4HB4B

Crystal structure of crm1 inhibitor leptomycin b in complex with crm1(537dltvk541/glceq)-ran-ranbp1
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
121
structure length
121
Chain Sequence
EEDEEVLYKVRAKLFRFDKDAKEWKERGTGDCKFLKNKKTNKVRILMRRDKTLKICANHIIAPEYTLKPNVGSDRSWVYACTADIAEGEAEAFTFAIRFGSKENADKFKEEFEKAQEINKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein transport/antibiotic
molecule keywords GTP-binding nuclear protein Ran
publication title Nuclear export inhibition through covalent conjugation and hydrolysis of Leptomycin B by CRM1.
pubmed doi rcsb
source organism Homo sapiens
total genus 33
structure length 121
sequence length 121
ec nomenclature
pdb deposition date 2012-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00638 Ran_BP1 RanBP1 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 4hb4B00
5C79A 1LW3A 2DX5A 1ZM0A 5DH9B 3HQCA 4P7IA 3KRXA 1GG3A 3HK0A 4HAYB 2DX1A 3PSCA 1XODA 1P3RA 2LKOA 3IVFA 2DHJA 2K2JA 4WSFA 1AQCA 2N23A 4EKUA 5HE3A 2RGNB 2RSGA 3BJIA 2GS0A 4IFSA 4KHAA 1Y19B 1FOEA 1MAIA 2L2IA 4NSWA 3SO6A 2J0MA 5D27A 1PLSA 4MK0A 1V89A 1PMSA 3DXCA 2Y8FA 3PVUA 2HTHB 2M38A 3PVLA 5DHFB 2Q13A 2NZ8B 4HDOA 1IRSA 1MIZB 2G35A 3A98B 1FGYA 2YT1A 3PZDA 3OANA 3G9WA 1DROA 3ODWA 1M7RA 5J3TA 1XR0B 2P0DA 1ISNA 1X1FA 5EFXA 1W1GA 2DTCA 2KCJA 1U5EA 4GN1A 2Z0OA 2RNRB 2LG1A 1E5WA 3KY9A 1WJ1A 3D8DA 1DDMA 4HB2B 2H7EA 2X18A 2DHKA 4XWXA 2DHIA 2OTXA 2D4QA 3A8PA 1NI2A 4D0NB 2RLOA 4ZRKA 3TCAA 3BINA 3DXEA 1GC7A 2LULA 2D9ZA 3DXDA 2P8VA 2K2UA 2Z0QA 1M7EA 4DX8A 2MKRA 4K2PA 4PQ0A 1RJ2A 2UZSA 4H8SA 5D3WA 1WI1A 3TO1A 2Z0PA 2D11A 1J19A 2YS3A 1U5GA 2EMSA 1ZSQA 1H10A 1FAOA 3LJUX 2COCA 4GPTB 2ROZB 4HAXB 3MPXA 2ZPYA 5LOPB 1X86A 2D9YA 2QKLA 1NU2A 4PNKA 2YS5A 1SHCA 4HHVA 2GJYA 5CLQB 2ELAA 2MFQA 5KCVA 4HATB 3FSSA 5J3YA 2L1CA 4TKNA 2XQNM 4HB0B 3GYOA 1FHXA 4MY6A 1UEFA 1UPRA 4GXBA 2YSZA 4K17A 2DKQA 1V88A 4HB3B 2JP2A 4GMVA 5D3XA 5CLLB 5GOWB 1U5FA 1XCGA 3KSYA 2DFKA 4HAZB 1UNPA 3MDBC 5HE0A 1BAKA 2KUPA 4KAXB 5DI9B 1FHOA 1MIXA 3PP2A 2NMBA 4HAUB 1DBHA 3AJ4A 2W2XC 1GC6A 2CY4A 2ELBA 4KHBB 3D8EA 1XD4A 2QKMA 1H4RA 2EMTA 4KHOA 3ULCA 1EVHA 1MPHA 1TXDA 1ZC4B 4HAWB 2GCLA 5KQ1A 3NSUA 4F7UP 4YONA 4ZRJA 1V5PA 5D3YA 1W1HA 1WG7A 2YT0A 4K81A 4ZRIA 3PG7A 1UPQA 2D9VA 2IYBA 2CRFA 3KZ1A 1UNRA 5JHGA 4IAPA 2YVCA 3SUZA 2D10A 1Q67A 2R09A 3X23A 2I1KA 1WVHA 1KI1B 3GYPA 3AU5A 4A5KA 2W2XD 2MWNB 2N0YA 4WVFB 2YRYA 1SGHA 4A6KA 1WJMA 1KZGA 5JP4A 4A6FB 2DLWA 4A6HA 1MK9B 3TW1A 2DN6A 5L81A 2J0JA 1MKEA 2E2XA 4CHMA 3QIJA 2CY5A 2P0FA 2VRWB 3FM8C 1P5TA 1X1GA 4CYEA 1FB8A 1OY2A 1U29A 3CIKA 1V5UA 3TVVA 2AL6A 1B55A 2DA0A 2D2QA 4YL8A 3O96A 4GZUA 4L6EA 3T06A 4BBKA 2LYDA 4NY0A 3WA0A 5KQ4A 5HE2A 4B6HA 1X05A 4A6FA 4C0AA 1WGQA 2DYNA 1K5DB 2I5FA 5JHHA 1MK7B 4WJ7A 1RRPB 3A8QA 3N7CA 2AEHA 3VIAA 2CAYA 3F5RA 2LOXA 1PFJA 1N3HA 1LB1A 1I2HA 2ADZA 2COFA 2HE7A 1U2BA 3FEHA 1V5MA 4Y94A 1DYNA 2ROVA 1EAZA 4Z2NA 1TJ6A 1QQGA 1EGXA 2DYQA 2EJ8A 5C5BB 