4HB4B

Crystal structure of crm1 inhibitor leptomycin b in complex with crm1(537dltvk541/glceq)-ran-ranbp1
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
121
structure length
121
Chain Sequence
EEDEEVLYKVRAKLFRFDKDAKEWKERGTGDCKFLKNKKTNKVRILMRRDKTLKICANHIIAPEYTLKPNVGSDRSWVYACTADIAEGEAEAFTFAIRFGSKENADKFKEEFEKAQEINKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Nuclear export inhibition through covalent conjugation and hydrolysis of Leptomycin B by CRM1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport/antibiotic
molecule keywords GTP-binding nuclear protein Ran
total genus 33
structure length 121
sequence length 121
ec nomenclature
pdb deposition date 2012-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00638 Ran_BP1 RanBP1 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 4hb4B00
2X18A 1U29A 1DDWA 1LW3A 2MWNB 4EKUA 1FB8A 2K2UA 2V76A 4A6FB 3F0WA 4GMXB 2DHKA 5DI9B 2YS5A 5J3QA 2R09A 2ROZB 5J3TA 1EAZA 3P6AA 2EMSA 1ZVRA 5CLQB 4KHOA 2EC1A 2RNRB 1U5FA 3ZVRA 4WJ7A 2MDXA 5FI1A 1MIZB 2Z0QA 1K5DB 4HAWB 1DYNA 3O96A 1V89A 2K00A 4HDQA 1UPRA 4MK0A 1OQNA 1U5EA 1UNQA 1GC7A 2DYQA 1BWNA 1X1FA 2Z0OA 1WGUA 2DKQA 2ADZA 3TO1A 1P5TA 3PEGA 2M38A 4BBKA 2P0DA 4GMVA 3DXDA 3UZTA 1DDMA 3QBVB 2LOXA 1V61A 5JP4A 2YVCA 2ELBA 1U27A 1UPQA 1X05A 5DHAB 4GN1A 3GYPA 1MK9B 3CXBB 1EVHA 1DROA 3ODXA 4HB4B 1UEFA 1XODA 1KZ7A 5DHFB 3ML4A 2DKPA 1V88A 1FGYA 1V5MA 4K2OA 3NSUA 4HDOA 3KY9A 1GG3A 4KHBB 5D3WA 2RSGA 2OTXA 2YT0A 1ZM0A 4HAZB 4EJNA 3TFMA 2BCJA 1ISNA 1UNPA 1MPHA 2UVMA 5EFXA 2JP2A 3PP2A 4CHJA 3IVFA 2Q13A 2KUPA 5KCVA 2J59M 3TCAA 2W2XD 4C0AA 1TJ6A 2UZSA 1W1DA 2Y8FA 1IRSA 1FHWA 1SGHA 3ULBA 2D9ZA 1OMWA 4GPTB 1NTYA 3QIJA 5CLLB 2YT1A 1FHXA 1K5GB 2LULA 3KRWA 3AU4A 2I1JA 5DIFB 4DXAB 1PLSA 4IAPA 3PVWA 1NU2A 2Y7BA 1QQGA 4KAXB 1MK7B 1WI1A 3DXEA 2COCA 2CAYA 1P3RA 2G35A 2CY5A 4WSFA 4YONA 3D8FA 1MKEA 4NY0A 4DX90 2D9WA 2YSZA 5LONB 1X1GA 1Y5OA 4Z2NA 3U8ZA 3N7CA 3P7ZA 2DHJA 1XR0B 1N3HA 2DX5A 2DX1A 3ODOA 4HATB 2E2XA 1H4RA 3A8PA 5KQ4A 3WA0A 1W1GA 2DLWA 5D3YA 2ROVA 1WJMA 1MIXA 2GS0A 1WGQA 4A5KA 4B6HA 1H10A 2EJ8A 2D4QA 3FEHA 2M14A 1J0WA 1TXDA 2J0JA 4TKNA 2DYNA 1FHOA 4WVFB 2Y8GA 4A6FA 1EF1A 1NTVA 2W2XC 4HAYB 4NSWA 2AL6A 5C5BA 4CYEA 2D9XA 3WYFB 2DTCA 3PZDA 3BINA 3HQCA 2XQNM 2GCLA 1U2BA 5HE1A 1B55A 2QKLA 3M1IB 4F7HA 1RJ2A 2RGNB 4HHVA 5C16A 5D3XA 5KQ1A 3A8QA 2YRYA 1Y19B 4TYZA 4IOYX 1WG7A 2DFKA 4HB0B 3KSYA 2P0FA 2P8VA 3OANA 4K17A 4Y94A 2KGXB 4Z2MB 1PFJA 3PSCA 4HB2B 5HE3A 2LOZA 4IFSA 2HE7A 5DH9B 3PVLA 1GC6A 2RVBB 2YF0A 1BTKA 4MY6A 1OY2A 2R0DA 4D0NB 3MDBC 3VIAA 3DXCA 4GZUA 4A6KA 1BTNA 3SYXA 4F7UP 2P0HA 2DN6A 3SNHA 2K2JA 2VKIA 1ZSQA 3TVVA 3TW1A 2VRWB 4YL8A 2H7EA 4ZRIA 2ELAA 5GOWB 2QKMA 2FJLA 2CODA 3D8DA 1J19A 2W2WA 2EMTA 4F7GA 2N23A 3AU5A 4GXBA 2J0KA 3SV1A 2YS1A 5J3YA 3ZDTA 2LYDA 2COFA 2RUKB 1KI1B 1ZC3B 2I1KA 2GCJA 5C79A 1X86A 3HW2B 3T06A 3MPXA 3SUZA 5HE2A 3LJUX 3BJIA 2L2IA 1I7AA 2CY4A 4ZRJA 1WJ1A 1U5DA 3G9WA 