWA 1X05A 3DXEA 2R0DA 5C6RA 4NSWA 1EF1A 2IYBA 2MWNB 5JHHA 5KCVA 2RLOA 1Y5OA 3X23A 2LG1A 2D10A 4EMOA 1FAOA 1FHWA 1MK9B 2VKIA 1IRSA 2D9ZA 2X18A 5C79A 2EMTA 1H10A 3PEGA 2DX5A 2ROZB 5DI9B 1ZSQA 3ODOA 4HAWB 2COAA 3PZDA 3QBVB 5KQ1A 2Q13A 1FB8A 1LW3A 4F7HA 1BAKA 4K17A 2D4QA 2W2WA 1P3RA 1WG7A 2NZ8B 2XQNM 4KAXB 3SUZA 2J0JA 4K81A 2DX1A 3OANA 2RGNB 3GYPA 1WJMA 1PMSA 3PVUA 1TJ6A 1DROA 1X86A 5GOWB 1B55A 4HAVB 2DKPA 1Q67A 3F5RA 4IOYX 1BTKA 2R09A 1GG3A 4A5KA 2I1JA 5J3QA 4DBBA 3KRXA 3G9WA 3A8QA 4ZRKA 3U7DA 4MT7A 3GYOA 2L2IA 1P5TA 1TQZA 2DKQA 1ZVRA 4PQ0A 5J3TA 1XODA 4HDQA 1UNPA 4KHAA 2ELBA 3QIJA 1NI2A 1V5PA 5DHFB 1Y19B 1UEFA 4Z2MB 4KHBB 5C5BA 1N3HA 3N7CA 1M7RA 1V5MA 1UPRA 2DLWA 2MFQA 1OMWA 3T06A 2DYQA 5HE1A 2ROVA 1XCGA 2P8VA 3UZTA 1FHOA 2V76A 4D0NB 5D3XA 4CYEA 3PSCA 2RSGA 4BBKA 2D9WA 2M38A 1WJ1A 1DBHA 1U27A 5C16A 1QC6A 4A6FB 4GZUA 1UNRA 4Z2NA 2ZPYA 2LOXA 2ADZA 1M7EA 5EFXA 1J0WA 2Y8FA 3DXDA 5CLLB 3TO1A 1U5DA 2YS1A 2GCLA 2Z0QA 1DDMA 5FI1A 5FI0A 5HE2A 1MKEA 2LULA 2EMSA 1OQNA 1Z87A 2UZRA 3MDBC 4GMXB 1H4RA 2J59M 3FSSA 4HB4B 5DHAB 1J19A 2KGXB 1XKEA 2I5FA 3A98B 2HE7A 4A6HA 4H8SA 5JLJB 1P6SA 2VSZA 2P0HA 1U5GA 5HE0A 1BWNA 4CHJA 4DXAB 1X11A 5HE3A 4KVGB 1K5DB 3PVLA 2COFA 1WVHA 1X1GA 2HTHB 2D11A 2DYNA 2JP2A 3CXBB 4MY6A 3AU5A 4GXBA 3FEHA 1LB1A 3TVVA 1NU2A 4WJ7A 3D8EA
chains in the Genus database with same CATH superfamily
4TYZA 1I2HA 2LYDA 2EJ8A 4IFSA 3V5WA 1XR0B 5JP4A 2D9XA 1V61A 5D3YA 1FGZA 2YT2A 3ULCA 3O96A 4DIXA 4F7UP 4HAYB 2N0YA 4QXAB 1U2BA 4Y94A 3IVFA 2YRYA 3SYXA 5M4YB 2DHKA 3SO6A 4TKNA 4ZRIA 4C0AA 2CODA 2DFKA 2DHJA 4KHBA 1WI1A 2K00A 3RCPA 5D27A 1E5WA 4GNKB 3WA0A 1DYNA 3FM8C 4ZRJA 3TW1A 1DDWA 1PFJA 2Y8GA 3A58A 2YF0A 2GUMA 4B6HA 1FHXA 2OTXA 1XD4A 2QKMA 5CLQB 1FGYA 1MK7B 3NW8A 4EKUA 4HATB 2J0KA 1ZC4B 1UNQA 2MKRA 1ZYIA 4MK0A 1PLSA 3ODXA 4HAXB 2GJYA 1ZC3B 2YS5A 3SNHA 3HQCA 1EAZA 3D8FA 2N23A 4QJ3B 2W2XD 3KRWA 3HIEA 4GN1A 2D2QA 2PZ1A 3HK0A 1NTVA 1TXDA 5IRSA 3TCAA 2YT0A 3F0WA 2LOZA 2Y7BA 2DN6A 1WGUA 2DTCA 1ZM0A 4HB3B 3AU4A 1OY2A 4GOUA 4HHVA 3AJ4A 4EJNA 2P0DA 1KZGA 2K2UA 1XX0A 2UVMA 4F7GA 5DIFB 1KI1B 3ZDTA 4HB2B 2J0MA 2FJUB 1DDVA 1MI1A 1U29A 4HB0B 4HAUB 3SV1A 2RUKB 2GCJA 4L6EA 2FJLA 1V88A 2D9YA 1RJ2A 2AEHA 2W2XC 1V89A 3QWMA 3VIAA 3M1IB 2EC1A 5I2MA 4WSFA 1V5UA 2KUPA 1U5FA 1SGHA 4P7IA 1T77A 2Z13A 3NWFA 1W1DA 4OSNA 2BCJA 1WGQA 1GC7A 2DA0A 4KHOA 3KZ1A 1GC6A 3LJUX 3MPXA 1MIXA 4DX90 2COCA 2CRFA 4A6KA 4PNKA 1MAIA 2NMBA 5D3VA 3ZVRA 2L1CA 2IFSA 1EGXA 3KSYA 1W1GA 1ISNA 5C5BB 1BTNA 1SHCA 1KZ7A 2CY5A 5J3YA 5L81A 2DHIA 3A8PA 4IAPA 5LOPB 5JHGA 4WVFB 2Z0OA 4GMVA 2CAYA 1AWEA 2CY4A 3PVWA 2H7DA 2D9VA 3DXCA 4NY0A 1K5GB 2KCJA 3ML4A 1NTYA 