2MDXA 3CXBB 2R0DA 5FI1A 4F7GA 5DIFB 2D9WA 1V61A 3U7DA 1W1DA 3AU4A 3ULBA 3M1IB 1NTVA 1DDVA 3P6AA 1EF1A 4DBBA 4CHJA 1J0WA 2EC1A 3D8FA 3F0WA 2KGXB 2I5CA 3QBVB 1OMWA 1QC6A 4DXAB 4K2OA 2CODA 3V5WA 3UZTA 3SYXA 4HAVB 1ZC3B 3RCPA 5C5BA 4GMXB 1KZ7A 2Y8GA 1U5DA 3VOQA 1FGZA 2RUKB 1P6SA 5C16A 2UZRA 3PEGA 1Z87A 4Z2MB 1ZVRA 2P0HA 2FJLA 2J0KA 4F7HA 1BTKA 2COAA 5D3VA 3KRWA 1FHWA 2YS1A 4DX90 2YF0A 1X11A 2IFSA 1AWEA 3SNHA 1Y5OA 2UVMA 4TYZA 2DKPA 5JLJB 2M14A 1BTNA 4IOYX 2I1JA 2GCJA 5HE1A 3U8ZA 4MT7A 2J59M 2RVBB 2VKIA 2K00A 3ML4A 4KVGB 2LOZA 3HW2B 5DHAB 2OQBA 2D9XA 3ZVRA 1I7AA 1XKEA 1TQZA 1NTYA 3ZDTA 1BWNA 3P7ZA 1DDWA 5LONB 4EJNA 3WYFB 1K5GB 2V76A 3QWMA 3ODOA 3TFMA 1U27A 3PVWA 1XX0A 3ODXA 2PZ1A 2VSZA 1WGUA 4EMOA 2Y7BA 1UNQA 5FI0A 1OQNA 5C6RA 2BCJA 4HB4B 5J3QA 2W2WA 3SV1A 4HDQA 2H7DA
chains in the Genus database with same CATH superfamily
5C79A 1LW3A 2DX5A 1ZM0A 5DH9B 2KIGA 3HQCA 4P7IA 3KRXA 1GG3A 3HK0A 4HAYB 2DX1A 3PSCA 1XODA 1P3RA 2LKOA 3IVFA 2DHJA 2K2JA 4WSFA 1AQCA 2N23A 4EKUA 5HE3A 2RGNB 2RSGA 2K49A 3BJIA 2GS0A 5LG4B 4IFSA 4KHAA 1Y19B 1FOEA 1MAIA 3DCXA 2L2IA 4NSWA 2J0MA 2YT2A 1PLSA 5D27A 3SO6A 4MK0A 1V89A 1PMSA 3DXCA 2Y8FA 3PVUA 2HTHB 2M38A 3PVLA 5DHFB 2Q13A 2NBVA 2NZ8B 4HDOA 1IRSA 1MIZB 2G35A 3A98B 1FGYA 4D6WA 2YT1A 3PZDA 2ZKMX 3OANA 3G9WA 1DROA 3ODWA 1M7RA 5J3TA 1XR0B 2P0DA 1ISNA 1X1FA 5EFXA 1W1GA 2DTCA 2KCJA 1U5EA 4GN1A 2Z0OA 2RNRB 2LG1A 1E5WA 3KY9A 1WJ1A 4L1RA 3D8DA 1DDMA 5M4YB 4HB2B 2H7EA 2X18A 2DHKA 4XWXA 2DHIA 2OTXA 2D4QA 3A8PA 3OHMB 1NI2A 3NWDA 3HIEA 4D0NB 2RLOA 4ZRKA 3TCAA 3BINA 3DXEA 1GC7A 2LULA 2D9ZA 3DXDA 2P8VA 2K2UA 2Z0QA 1M7EA 4DX8A 2MKRA 4K2PA 4PQ0A 1RJ2A 2UZSA 4H8SA 5D3WA 5I2MA 1WI1A 3TO1A 2Z0PA 2D11A 1J19A 2YS3A 1U5GA 2EMSA 1ZSQA 1H10A 1FAOA 2Z13A 3LJUX 2COCA 4QXAB 4GPTB 2ROZB 4HAXB 3MPXA 2RRFA 2ZPYA 1X86A 5LOPB 2D9YA 4GOUA 2QKLA 1NU2A 4PNKA 2YS5A 1SHCA 4HHVA 2GJYA 5CLQB 2ELAA 2MFQA 5KCVA 4HATB 3FSSA 5J3YA 2L1CA 4TKNA 2XQNM 2R2YA 4HB0B 3GYOA 1FHXA 3B77A 4MY6A 1UEFA 1UPRA 3NWFA 4GXBA 2YSZA 4K17A 2DKQA 1V88A 4HB3B 2JP2A 4GMVA 5D3XA 5CLLB 5GOWB 1U5FA 1XCGA 3KSYA 2DFKA 4HAZB 3U12A 1UNPA 1ZYIA 3MDBC 5HE0A 3HSAA 1BAKA 2KUPA 4KAXB 5DI9B 1FHOA 1MIXA 3PP2A 2NMBA 4HAUB 1DBHA 3AJ4A 2W2XC 1GC6A 2CY4A 2ELBA 4KHBB 3D8EA 1XD4A 2KUQA 2QKMA 1H4RA 2EMTA 4KHOA 3ULCA 1EVHA 1MPHA 1TXDA 1ZC4B 4HAWB 2GCLA 5KQ1A 3NSUA 4F7UP 4YONA 4ZRJA 1V5PA 5D3YA 1W1HA 1WG7A 2YT0A 4K81A 4ZRIA 3PG7A 1UPQA 2D9VA 2IYBA 2CRFA 3KZ1A 1UNRA 5JHGA 4IAPA 3A58A 4QJ5B 2YVCA 3SUZA 2D10A 4DIXA 1Q67A 2R09A 3FVCA 3X23A 2I1KA 1WVHA 1KI1B 3GYPA 3AU5A 4A5KA 2W2XD 2MWNB 2N0YA 4WVFB 2YRYA 1SGHA 4A6KA 1WJMA 4QJ3B 1KZGA 5JP4A 4A6FB 2DLWA 4A6HA 1MK9B 3TW1A 2DN6A 5L81A 2J0JA 4CSQA 1MKEA 2Z59A 2E2XA 4CHMA 3QIJA 2CY5A 2Z4DA 2P0FA 2VRWB 3FM8C 1P5TA 4QJ4B 1X1GA 4CYEA 1FB8A 4OT1A 1OY2A 1U29A 3CIKA 1V5UA 3TVVA 2AL6A 1B55A 2DA0A 2D2QA 4YL8A 3O96A 4GZUA 4L6EA 3T06A 4BBKA 2LYDA 4NY0A 3WA0A 5KQ4A 5HE2A 4B6HA 1X05A 4A6FA 2Z14A 4C0AA 1WGQA 2DYNA 1K5DB 