2KUPA

Solution structure of the complex of the ptb domain of snt-2 and 19-residue peptide (aa 1571-1589) of halk
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
146
structure length
146
Chain Sequence
b'GSSGSSGLNRDSVPDNHPTKFKVTNVDDEGVELGSGVMELTQSELVLHLHRREAVRWPYLCLRRYGYDSNLFSFESGRRCQTGQGIFAFKCSRAEEIFNLLQDLMQCNSINVMEEPVIITRNSHPAELDLPRAPQPPNALGYTVSS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fibroblast growth factor receptor substrate 3
publication title Structural basis for the recognition of nucleophosmin-anaplastic lymphoma kinase oncoprotein by the phosphotyrosine binding domain of Suc1-associated neurotrophic factor-induced tyrosine-phosphorylated target-2
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein/oncoprotein
total genus 21
structure length 146
sequence length 146
ec nomenclature
pdb deposition date 2010-02-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02174 IRS PTB domain (IRS-1 type)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2kupA01
1X1FA 1V5MA 1TXDA 3DXEA 4TYZA 3M1IB 2YF0A 2J0MA 1DDMA 4HAXB 1MAIA 2KUPA 2D10A 1TJ6A 3UZTA 2D11A 2W2XC 1OQNA 5HE0A 2M14A 2YS3A 2N0YA 4KVGB 3HK0A 3O96A 1Y19B 1IRSA 4WJ7A 1P3RA 1I7AA 5D3WA 5DIFB 2YVCA 1TQZA 1WGUA 2J0JA 1NTYA 1BAKA 3CIKA 5DI9B 3FSSA 3GYPA 2L2IA 4HATB 4ZRJA 1GC6A 5KQ1A 1PLSA 4IAPA 2NMBA 4A6FB 4CHJA 2YSZA 1FAOA 2N23A 5DHFB 2KGXB 2Z0PA 1KZGA 3PVUA 1RRPB 4HAUB 4NY0A 3ULBA 1U2BA 5DH9B 4YONA 1V89A 2P0DA 1K5GB 3PVWA 3PSCA 2GJYA 1UNQA 4BBKA 5FI0A 1H4RA 1MK7B 3WYFB 1FHOA 2UZRA 1ZC3B 1U5EA 2DKPA 1P6SA 2ROVA 1FHXA 2GS0A 3X23A 2E2XA 4HAZB 3D8DA 2YRYA 5D27A 5D3VA 2IFSA 2J0KA 4C0AA 1V5PA 4KAXB 1EAZA 3KRWA 3PG7A 1WI1A 2R09A 4H8SA 5L81A 3P7ZA 2RGNB 3LJUX 1FGYA 1Z87A 4GN1A 4MT7A 4CHMA 4DXAB 1WG7A 2DX5A 1DDVA 3FM8C 4B6HA 4GMVA 2QKLA 1RJ2A 4EMOA 1PFJA 3V5WA 3KRXA 4HAVB 2ELBA 5C6RA 1X1GA 2ELAA 3WA0A 2VKIA 3OANA 3ML4A 1DROA 1V88A 5GOWB 1MIXA 2CAYA 2OQBA 1MIZB 1Y5OA 2EJ8A 2LOXA 5JHHA 4IFSA 1ZVRA 3VOQA 2D9WA 4HB3B 3N7CA 2V76A 1P5TA 5LOPB 2K00A 1M7RA 4DX90 3P6AA 2YS1A 2Y7BA 5C5BA 4GXBA 2LOZA 1H10A 4K2PA 4Z2NA 2UZSA 2Y8GA 2ROZB 3D8EA 1SHCA 1Q67A 2DHJA 2LYDA 2EMTA 1EGXA 2H7EA 1QC6A 1EF1A 2EC1A 1XD4A 4K81A 2MDXA 3AJ4A 3HW2B 1X86A 2COFA 1UPRA 3GYOA 5J3TA 2D2QA 1AWEA 1SGHA 2DKQA 3TO1A 4PQ0A 2CY4A 1FHWA 