3HSAA 1FOEA 1U5EA 4A6FA 3VOQA 3D8DA 2GS0A 4HAZB 2Z0PA 5D3WA 4GPTB 5KQ4A 2G35A 1RRPB 2RNRB 2R2YA 4OT1A 5LONB 1I7AA 3PG7A 2YSZA 3U12A 2H7EA 2LKOA 4CHMA 2ELAA 1AQCA 2UZSA 4XWXA 4HDOA 2AL6A 3BINA 3KY9A 3PP2A 1W1HA 4K2PA 1MIZB 3WYFB 2YVCA 2YT1A 2I1KA 5LG4B 2P0FA 2VRWB 1UPQA 1QQGA 4YONA 1X1FA 2I5CA 2YS3A 4YL8A 2RVBB 2QKLA 2M14A 3CIKA 2KR0A 2K49A 3NSUA 3U8ZA 2K2JA 1EVHA 4DX8A 2Z4DA 2KUQA 3HW2B 3P7ZA 3ULBA 2E2XA 2NBVA 3P6AA 3BJIA 1MPHA 3NWDA 5DH9B 3TFMA 2OQBA 4L1RA 2MDXA 4K2OA 3ODWA 1X05A 3DXEA 2R0DA 5C6RA 4NSWA 1EF1A 2IYBA 2MWNB 5JHHA 5KCVA 2RLOA 1Y5OA 3X23A 2LG1A 2D10A 4EMOA 1FAOA 1FHWA 1MK9B 2VKIA 1IRSA 2D9ZA 2X18A 5C79A 2EMTA 1H10A 2Z59A 3PEGA 2DX5A 2ROZB 5DI9B 1ZSQA 3ODOA 4HAWB 2COAA 3QBVB 3PZDA 5KQ1A 2Q13A 3OHMB 1FB8A 1LW3A 2KIGA 4F7HA 1BAKA 4K17A 2D4QA 2W2WA 2XQNM 1P3RA 1WG7A 2NZ8B 4KAXB 3SUZA 2J0JA 4K81A 4CSQA 2DX1A 3OANA 2RGNB 3GYPA 1WJMA 1PMSA 3PVUA 1TJ6A 1DROA 1X86A 5GOWB 1B55A 4HAVB 2DKPA 1Q67A 3F5RA 4IOYX 1BTKA 4HSIA 2R09A 1GG3A 4A5KA 2I1JA 5J3QA 4DBBA 3KRXA 3G9WA 4D6WA 3A8QA 4ZRKA 3U7DA 4MT7A 3GYOA 2RRFA 2L2IA 1P5TA 1TQZA 2DKQA 1ZVRA 4PQ0A 5J3TA 1XODA 4HDQA 1UNPA 4KHAA 2ELBA 3QIJA 1NI2A 1V5PA 5DHFB 1Y19B 1UEFA 3DCXA 4Z2MB 4KHBB 5C5BA 1N3HA 3N7CA 1M7RA 1V5MA 1UPRA 2DLWA 2MFQA 2Z14A 1OMWA 3T06A 2DYQA 5HE1A 2ROVA 1XCGA 4QJ4B 2P8VA 3UZTA 1FHOA 2V76A 4D0NB 5D3XA 4CYEA 3PSCA 2RSGA 4BBKA 2D9WA 3B77A 2M38A 1WJ1A 1DBHA 1U27A 5C16A 1QC6A 4A6FB 4GZUA 1UNRA 4Z2NA 2ZPYA 2LOXA 2ADZA 1M7EA 2KIEA 1J0WA 5EFXA 2Y8FA 3DXDA 5CLLB 3TO1A 1U5DA 2YS1A 2GCLA 2Z0QA 1DDMA 5FI1A 5FI0A 5HE2A 1MKEA 2LULA 2EMSA 1OQNA 1Z87A 2UZRA 3MDBC 4GMXB 3NWAA 1H4RA 2J59M 3FSSA 3FVCA 4HB4B 5DHAB 5I2SA 1J19A 2KGXB 1XKEA 2I5FA 2K8EA 3A98B 2HE7A 4A6HA 4H8SA 5JLJB 1P6SA 2VSZA 2P0HA 4QJ5B 1U5GA 5HE0A 1BWNA 4CHJA 2ZKMX 4DXAB 1X11A 5HE3A 4KVGB 1K5DB 3PVLA 2COFA 1WVHA 1X1GA 2HTHB 2D11A 2DYNA 2JP2A 3CXBB 4MY6A 3AU5A 4GXBA 3FEHA 1LB1A 3TVVA 1NU2A 4WJ7A 3D8EA
chains in the Genus database with same CATH topology
4TYZA 1I2HA 2LYDA 2EJ8A 4IFSA 3V5WA 1XR0B 5JP4A 2D9XA 1V61A 5D3YA 1FGZA 3ULCA 3O96A 4F7UP 4HAYB 2N0YA 1U2BA 4Y94A 3IVFA 2YRYA 3SYXA 2DHKA 3SO6A 4TKNA 4ZRIA 4C0AA 2CODA 2DFKA 2DHJA 1WI1A 2K00A 3RCPA 5D27A 1E5WA 3WA0A 1DYNA 3FM8C 4ZRJA 3TW1A 1DDWA 1PFJA 2Y8GA 2YF0A 4B6HA 1FHXA 2OTXA 1XD4A 2QKMA 5CLQB 1FGYA 1MK7B 4EKUA 4HATB 2J0KA 1ZC4B 1UNQA 2MKRA 4MK0A 1PLSA 3ODXA 4HAXB 2GJYA 1ZC3B 2YS5A 3SNHA 3HQCA 1EAZA 3D8FA 2N23A 2W2XD 3KRWA 4GN1A 2D2QA 2PZ1A 3HK0A 1NTVA 1TXDA 3TCAA 2YT0A 3F0WA 2LOZA 2Y7BA 2DN6A 1WGUA 2DTCA 1ZM0A 4HB3B 3AU4A 1OY2A 4HHVA 3AJ4A 4EJNA 2P0DA 1KZGA 2K2UA 1XX0A 2UVMA 4F7GA 5DIFB 1KI1B 3ZDTA 4HB2B 2J0MA 1DDVA 1U29A 