2I5FA 5JHHA 1MK7B 4WJ7A 1RRPB 3A8QA 3N7CA 2AEHA 3VIAA 2CAYA 2GUMA 2LOXA 3F5RA 5I2SA 1PFJA 1T77A 1N3HA 1LB1A 1I2HA 3NW8A 2ADZA 2COFA 2HE7A 1U2BA 3FEHA 1V5MA 4Y94A 1DYNA 2ROVA 1EAZA 4Z2NA 1TJ6A 1QQGA 1EGXA 2DYQA 2EJ8A 5C5BB 2MDXA 3CXBB 2R0DA 5FI1A 4F7GA 5DIFB 2KR0A 2D9WA 1V61A 3U7DA 1W1DA 3AU4A 3ULBA 3M1IB 1NTVA 1DDVA 3P6AA 1EF1A 4DBBA 2FJUB 4CHJA 1J0WA 2EC1A 3D8FA 3F0WA 2KGXB 2I5CA 3QBVB 1OMWA 1QC6A 4DXAB 4K2OA 2CODA 3V5WA 3UZTA 3SYXA 4HAVB 1ZC3B 3RCPA 5C5BA 4GMXB 1KZ7A 2Y8GA 1U5DA 3VOQA 1FGZA 2RUKB 1P6SA 5C16A 2UZRA 3PEGA 1Z87A 4Z2MB 1ZVRA 2P0HA 2FJLA 2J0KA 4F7HA 4KHBA 1BTKA 2COAA 1MI1A 2K8EA 5D3VA 3KRWA 1FHWA 2YS1A 4DX90 2YF0A 1X11A 2IFSA 1AWEA 3SNHA 1Y5OA 2UVMA 4TYZA 2DKPA 5JLJB 2M14A 1BTNA 2KIEA 4IOYX 2I1JA 2GCJA 5HE1A 3U8ZA 4MT7A 2J59M 2RVBB 2VKIA 2K00A 3ML4A 4KVGB 2LOZA 3HW2B 5DHAB 2OQBA 2D9XA 4HSIA 3ZVRA 1I7AA 1XKEA 1TQZA 1NTYA 5IRSA 3ZDTA 1BWNA 3P7ZA 1DDWA 5LONB 4EJNA 4GNKB 3WYFB 1K5GB 2V76A 3QWMA 3ODOA 4OSNA 3TFMA 1U27A 3PVWA 1XX0A 3ODXA 2PZ1A 2VSZA 1WGUA 4EMOA 2Y7BA 1UNQA 5FI0A 3NWAA 1OQNA 5C6RA 2BCJA 4HB4B 5J3QA 2W2WA 3SV1A 4HDQA 2H7DA
chains in the Genus database with same CATH topology
5C79A 1LW3A 2DX5A 1ZM0A 5DH9B 3HQCA 4P7IA 3KRXA 1GG3A 3HK0A 4HAYB 2DX1A 3PSCA 1XODA 1P3RA 2LKOA 3IVFA 2DHJA 2K2JA 4WSFA 1AQCA 2N23A 4EKUA 5HE3A 2RGNB 2RSGA 3BJIA 2GS0A 4IFSA 4KHAA 1Y19B 1FOEA 1MAIA 2L2IA 4NSWA 3SO6A 2J0MA 5D27A 1PLSA 4MK0A 1V89A 1PMSA 3DXCA 2Y8FA 3PVUA 2HTHB 2M38A 3PVLA 5DHFB 2Q13A 2NZ8B 4HDOA 1IRSA 1MIZB 2G35A 3A98B 1FGYA 2YT1A 3PZDA 3OANA 3G9WA 1DROA 3ODWA 1M7RA 5J3TA 1XR0B 2P0DA 1ISNA 1X1FA 5EFXA 1W1GA 2DTCA 2KCJA 1U5EA 4GN1A 2Z0OA 2RNRB 2LG1A 1E5WA 3KY9A 1WJ1A 3D8DA 1DDMA 4HB2B 2H7EA 2X18A 2DHKA 4XWXA 2DHIA 2OTXA 2D4QA 3A8PA 1NI2A 4D0NB 2RLOA 4ZRKA 3TCAA 3BINA 3DXEA 1GC7A 2LULA 2D9ZA 3DXDA 2P8VA 2K2UA 2Z0QA 1M7EA 4DX8A 2MKRA 4K2PA 4PQ0A 1RJ2A 2UZSA 4H8SA 5D3WA 1WI1A 3TO1A 2Z0PA 2D11A 1J19A 2YS3A 1U5GA 2EMSA 1ZSQA 1H10A 1FAOA 3LJUX 2COCA 4GPTB 2ROZB 4HAXB 3MPXA 2ZPYA 5LOPB 1X86A 2D9YA 2QKLA 1NU2A 4PNKA 2YS5A 1SHCA 4HHVA 2GJYA 5CLQB 2ELAA 2MFQA 5KCVA 4HATB 3FSSA 5J3YA 2L1CA 4TKNA 2XQNM 4HB0B 3GYOA 1FHXA 4MY6A 1UEFA 1UPRA 4GXBA 2YSZA 4K17A 2DKQA 1V88A 4HB3B 2JP2A 4GMVA 5D3XA 5CLLB 5GOWB 1U5FA 1XCGA 3KSYA 2DFKA 4HAZB 1UNPA 3MDBC 5HE0A 1BAKA 2KUPA 4KAXB 5DI9B 1FHOA 1MIXA 3PP2A 2NMBA 4HAUB 1DBHA 3AJ4A 2W2XC 1GC6A 2CY4A 2ELBA 4KHBB 3D8EA 1XD4A 2QKMA 1H4RA 2EMTA 4KHOA 3ULCA 1EVHA 1MPHA 1TXDA 1ZC4B 4HAWB 2GCLA 5KQ1A 3NSUA 4F7UP 4YONA 4ZRJA 1V5PA 5D3YA 1W1HA 1WG7A 2YT0A 4K81A 4ZRIA 3PG7A 1UPQA 2D9VA 2IYBA 2CRFA 3KZ1A 1UNRA 5JHGA 4IAPA 2YVCA 3SUZA 2D10A 1Q67A 2R09A 3X23A 2I1KA 1WVHA 1KI1B 3GYPA 3AU5A 4A5KA 2W2XD 2MWNB 2N0YA 4WVFB 2YRYA 1SGHA 4A6KA 1WJMA 1KZGA 5JP4A 4A6FB 2DLWA 4A6HA 1MK9B 3TW1A 2DN6A 5L81A 2J0JA 1MKEA 2E2XA 4CHMA 3QIJA 2CY5A 2P0FA 2VRWB 3FM8C 1P5TA 1X1GA 4CYEA 1FB8A 1OY2A 1U29A 3CIKA 1V5UA 3TVVA 2AL6A 1B55A 2DA0A 2D2QA 4YL8A 3O96A 4GZUA 4L6EA 3T06A 