1XX0A 4KVGB 4DX8A 5C6RA 2IYBA 2COAA 1RRPB 2YS3A 1TQZA 2DA0A 2LKOA 3PVUA 4XWXA 1LB1A 4K81A 2J0MA 1I2HA 1QC6A 3GYOA 1Z87A 4MT7A 1M7RA 3QWMA 1NI2A 5JHHA 1AWEA 3F5RA 1XD4A 1Q67A 4ZRKA 1U5GA 2AEHA 5D3VA 5FI0A 2D10A 2L1CA 2I5FA 1PMSA 4HB3B 1M7EA 3CIKA 2CRFA 2IFSA 3V5WA 3X23A 3SO6A 1DDVA 1V5UA 5HE0A 2D2QA 2D9VA 3KRXA 4EMOA 4HAXB 4K2PA 4HAUB 3AJ4A 2VSZA 3HK0A 4KHAA 2ZPYA 4L6EA 2LG1A 3ULCA 2RLOA 4CHMA 3FSSA 5LOPB 1FOEA 1WVHA 3D8EA 1MAIA 4PNKA 2NMBA 4P7IA 5D27A 2N0YA 4A6HA 4PQ0A 1FAOA 5JLJB 1KZGA 2HTHB 1BAKA 1EGXA 4HAVB 1UNRA 1V5PA 2H7DA 4H8SA 2PZ1A 2D9YA 1AQCA 1DBHA 2Z0PA 2D11A 3U7DA 1XCGA 2MFQA 3KZ1A 2I5CA 3RCPA 1FGZA 1X11A 2GJYA 1E5WA 1ZC4B 5C5BB 5L81A 1W1HA 2OQBA 1SHCA 3A98B 2UZRA 1P6SA 4DBBA 2NZ8B 3VOQA 1XKEA 2MKRA 3FM8C 5JHGA 3PG7A 3ODWA 2DHIA 2KCJA
chains in the Genus database with same CATH superfamily
2X18A 1U29A 3HSAA 1DDWA 1LW3A 2MWNB 5M4YB 4EKUA 1FB8A 2K2UA 2V76A 4A6FB 4GNKB 3F0WA 4GMXB 2DHKA 5DI9B 2YS5A 5J3QA 2R09A 2ROZB 5J3TA 1EAZA 3P6AA 4DIXA 2EMSA 1ZVRA 5CLQB 4KHOA 2EC1A 2RNRB 1U5FA 3ZVRA 4WJ7A 1MI1A 2MDXA 5FI1A 1MIZB 2Z0QA 1K5DB 4HAWB 1DYNA 3O96A 1V89A 2K00A 4HDQA 1UPRA 4MK0A 1OQNA 1U5EA 1UNQA 1GC7A 3OHMB 2DYQA 1BWNA 1X1FA 2Z0OA 1WGUA 2DKQA 2ADZA 3TO1A 3NW8A 1P5TA 2KR0A 3PEGA 2M38A 4BBKA 2P0DA 4GMVA 3DXDA 3UZTA 1DDMA 3QBVB 2LOXA 1V61A 5JP4A 2YVCA 2ELBA 1U27A 1UPQA 1X05A 5DHAB 4GN1A 3GYPA 1MK9B 3CXBB 3FVCA 1EVHA 1DROA 3ODXA 3NWAA 4HB4B 1UEFA 1XODA 1KZ7A 5DHFB 3ML4A 2DKPA 1V88A 1FGYA 1V5MA 4K2OA 1ZYIA 3NSUA 2KIGA 4HDOA 3KY9A 1GG3A 4KHBB 5D3WA 2RSGA 2OTXA 2YT0A 1ZM0A 4HAZB 4EJNA 3TFMA 2BCJA 1ISNA 1UNPA 1MPHA 2UVMA 5EFXA 2JP2A 3PP2A 4CHJA 3IVFA 2Q13A 2KUPA 5KCVA 2YT2A 2J59M 2ZKMX 3TCAA 2W2XD 4C0AA 1TJ6A 2UZSA 1W1DA 2Y8FA 1IRSA 1FHWA 1SGHA 3ULBA 2D9ZA 1OMWA 4GPTB 1NTYA 3QIJA 5CLLB 5LG4B 2YT1A 1FHXA 1K5GB 2LULA 3KRWA 3AU4A 2I1JA 5DIFB 4DXAB 1PLSA 4IAPA 3PVWA 1NU2A 2Y7BA 1QQGA 4KAXB 1MK7B 1WI1A 3DXEA 2COCA 2CAYA 1P3RA 2G35A 2CY5A 2KIEA 4WSFA 4CSQA 4YONA 3D8FA 1MKEA 4NY0A 4DX90 2D9WA 2YSZA 5LONB 1X1GA 1Y5OA 4Z2NA 3U8ZA 3N7CA 3P7ZA 2DHJA 1XR0B 1N3HA 4KHBA 2DX5A 2DX1A 3ODOA 4HATB 2E2XA 1H4RA 3A8PA 5KQ4A 3WA0A 2Z4DA 1W1GA 2DLWA 5D3YA 2ROVA 1WJMA 1MIXA 2GS0A 1WGQA 4OT1A 4A5KA 3NWFA 4B6HA 1H10A 2EJ8A 2D4QA 3FEHA 2M14A 4L1RA 1J0WA 2GUMA 5I2SA 1TXDA 4QXAB 2J0JA 4TKNA 2DYNA 3B77A 1FHOA 4WVFB 2Y8GA 4A6FA 1EF1A 1NTVA 2W2XC 4HAYB 4NSWA 2AL6A 5C5BA 4CYEA 2D9XA 3WYFB 2DTCA 3PZDA 3BINA 3HQCA 4GOUA 2XQNM 2GCLA 2FJUB 4QJ3B 1U2BA 5HE1A 1B55A 2QKLA 3M1IB 4F7HA 2RRFA 1RJ2A 2RGNB 4HHVA 5C16A 5D3XA 5KQ1A 4HSIA 3A8QA 2YRYA 1Y19B 4TYZA 4IOYX 1WG7A 2DFKA 4HB0B 3KSYA 2P0FA 2P8VA 3OANA 4K17A 4Y94A 1T77A 2KGXB 4Z2MB 1PFJA 3PSCA 2Z13A 4HB2B 5HE3A 2LOZA 4QJ4B 4IFSA 2HE7A 5DH9B 3PVLA 2K49A 1GC6A 2RVBB 2YF0A 1BTKA 4MY6A 1OY2A 2R0DA 4D0NB 3MDBC 3VIAA 3DXCA 4GZUA 4A6KA 1BTNA 3SYXA 4F7UP 2P0HA 2DN6A 2KUQA 3SNHA 2K2JA 2VKIA 1ZSQA 3TVVA 3TW1A 2VRWB 4YL8A 2H7EA 4ZRIA 2ELAA 5GOWB 4D6WA 2QKMA 2FJLA 2CODA 3D8DA 