4DX8A 4PNKA 1DDWA 4MY6A 4DBBA 1BTKA 5C79A 1J19A 2ADZA 4WSFA 3SYXA 3TCAA 2JP2A 5HE2A 3CXBB 2YT1A 2DN6A 3F5RA 3D8FA 1U29A 2DLWA 5J3YA 2W2XD 1U5GA 5C5BB 3ZDTA 1K5DB 3RCPA 3BJIA 2D9XA 2X18A 2ZPYA 4KHOA 5C16A 3PZDA 1GG3A 2AEHA 1X11A 2L1CA 4TKNA 1PMSA 1DYNA 4A5KA 2J59M 5JLJB 1WVHA 3AU4A 4Y94A 1U27A 1X05A 4HAYB 3U7DA 2KCJA 3DXDA 1FGZA 2COAA 2CY5A 2COCA 4F7GA 2D9ZA 2K2JA 1N3HA 1WJMA 3KSYA 3QWMA 1J0WA 1ZSQA 1GC7A 3ODWA 4Z2MB 1LB1A 2Y8FA 3U8ZA 1KI1B 4P7IA 2DTCA 3IVFA 4ZRKA 4XWXA 3T06A 2I5FA 2MWNB 4D0NB 1XR0B 3PP2A 5J3QA 4K17A 3G9WA 3MPXA 2P0HA 5CLQB 2BCJA 4KHBB 2RUKB 1ZC4B 2LG1A 3KZ1A 2QKMA 2I1KA 5LONB 1XODA 1XKEA 5EFXA 5HE3A 1FOEA 3SNHA 3QBVB 2P8VA 3FEHA 2LULA 3A8QA 3A98B 4GMXB 3AU5A 4KHAA 4HHVA 2PZ1A 4EJNA 1ZM0A 2DYNA 2P0FA 4L6EA 5FI1A 1E5WA 4WVFB 5D3XA 2DA0A 1U5FA 2Z0QA 1MK9B 2R0DA 3VIAA 2DHKA 4HB4B 2DX1A 1AQCA 2GCJA 2I1JA 4HAWB 2RSGA 1XX0A 1WGQA 3SV1A 5DHAB 2LKOA 3TW1A 4F7HA 1QQGA 2VSZA 2RLOA 2UVMA 1M7EA 1UNPA 2Q13A 1WJ1A 2DYQA 2OTXA 1MKEA 2D9YA 2IYBA 4EKUA 1NI2A 2H7DA 3NSUA 3ODXA 1B55A 2GCLA 1XCGA 2G35A 2W2WA 2M38A 1V61A 2FJLA 4GZUA 2MKRA 2MFQA 4K2OA 4HB2B 3PEGA 4A6KA 1W1DA 1OY2A 2HTHB 4GPTB 1DBHA 2K2UA 1OMWA 4IOYX 3SUZA 3F0WA 5JHGA 3ODOA 2D9VA 2EMSA 2VRWB 4CYEA 2XQNM 3KY9A 4NSWA 3SO6A 1U5DA 2CRFA 1UPQA 2DFKA 1BTNA 1I2HA 2CODA 5KCVA 3BINA 2YS5A 3TFMA 3A8PA 1FB8A 4HDQA 3DXCA 2YT0A 2NZ8B 3PVLA 2DHIA 1W1GA 1V5UA 4MK0A 3MDBC 5KQ4A 2AL6A 1BWNA 2Z0OA 1UEFA 4A6HA 1KZ7A 1NTVA 1W1HA 2D4QA 3TVVA 2HE7A 2RVBB 3HQCA 5HE1A 4HDOA 4HB0B 5JP4A 5D3YA 4ZRIA 4F7UP 3ZVRA 2I5CA 1UNRA 1EVHA 1ISNA 1MPHA 3QIJA 1LW3A 4YL8A 2RNRB 1NU2A 3ULCA 4A6FA 5CLLB
chains in the Genus database with same CATH superfamily
1X1FA 2Z13A 1V5MA 1TXDA 3DXEA 4TYZA 3M1IB 2YF0A 2J0MA 1DDMA 4HAXB 1MAIA 2KUPA 2D10A 1TJ6A 3UZTA 2D11A 2W2XC 1OQNA 5HE0A 2YS3A 2M14A 2K49A 2N0YA 4KVGB 3HK0A 3O96A 1Y19B 1IRSA 4WJ7A 1P3RA 4QJ3B 1I7AA 2YT2A 5D3WA 5DIFB 5LG4B 2YVCA 1TQZA 1WGUA 2J0JA 1NTYA 1BAKA 3CIKA 5DI9B 3FSSA 4HSIA 3GYPA 2L2IA 4HATB 4ZRJA 1GC6A 5KQ1A 1PLSA 4QXAB 4IAPA 2NMBA 4A6FB 4CHJA 4CSQA 2YSZA 1FAOA 2N23A 5DHFB 2KGXB 2Z0PA 3HSAA 1KZGA 3PVUA 1RRPB 4HAUB 4NY0A 3ULBA 1U2BA 5DH9B 4YONA 5I2MA 1V89A 2P0DA 1K5GB 5IRSA 3PVWA 3PSCA 2GJYA 1UNQA 4BBKA 5FI0A 1H4RA 1MK7B 3WYFB 1FHOA 2UZRA 1ZC3B 2KR0A 1U5EA 2DKPA 2NBVA 1P6SA 2ROVA 3FVCA 1FHXA 