4BBKA 2LYDA 4NY0A 3WA0A 5KQ4A 5HE2A 4B6HA 1X05A 4A6FA 4C0AA 1WGQA 2DYNA 1K5DB 2I5FA 5JHHA 1MK7B 4WJ7A 1RRPB 3A8QA 3N7CA 2AEHA 3VIAA 2CAYA 3F5RA 2LOXA 1PFJA 1N3HA 1LB1A 1I2HA 2ADZA 2COFA 2HE7A 1U2BA 3FEHA 1V5MA 4Y94A 1DYNA 2ROVA 1EAZA 4Z2NA 1TJ6A 1QQGA 1EGXA 2DYQA 2EJ8A 5C5BB 2MDXA 3CXBB 2R0DA 5FI1A 4F7GA 5DIFB 2D9WA 1V61A 3U7DA 1W1DA 3AU4A 3ULBA 3M1IB 1NTVA 1DDVA 3P6AA 1EF1A 4DBBA 4CHJA 1J0WA 2EC1A 3D8FA 3F0WA 2KGXB 2I5CA 3QBVB 1OMWA 1QC6A 4DXAB 4K2OA 2CODA 3V5WA 3UZTA 3SYXA 4HAVB 1ZC3B 3RCPA 5C5BA 4GMXB 1KZ7A 2Y8GA 1U5DA 3VOQA 1FGZA 2RUKB 1P6SA 5C16A 2UZRA 3PEGA 1Z87A 4Z2MB 1ZVRA 2P0HA 2FJLA 2J0KA 4F7HA 1BTKA 2COAA 5D3VA 3KRWA 1FHWA 2YS1A 4DX90 2YF0A 1X11A 2IFSA 1AWEA 3SNHA 1Y5OA 2UVMA 4TYZA 2DKPA 5JLJB 2M14A 1BTNA 4IOYX 2I1JA 2GCJA 5HE1A 3U8ZA 4MT7A 2J59M 2RVBB 2VKIA 2K00A 3ML4A 4KVGB 2LOZA 3HW2B 5DHAB 2OQBA 2D9XA 3ZVRA 1I7AA 1XKEA 1TQZA 1NTYA 3ZDTA 1BWNA 3P7ZA 1DDWA 5LONB 4EJNA 3WYFB 1K5GB 2V76A 3QWMA 3ODOA 3TFMA 1U27A 3PVWA 1XX0A 3ODXA 2PZ1A 2VSZA 1WGUA 4EMOA 2Y7BA 1UNQA 5FI0A 1OQNA 5C6RA 2BCJA 4HB4B 5J3QA 2W2WA 3SV1A 4HDQA 2H7DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5C79 A;  1LW3 A;  2DX5 A;  1ZM0 A;  5DH9 B;  3HQC A;  4P7I A;  3KRX A;  1GG3 A;  3HK0 A;  4HAY B;  2DX1 A;  3PSC A;  1XOD A;  1P3R A;  2LKO A;  3IVF A;  2DHJ A;  2K2J A;  4WSF A;  1AQC A;  2N23 A;  4EKU A;  5HE3 A;  2RGN B;  2RSG A;  3BJI A;  2GS0 A;  4IFS A;  4KHA A;  1Y19 B;  1FOE A;  1MAI A;  2L2I A;  4NSW A;  3SO6 A;  2J0M A;  5D27 A;  1PLS A;  4MK0 A;  1V89 A;  1PMS A;  3DXC A;  2Y8F A;  3PVU A;  2HTH B;  2M38 A;  3PVL A;  5DHF B;  2Q13 A;  2NZ8 B;  4HDO A;  1IRS A;  1MIZ B;  2G35 A;  3A98 B;  1FGY A;  2YT1 A;  3PZD A;  3OAN A;  3G9W A;  1DRO A;  3ODW A;  1M7R A;  5J3T A;  1XR0 B;  2P0D A;  1ISN A;  1X1F A;  5EFX A;  1W1G A;  2DTC A;  2KCJ A;  1U5E A;  4GN1 A;  2Z0O A;  2RNR B;  2LG1 A;  1E5W A;  3KY9 A;  1WJ1 A;  3D8D A;  1DDM A;  4HB2 B;  2H7E A;  2X18 A;  2DHK A;  4XWX A;  2DHI A;  2OTX A;  2D4Q A;  3A8P A;  1NI2 A;  4D0N B;  2RLO A;  4ZRK A;  3TCA A;  3BIN A;  3DXE A;  1GC7 A;  2LUL A;  2D9Z A;  3DXD A;  2P8V A;  2K2U A;  2Z0Q A;  1M7E A;  4DX8 A;  2MKR A;  4K2P A;  4PQ0 A;  1RJ2 A;  2UZS A;  4H8S A;  5D3W A;  1WI1 A;  3TO1 A;  2Z0P A;  2D11 A;  1J19 A;  2YS3 A;  1U5G A;  2EMS A;  1ZSQ A;  1H10 A;  1FAO A;  3LJU X;  2COC A;  4GPT B;  2ROZ B;  4HAX B;  3MPX A;  2ZPY A;  5LOP B;  1X86 A;  2D9Y A;  2QKL A;  1NU2 A;  4PNK A;  2YS5 A;  1SHC A;  4HHV A;  2GJY A;  5CLQ B;  2ELA A;  2MFQ A;  5KCV A;  4HAT B;  3FSS A;  5J3Y A;  2L1C A;  4TKN A;  2XQN M;  4HB0 B;  3GYO A;  1FHX A;  4MY6 A;  1UEF A;  1UPR A;  4GXB A;  2YSZ A;  4K17 A;  2DKQ A;  1V88 A;  4HB3 B;  2JP2 A;  4GMV A;  5D3X A;  5CLL B;  5GOW B;  1U5F A;  1XCG A;  3KSY A;  2DFK A;  4HAZ B;  1UNP A;  3MDB C;  5HE0 A;  1BAK A;  2KUP A;  4KAX B;  5DI9 B;  1FHO A;  1MIX A;  3PP2 A;  2NMB A;  4HAU B;  1DBH A;  3AJ4 A;  2W2X C;  1GC6 A;  2CY4 