1J19A 2W2WA 2EMTA 4F7GA 2N23A 3AU5A 4GXBA 2J0KA 3U12A 3SV1A 2YS1A 5J3YA 3ZDTA 2LYDA 2COFA 2RUKB 5IRSA 1KI1B 1ZC3B 2I1KA 3NWDA 2GCJA 5C79A 1X86A 3HW2B 3T06A 3MPXA 3SUZA 5HE2A 3LJUX 3BJIA 2L2IA 1I7AA 2CY4A 4ZRJA 1WJ1A 1U5DA 3G9WA 1XX0A 2Z59A 4KVGB 4DX8A 5C6RA 2IYBA 2COAA 1RRPB 2YS3A 1TQZA 2DA0A 2LKOA 3PVUA 4XWXA 1LB1A 4K81A 2J0MA 1I2HA 1QC6A 3GYOA 1Z87A 4MT7A 1M7RA 3QWMA 1NI2A 5JHHA 2NBVA 1AWEA 3F5RA 1XD4A 1Q67A 4ZRKA 1U5GA 2AEHA 5D3VA 5FI0A 2R2YA 2D10A 2L1CA 2I5FA 1PMSA 4HB3B 1M7EA 3CIKA 2CRFA 3DCXA 2IFSA 3V5WA 3X23A 3SO6A 1DDVA 1V5UA 5HE0A 2D2QA 2D9VA 3KRXA 4EMOA 4HAXB 4K2PA 4HAUB 3AJ4A 2VSZA 3HK0A 3A58A 4KHAA 2ZPYA 4L6EA 2LG1A 3ULCA 2RLOA 4CHMA 3FSSA 5LOPB 1FOEA 1WVHA 3D8EA 1MAIA 4PNKA 2NMBA 4P7IA 5D27A 4OSNA 2N0YA 4A6HA 4PQ0A 1FAOA 5JLJB 1KZGA 2Z14A 2HTHB 1BAKA 1EGXA 4HAVB 4QJ5B 1UNRA 1V5PA 5I2MA 2H7DA 4H8SA 2PZ1A 2D9YA 1AQCA 1DBHA 2Z0PA 2K8EA 2D11A 3U7DA 1XCGA 2MFQA 3KZ1A 2I5CA 3RCPA 1FGZA 1X11A 2GJYA 1E5WA 1ZC4B 5C5BB 5L81A 1W1HA 2OQBA 1SHCA 3A98B 2UZRA 1P6SA 4DBBA 2NZ8B 3VOQA 1XKEA 2MKRA 3FM8C 5JHGA 3PG7A 3HIEA 3ODWA 2DHIA 2KCJA
chains in the Genus database with same CATH topology
2X18A 1U29A 1DDWA 1LW3A 2MWNB 4EKUA 1FB8A 2K2UA 2V76A 4A6FB 3F0WA 4GMXB 2DHKA 5DI9B 2YS5A 5J3QA 2R09A 2ROZB 5J3TA 1EAZA 3P6AA 2EMSA 1ZVRA 5CLQB 4KHOA 2EC1A 2RNRB 1U5FA 3ZVRA 4WJ7A 2MDXA 5FI1A 1MIZB 2Z0QA 1K5DB 4HAWB 1DYNA 3O96A 1V89A 2K00A 4HDQA 1UPRA 4MK0A 1OQNA 1U5EA 1UNQA 1GC7A 2DYQA 1BWNA 1X1FA 2Z0OA 1WGUA 2DKQA 2ADZA 3TO1A 1P5TA 3PEGA 2M38A 4BBKA 2P0DA 4GMVA 3DXDA 3UZTA 1DDMA 3QBVB 2LOXA 1V61A 5JP4A 2YVCA 2ELBA 1U27A 1UPQA 1X05A 5DHAB 4GN1A 3GYPA 1MK9B 3CXBB 1EVHA 1DROA 3ODXA 4HB4B 1UEFA 1XODA 1KZ7A 5DHFB 3ML4A 2DKPA 1V88A 1FGYA 1V5MA 4K2OA 3NSUA 4HDOA 3KY9A 1GG3A 4KHBB 5D3WA 2RSGA 2OTXA 2YT0A 1ZM0A 4HAZB 4EJNA 3TFMA 2BCJA 1ISNA 1UNPA 1MPHA 2UVMA 5EFXA 2JP2A 3PP2A 4CHJA 3IVFA 2Q13A 2KUPA 5KCVA 2J59M 3TCAA 2W2XD 4C0AA 1TJ6A 2UZSA 1W1DA 2Y8FA 1IRSA 1FHWA 1SGHA 3ULBA 2D9ZA 1OMWA 4GPTB 1NTYA 3QIJA 5CLLB 2YT1A 1FHXA 1K5GB 2LULA 3KRWA 3AU4A 2I1JA 5DIFB 4DXAB 1PLSA 4IAPA 3PVWA 1NU2A 2Y7BA 1QQGA 4KAXB 1MK7B 1WI1A 3DXEA 2COCA 2CAYA 1P3RA 2G35A 2CY5A 4WSFA 4YONA 3D8FA 1MKEA 4NY0A 4DX90 2D9WA 2YSZA 5LONB 1X1GA 1Y5OA 4Z2NA 3U8ZA 3N7CA 3P7ZA 2DHJA 1XR0B 1N3HA 2DX5A 2DX1A 3ODOA 4HATB 2E2XA 1H4RA 3A8PA 5KQ4A 3WA0A 1W1GA 2DLWA 5D3YA 2ROVA 1WJMA 1MIXA 2GS0A 1WGQA 4A5KA 4B6HA 1H10A 2EJ8A 2D4QA 3FEHA 2M14A 1J0WA 1TXDA 2J0JA 4TKNA 2DYNA 1FHOA 4WVFB 2Y8GA 4A6FA 1EF1A 1NTVA 2W2XC 4HAYB 4NSWA 2AL6A 5C5BA 4CYEA 2D9XA 3WYFB 2DTCA 3PZDA 3BINA 3HQCA 2XQNM 2GCLA 1U2BA 5HE1A 1B55A 2QKLA 3M1IB 4F7HA 1RJ2A 2RGNB 4HHVA 5C16A 5D3XA 5KQ1A 3A8QA 2YRYA 1Y19B 4TYZA 4IOYX 1WG7A 2DFKA 4HB0B 3KSYA 2P0FA 2P8VA 3OANA 4K17A 4Y94A 2KGXB 4Z2MB 1PFJA 3PSCA 4HB2B 5HE3A 2LOZA 4IFSA 2HE7A 5DH9B 3PVLA 1GC6A 2RVBB 2YF0A 1BTKA 4MY6A 1OY2A 2R0DA 4D0NB 3MDBC 3VIAA 3DXCA 4GZUA 4A6KA 1BTNA 3SYXA 4F7UP 2P0HA 2DN6A 3SNHA 2K2JA 2VKIA 1ZSQA 