4HB0B 4HAUB 3SV1A 2RUKB 2GCJA 4L6EA 2FJLA 1V88A 2D9YA 1RJ2A 2AEHA 2W2XC 1V89A 3QWMA 3VIAA 3M1IB 2EC1A 4WSFA 1V5UA 2KUPA 1U5FA 1SGHA 4P7IA 1W1DA 2BCJA 1WGQA 1GC7A 2DA0A 4KHOA 3KZ1A 1GC6A 3LJUX 3MPXA 1MIXA 4DX90 2COCA 2CRFA 4A6KA 4PNKA 1MAIA 2NMBA 5D3VA 3ZVRA 2L1CA 2IFSA 1EGXA 3KSYA 1W1GA 1ISNA 5C5BB 1BTNA 1SHCA 1KZ7A 2CY5A 5J3YA 5L81A 2DHIA 3A8PA 4IAPA 5LOPB 5JHGA 4WVFB 2Z0OA 4GMVA 2CAYA 1AWEA 2CY4A 3PVWA 2H7DA 2D9VA 3DXCA 4NY0A 1K5GB 2KCJA 3ML4A 1NTYA 1FOEA 1U5EA 4A6FA 3VOQA 3D8DA 2GS0A 4HAZB 2Z0PA 5D3WA 4GPTB 5KQ4A 2G35A 1RRPB 2RNRB 5LONB 1I7AA 3PG7A 2YSZA 2H7EA 2LKOA 4CHMA 2ELAA 1AQCA 2UZSA 4XWXA 4HDOA 2AL6A 3BINA 3KY9A 3PP2A 1W1HA 4K2PA 1MIZB 3WYFB 2YVCA 2YT1A 2I1KA 2P0FA 2VRWB 1UPQA 1QQGA 4YONA 1X1FA 2I5CA 2YS3A 4YL8A 2RVBB 2QKLA 2M14A 3CIKA 3NSUA 3U8ZA 2K2JA 1EVHA 4DX8A 3HW2B 3P7ZA 3ULBA 2E2XA 3P6AA 3BJIA 1MPHA 3TFMA 5DH9B 2OQBA 2MDXA 4K2OA 3ODWA 1X05A 3DXEA 2R0DA 5C6RA 4NSWA 1EF1A 2IYBA 2MWNB 5JHHA 5KCVA 2RLOA 1Y5OA 3X23A 2LG1A 2D10A 4EMOA 1FAOA 1FHWA 1MK9B 2VKIA 1IRSA 2D9ZA 2X18A 5C79A 2EMTA 1H10A 3PEGA 2DX5A 2ROZB 5DI9B 1ZSQA 3ODOA 4HAWB 2COAA 3PZDA 3QBVB 5KQ1A 2Q13A 1FB8A 1LW3A 4F7HA 1BAKA 4K17A 2D4QA 2W2WA 1P3RA 1WG7A 2NZ8B 2XQNM 4KAXB 3SUZA 2J0JA 4K81A 2DX1A 3OANA 2RGNB 3GYPA 1WJMA 1PMSA 3PVUA 1TJ6A 1DROA 1X86A 5GOWB 1B55A 4HAVB 2DKPA 1Q67A 3F5RA 4IOYX 1BTKA 2R09A 1GG3A 4A5KA 2I1JA 5J3QA 4DBBA 3KRXA 3G9WA 3A8QA 4ZRKA 3U7DA 4MT7A 3GYOA 2L2IA 1P5TA 1TQZA 2DKQA 1ZVRA 4PQ0A 5J3TA 1XODA 4HDQA 1UNPA 4KHAA 2ELBA 3QIJA 1NI2A 1V5PA 5DHFB 1Y19B 1UEFA 4Z2MB 4KHBB 5C5BA 1N3HA 3N7CA 1M7RA 1V5MA 1UPRA 2DLWA 2MFQA 1OMWA 3T06A 2DYQA 5HE1A 2ROVA 1XCGA 2P8VA 3UZTA 1FHOA 2V76A 4D0NB 5D3XA 4CYEA 3PSCA 2RSGA 4BBKA 2D9WA 2M38A 1WJ1A 1DBHA 1U27A 5C16A 1QC6A 4A6FB 4GZUA 1UNRA 4Z2NA 2ZPYA 2LOXA 2ADZA 1M7EA 5EFXA 1J0WA 2Y8FA 3DXDA 5CLLB 3TO1A 1U5DA 2YS1A 2GCLA 2Z0QA 1DDMA 5FI1A 5FI0A 5HE2A 1MKEA 2LULA 2EMSA 1OQNA 1Z87A 2UZRA 3MDBC 4GMXB 1H4RA 2J59M 3FSSA 4HB4B 5DHAB 1J19A 2KGXB 1XKEA 2I5FA 3A98B 2HE7A 4A6HA 4H8SA 5JLJB 1P6SA 2VSZA 2P0HA 1U5GA 5HE0A 1BWNA 4CHJA 4DXAB 1X11A 5HE3A 4KVGB 1K5DB 3PVLA 2COFA 1WVHA 1X1GA 2HTHB 2D11A 2DYNA 2JP2A 3CXBB 4MY6A 3AU5A 4GXBA 3FEHA 1LB1A 3TVVA 1NU2A 4WJ7A 3D8EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4TYZ A;  1I2H A;  2LYD A;  2EJ8 A;  4IFS A;  3V5W A;  1XR0 B;  5JP4 A;  2D9X A;  1V61 A;  5D3Y A;  1FGZ A;  3ULC A;  3O96 A;  4F7U P;  4HAY B;  2N0Y A;  1U2B A;  4Y94 A;  3IVF A;  2YRY A;  3SYX A;  2DHK A;  3SO6 A;  4TKN A;  4ZRI A;  4C0A A;  2COD A;  2DFK A;  2DHJ A;  1WI1 A;  2K00 A;  3RCP A;  5D27 A;  1E5W A;  3WA0 A;  1DYN A;  3FM8 C;  4ZRJ A;  3TW1 A;  