2GS0A 3X23A 2E2XA 4HAZB 3D8DA 2YRYA 5D27A 2R2YA 5D3VA 2IFSA 4QJ5B 2J0KA 3HIEA 4C0AA 1V5PA 4KAXB 1EAZA 3KRWA 3PG7A 1WI1A 2R09A 4H8SA 5L81A 2Z59A 2FJUB 3P7ZA 2RGNB 3LJUX 1FGYA 1Z87A 4GN1A 3A58A 4MT7A 4CHMA 4DXAB 1WG7A 2DX5A 1DDVA 3FM8C 4B6HA 4GMVA 2QKLA 1RJ2A 4OSNA 4EMOA 1PFJA 3V5WA 3KRXA 4HAVB 2ELBA 5C6RA 1MI1A 1X1GA 2ELAA 3WA0A 2VKIA 2Z4DA 3OANA 3ML4A 1DROA 1V88A 5GOWB 4GOUA 1MIXA 2CAYA 3OHMB 2OQBA 1MIZB 1Y5OA 2EJ8A 2LOXA 5JHHA 4IFSA 1ZVRA 3VOQA 2D9WA 4HB3B 3N7CA 2V76A 1P5TA 5LOPB 2K00A 1M7RA 2GUMA 1ZYIA 2RRFA 3P6AA 2YS1A 4DX90 2Y7BA 5C5BA 4GXBA 2LOZA 1H10A 4K2PA 4Z2NA 3D8EA 2UZSA 2Y8GA 2ROZB 1SHCA 4DIXA 1Q67A 2DHJA 2LYDA 2EMTA 1EGXA 2H7EA 1QC6A 1EF1A 2EC1A 1XD4A 4K81A 2MDXA 3AJ4A 3HW2B 1X86A 2COFA 1UPRA 3GYOA 5J3TA 2D2QA 1AWEA 1SGHA 2KUQA 2DKQA 3TO1A 4PQ0A 2CY4A 1FHWA 4DX8A 4PNKA 1DDWA 4MY6A 4DBBA 1BTKA 5C79A 1J19A 2ADZA 4WSFA 3SYXA 3TCAA 2JP2A 5HE2A 3CXBB 2YT1A 2DN6A 3F5RA 3D8FA 1U29A 2DLWA 5J3YA 2W2XD 1U5GA 5C5BB 3ZDTA 1K5DB 3RCPA 3BJIA 2D9XA 2X18A 2ZPYA 4KHOA 5C16A 3PZDA 1GG3A 2AEHA 1X11A 2L1CA 4TKNA 1PMSA 1DYNA 4KHBA 4A5KA 2J59M 5JLJB 1WVHA 4QJ4B 3AU4A 4Y94A 1U27A 1X05A 4HAYB 3U7DA 2KCJA 3DXDA 2K8EA 1FGZA 2COAA 2CY5A 2COCA 4F7GA 2D9ZA 2K2JA 4L1RA 1N3HA 1WJMA 3KSYA 3QWMA 1J0WA 1ZSQA 1GC7A 3ODWA 4Z2MB 1LB1A 2Y8FA 3NWAA 3U8ZA 1KI1B 4P7IA 4D6WA 2DTCA 3IVFA 4ZRKA 4XWXA 3T06A 2I5FA 2MWNB 4D0NB 1XR0B 3PP2A 5J3QA 4K17A 3G9WA 3MPXA 2P0HA 5CLQB 2BCJA 4KHBB 2RUKB 1ZC4B 3NWFA 2LG1A 3KZ1A 2QKMA 2I1KA 5LONB 1XODA 1XKEA 5EFXA 5HE3A 1FOEA 3SNHA 3QBVB 2P8VA 3FEHA 2LULA 3A8QA 3A98B 4GMXB 3AU5A 4KHAA 4HHVA 2PZ1A 4EJNA 1ZM0A 2DYNA 2P0FA 4L6EA 5FI1A 1E5WA 2Z14A 4WVFB 5D3XA 2DA0A 1U5FA 2Z0QA 1MK9B 2R0DA 3VIAA 2DHKA 4HB4B 2DX1A 1AQCA 2GCJA 2I1JA 4HAWB 2RSGA 1XX0A 1WGQA 3SV1A 3NW8A 5DHAB 3B77A 2LKOA 3TW1A 4F7HA 1QQGA 2VSZA 2RLOA 2UVMA 1M7EA 1UNPA 2Q13A 1WJ1A 2DYQA 2OTXA 1MKEA 2D9YA 2IYBA 4EKUA 1NI2A 2H7DA 3NSUA 3ODXA 4OT1A 3NWDA 1B55A 2GCLA 2KIEA 1XCGA 2G35A 2W2WA 2M38A 1V61A 2FJLA 4GZUA 2MKRA 2MFQA 4K2OA 4HB2B 3PEGA 4A6KA 1W1DA 1OY2A 2HTHB 4GPTB 1DBHA 2K2UA 1OMWA 4IOYX 1T77A 2KIGA 3SUZA 3F0WA 5JHGA 2D9VA 2EMSA 2VRWB 3ODOA 4CYEA 2XQNM 3KY9A 4NSWA 3SO6A 1U5DA 2CRFA 1UPQA 2DFKA 1BTNA 1I2HA 2CODA 5KCVA 3BINA 2YS5A 3TFMA 3A8PA 1FB8A 4HDQA 3DXCA 2YT0A 2NZ8B 3PVLA 2DHIA 1W1GA 1V5UA 4MK0A 3MDBC 5KQ4A 2AL6A 1BWNA 2Z0OA 1UEFA 4A6HA 5I2SA 1KZ7A 1NTVA 1W1HA 2D4QA 3TVVA 2HE7A 2RVBB 3HQCA 5HE1A 4HDOA 4HB0B 5JP4A 5D3YA 4ZRIA 4F7UP 3ZVRA 2I5CA 1UNRA 1EVHA 1ISNA 1MPHA 3QIJA 3U12A 1LW3A 2ZKMX 3DCXA 4YL8A 4GNKB 2RNRB 1NU2A 3ULCA 4A6FA 5M4YB 5CLLB