3TVVA 3TW1A 2VRWB 4YL8A 2H7EA 4ZRIA 2ELAA 5GOWB 2QKMA 2FJLA 2CODA 3D8DA 1J19A 2W2WA 2EMTA 4F7GA 2N23A 3AU5A 4GXBA 2J0KA 3SV1A 2YS1A 5J3YA 3ZDTA 2LYDA 2COFA 2RUKB 1KI1B 1ZC3B 2I1KA 2GCJA 5C79A 1X86A 3HW2B 3T06A 3MPXA 3SUZA 5HE2A 3LJUX 3BJIA 2L2IA 1I7AA 2CY4A 4ZRJA 1WJ1A 1U5DA 3G9WA 1XX0A 4KVGB 4DX8A 5C6RA 2IYBA 2COAA 1RRPB 2YS3A 1TQZA 2DA0A 2LKOA 3PVUA 4XWXA 1LB1A 4K81A 2J0MA 1I2HA 1QC6A 3GYOA 1Z87A 4MT7A 1M7RA 3QWMA 1NI2A 5JHHA 1AWEA 3F5RA 1XD4A 1Q67A 4ZRKA 1U5GA 2AEHA 5D3VA 5FI0A 2D10A 2L1CA 2I5FA 1PMSA 4HB3B 1M7EA 3CIKA 2CRFA 2IFSA 3V5WA 3X23A 3SO6A 1DDVA 1V5UA 5HE0A 2D2QA 2D9VA 3KRXA 4EMOA 4HAXB 4K2PA 4HAUB 3AJ4A 2VSZA 3HK0A 4KHAA 2ZPYA 4L6EA 2LG1A 3ULCA 2RLOA 4CHMA 3FSSA 5LOPB 1FOEA 1WVHA 3D8EA 1MAIA 4PNKA 2NMBA 4P7IA 5D27A 2N0YA 4A6HA 4PQ0A 1FAOA 5JLJB 1KZGA 2HTHB 1BAKA 1EGXA 4HAVB 1UNRA 1V5PA 2H7DA 4H8SA 2PZ1A 2D9YA 1AQCA 1DBHA 2Z0PA 2D11A 3U7DA 1XCGA 2MFQA 3KZ1A 2I5CA 3RCPA 1FGZA 1X11A 2GJYA 1E5WA 1ZC4B 5C5BB 5L81A 1W1HA 2OQBA 1SHCA 3A98B 2UZRA 1P6SA 4DBBA 2NZ8B 3VOQA 1XKEA 2MKRA 3FM8C 5JHGA 3PG7A 3ODWA 2DHIA 2KCJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2X18 A;  1U29 A;  1DDW A;  1LW3 A;  2MWN B;  4EKU A;  1FB8 A;  2K2U A;  2V76 A;  4A6F B;  3F0W A;  4GMX B;  2DHK A;  5DI9 B;  2YS5 A;  5J3Q A;  2R09 A;  2ROZ B;  5J3T A;  1EAZ A;  3P6A A;  2EMS A;  1ZVR A;  5CLQ B;  4KHO A;  2EC1 A;  2RNR B;  1U5F A;  3ZVR A;  4WJ7 A;  2MDX A;  5FI1 A;  1MIZ B;  2Z0Q A;  1K5D B;  4HAW B;  1DYN A;  3O96 A;  1V89 A;  2K00 A;  4HDQ A;  1UPR A;  4MK0 A;  1OQN A;  1U5E A;  1UNQ A;  1GC7 A;  2DYQ A;  1BWN A;  1X1F A;  2Z0O A;  1WGU A;  2DKQ A;  2ADZ A;  3TO1 A;  1P5T A;  3PEG A;  2M38 A;  4BBK A;  2P0D A;  4GMV A;  3DXD A;  3UZT A;  1DDM A;  3QBV B;  2LOX A;  1V61 A;  5JP4 A;  2YVC A;  2ELB A;  1U27 A;  1UPQ A;  1X05 A;  5DHA B;  4GN1 A;  3GYP A;  1MK9 B;  3CXB B;  1EVH A;  1DRO A;  3ODX A;  4HB4 B;  1UEF A;  1XOD A;  1KZ7 A;  5DHF B;  3ML4 A;  2DKP A;  1V88 A;  1FGY A;  1V5M A;  4K2O A;  3NSU A;  4HDO A;  3KY9 A;  1GG3 A;  4KHB B;  5D3W A;  2RSG A;  2OTX A;  2YT0 A;  1ZM0 A;  4HAZ B;  4EJN A;  3TFM A;  2BCJ A;  1ISN A;  1UNP A;  1MPH A;  2UVM A;  5EFX A;  2JP2 A;  3PP2 A;  4CHJ A;  3IVF A;  2Q13 A;  2KUP A;  5KCV A;  2J59 M;  3TCA A;  2W2X D;  4C0A A;  1TJ6 A;  2UZS A;  1W1D A;  2Y8F A;  1IRS A;  1FHW A;  1SGH A;  3ULB A;  2D9Z A;  1OMW A;  4GPT B;  1NTY A;  3QIJ A;  5CLL B;  2YT1 A;  1FHX A;  1K5G B;  2LUL A;  3KRW A;  3AU4 A;  2I1J A;  5DIF B;  4DXA B;  1PLS A;  4IAP A;  3PVW A;  1NU2 A;  2Y7B A;  1QQG A;  4KAX B;  1MK7 B;  1WI1 A;  3DXE A;  2COC A;  2CAY A;  1P3R A;  2G35 A;  2CY5 A;  4WSF A;  4YON A;  3D8F A;  1MKE A;  4NY0 A;  4DX9 0;  2D9W A;  2YSZ A;  5LON B;  1X1G A;  1Y5O A;  4Z2N A;  3U8Z A;  3N7C A;  3P7Z A;  2DHJ A;  1XR0 B;  1N3H A;  2DX5 A;  2DX1 A;  3ODO A;  4HAT B;  2E2X A;  1H4R A;  3A8P A;  5KQ4 A;  3WA0 A;  1W1G A;  2DLW A;  5D3Y A;  2ROV A;  1WJM A;  1MIX