1DDW A;  1PFJ A;  2Y8G A;  2YF0 A;  4B6H A;  1FHX A;  2OTX A;  1XD4 A;  2QKM A;  5CLQ B;  1FGY A;  1MK7 B;  4EKU A;  4HAT B;  2J0K A;  1ZC4 B;  1UNQ A;  2MKR A;  4MK0 A;  1PLS A;  3ODX A;  4HAX B;  2GJY A;  1ZC3 B;  2YS5 A;  3SNH A;  3HQC A;  1EAZ A;  3D8F A;  2N23 A;  2W2X D;  3KRW A;  4GN1 A;  2D2Q A;  2PZ1 A;  3HK0 A;  1NTV A;  1TXD A;  3TCA A;  2YT0 A;  3F0W A;  2LOZ A;  2Y7B A;  2DN6 A;  1WGU A;  2DTC A;  1ZM0 A;  4HB3 B;  3AU4 A;  1OY2 A;  4HHV A;  3AJ4 A;  4EJN A;  2P0D A;  1KZG A;  2K2U A;  1XX0 A;  2UVM A;  4F7G A;  5DIF B;  1KI1 B;  3ZDT A;  4HB2 B;  2J0M A;  1DDV A;  1U29 A;  4HB0 B;  4HAU B;  3SV1 A;  2RUK B;  2GCJ A;  4L6E A;  2FJL A;  1V88 A;  2D9Y A;  1RJ2 A;  2AEH A;  2W2X C;  1V89 A;  3QWM A;  3VIA A;  3M1I B;  2EC1 A;  4WSF A;  1V5U A;  2KUP A;  1U5F A;  1SGH A;  4P7I A;  1W1D A;  2BCJ A;  1WGQ A;  1GC7 A;  2DA0 A;  4KHO A;  3KZ1 A;  1GC6 A;  3LJU X;  3MPX A;  1MIX A;  4DX9 0;  2COC A;  2CRF A;  4A6K A;  4PNK A;  1MAI A;  2NMB A;  5D3V A;  3ZVR A;  2L1C A;  2IFS A;  1EGX A;  3KSY A;  1W1G A;  1ISN A;  5C5B B;  1BTN A;  1SHC A;  1KZ7 A;  2CY5 A;  5J3Y A;  5L81 A;  2DHI A;  3A8P A;  4IAP A;  5LOP B;  5JHG A;  4WVF B;  2Z0O A;  4GMV A;  2CAY A;  1AWE A;  2CY4 A;  3PVW A;  2H7D A;  2D9V A;  3DXC A;  4NY0 A;  1K5G B;  2KCJ A;  3ML4 A;  1NTY A;  1FOE A;  1U5E A;  4A6F A;  3VOQ A;  3D8D A;  2GS0 A;  4HAZ B;  2Z0P A;  5D3W A;  4GPT B;  5KQ4 A;  2G35 A;  1RRP B;  2RNR B;  5LON B;  1I7A A;  3PG7 A;  2YSZ A;  2H7E A;  2LKO A;  4CHM A;  2ELA A;  1AQC A;  2UZS A;  4XWX A;  4HDO A;  2AL6 A;  3BIN A;  3KY9 A;  3PP2 A;  1W1H A;  4K2P A;  1MIZ B;  3WYF B;  2YVC A;  2YT1 A;  2I1K A;  2P0F A;  2VRW B;  1UPQ A;  1QQG A;  4YON A;  1X1F A;  2I5C A;  2YS3 A;  4YL8 A;  2RVB B;  2QKL A;  2M14 A;  3CIK A;  3NSU A;  3U8Z A;  2K2J A;  1EVH A;  4DX8 A;  3HW2 B;  3P7Z A;  3ULB A;  2E2X A;  3P6A A;  3BJI A;  1MPH A;  3TFM A;  5DH9 B;  2OQB A;  2MDX A;  4K2O A;  3ODW A;  1X05 A;  3DXE A;  2R0D A;  5C6R A;  4NSW A;  1EF1 A;  2IYB A;  2MWN B;  5JHH A;  5KCV A;  2RLO A;  1Y5O A;  3X23 A;  2LG1 A;  2D10 A;  4EMO A;  1FAO A;  1FHW A;  1MK9 B;  2VKI A;  1IRS A;  2D9Z A;  2X18 A;  5C79 A;  2EMT A;  1H10 A;  3PEG A;  2DX5 A;  2ROZ B;  5DI9 B;  1ZSQ A;  3ODO A;  4HAW B;  2COA A;  3PZD A;  3QBV B;  5KQ1 A;  2Q13 A;  1FB8 A;  1LW3 A;  4F7H A;  1BAK A;  4K17 A;  2D4Q A;  2W2W A;  1P3R A;  1WG7 A;  2NZ8 B;  2XQN M;  4KAX B;  3SUZ A;  2J0J A;  4K81 A;  2DX1 A;  3OAN A;  2RGN B;  3GYP A;  1WJM A;  1PMS A;  3PVU A;  1TJ6 A;  1DRO A;  1X86 A;  5GOW B;  1B55 A;  4HAV B;  2DKP A;  1Q67 A;  3F5R A;  4IOY X;  1BTK A;  