chains in the Genus database with same CATH topology
1X1FA 1V5MA 1TXDA 3DXEA 4TYZA 3M1IB 2YF0A 2J0MA 1DDMA 4HAXB 1MAIA 2KUPA 2D10A 1TJ6A 3UZTA 2D11A 2W2XC 1OQNA 5HE0A 2M14A 2YS3A 2N0YA 4KVGB 3HK0A 3O96A 1Y19B 1IRSA 4WJ7A 1P3RA 1I7AA 5D3WA 5DIFB 2YVCA 1TQZA 1WGUA 2J0JA 1NTYA 1BAKA 3CIKA 5DI9B 3FSSA 3GYPA 2L2IA 4HATB 4ZRJA 1GC6A 5KQ1A 1PLSA 4IAPA 2NMBA 4A6FB 4CHJA 2YSZA 1FAOA 2N23A 5DHFB 2KGXB 2Z0PA 1KZGA 3PVUA 1RRPB 4HAUB 4NY0A 3ULBA 1U2BA 5DH9B 4YONA 1V89A 2P0DA 1K5GB 3PVWA 3PSCA 2GJYA 1UNQA 4BBKA 5FI0A 1H4RA 1MK7B 3WYFB 1FHOA 2UZRA 1ZC3B 1U5EA 2DKPA 1P6SA 2ROVA 1FHXA 2GS0A 3X23A 2E2XA 4HAZB 3D8DA 2YRYA 5D27A 5D3VA 2IFSA 2J0KA 4C0AA 1V5PA 4KAXB 1EAZA 3KRWA 3PG7A 1WI1A 2R09A 4H8SA 5L81A 3P7ZA 2RGNB 3LJUX 1FGYA 1Z87A 4GN1A 4MT7A 4CHMA 4DXAB 1WG7A 2DX5A 1DDVA 3FM8C 4B6HA 4GMVA 2QKLA 1RJ2A 4EMOA 1PFJA 3V5WA 3KRXA 4HAVB 2ELBA 5C6RA 1X1GA 2ELAA 3WA0A 2VKIA 3OANA 3ML4A 1DROA 1V88A 5GOWB 1MIXA 2CAYA 2OQBA 1MIZB 1Y5OA 2EJ8A 2LOXA 5JHHA 4IFSA 1ZVRA 3VOQA 2D9WA 4HB3B 3N7CA 2V76A 1P5TA 5LOPB 2K00A 1M7RA 4DX90 3P6AA 2YS1A 2Y7BA 5C5BA 4GXBA 2LOZA 1H10A 4K2PA 4Z2NA 2UZSA 2Y8GA 2ROZB 3D8EA 1SHCA 1Q67A 2DHJA 2LYDA 2EMTA 1EGXA 2H7EA 1QC6A 1EF1A 2EC1A 1XD4A 4K81A 2MDXA 3AJ4A 3HW2B 1X86A 2COFA 1UPRA 3GYOA 5J3TA 2D2QA 1AWEA 1SGHA 2DKQA 3TO1A 4PQ0A 2CY4A 1FHWA 4DX8A 4PNKA 1DDWA 4MY6A 4DBBA 1BTKA 5C79A 1J19A 2ADZA 4WSFA 3SYXA 3TCAA 2JP2A 5HE2A 3CXBB 2YT1A 2DN6A 3F5RA 3D8FA 1U29A 2DLWA 5J3YA 2W2XD 1U5GA 5C5BB 3ZDTA 1K5DB 3RCPA 3BJIA 2D9XA 2X18A 2ZPYA 4KHOA 5C16A 3PZDA 1GG3A 2AEHA 1X11A 2L1CA 4TKNA 1PMSA 1DYNA 4A5KA 2J59M 5JLJB 1WVHA 3AU4A 4Y94A 1U27A 1X05A 4HAYB 3U7DA 2KCJA 3DXDA 1FGZA 2COAA 2CY5A 2COCA 4F7GA 2D9ZA 2K2JA 1N3HA 1WJMA 3KSYA 3QWMA 1J0WA 1ZSQA 1GC7A 3ODWA 4Z2MB 1LB1A 2Y8FA 3U8ZA 1KI1B 4P7IA 2DTCA 3IVFA 4ZRKA 4XWXA 3T06A 2I5FA 2MWNB 4D0NB 1XR0B 3PP2A 5J3QA 4K17A 3G9WA 3MPXA 2P0HA 5CLQB 2BCJA 4KHBB 2RUKB 1ZC4B 2LG1A 3KZ1A 2QKMA 2I1KA 5LONB 1XODA 1XKEA 5EFXA 5HE3A 1FOEA 3SNHA 3QBVB 2P8VA 3FEHA 2LULA 3A8QA 3A98B 4GMXB 3AU5A 4KHAA 4HHVA 2PZ1A 