A;  2GS0 A;  1WGQ A;  4A5K A;  4B6H A;  1H10 A;  2EJ8 A;  2D4Q A;  3FEH A;  2M14 A;  1J0W A;  1TXD A;  2J0J A;  4TKN A;  2DYN A;  1FHO A;  4WVF B;  2Y8G A;  4A6F A;  1EF1 A;  1NTV A;  2W2X C;  4HAY B;  4NSW A;  2AL6 A;  5C5B A;  4CYE A;  2D9X A;  3WYF B;  2DTC A;  3PZD A;  3BIN A;  3HQC A;  2XQN M;  2GCL A;  1U2B A;  5HE1 A;  1B55 A;  2QKL A;  3M1I B;  4F7H A;  1RJ2 A;  2RGN B;  4HHV A;  5C16 A;  5D3X A;  5KQ1 A;  3A8Q A;  2YRY A;  1Y19 B;  4TYZ A;  4IOY X;  1WG7 A;  2DFK A;  4HB0 B;  3KSY A;  2P0F A;  2P8V A;  3OAN A;  4K17 A;  4Y94 A;  2KGX B;  4Z2M B;  1PFJ A;  3PSC A;  4HB2 B;  5HE3 A;  2LOZ A;  4IFS A;  2HE7 A;  5DH9 B;  3PVL A;  1GC6 A;  2RVB B;  2YF0 A;  1BTK A;  4MY6 A;  1OY2 A;  2R0D A;  4D0N B;  3MDB C;  3VIA A;  3DXC A;  4GZU A;  4A6K A;  1BTN A;  3SYX A;  4F7U P;  2P0H A;  2DN6 A;  3SNH A;  2K2J A;  2VKI A;  1ZSQ A;  3TVV A;  3TW1 A;  2VRW B;  4YL8 A;  2H7E A;  4ZRI A;  2ELA A;  5GOW B;  2QKM A;  2FJL A;  2COD A;  3D8D A;  1J19 A;  2W2W A;  2EMT A;  4F7G A;  2N23 A;  3AU5 A;  4GXB A;  2J0K A;  3SV1 A;  2YS1 A;  5J3Y A;  3ZDT A;  2LYD A;  2COF A;  2RUK B;  1KI1 B;  1ZC3 B;  2I1K A;  2GCJ A;  5C79 A;  1X86 A;  3HW2 B;  3T06 A;  3MPX A;  3SUZ A;  5HE2 A;  3LJU X;  3BJI A;  2L2I A;  1I7A A;  2CY4 A;  4ZRJ A;  1WJ1 A;  1U5D A;  3G9W A;  1XX0 A;  4KVG B;  4DX8 A;  5C6R A;  2IYB A;  2COA A;  1RRP B;  2YS3 A;  1TQZ A;  2DA0 A;  2LKO A;  3PVU A;  4XWX A;  1LB1 A;  4K81 A;  2J0M A;  1I2H A;  1QC6 A;  3GYO A;  1Z87 A;  4MT7 A;  1M7R A;  3QWM A;  1NI2 A;  5JHH A;  1AWE A;  3F5R A;  1XD4 A;  1Q67 A;  4ZRK A;  1U5G A;  2AEH A;  5D3V A;  5FI0 A;  2D10 A;  2L1C A;  2I5F A;  1PMS A;  4HB3 B;  1M7E A;  3CIK A;  2CRF A;  2IFS A;  3V5W A;  3X23 A;  3SO6 A;  1DDV A;  1V5U A;  5HE0 A;  2D2Q A;  2D9V A;  3KRX A;  4EMO A;  4HAX B;  4K2P A;  4HAU B;  3AJ4 A;  2VSZ A;  3HK0 A;  4KHA A;  2ZPY A;  4L6E A;  2LG1 A;  3ULC A;  2RLO A;  4CHM A;  3FSS A;  5LOP B;  1FOE A;  1WVH A;  3D8E A;  1MAI A;  4PNK A;  2NMB A;  4P7I A;  5D27 A;  2N0Y A;  4A6H A;  4PQ0 A;  1FAO A;  5JLJ B;  1KZG A;  2HTH B;  1BAK A;  1EGX A;  4HAV B;  1UNR A;  1V5P A;  2H7D A;  4H8S A;  2PZ1 A;  2D9Y A;  1AQC A;  1DBH A;  2Z0P A;  2D11 A;  3U7D A;  1XCG A;  2MFQ A;  3KZ1 A;  2I5C A;  3RCP A;  1FGZ A;  1X11 A;  2GJY A;  1E5W A;  1ZC4 B;  5C5B B;  5L81 A;  1W1H A;  2OQB A;  1SHC A;  3A98 B;  2UZR A;  1P6S A;  4DBB A;  2NZ8 B;  3VOQ A;  1XKE A;  2MKR A;  3FM8 C;  5JHG A;  3PG7 A;  3ODW A;  2DHI A;  2KCJ A; 
#chains in the Genus database with same CATH topology