2R09 A;  1GG3 A;  4A5K A;  2I1J A;  5J3Q A;  4DBB A;  3KRX A;  3G9W A;  3A8Q A;  4ZRK A;  3U7D A;  4MT7 A;  3GYO A;  2L2I A;  1P5T A;  1TQZ A;  2DKQ A;  1ZVR A;  4PQ0 A;  5J3T A;  1XOD A;  4HDQ A;  1UNP A;  4KHA A;  2ELB A;  3QIJ A;  1NI2 A;  1V5P A;  5DHF B;  1Y19 B;  1UEF A;  4Z2M B;  4KHB B;  5C5B A;  1N3H A;  3N7C A;  1M7R A;  1V5M A;  1UPR A;  2DLW A;  2MFQ A;  1OMW A;  3T06 A;  2DYQ A;  5HE1 A;  2ROV A;  1XCG A;  2P8V A;  3UZT A;  1FHO A;  2V76 A;  4D0N B;  5D3X A;  4CYE A;  3PSC A;  2RSG A;  4BBK A;  2D9W A;  2M38 A;  1WJ1 A;  1DBH A;  1U27 A;  5C16 A;  1QC6 A;  4A6F B;  4GZU A;  1UNR A;  4Z2N A;  2ZPY A;  2LOX A;  2ADZ A;  1M7E A;  5EFX A;  1J0W A;  2Y8F A;  3DXD A;  5CLL B;  3TO1 A;  1U5D A;  2YS1 A;  2GCL A;  2Z0Q A;  1DDM A;  5FI1 A;  5FI0 A;  5HE2 A;  1MKE A;  2LUL A;  2EMS A;  1OQN A;  1Z87 A;  2UZR A;  3MDB C;  4GMX B;  1H4R A;  2J59 M;  3FSS A;  4HB4 B;  5DHA B;  1J19 A;  2KGX B;  1XKE A;  2I5F A;  3A98 B;  2HE7 A;  4A6H A;  4H8S A;  5JLJ B;  1P6S A;  2VSZ A;  2P0H A;  1U5G A;  5HE0 A;  1BWN A;  4CHJ A;  4DXA B;  1X11 A;  5HE3 A;  4KVG B;  1K5D B;  3PVL A;  2COF A;  1WVH A;  1X1G A;  2HTH B;  2D11 A;  2DYN A;  2JP2 A;  3CXB B;  4MY6 A;  3AU5 A;  4GXB A;  3FEH A;  1LB1 A;  3TVV A;  1NU2 A;  4WJ7 A;  3D8E A; 
#chains in the Genus database with same CATH topology
 4TYZ A;  1I2H A;  2LYD A;  2EJ8 A;  4IFS A;  3V5W A;  1XR0 B;  5JP4 A;  2D9X A;  1V61 A;  5D3Y A;  1FGZ A;  2YT2 A;  3ULC A;  3O96 A;  4DIX A;  4F7U P;  4HAY B;  2N0Y A;  4QXA B;  1U2B A;  4Y94 A;  3IVF A;  2YRY A;  3SYX A;  5M4Y B;  2DHK A;  3SO6 A;  4TKN A;  4ZRI A;  4C0A A;  2COD A;  2DFK A;  2DHJ A;  4KHB A;  1WI1 A;  2K00 A;  3RCP A;  5D27 A;  1E5W A;  4GNK B;  3WA0 A;  1DYN A;  3FM8 C;  4ZRJ A;  3TW1 A;  1DDW A;  1PFJ A;  2Y8G A;  3A58 A;  2YF0 A;  2GUM A;  4B6H A;  1FHX A;  2OTX A;  1XD4 A;  2QKM A;  5CLQ B;  1FGY A;  1MK7 B;  3NW8 A;  4EKU A;  4HAT B;  2J0K A;  1ZC4 B;  1UNQ A;  2MKR A;  1ZYI A;  4MK0 A;  1PLS A;  3ODX A;  4HAX B;  2GJY A;  1ZC3 B;  2YS5 A;  3SNH A;  3HQC A;  1EAZ A;  3D8F A;  2N23 A;  4QJ3 B;  2W2X D;  3KRW A;  3HIE A;  4GN1 A;  2D2Q A;  2PZ1 A;  3HK0 A;  1NTV A;  1TXD A;  5IRS A;  3TCA A;  2YT0 A;  3F0W A;  2LOZ A;  2Y7B A;  2DN6 A;  1WGU A;  2DTC A;  1ZM0 A;  4HB3 B;  3AU4 A;  1OY2 A;  4GOU A;  4HHV A;  3AJ4 A;  4EJN A;  2P0D A;  1KZG A;  2K2U A;  1XX0 A;  2UVM A;  4F7G A;  5DIF B;  1KI1 B;  3ZDT A;  4HB2 B;  2J0M A;  2FJU B;  1DDV A;  1MI1 A;  1U29 A;  4HB0 B;  4HAU B;  3SV1 A;  2RUK B;  2GCJ A;  4L6E A;  2FJL A;  1V88 A;  2D9Y A;  1RJ2 A;  2AEH A;  2W2X C;  1V89 A;  3QWM A;  3VIA A;  