4EJNA 1ZM0A 2DYNA 2P0FA 4L6EA 5FI1A 1E5WA 4WVFB 5D3XA 2DA0A 1U5FA 2Z0QA 1MK9B 2R0DA 3VIAA 2DHKA 4HB4B 2DX1A 1AQCA 2GCJA 2I1JA 4HAWB 2RSGA 1XX0A 1WGQA 3SV1A 5DHAB 2LKOA 3TW1A 4F7HA 1QQGA 2VSZA 2RLOA 2UVMA 1M7EA 1UNPA 2Q13A 1WJ1A 2DYQA 2OTXA 1MKEA 2D9YA 2IYBA 4EKUA 1NI2A 2H7DA 3NSUA 3ODXA 1B55A 2GCLA 1XCGA 2G35A 2W2WA 2M38A 1V61A 2FJLA 4GZUA 2MKRA 2MFQA 4K2OA 4HB2B 3PEGA 4A6KA 1W1DA 1OY2A 2HTHB 4GPTB 1DBHA 2K2UA 1OMWA 4IOYX 3SUZA 3F0WA 5JHGA 3ODOA 2D9VA 2EMSA 2VRWB 4CYEA 2XQNM 3KY9A 4NSWA 3SO6A 1U5DA 2CRFA 1UPQA 2DFKA 1BTNA 1I2HA 2CODA 5KCVA 3BINA 2YS5A 3TFMA 3A8PA 1FB8A 4HDQA 3DXCA 2YT0A 2NZ8B 3PVLA 2DHIA 1W1GA 1V5UA 4MK0A 3MDBC 5KQ4A 2AL6A 1BWNA 2Z0OA 1UEFA 4A6HA 1KZ7A 1NTVA 1W1HA 2D4QA 3TVVA 2HE7A 2RVBB 3HQCA 5HE1A 4HDOA 4HB0B 5JP4A 5D3YA 4ZRIA 4F7UP 3ZVRA 2I5CA 1UNRA 1EVHA 1ISNA 1MPHA 3QIJA 1LW3A 4YL8A 2RNRB 1NU2A 3ULCA 4A6FA 5CLLB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1X1F A;  1V5M A;  1TXD A;  3DXE A;  4TYZ A;  3M1I B;  2YF0 A;  2J0M A;  1DDM A;  4HAX B;  1MAI A;  2KUP A;  2D10 A;  1TJ6 A;  3UZT A;  2D11 A;  2W2X C;  1OQN A;  5HE0 A;  2M14 A;  2YS3 A;  2N0Y A;  4KVG B;  3HK0 A;  3O96 A;  1Y19 B;  1IRS A;  4WJ7 A;  1P3R A;  1I7A A;  5D3W A;  5DIF B;  2YVC A;  1TQZ A;  1WGU A;  2J0J A;  1NTY A;  1BAK A;  3CIK A;  5DI9 B;  3FSS A;  3GYP A;  2L2I A;  4HAT B;  4ZRJ A;  1GC6 A;  5KQ1 A;  1PLS A;  4IAP A;  2NMB A;  4A6F B;  4CHJ A;  2YSZ A;  1FAO A;  2N23 A;  5DHF B;  2KGX B;  2Z0P A;  1KZG A;  3PVU A;  1RRP B;  4HAU B;  4NY0 A;  3ULB A;  1U2B A;  5DH9 B;  4YON A;  1V89 A;  2P0D A;  1K5G B;  3PVW A;  3PSC A;  2GJY A;  1UNQ A;  4BBK A;  5FI0 A;  1H4R A;  1MK7 B;  3WYF B;  1FHO A;  2UZR A;  1ZC3 B;  1U5E A;  2DKP A;  1P6S A;  2ROV A;  1FHX A;  2GS0 A;  3X23 A;  2E2X A;  4HAZ B;  3D8D A;  2YRY A;  5D27 A;  5D3V A;  2IFS A;  2J0K A;  4C0A A;  1V5P A;  4KAX B;  1EAZ A;  3KRW A;  3PG7 A;  1WI1 A;  2R09 A;  4H8S A;  5L81 A;  3P7Z A;  2RGN B;  3LJU X;  1FGY A;  1Z87 A;  4GN1 A;  4MT7 A;  4CHM A;  4DXA B;  1WG7 A;  2DX5 A;  1DDV A;  3FM8 C;  4B6H A;  4GMV A;  2QKL A;  1RJ2 A;  4EMO A;  1PFJ A;  3V5W A;  3KRX A;  4HAV B;  2ELB A;  5C6R A;  1X1G A;  2ELA A;  3WA0 A;  2VKI A;  3OAN A;  3ML4 A;  1DRO A;  1V88 A;  5GOW B;  1MIX A;  2CAY A;  2OQB A;  1MIZ B;  1Y5O A;  2EJ8 A;  2LOX A;  5JHH A;  4IFS A;  1ZVR A;  3VOQ A;  2D9W A;  4HB3 B;  3N7C A;  2V76 A;  1P5T A;  5LOP B;  2K00 A;  1M7R A;  4DX9 0;  3P6A A;  2YS1 A;  2Y7B A;  5C5B A;  4GXB A;  2LOZ A;  1H10 A;  4K2P A;  4Z2N A;  2UZS A;  2Y8G A;  2ROZ B;  3D8E A;  1SHC A;  1Q67 A;  2DHJ A;  2LYD A;  2EMT A;  1EGX A;  2H7E A;  1QC6 A;  1EF1 A;  2EC1 A;  1XD4 A;  4K81 A;  2MDX A;  3AJ4 A;  3HW2 B;  1X86 A;  2COF A;  1UPR A;  3GYO A;  5J3T A;  2D2Q A;  1AWE A;  1SGH A;  2DKQ A;  3TO1 A;  4PQ0 A;  2CY4 A;  1FHW A;  4DX8 A;  4PNK A;  1DDW A;  4MY6 A;  4DBB A;  1BTK A;  5C79 A;  1J19 A;  2ADZ A;  4WSF A;  3SYX A;  3TCA A;  2JP2 A;  5HE2 A;  3CXB B;  2YT1 A;  2DN6 A;  3F5R A;  3D8F A;  1U29 A;  2DLW A;  5J3Y A;  2W2X D;  1U5G A;  5C5B B;  3ZDT A;  1K5D B;  3RCP A;  3BJI A;  2D9X A;  2X18 A;  2ZPY A;  4KHO A;  5C16 A;  3PZD A;  1GG3 A;  2AEH A;  1X11 A;  2L1C A;  4TKN A;  1PMS A;  1DYN A;  4A5K A;  2J59 M;  5JLJ B;  1WVH A;  3AU4 A;  4Y94 A;  1U27 A;  1X05 A;  4HAY B;  3U7D A;  2KCJ A;  3DXD A;  1FGZ A;  2COA A;  2CY5 A;  2COC A;  4F7G A;  2D9Z A;  2K2J A;  1N3H A;  1WJM A;  3KSY A;  3QWM A;  1J0W A;  1ZSQ A;  1GC7 A;  3ODW A;  4Z2M B;  1LB1 A;  2Y8F A;  3U8Z A;  1KI1 B;  4P7I A;  2DTC A;  3IVF A;  4ZRK A;  4XWX A;  3T06 A;  2I5F A;  2MWN B;  4D0N B;  1XR0 B;  3PP2 A;  5J3Q A;  4K17 A;  3G9W A;  3MPX A;  2P0H A;  5CLQ B;  2BCJ A;  4KHB B;  2RUK B;  1ZC4 B;  2LG1 A;  3KZ1 A;  2QKM A;  2I1K A;  5LON B;  1XOD A;  1XKE A;  5EFX A;  5HE3 A;  1FOE A;  3SNH A;  3QBV B;  2P8V A;  3FEH A;  2LUL A;  3A8Q A;  3A98 B;  4GMX B;  3AU5 A;  4KHA A;  4HHV A;  2PZ1 A;  4EJN A;  1ZM0 A;  2DYN A;  2P0F A;  4L6E A;  5FI1 A;  1E5W A;  4WVF B;  5D3X A;  2DA0 A;  1U5F A;  2Z0Q A;  1MK9 B;  2R0D A;  3VIA A;  2DHK A;  4HB4 B;  2DX1 A;  1AQC A;  2GCJ A;  2I1J A;  4HAW B;  2RSG A;  1XX0 A;  1WGQ A;  3SV1 A;  5DHA B;  2LKO A;  3TW1 A;  4F7H A;  1QQG A;  2VSZ A;  2RLO A;  2UVM A;  1M7E A;  1UNP A;  2Q13 A;  1WJ1 A;  2DYQ A;  2OTX A;  1MKE A;  2D9Y A;  2IYB A;  4EKU A;  1NI2 A;  2H7D A;  3NSU A;  3ODX A;  1B55 A;  2GCL A;  1XCG A;  2G35 A;  2W2W A;  2M38 A;  1V61 A;  2FJL A;  4GZU A;  2MKR A;  2MFQ A;  4K2O A;  4HB2 B;  3PEG A;  4A6K A;  1W1D A;  1OY2 A;  2HTH B;  4GPT B;  1DBH A;  2K2U A;  1OMW A;  4IOY X;  3SUZ A;  3F0W A;  