A;  2ELB A;  4KHB B;  3D8E A;  1XD4 A;  2QKM A;  1H4R A;  2EMT A;  4KHO A;  3ULC A;  1EVH A;  1MPH A;  1TXD A;  1ZC4 B;  4HAW B;  2GCL A;  5KQ1 A;  3NSU A;  4F7U P;  4YON A;  4ZRJ A;  1V5P A;  5D3Y A;  1W1H A;  1WG7 A;  2YT0 A;  4K81 A;  4ZRI A;  3PG7 A;  1UPQ A;  2D9V A;  2IYB A;  2CRF A;  3KZ1 A;  1UNR A;  5JHG A;  4IAP A;  2YVC A;  3SUZ A;  2D10 A;  1Q67 A;  2R09 A;  3X23 A;  2I1K A;  1WVH A;  1KI1 B;  3GYP A;  3AU5 A;  4A5K A;  2W2X D;  2MWN B;  2N0Y A;  4WVF B;  2YRY A;  1SGH A;  4A6K A;  1WJM A;  1KZG A;  5JP4 A;  4A6F B;  2DLW A;  4A6H A;  1MK9 B;  3TW1 A;  2DN6 A;  5L81 A;  2J0J A;  1MKE A;  2E2X A;  4CHM A;  3QIJ A;  2CY5 A;  2P0F A;  2VRW B;  3FM8 C;  1P5T A;  1X1G A;  4CYE A;  1FB8 A;  1OY2 A;  1U29 A;  3CIK A;  1V5U A;  3TVV A;  2AL6 A;  1B55 A;  2DA0 A;  2D2Q A;  4YL8 A;  3O96 A;  4GZU A;  4L6E A;  3T06 A;  4BBK A;  2LYD A;  4NY0 A;  3WA0 A;  5KQ4 A;  5HE2 A;  4B6H A;  1X05 A;  4A6F A;  4C0A A;  1WGQ A;  2DYN A;  1K5D B;  2I5F A;  5JHH A;  1MK7 B;  4WJ7 A;  1RRP B;  3A8Q A;  3N7C A;  2AEH A;  3VIA A;  2CAY A;  3F5R A;  2LOX A;  1PFJ A;  1N3H A;  1LB1 A;  1I2H A;  2ADZ A;  2COF A;  2HE7 A;  1U2B A;  3FEH A;  1V5M A;  4Y94 A;  1DYN A;  2ROV A;  1EAZ A;  4Z2N A;  1TJ6 A;  1QQG A;  1EGX A;  2DYQ A;  2EJ8 A;  5C5B B;  2MDX A;  3CXB B;  2R0D A;  5FI1 A;  4F7G A;  5DIF B;  2D9W A;  1V61 A;  3U7D A;  1W1D A;  3AU4 A;  3ULB A;  3M1I B;  1NTV A;  1DDV A;  3P6A A;  1EF1 A;  4DBB A;  4CHJ A;  1J0W A;  2EC1 A;  3D8F A;  3F0W A;  2KGX B;  2I5C A;  3QBV B;  1OMW A;  1QC6 A;  4DXA B;  4K2O A;  2COD A;  3V5W A;  3UZT A;  3SYX A;  4HAV B;  1ZC3 B;  3RCP A;  5C5B A;  4GMX B;  1KZ7 A;  2Y8G A;  1U5D A;  3VOQ A;  1FGZ A;  2RUK B;  1P6S A;  5C16 A;  2UZR A;  3PEG A;  1Z87 A;  4Z2M B;  1ZVR A;  2P0H A;  2FJL A;  2J0K A;  4F7H A;  1BTK A;  2COA A;  5D3V A;  3KRW A;  1FHW A;  2YS1 A;  4DX9 0;  2YF0 A;  1X11 A;  2IFS A;  1AWE A;  3SNH A;  1Y5O A;  2UVM A;  4TYZ A;  2DKP A;  5JLJ B;  2M14 A;  1BTN A;  4IOY X;  2I1J A;  2GCJ A;  5HE1 A;  3U8Z A;  4MT7 A;  2J59 M;  2RVB B;  2VKI A;  2K00 A;  3ML4 A;  4KVG B;  2LOZ A;  3HW2 B;  5DHA B;  2OQB A;  2D9X A;  3ZVR A;  1I7A A;  1XKE A;  1TQZ A;  1NTY A;  3ZDT A;  1BWN A;  3P7Z A;  1DDW A;  5LON B;  4EJN A;  3WYF B;  1K5G B;  2V76 A;  3QWM A;  3ODO A;  3TFM A;  1U27 A;  3PVW A;  1XX0 A;  3ODX A;  2PZ1 A;  2VSZ A;  1WGU A;  4EMO A;  2Y7B A;  1UNQ A;  5FI0 A;  1OQN A;  5C6R A;  2BCJ A;  4HB4 B;  5J3Q A;  2W2W A;  3SV1 A;  4HDQ A;  2H7D A; 
#chains in the Genus database with same CATH topology