 2X18 A;  1U29 A;  3HSA A;  1DDW A;  1LW3 A;  2MWN B;  5M4Y B;  4EKU A;  1FB8 A;  2K2U A;  2V76 A;  4A6F B;  4GNK B;  3F0W A;  4GMX B;  2DHK A;  5DI9 B;  2YS5 A;  5J3Q A;  2R09 A;  2ROZ B;  5J3T A;  1EAZ A;  3P6A A;  4DIX A;  2EMS A;  1ZVR A;  5CLQ B;  4KHO A;  2EC1 A;  2RNR B;  1U5F A;  3ZVR A;  4WJ7 A;  1MI1 A;  2MDX A;  5FI1 A;  1MIZ B;  2Z0Q A;  1K5D B;  4HAW B;  1DYN A;  3O96 A;  1V89 A;  2K00 A;  4HDQ A;  1UPR A;  4MK0 A;  1OQN A;  1U5E A;  1UNQ A;  1GC7 A;  3OHM B;  2DYQ A;  1BWN A;  1X1F A;  2Z0O A;  1WGU A;  2DKQ A;  2ADZ A;  3TO1 A;  3NW8 A;  1P5T A;  2KR0 A;  3PEG A;  2M38 A;  4BBK A;  2P0D A;  4GMV A;  3DXD A;  3UZT A;  1DDM A;  3QBV B;  2LOX A;  1V61 A;  5JP4 A;  2YVC A;  2ELB A;  1U27 A;  1UPQ A;  1X05 A;  5DHA B;  4GN1 A;  3GYP A;  1MK9 B;  3CXB B;  3FVC A;  1EVH A;  1DRO A;  3ODX A;  3NWA A;  4HB4 B;  1UEF A;  1XOD A;  1KZ7 A;  5DHF B;  3ML4 A;  2DKP A;  1V88 A;  1FGY A;  1V5M A;  4K2O A;  1ZYI A;  3NSU A;  2KIG A;  4HDO A;  3KY9 A;  1GG3 A;  4KHB B;  5D3W A;  2RSG A;  2OTX A;  2YT0 A;  1ZM0 A;  4HAZ B;  4EJN A;  3TFM A;  2BCJ A;  1ISN A;  1UNP A;  1MPH A;  2UVM A;  5EFX A;  2JP2 A;  3PP2 A;  4CHJ A;  3IVF A;  2Q13 A;  2KUP A;  5KCV A;  2YT2 A;  2J59 M;  2ZKM X;  3TCA A;  2W2X D;  4C0A A;  1TJ6 A;  2UZS A;  1W1D A;  2Y8F A;  1IRS A;  1FHW A;  1SGH A;  3ULB A;  2D9Z A;  1OMW A;  4GPT B;  1NTY A;  3QIJ A;  5CLL B;  5LG4 B;  2YT1 A;  1FHX A;  1K5G B;  2LUL A;  3KRW A;  3AU4 A;  2I1J A;  5DIF B;  4DXA B;  1PLS A;  4IAP A;  3PVW A;  1NU2 A;  2Y7B A;  1QQG A;  4KAX B;  1MK7 B;  1WI1 A;  3DXE A;  2COC A;  2CAY A;  1P3R A;  2G35 A;  2CY5 A;  2KIE A;  4WSF A;  4CSQ A;  4YON A;  3D8F A;  1MKE A;  4NY0 A;  4DX9 0;  2D9W A;  2YSZ A;  5LON B;  1X1G A;  1Y5O A;  4Z2N A;  3U8Z A;  3N7C A;  3P7Z A;  2DHJ A;  1XR0 B;  1N3H A;  4KHB A;  2DX5 A;  2DX1 A;  3ODO A;  4HAT B;  2E2X A;  1H4R A;  3A8P A;  5KQ4 A;  3WA0 A;  2Z4D A;  1W1G A;  2DLW A;  5D3Y A;  2ROV A;  1WJM A;  1MIX A;  2GS0 A;  1WGQ A;  4OT1 A;  4A5K A;  3NWF A;  4B6H A;  1H10 A;  2EJ8 A;  2D4Q A;  3FEH A;  2M14 A;  4L1R A;  1J0W A;  2GUM A;  5I2S A;  1TXD A;  4QXA B;  2J0J A;  4TKN A;  2DYN A;  3B77 A;  1FHO A;  4WVF B;  2Y8G A;  4A6F A;  1EF1 A;  1NTV A;  2W2X C;  4HAY B;  4NSW A;  2AL6 A;  5C5B A;  4CYE A;  2D9X A;  3WYF B;  2DTC A;  3PZD A;  3BIN A;  3HQC A;  4GOU A;  2XQN M;  2GCL A;  2FJU B;  4QJ3 B;  1U2B A;  5HE1 A;  1B55 A;  2QKL A;  3M1I B;  4F7H A;  2RRF A;  1RJ2 A;  2RGN B;  4HHV A;  5C16 A;  5D3X A;  5KQ1 A;  4HSI A;  3A8Q A;  2YRY A;  1Y19 B;  4TYZ A;  4IOY X;  1WG7 A;  2DFK A;  4HB0 B;  3KSY A;  2P0F A;  2P8V A;  3OAN A;  4K17 A;  4Y94 A;  1T77 A;  2KGX B;  4Z2M B;  1PFJ A;  3PSC A;  2Z13 A;  4HB2 B;  5HE3 A;  2LOZ A;  4QJ4 B;  4IFS A;  2HE7 A;  5DH9 B;  3PVL A;  2K49 A;  1GC6 A;  2RVB B;  2YF0 A;  1BTK A;  4MY6 A;  1OY2 A;  2R0D A;  4D0N B;  3MDB C;  3VIA A;  3DXC A;  4GZU A;  4A6K A;  1BTN A;  3SYX A;  4F7U P;  2P0H A;  2DN6 A;  2KUQ A;  3SNH A;  2K2J A;  2VKI A;  1ZSQ A;  3TVV A;  3TW1 A;  2VRW B;  4YL8 A;  2H7E A;  4ZRI A;  2ELA A;  5GOW B;  4D6W A;  2QKM A;  2FJL A;  2COD A;  3D8D A;  1J19 A;  2W2W A;  2EMT A;  4F7G A;  2N23 A;  3AU5 A;  4GXB A;  2J0K A;  3U12 A;  3SV1 A;  2YS1 A;  5J3Y A;  3ZDT A;  2LYD A;  2COF A;  2RUK B;  5IRS A;  1KI1 B;  1ZC3 B;  