5JHG A;  3ODO A;  2D9V A;  2EMS A;  2VRW B;  4CYE A;  2XQN M;  3KY9 A;  4NSW A;  3SO6 A;  1U5D A;  2CRF A;  1UPQ A;  2DFK A;  1BTN A;  1I2H A;  2COD A;  5KCV A;  3BIN A;  2YS5 A;  3TFM A;  3A8P A;  1FB8 A;  4HDQ A;  3DXC A;  2YT0 A;  2NZ8 B;  3PVL A;  2DHI A;  1W1G A;  1V5U A;  4MK0 A;  3MDB C;  5KQ4 A;  2AL6 A;  1BWN A;  2Z0O A;  1UEF A;  4A6H A;  1KZ7 A;  1NTV A;  1W1H A;  2D4Q A;  3TVV A;  2HE7 A;  2RVB B;  3HQC A;  5HE1 A;  4HDO A;  4HB0 B;  5JP4 A;  5D3Y A;  4ZRI A;  4F7U P;  3ZVR A;  2I5C A;  1UNR A;  1EVH A;  1ISN A;  1MPH A;  3QIJ A;  1LW3 A;  4YL8 A;  2RNR B;  1NU2 A;  3ULC A;  4A6F A;  5CLL B; 
#chains in the Genus database with same CATH topology
 1X1F A;  2Z13 A;  1V5M A;  1TXD A;  3DXE A;  4TYZ A;  3M1I B;  2YF0 A;  2J0M A;  1DDM A;  4HAX B;  1MAI A;  2KUP A;  2D10 A;  1TJ6 A;  3UZT A;  2D11 A;  2W2X C;  1OQN A;  5HE0 A;  2YS3 A;  2M14 A;  2K49 A;  2N0Y A;  4KVG B;  3HK0 A;  3O96 A;  1Y19 B;  1IRS A;  4WJ7 A;  1P3R A;  4QJ3 B;  1I7A A;  2YT2 A;  5D3W A;  5DIF B;  5LG4 B;  2YVC A;  1TQZ A;  1WGU A;  2J0J A;  1NTY A;  1BAK A;  3CIK A;  5DI9 B;  3FSS A;  4HSI A;  3GYP A;  2L2I A;  4HAT B;  4ZRJ A;  1GC6 A;  5KQ1 A;  1PLS A;  4QXA B;  4IAP A;  2NMB A;  4A6F B;  4CHJ A;  4CSQ A;  2YSZ A;  1FAO A;  2N23 A;  5DHF B;  2KGX B;  2Z0P A;  3HSA A;  1KZG A;  3PVU A;  1RRP B;  4HAU B;  4NY0 A;  3ULB A;  1U2B A;  5DH9 B;  4YON A;  5I2M A;  1V89 A;  2P0D A;  1K5G B;  5IRS A;  3PVW A;  3PSC A;  2GJY A;  1UNQ A;  4BBK A;  5FI0 A;  1H4R A;  1MK7 B;  3WYF B;  1FHO A;  2UZR A;  1ZC3 B;  2KR0 A;  1U5E A;  2DKP A;  2NBV A;  1P6S A;  2ROV A;  3FVC A;  1FHX A;  2GS0 A;  3X23 A;  2E2X A;  4HAZ B;  3D8D A;  2YRY A;  5D27 A;  2R2Y A;  5D3V A;  2IFS A;  4QJ5 B;  2J0K A;  3HIE A;  4C0A A;  1V5P A;  4KAX B;  1EAZ A;  3KRW A;  3PG7 A;  1WI1 A;  2R09 A;  4H8S A;  5L81 A;  2Z59 A;  2FJU B;  3P7Z A;  2RGN B;  3LJU X;  1FGY A;  1Z87 A;  4GN1 A;  3A58 A;  4MT7 A;  4CHM A;  4DXA B;  1WG7 A;  2DX5 A;  1DDV A;  3FM8 C;  4B6H A;  4GMV A;  2QKL A;  1RJ2 A;  4OSN A;  4EMO A;  1PFJ A;  3V5W A;  3KRX A;  4HAV B;  2ELB A;  5C6R A;  1MI1 A;  1X1G A;  2ELA A;  3WA0 A;  2VKI A;  2Z4D A;  3OAN A;  3ML4 A;  1DRO A;  1V88 A;  5GOW B;  4GOU A;  1MIX A;  2CAY A;  3OHM B;  2OQB A;  1MIZ B;  1Y5O A;  2EJ8 A;  2LOX