3M1I B;  2EC1 A;  5I2M A;  4WSF A;  1V5U A;  2KUP A;  1U5F A;  1SGH A;  4P7I A;  1T77 A;  2Z13 A;  3NWF A;  1W1D A;  4OSN A;  2BCJ A;  1WGQ A;  1GC7 A;  2DA0 A;  4KHO A;  3KZ1 A;  1GC6 A;  3LJU X;  3MPX A;  1MIX A;  4DX9 0;  2COC A;  2CRF A;  4A6K A;  4PNK A;  1MAI A;  2NMB A;  5D3V A;  3ZVR A;  2L1C A;  2IFS A;  1EGX A;  3KSY A;  1W1G A;  1ISN A;  5C5B B;  1BTN A;  1SHC A;  1KZ7 A;  2CY5 A;  5J3Y A;  5L81 A;  2DHI A;  3A8P A;  4IAP A;  5LOP B;  5JHG A;  4WVF B;  2Z0O A;  4GMV A;  2CAY A;  1AWE A;  2CY4 A;  3PVW A;  2H7D A;  2D9V A;  3DXC A;  4NY0 A;  1K5G B;  2KCJ A;  3ML4 A;  1NTY A;  3HSA A;  1FOE A;  1U5E A;  4A6F A;  3VOQ A;  3D8D A;  2GS0 A;  4HAZ B;  2Z0P A;  5D3W A;  4GPT B;  5KQ4 A;  2G35 A;  1RRP B;  2RNR B;  2R2Y A;  4OT1 A;  5LON B;  1I7A A;  3PG7 A;  2YSZ A;  3U12 A;  2H7E A;  2LKO A;  4CHM A;  2ELA A;  1AQC A;  2UZS A;  4XWX A;  4HDO A;  2AL6 A;  3BIN A;  3KY9 A;  3PP2 A;  1W1H A;  4K2P A;  1MIZ B;  3WYF B;  2YVC A;  2YT1 A;  2I1K A;  5LG4 B;  2P0F A;  2VRW B;  1UPQ A;  1QQG A;  4YON A;  1X1F A;  2I5C A;  2YS3 A;  4YL8 A;  2RVB B;  2QKL A;  2M14 A;  3CIK A;  2KR0 A;  2K49 A;  3NSU A;  3U8Z A;  2K2J A;  1EVH A;  4DX8 A;  2Z4D A;  2KUQ A;  3HW2 B;  3P7Z A;  3ULB A;  2E2X A;  2NBV A;  3P6A A;  3BJI A;  1MPH A;  3NWD A;  5DH9 B;  3TFM A;  2OQB A;  4L1R A;  2MDX A;  4K2O A;  3ODW A;  1X05 A;  3DXE A;  2R0D A;  5C6R A;  4NSW A;  1EF1 A;  2IYB A;  2MWN B;  5JHH A;  5KCV A;  2RLO A;  1Y5O A;  3X23 A;  2LG1 A;  2D10 A;  4EMO A;  1FAO A;  1FHW A;  1MK9 B;  2VKI A;  1IRS A;  2D9Z A;  2X18 A;  5C79 A;  2EMT A;  1H10 A;  2Z59 A;  3PEG A;  2DX5 A;  2ROZ B;  5DI9 B;  1ZSQ A;  3ODO A;  4HAW B;  2COA A;  3QBV B;  3PZD A;  5KQ1 A;  2Q13 A;  3OHM B;  1FB8 A;  1LW3 A;  2KIG A;  4F7H A;  1BAK A;  4K17 A;  2D4Q A;  2W2W A;  2XQN M;  1P3R A;  1WG7 A;  2NZ8 B;  4KAX B;  3SUZ A;  2J0J A;  4K81 A;  4CSQ A;  2DX1 A;  3OAN A;  2RGN B;  3GYP A;  1WJM A;  1PMS A;  3PVU A;  1TJ6 A;  1DRO A;  1X86 A;  5GOW B;  1B55 A;  4HAV B;  2DKP A;  1Q67 A;  3F5R A;  4IOY X;  1BTK A;  4HSI A;  2R09 A;  1GG3 A;  4A5K A;  2I1J A;  5J3Q A;  4DBB A;  3KRX A;  3G9W A;  4D6W A;  3A8Q A;  4ZRK A;  3U7D A;  4MT7 A;  3GYO A;  2RRF A;  2L2I A;  1P5T A;  1TQZ A;  2DKQ A;  1ZVR A;  4PQ0 A;  5J3T A;  1XOD A;  4HDQ A;  1UNP A;  4KHA A;  2ELB A;  3QIJ A;  1NI2 A;  1V5P A;  5DHF B;  1Y19 B;  1UEF A;  3DCX A;  4Z2M B;  4KHB B;  5C5B A;  1N3H A;  3N7C A;  1M7R A;  1V5M A;  1UPR A;  2DLW A;  2MFQ A;  2Z14 A;  1OMW A;  3T06 A;  2DYQ A;  5HE1 A;  2ROV A;  1XCG A;  4QJ4 B;  2P8V A;  3UZT A;  1FHO A;  2V76 A;  4D0N B;  5D3X A;  4CYE A;  3PSC