2I1K A;  3NWD A;  2GCJ A;  5C79 A;  1X86 A;  3HW2 B;  3T06 A;  3MPX A;  3SUZ A;  5HE2 A;  3LJU X;  3BJI A;  2L2I A;  1I7A A;  2CY4 A;  4ZRJ A;  1WJ1 A;  1U5D A;  3G9W A;  1XX0 A;  2Z59 A;  4KVG B;  4DX8 A;  5C6R A;  2IYB A;  2COA A;  1RRP B;  2YS3 A;  1TQZ A;  2DA0 A;  2LKO A;  3PVU A;  4XWX A;  1LB1 A;  4K81 A;  2J0M A;  1I2H A;  1QC6 A;  3GYO A;  1Z87 A;  4MT7 A;  1M7R A;  3QWM A;  1NI2 A;  5JHH A;  2NBV A;  1AWE A;  3F5R A;  1XD4 A;  1Q67 A;  4ZRK A;  1U5G A;  2AEH A;  5D3V A;  5FI0 A;  2R2Y A;  2D10 A;  2L1C A;  2I5F A;  1PMS A;  4HB3 B;  1M7E A;  3CIK A;  2CRF A;  3DCX A;  2IFS A;  3V5W A;  3X23 A;  3SO6 A;  1DDV A;  1V5U A;  5HE0 A;  2D2Q A;  2D9V A;  3KRX A;  4EMO A;  4HAX B;  4K2P A;  4HAU B;  3AJ4 A;  2VSZ A;  3HK0 A;  3A58 A;  4KHA A;  2ZPY A;  4L6E A;  2LG1 A;  3ULC A;  2RLO A;  4CHM A;  3FSS A;  5LOP B;  1FOE A;  1WVH A;  3D8E A;  1MAI A;  4PNK A;  2NMB A;  4P7I A;  5D27 A;  4OSN A;  2N0Y A;  4A6H A;  4PQ0 A;  1FAO A;  5JLJ B;  1KZG A;  2Z14 A;  2HTH B;  1BAK A;  1EGX A;  4HAV B;  4QJ5 B;  1UNR A;  1V5P A;  5I2M A;  2H7D A;  4H8S A;  2PZ1 A;  2D9Y A;  1AQC A;  1DBH A;  2Z0P A;  2K8E A;  2D11 A;  3U7D A;  1XCG A;  2MFQ A;  3KZ1 A;  2I5C A;  3RCP A;  1FGZ A;  1X11 A;  2GJY A;  1E5W A;  1ZC4 B;  5C5B B;  5L81 A;  1W1H A;  2OQB A;  1SHC A;  3A98 B;  2UZR A;  1P6S A;  4DBB A;  2NZ8 B;  3VOQ A;  1XKE A;  2MKR A;  3FM8 C;  5JHG A;  3PG7 A;  3HIE A;  3ODW A;  2DHI A;  2KCJ A; 
#chains in the Genus database with same CATH homology
 2X18 A;  1U29 A;  1DDW A;  1LW3 A;  2MWN B;  4EKU A;  1FB8 A;  2K2U A;  2V76 A;  4A6F B;  3F0W A;  4GMX B;  2DHK A;  5DI9 B;  2YS5 A;  5J3Q A;  2R09 A;  2ROZ B;  5J3T A;  1EAZ A;  3P6A A;  2EMS A;  1ZVR A;  5CLQ B;  4KHO A;  2EC1 A;  2RNR B;  1U5F A;  3ZVR A;  4WJ7 A;  2MDX A;  5FI1 A;  1MIZ B;  2Z0Q A;  1K5D B;  4HAW B;  1DYN A;  3O96 A;  1V89 A;  2K00 A;  4HDQ A;  1UPR A;  4MK0 A;  1OQN A;  1U5E A;  1UNQ A;  1GC7 A;  2DYQ A;  1BWN A;  1X1F A;  2Z0O A;  1WGU A;  2DKQ A;  2ADZ A;  3TO1 A;  1P5T A;  3PEG A;  2M38 A;  4BBK A;  2P0D A;  4GMV A;  3DXD A;  3UZT A;  1DDM A;  3QBV B;  2LOX A;  1V61 A;  5JP4 A;  2YVC A;  2ELB A;  1U27 A;  1UPQ A;  1X05 A;  5DHA B;  4GN1 A;  3GYP A;  1MK9 B;  3CXB B;  1EVH A;  1DRO A;  3ODX A;  4HB4 B;  1UEF A;  1XOD A;  1KZ7 A;  5DHF B;  3ML4 A;  2DKP A;  1V88 A;  1FGY A;  1V5M A;  4K2O A;  3NSU A;  4HDO A;  3KY9 A;  1GG3 A;  4KHB B;  5D3W A;  2RSG A;  2OTX A;  2YT0 A;  1ZM0 A;  4HAZ B;  4EJN A;  3TFM A;  2BCJ A;  1ISN A;  1UNP A;  1MPH A;  2UVM A;  5EFX A;  2JP2 A;  3PP2 A;  4CHJ A;  3IVF A;  2Q13 A;  2KUP A;  5KCV A;  2J59 M;  3TCA A;  2W2X D;  4C0A A;  1TJ6 A;  2UZS A;  1W1D A;  2Y8F A;  1IRS A;  1FHW A;  1SGH A;  3ULB A;  2D9Z A;  1OMW A;  4GPT B;  1NTY A;  3QIJ A;  5CLL B;  2YT1 A;  1FHX A;  1K5G B;  2LUL A;  3KRW A;  3AU4 A;  2I1J A;  5DIF B;  4DXA B;  1PLS A;  4IAP A;  3PVW A;  1NU2 A;  2Y7B A;  1QQG A;  4KAX