 5C79 A;  1LW3 A;  2DX5 A;  1ZM0 A;  5DH9 B;  2KIG A;  3HQC A;  4P7I A;  3KRX A;  1GG3 A;  3HK0 A;  4HAY B;  2DX1 A;  3PSC A;  1XOD A;  1P3R A;  2LKO A;  3IVF A;  2DHJ A;  2K2J A;  4WSF A;  1AQC A;  2N23 A;  4EKU A;  5HE3 A;  2RGN B;  2RSG A;  2K49 A;  3BJI A;  2GS0 A;  5LG4 B;  4IFS A;  4KHA A;  1Y19 B;  1FOE A;  1MAI A;  3DCX A;  2L2I A;  4NSW A;  2J0M A;  2YT2 A;  1PLS A;  5D27 A;  3SO6 A;  4MK0 A;  1V89 A;  1PMS A;  3DXC A;  2Y8F A;  3PVU A;  2HTH B;  2M38 A;  3PVL A;  5DHF B;  2Q13 A;  2NBV A;  2NZ8 B;  4HDO A;  1IRS A;  1MIZ B;  2G35 A;  3A98 B;  1FGY A;  4D6W A;  2YT1 A;  3PZD A;  2ZKM X;  3OAN A;  3G9W A;  1DRO A;  3ODW A;  1M7R A;  5J3T A;  1XR0 B;  2P0D A;  1ISN A;  1X1F A;  5EFX A;  1W1G A;  2DTC A;  2KCJ A;  1U5E A;  4GN1 A;  2Z0O A;  2RNR B;  2LG1 A;  1E5W A;  3KY9 A;  1WJ1 A;  4L1R A;  3D8D A;  1DDM A;  5M4Y B;  4HB2 B;  2H7E A;  2X18 A;  2DHK A;  4XWX A;  2DHI A;  2OTX A;  2D4Q A;  3A8P A;  3OHM B;  1NI2 A;  3NWD A;  3HIE A;  4D0N B;  2RLO A;  4ZRK A;  3TCA A;  3BIN A;  3DXE A;  1GC7 A;  2LUL A;  2D9Z A;  3DXD A;  2P8V A;  2K2U A;  2Z0Q A;  1M7E A;  4DX8 A;  2MKR A;  4K2P A;  4PQ0 A;  1RJ2 A;  2UZS A;  4H8S A;  5D3W A;  5I2M A;  1WI1 A;  3TO1 A;  2Z0P A;  2D11 A;  1J19 A;  2YS3 A;  1U5G A;  2EMS A;  1ZSQ A;  1H10 A;  1FAO A;  2Z13 A;  3LJU X;  2COC A;  4QXA B;  4GPT B;  2ROZ B;  4HAX B;  3MPX A;  2RRF A;  2ZPY A;  1X86 A;  5LOP B;  2D9Y A;  4GOU A;  2QKL A;  1NU2 A;  4PNK A;  2YS5 A;  1SHC A;  4HHV A;  2GJY A;  5CLQ B;  2ELA A;  2MFQ A;  5KCV A;  4HAT B;  3FSS A;  5J3Y A;  2L1C A;  4TKN A;  2XQN M;  2R2Y A;  4HB0 B;  3GYO A;  1FHX A;  3B77 A;  4MY6 A;  1UEF A;  1UPR A;  3NWF A;  4GXB A;  2YSZ A;  4K17 A;  2DKQ A;  1V88 A;  4HB3 B;  2JP2 A;  4GMV A;  5D3X A;  5CLL B;  5GOW B;  1U5F A;  1XCG A;  3KSY A;  2DFK A;  4HAZ B;  3U12 A;  1UNP A;  1ZYI A;  3MDB C;  5HE0 A;  3HSA A;  1BAK A;  2KUP A;  4KAX B;  5DI9 B;  1FHO A;  1MIX A;  3PP2 A;  2NMB A;  4HAU B;  1DBH A;  3AJ4 A;  2W2X C;  1GC6 A;  2CY4 A;  2ELB A;  4KHB B;  3D8E A;  1XD4 A;  2KUQ A;  2QKM A;  1H4R A;  2EMT A;  4KHO A;  3ULC A;  1EVH A;  1MPH A;  1TXD A;  1ZC4 B;  4HAW B;  2GCL A;  5KQ1 A;  3NSU A;  4F7U P;  4YON A;  4ZRJ A;  1V5P A;  5D3Y A;  1W1H A;  1WG7 A;  2YT0 A;  4K81 A;  4ZRI A;  3PG7 A;  1UPQ A;  2D9V A;  2IYB A;  2CRF A;  3KZ1 A;  1UNR A;  5JHG A;  4IAP A;  3A58 A;  4QJ5 B;  2YVC A;  3SUZ A;  2D10 A;  4DIX A;  1Q67 A;  2R09 A;  3FVC A;  3X23 A;  2I1K A;  1WVH A;  1KI1 B;  3GYP A;  3AU5 A;  4A5K A;  2W2X D;  2MWN B;  2N0Y A;  4WVF B;  2YRY A;  1SGH A;  4A6K A;  1WJM A;  4QJ3 B;  1KZG A;  5JP4 A;  4A6F B;  2DLW A;  4A6H A;  1MK9 B;  3TW1 A;  2DN6 A;  5L81 A;  2J0J A;  4CSQ A;  1MKE A;  2Z59 A;  2E2X A;  4CHM A;  3QIJ A;  2CY5 A;  2Z4D A;  2P0F A;  2VRW B;  3FM8 C;  1P5T A;  4QJ4 B;  1X1G A;  4CYE A;  1FB8 A;  4OT1 A;  1OY2 A;  1U29 A;  3CIK A;  1V5U A;  3TVV A;  2AL6 A;  1B55 A;  2DA0 A;  2D2Q A;  4YL8 A;  3O96 A;  4GZU A;  4L6E A;  3T06 A;  4BBK A;  2LYD A;  4NY0 A;  3WA0 A;  5KQ4 A;  5HE2 A;  4B6H A;  1X05 A;  4A6F A;  2Z14 A;  4C0A A;  1WGQ A;  2DYN A;  1K5D B;  2I5F A;  5JHH A;  1MK7 B;  4WJ7 A;  1RRP B;  3A8Q A;  3N7C A;  2AEH A;  3VIA A;  2CAY A;  2GUM A;  2LOX A;  3F5R A;  5I2S A;  1PFJ A;  1T77 A;  1N3H A;  1LB1 A;  1I2H A;  3NW8 A;  2ADZ A;  2COF A;  2HE7 A;  1U2B A;  3FEH A;  1V5M A;  4Y94 A;  1DYN A;  2ROV A;  1EAZ A;  4Z2N A;  1TJ6 A;  1QQG A;  1EGX A;  2DYQ A;  2EJ8 A;  5C5B B;  2MDX A;  3CXB B;  2R0D A;  5FI1 A;  4F7G A;  5DIF B;  2KR0 A;  2D9W A;  1V61 A;  3U7D A;  1W1D A;  3AU4 A;  3ULB A;  3M1I B;  1NTV A;  1DDV A;  3P6A A;  1EF1 A;  4DBB A;  2FJU B;  4CHJ A;  1J0W A;  2EC1 A;  3D8F A;  3F0W A;  2KGX B;  2I5C A;  3QBV B;  1OMW A;  1QC6 A;  4DXA B;  4K2O A;  2COD A;  3V5W A;  3UZT A;  3SYX A;  4HAV B;  1ZC3 B;  3RCP A;  5C5B A;  4GMX B;  1KZ7 A;  2Y8G A;  1U5D A;  3VOQ A;  1FGZ A;  2RUK B;  1P6S A;  5C16 A;  2UZR A;  3PEG A;  1Z87 A;  4Z2M B;  1ZVR A;  2P0H A;  2FJL A;  2J0K A;  4F7H A;  4KHB A;  1BTK A;  2COA A;  1MI1 A;  2K8E A;  5D3V A;  3KRW A;  1FHW A;  2YS1 A;  4DX9 0;  2YF0 A;  1X11 A;  2IFS A;  1AWE A;  3SNH A;  1Y5O A;  2UVM A;  4TYZ A;  2DKP A;  5JLJ B;  2M14 A;  1BTN A;  2KIE A;  4IOY X;  2I1J A;  2GCJ A;  5HE1 A;  3U8Z A;  4MT7 A;  2J59 M;  2RVB B;  2VKI A;  2K00 A;  3ML4 A;  4KVG B;  2LOZ A;  3HW2 B;  5DHA B;  2OQB A;  2D9X A;  4HSI A;  3ZVR A;  1I7A A;  1XKE A;  1TQZ A;  1NTY A;  5IRS A;  3ZDT A;  1BWN A;  3P7Z A;  1DDW A;  5LON B;  4EJN A;  4GNK B;  3WYF B;  1K5G B;  2V76 A;  3QWM A;  3ODO A;  4OSN A;  3TFM A;  1U27 A;  3PVW A;  1XX0 A;  3ODX A;  2PZ1 A;  2VSZ A;  1WGU A;  4EMO A;  2Y7B A;  1UNQ A;  5FI0 A;  3NWA A;  1OQN A;  5C6R A;  2BCJ A;  4HB4 B;  5J3Q A;  2W2W A;  3SV1 A;  4HDQ A;  2H7D A; 
#chains in the Genus database with same CATH homology
 5C79 A;  1LW3 A;  2DX5 A;  1ZM0 A;  5DH9 B;  3HQC A;  4P7I A;  3KRX A;  1GG3 A;  3HK0 A;  4HAY B;  2DX1 A;  3PSC A;  1XOD A;  1P3R A;  2LKO A;  3IVF A;  2DHJ A;  2K2J A;  4WSF A;  1AQC A;  2N23 A;  4EKU A;  5HE3 A;  2RGN B;  2RSG A;  3BJI A;  2GS0 A;  4IFS A;  4KHA A;  1Y19 B;  1FOE A;  1MAI A;  2L2I A;  4NSW A;  3SO6 A;  2J0M A;  5D27 A;  1PLS A;  4MK0 A;  1V89 A;  1PMS A;  3DXC A;  2Y8F A;  3PVU A;  2HTH B;  2M38 A;  3PVL A;  5DHF B;  2Q13 A;  2NZ8 B;  4HDO A;  1IRS A;  1MIZ B;  2G35 A;  3A98 B;  1FGY A;  2YT1 A;  3PZD A;  3OAN A;  3G9W A;  1DRO A;  3ODW A;  1M7R A;  5J3T A;  1XR0 B;  2P0D A;  1ISN A;  1X1F A;  5EFX A;  1W1G A;  2DTC A;  2KCJ A;  1U5E A;  4GN1 A;  2Z0O A;  2RNR B;  2LG1 A;  1E5W A;  3KY9 A;  1WJ1 A;  3D8D A;  1DDM A;  4HB2 B;  2H7E A;  2X18 A;  2DHK A;  4XWX A;  2DHI A;  2OTX A;  2D4Q A;  3A8P A;  1NI2 A;  4D0N B;  2RLO A;  4ZRK A;  3TCA A;  3BIN A;  3DXE A;  1GC7 A;  2LUL A;  2D9Z A;  3DXD A;  2P8V A;  2K2U A;  2Z0Q A;  1M7E A;  4DX8 A;  2MKR A;  4K2P A;  4PQ0 A;  1RJ2 A;  2UZS A;  4H8S A;  5D3W A;  1WI1 A;  3TO1 A;  2Z0P A;  2D11 A;  1J19 A;  2YS3 A;  1U5G A;  2EMS A;  1ZSQ A;  1H10 A;  1FAO A;  3LJU X;  2COC A;  4GPT B;  2ROZ B;  4HAX B;  3MPX A;  2ZPY A;  5LOP B;  1X86 A;  2D9Y A;  2QKL A;  1NU2 A;  4PNK A;  2YS5 A;  1SHC A;  4HHV A;  2GJY A;  5CLQ B;  2ELA A;  2MFQ A;  5KCV A;  4HAT B;  3FSS A;  5J3Y A;  2L1C A;  