A;  2RSG A;  4BBK A;  2D9W A;  3B77 A;  2M38 A;  1WJ1 A;  1DBH A;  1U27 A;  5C16 A;  1QC6 A;  4A6F B;  4GZU A;  1UNR A;  4Z2N A;  2ZPY A;  2LOX A;  2ADZ A;  1M7E A;  2KIE A;  1J0W A;  5EFX A;  2Y8F A;  3DXD A;  5CLL B;  3TO1 A;  1U5D A;  2YS1 A;  2GCL A;  2Z0Q A;  1DDM A;  5FI1 A;  5FI0 A;  5HE2 A;  1MKE A;  2LUL A;  2EMS A;  1OQN A;  1Z87 A;  2UZR A;  3MDB C;  4GMX B;  3NWA A;  1H4R A;  2J59 M;  3FSS A;  3FVC A;  4HB4 B;  5DHA B;  5I2S A;  1J19 A;  2KGX B;  1XKE A;  2I5F A;  2K8E A;  3A98 B;  2HE7 A;  4A6H A;  4H8S A;  5JLJ B;  1P6S A;  2VSZ A;  2P0H A;  4QJ5 B;  1U5G A;  5HE0 A;  1BWN A;  4CHJ A;  2ZKM X;  4DXA B;  1X11 A;  5HE3 A;  4KVG B;  1K5D B;  3PVL A;  2COF A;  1WVH A;  1X1G A;  2HTH B;  2D11 A;  2DYN A;  2JP2 A;  3CXB B;  4MY6 A;  3AU5 A;  4GXB A;  3FEH A;  1LB1 A;  3TVV A;  1NU2 A;  4WJ7 A;  3D8E A; 
#chains in the Genus database with same CATH homology
 4TYZ A;  1I2H A;  2LYD A;  2EJ8 A;  4IFS A;  3V5W A;  1XR0 B;  5JP4 A;  2D9X A;  1V61 A;  5D3Y A;  1FGZ A;  3ULC A;  3O96 A;  4F7U P;  4HAY B;  2N0Y A;  1U2B A;  4Y94 A;  3IVF A;  2YRY A;  3SYX A;  2DHK A;  3SO6 A;  4TKN A;  4ZRI A;  4C0A A;  2COD A;  2DFK A;  2DHJ A;  1WI1 A;  2K00 A;  3RCP A;  5D27 A;  1E5W A;  3WA0 A;  1DYN A;  3FM8 C;  4ZRJ A;  3TW1 A;  1DDW A;  1PFJ A;  2Y8G A;  2YF0 A;  4B6H A;  1FHX A;  2OTX A;  1XD4 A;  2QKM A;  5CLQ B;  1FGY A;  1MK7 B;  4EKU A;  4HAT B;  2J0K A;  1ZC4 B;  1UNQ A;  2MKR A;  4MK0 A;  1PLS A;  3ODX A;  4HAX B;  2GJY A;  1ZC3 B;  2YS5 A;  3SNH A;  3HQC A;  1EAZ A;  3D8F A;  2N23 A;  2W2X D;  3KRW A;  4GN1 A;  2D2Q A;  2PZ1 A;  3HK0 A;  1NTV A;  1TXD A;  3TCA A;  2YT0 A;  3F0W A;  2LOZ A;  2Y7B A;  2DN6 A;  1WGU A;  2DTC A;  1ZM0 A;  4HB3 B;  3AU4 A;  1OY2 A;  4HHV A;  3AJ4 A;  4EJN A;  2P0D A;  1KZG A;  2K2U A;  1XX0 A;  2UVM A;  4F7G A;  5DIF B;  1KI1 B;  3ZDT A;  4HB2 B;  2J0M A;  1DDV A;  1U29 A;  4HB0 B;  4HAU B;  3SV1 A;  2RUK B;  2GCJ A;  4L6E A;  2FJL A;  1V88 A;  2D9Y A;  1RJ2 A;  2AEH A;  2W2X C;  1V89 A;  3QWM A;  3VIA A;  3M1I B;  2EC1 A;  4WSF A;  1V5U A;  2KUP A;  1U5F A;  1SGH A;  4P7I A;  1W1D A;  2BCJ A;  1WGQ A;  1GC7 A;  2DA0 A;  4KHO A;  3KZ1 A;  1GC6 A;  3LJU X;  3MPX A;  1MIX A;  4DX9 0;  2COC A;  2CRF A;  4A6K A;  4PNK A;  1MAI A;  2NMB A;  5D3V A;  3ZVR A;  2L1C A;  2IFS A;  1EGX A;  3KSY A;  1W1G A;  1ISN A;  5C5B B;  1BTN A;  1SHC A;  1KZ7 A;  2CY5 A;  5J3Y A;  5L81 A;  2DHI A;  3A8P A;  4IAP A;  5LOP B;  5JHG A;  4WVF B;  2Z0O A;  4GMV A;  2CAY A;  1AWE A;  2CY4 A;  3PVW A;  2H7D A;  2D9V A;  3DXC A;  4NY0 A;  1K5G B;  2KCJ A;  3ML4 A;  1NTY A;  1FOE A;  1U5E