B;  1MK7 B;  1WI1 A;  3DXE A;  2COC A;  2CAY A;  1P3R A;  2G35 A;  2CY5 A;  4WSF A;  4YON A;  3D8F A;  1MKE A;  4NY0 A;  4DX9 0;  2D9W A;  2YSZ A;  5LON B;  1X1G A;  1Y5O A;  4Z2N A;  3U8Z A;  3N7C A;  3P7Z A;  2DHJ A;  1XR0 B;  1N3H A;  2DX5 A;  2DX1 A;  3ODO A;  4HAT B;  2E2X A;  1H4R A;  3A8P A;  5KQ4 A;  3WA0 A;  1W1G A;  2DLW A;  5D3Y A;  2ROV A;  1WJM A;  1MIX A;  2GS0 A;  1WGQ A;  4A5K A;  4B6H A;  1H10 A;  2EJ8 A;  2D4Q A;  3FEH A;  2M14 A;  1J0W A;  1TXD A;  2J0J A;  4TKN A;  2DYN A;  1FHO A;  4WVF B;  2Y8G A;  4A6F A;  1EF1 A;  1NTV A;  2W2X C;  4HAY B;  4NSW A;  2AL6 A;  5C5B A;  4CYE A;  2D9X A;  3WYF B;  2DTC A;  3PZD A;  3BIN A;  3HQC A;  2XQN M;  2GCL A;  1U2B A;  5HE1 A;  1B55 A;  2QKL A;  3M1I B;  4F7H A;  1RJ2 A;  2RGN B;  4HHV A;  5C16 A;  5D3X A;  5KQ1 A;  3A8Q A;  2YRY A;  1Y19 B;  4TYZ A;  4IOY X;  1WG7 A;  2DFK A;  4HB0 B;  3KSY A;  2P0F A;  2P8V A;  3OAN A;  4K17 A;  4Y94 A;  2KGX B;  4Z2M B;  1PFJ A;  3PSC A;  4HB2 B;  5HE3 A;  2LOZ A;  4IFS A;  2HE7 A;  5DH9 B;  3PVL A;  1GC6 A;  2RVB B;  2YF0 A;  1BTK A;  4MY6 A;  1OY2 A;  2R0D A;  4D0N B;  3MDB C;  3VIA A;  3DXC A;  4GZU A;  4A6K A;  1BTN A;  3SYX A;  4F7U P;  2P0H A;  2DN6 A;  3SNH A;  2K2J A;  2VKI A;  1ZSQ A;  3TVV A;  3TW1 A;  2VRW B;  4YL8 A;  2H7E A;  4ZRI A;  2ELA A;  5GOW B;  2QKM A;  2FJL A;  2COD A;  3D8D A;  1J19 A;  2W2W A;  2EMT A;  4F7G A;  2N23 A;  3AU5 A;  4GXB A;  2J0K A;  3SV1 A;  2YS1 A;  5J3Y A;  3ZDT A;  2LYD A;  2COF A;  2RUK B;  1KI1 B;  1ZC3 B;  2I1K A;  2GCJ A;  5C79 A;  1X86 A;  3HW2 B;  3T06 A;  3MPX A;  3SUZ A;  5HE2 A;  3LJU X;  3BJI A;  2L2I A;  1I7A A;  2CY4 A;  4ZRJ A;  1WJ1 A;  1U5D A;  3G9W A;  1XX0 A;  4KVG B;  4DX8 A;  5C6R A;  2IYB A;  2COA A;  1RRP B;  2YS3 A;  1TQZ A;  2DA0 A;  2LKO A;  3PVU A;  4XWX A;  1LB1 A;  4K81 A;  2J0M A;  1I2H A;  1QC6 A;  3GYO A;  1Z87 A;  4MT7 A;  1M7R A;  3QWM A;  1NI2 A;  5JHH A;  1AWE A;  3F5R A;  1XD4 A;  1Q67 A;  4ZRK A;  1U5G A;  2AEH A;  5D3V A;  5FI0 A;  2D10 A;  2L1C A;  2I5F A;  1PMS A;  4HB3 B;  1M7E A;  3CIK A;  2CRF A;  2IFS A;  3V5W A;  3X23 A;  3SO6 A;  1DDV A;  1V5U A;  5HE0 A;  2D2Q A;  2D9V A;  3KRX A;  4EMO A;  4HAX B;  4K2P A;  4HAU B;  3AJ4 A;  2VSZ A;  3HK0 A;  4KHA A;  2ZPY A;  4L6E A;  2LG1 A;  3ULC A;  2RLO A;  4CHM A;  3FSS A;  5LOP B;  1FOE A;  1WVH A;  3D8E A;  1MAI A;  4PNK A;  2NMB A;  4P7I A;  5D27 A;  2N0Y A;  4A6H A;  4PQ0 A;  1FAO A;  5JLJ B;  1KZG A;  2HTH B;  1BAK A;  1EGX A;  4HAV B;  1UNR A;  1V5P A;  2H7D A;  4H8S A;  2PZ1 A;  2D9Y A;  1AQC A;  1DBH A;  2Z0P A;  2D11 A;  3U7D A;  1XCG A;  2MFQ A;  3KZ1 A;  2I5C A;  3RCP A;  1FGZ A;  1X11 A;  2GJY A;  1E5W A;  1ZC4 B;  5C5B B;  5L81 A;  1W1H A;  2OQB A;  1SHC A;  3A98 B;  2UZR A;  1P6S A;  4DBB A;  2NZ8 B;  3VOQ A;  1XKE A;  2MKR A;  3FM8 C;  5JHG A;  3PG7 A;  3ODW A;  2DHI A;  2KCJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...