4TKN A;  2XQN M;  4HB0 B;  3GYO A;  1FHX A;  4MY6 A;  1UEF A;  1UPR A;  4GXB A;  2YSZ A;  4K17 A;  2DKQ A;  1V88 A;  4HB3 B;  2JP2 A;  4GMV A;  5D3X A;  5CLL B;  5GOW B;  1U5F A;  1XCG A;  3KSY A;  2DFK A;  4HAZ B;  1UNP A;  3MDB C;  5HE0 A;  1BAK A;  2KUP A;  4KAX B;  5DI9 B;  1FHO A;  1MIX A;  3PP2 A;  2NMB A;  4HAU B;  1DBH A;  3AJ4 A;  2W2X C;  1GC6 A;  2CY4 A;  2ELB A;  4KHB B;  3D8E A;  1XD4 A;  2QKM A;  1H4R A;  2EMT A;  4KHO A;  3ULC A;  1EVH A;  1MPH A;  1TXD A;  1ZC4 B;  4HAW B;  2GCL A;  5KQ1 A;  3NSU A;  4F7U P;  4YON A;  4ZRJ A;  1V5P A;  5D3Y A;  1W1H A;  1WG7 A;  2YT0 A;  4K81 A;  4ZRI A;  3PG7 A;  1UPQ A;  2D9V A;  2IYB A;  2CRF A;  3KZ1 A;  1UNR A;  5JHG A;  4IAP A;  2YVC A;  3SUZ A;  2D10 A;  1Q67 A;  2R09 A;  3X23 A;  2I1K A;  1WVH A;  1KI1 B;  3GYP A;  3AU5 A;  4A5K A;  2W2X D;  2MWN B;  2N0Y A;  4WVF B;  2YRY A;  1SGH A;  4A6K A;  1WJM A;  1KZG A;  5JP4 A;  4A6F B;  2DLW A;  4A6H A;  1MK9 B;  3TW1 A;  2DN6 A;  5L81 A;  2J0J A;  1MKE A;  2E2X A;  4CHM A;  3QIJ A;  2CY5 A;  2P0F A;  2VRW B;  3FM8 C;  1P5T A;  1X1G A;  4CYE A;  1FB8 A;  1OY2 A;  1U29 A;  3CIK A;  1V5U A;  3TVV A;  2AL6 A;  1B55 A;  2DA0 A;  2D2Q A;  4YL8 A;  3O96 A;  4GZU A;  4L6E A;  3T06 A;  4BBK A;  2LYD A;  4NY0 A;  3WA0 A;  5KQ4 A;  5HE2 A;  4B6H A;  1X05 A;  4A6F A;  4C0A A;  1WGQ A;  2DYN A;  1K5D B;  2I5F A;  5JHH A;  1MK7 B;  4WJ7 A;  1RRP B;  3A8Q A;  3N7C A;  2AEH A;  3VIA A;  2CAY A;  3F5R A;  2LOX A;  1PFJ A;  1N3H A;  1LB1 A;  1I2H A;  2ADZ A;  2COF A;  2HE7 A;  1U2B A;  3FEH A;  1V5M A;  4Y94 A;  1DYN A;  2ROV A;  1EAZ A;  4Z2N A;  1TJ6 A;  1QQG A;  1EGX A;  2DYQ A;  2EJ8 A;  5C5B B;  2MDX A;  3CXB B;  2R0D A;  5FI1 A;  4F7G A;  5DIF B;  2D9W A;  1V61 A;  3U7D A;  1W1D A;  3AU4 A;  3ULB A;  3M1I B;  1NTV A;  1DDV A;  3P6A A;  1EF1 A;  4DBB A;  4CHJ A;  1J0W A;  2EC1 A;  3D8F A;  3F0W A;  2KGX B;  2I5C A;  3QBV B;  1OMW A;  1QC6 A;  4DXA B;  4K2O A;  2COD A;  3V5W A;  3UZT A;  3SYX A;  4HAV B;  1ZC3 B;  3RCP A;  5C5B A;  4GMX B;  1KZ7 A;  2Y8G A;  1U5D A;  3VOQ A;  1FGZ A;  2RUK B;  1P6S A;  5C16 A;  2UZR A;  3PEG A;  1Z87 A;  4Z2M B;  1ZVR A;  2P0H A;  2FJL A;  2J0K A;  4F7H A;  1BTK A;  2COA A;  5D3V A;  3KRW A;  1FHW A;  2YS1 A;  4DX9 0;  2YF0 A;  1X11 A;  2IFS A;  1AWE A;  3SNH A;  1Y5O A;  2UVM A;  4TYZ A;  2DKP A;  5JLJ B;  2M14 A;  1BTN A;  4IOY X;  2I1J A;  2GCJ A;  5HE1 A;  3U8Z A;  4MT7 A;  2J59 M;  2RVB B;  2VKI A;  2K00 A;  3ML4 A;  4KVG B;  2LOZ A;  3HW2 B;  5DHA B;  2OQB A;  2D9X A;  3ZVR A;  1I7A A;  1XKE A;  1TQZ A;  1NTY A;  3ZDT A;  1BWN A;  3P7Z A;  1DDW A;  5LON B;  4EJN A;  3WYF B;  1K5G B;  2V76 A;  3QWM A;  3ODO A;  3TFM A;  1U27 A;  3PVW A;  1XX0 A;  3ODX A;  2PZ1 A;  2VSZ A;  1WGU A;  4EMO A;  2Y7B A;  1UNQ A;  5FI0 A;  1OQN A;  5C6R A;  2BCJ A;  4HB4 B;  5J3Q A;  2W2W A;  3SV1 A;  4HDQ A;  2H7D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...