A;  4A6F A;  3VOQ A;  3D8D A;  2GS0 A;  4HAZ B;  2Z0P A;  5D3W A;  4GPT B;  5KQ4 A;  2G35 A;  1RRP B;  2RNR B;  5LON B;  1I7A A;  3PG7 A;  2YSZ A;  2H7E A;  2LKO A;  4CHM A;  2ELA A;  1AQC A;  2UZS A;  4XWX A;  4HDO A;  2AL6 A;  3BIN A;  3KY9 A;  3PP2 A;  1W1H A;  4K2P A;  1MIZ B;  3WYF B;  2YVC A;  2YT1 A;  2I1K A;  2P0F A;  2VRW B;  1UPQ A;  1QQG A;  4YON A;  1X1F A;  2I5C A;  2YS3 A;  4YL8 A;  2RVB B;  2QKL A;  2M14 A;  3CIK A;  3NSU A;  3U8Z A;  2K2J A;  1EVH A;  4DX8 A;  3HW2 B;  3P7Z A;  3ULB A;  2E2X A;  3P6A A;  3BJI A;  1MPH A;  3TFM A;  5DH9 B;  2OQB A;  2MDX A;  4K2O A;  3ODW A;  1X05 A;  3DXE A;  2R0D A;  5C6R A;  4NSW A;  1EF1 A;  2IYB A;  2MWN B;  5JHH A;  5KCV A;  2RLO A;  1Y5O A;  3X23 A;  2LG1 A;  2D10 A;  4EMO A;  1FAO A;  1FHW A;  1MK9 B;  2VKI A;  1IRS A;  2D9Z A;  2X18 A;  5C79 A;  2EMT A;  1H10 A;  3PEG A;  2DX5 A;  2ROZ B;  5DI9 B;  1ZSQ A;  3ODO A;  4HAW B;  2COA A;  3PZD A;  3QBV B;  5KQ1 A;  2Q13 A;  1FB8 A;  1LW3 A;  4F7H A;  1BAK A;  4K17 A;  2D4Q A;  2W2W A;  1P3R A;  1WG7 A;  2NZ8 B;  2XQN M;  4KAX B;  3SUZ A;  2J0J A;  4K81 A;  2DX1 A;  3OAN A;  2RGN B;  3GYP A;  1WJM A;  1PMS A;  3PVU A;  1TJ6 A;  1DRO A;  1X86 A;  5GOW B;  1B55 A;  4HAV B;  2DKP A;  1Q67 A;  3F5R A;  4IOY X;  1BTK A;  2R09 A;  1GG3 A;  4A5K A;  2I1J A;  5J3Q A;  4DBB A;  3KRX A;  3G9W A;  3A8Q A;  4ZRK A;  3U7D A;  4MT7 A;  3GYO A;  2L2I A;  1P5T A;  1TQZ A;  2DKQ A;  1ZVR A;  4PQ0 A;  5J3T A;  1XOD A;  4HDQ A;  1UNP A;  4KHA A;  2ELB A;  3QIJ A;  1NI2 A;  1V5P A;  5DHF B;  1Y19 B;  1UEF A;  4Z2M B;  4KHB B;  5C5B A;  1N3H A;  3N7C A;  1M7R A;  1V5M A;  1UPR A;  2DLW A;  2MFQ A;  1OMW A;  3T06 A;  2DYQ A;  5HE1 A;  2ROV A;  1XCG A;  2P8V A;  3UZT A;  1FHO A;  2V76 A;  4D0N B;  5D3X A;  4CYE A;  3PSC A;  2RSG A;  4BBK A;  2D9W A;  2M38 A;  1WJ1 A;  1DBH A;  1U27 A;  5C16 A;  1QC6 A;  4A6F B;  4GZU A;  1UNR A;  4Z2N A;  2ZPY A;  2LOX A;  2ADZ A;  1M7E A;  5EFX A;  1J0W A;  2Y8F A;  3DXD A;  5CLL B;  3TO1 A;  1U5D A;  2YS1 A;  2GCL A;  2Z0Q A;  1DDM A;  5FI1 A;  5FI0 A;  5HE2 A;  1MKE A;  2LUL A;  2EMS A;  1OQN A;  1Z87 A;  2UZR A;  3MDB C;  4GMX B;  1H4R A;  2J59 M;  3FSS A;  4HB4 B;  5DHA B;  1J19 A;  2KGX B;  1XKE A;  2I5F A;  3A98 B;  2HE7 A;  4A6H A;  4H8S A;  5JLJ B;  1P6S A;  2VSZ A;  2P0H A;  1U5G A;  5HE0 A;  1BWN A;  4CHJ A;  4DXA B;  1X11 A;  5HE3 A;  4KVG B;  1K5D B;  3PVL A;  2COF A;  1WVH A;  1X1G A;  2HTH B;  2D11 A;  2DYN A;  2JP2 A;  3CXB B;  4MY6 A;  3AU5 A;  4GXB A;  3FEH A;  1LB1 A;  3TVV A;  1NU2 A;  4WJ7 A;  3D8E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...