A;  5JHH A;  4IFS A;  1ZVR A;  3VOQ A;  2D9W A;  4HB3 B;  3N7C A;  2V76 A;  1P5T A;  5LOP B;  2K00 A;  1M7R A;  2GUM A;  1ZYI A;  2RRF A;  3P6A A;  2YS1 A;  4DX9 0;  2Y7B A;  5C5B A;  4GXB A;  2LOZ A;  1H10 A;  4K2P A;  4Z2N A;  3D8E A;  2UZS A;  2Y8G A;  2ROZ B;  1SHC A;  4DIX A;  1Q67 A;  2DHJ A;  2LYD A;  2EMT A;  1EGX A;  2H7E A;  1QC6 A;  1EF1 A;  2EC1 A;  1XD4 A;  4K81 A;  2MDX A;  3AJ4 A;  3HW2 B;  1X86 A;  2COF A;  1UPR A;  3GYO A;  5J3T A;  2D2Q A;  1AWE A;  1SGH A;  2KUQ A;  2DKQ A;  3TO1 A;  4PQ0 A;  2CY4 A;  1FHW A;  4DX8 A;  4PNK A;  1DDW A;  4MY6 A;  4DBB A;  1BTK A;  5C79 A;  1J19 A;  2ADZ A;  4WSF A;  3SYX A;  3TCA A;  2JP2 A;  5HE2 A;  3CXB B;  2YT1 A;  2DN6 A;  3F5R A;  3D8F A;  1U29 A;  2DLW A;  5J3Y A;  2W2X D;  1U5G A;  5C5B B;  3ZDT A;  1K5D B;  3RCP A;  3BJI A;  2D9X A;  2X18 A;  2ZPY A;  4KHO A;  5C16 A;  3PZD A;  1GG3 A;  2AEH A;  1X11 A;  2L1C A;  4TKN A;  1PMS A;  1DYN A;  4KHB A;  4A5K A;  2J59 M;  5JLJ B;  1WVH A;  4QJ4 B;  3AU4 A;  4Y94 A;  1U27 A;  1X05 A;  4HAY B;  3U7D A;  2KCJ A;  3DXD A;  2K8E A;  1FGZ A;  2COA A;  2CY5 A;  2COC A;  4F7G A;  2D9Z A;  2K2J A;  4L1R A;  1N3H A;  1WJM A;  3KSY A;  3QWM A;  1J0W A;  1ZSQ A;  1GC7 A;  3ODW A;  4Z2M B;  1LB1 A;  2Y8F A;  3NWA A;  3U8Z A;  1KI1 B;  4P7I A;  4D6W A;  2DTC A;  3IVF A;  4ZRK A;  4XWX A;  3T06 A;  2I5F A;  2MWN B;  4D0N B;  1XR0 B;  3PP2 A;  5J3Q A;  4K17 A;  3G9W A;  3MPX A;  2P0H A;  5CLQ B;  2BCJ A;  4KHB B;  2RUK B;  1ZC4 B;  3NWF A;  2LG1 A;  3KZ1 A;  2QKM A;  2I1K A;  5LON B;  1XOD A;  1XKE A;  5EFX A;  5HE3 A;  1FOE A;  3SNH A;  3QBV B;  2P8V A;  3FEH A;  2LUL A;  3A8Q A;  3A98 B;  4GMX B;  3AU5 A;  4KHA A;  4HHV A;  2PZ1 A;  4EJN A;  1ZM0 A;  2DYN A;  2P0F A;  4L6E A;  5FI1 A;  1E5W A;  2Z14 A;  4WVF B;  5D3X A;  2DA0 A;  1U5F A;  2Z0Q A;  1MK9 B;  2R0D A;  3VIA A;  2DHK A;  4HB4 B;  2DX1 A;  1AQC A;  2GCJ A;  2I1J A;  4HAW B;  2RSG A;  1XX0 A;  1WGQ A;  3SV1 A;  3NW8 A;  5DHA B;  3B77 A;  2LKO A;  3TW1 A;  4F7H A;  1QQG A;  2VSZ A;  2RLO A;  2UVM A;  1M7E A;  1UNP A;  2Q13 A;  1WJ1 A;  2DYQ A;  2OTX A;  1MKE A;  2D9Y A;  2IYB A;  4EKU A;  1NI2 A;  2H7D A;  3NSU A;  3ODX A;  4OT1 A;  3NWD A;  1B55 A;  2GCL A;  2KIE A;  1XCG A;  2G35 A;  2W2W A;  2M38 A;  1V61 A;  2FJL A;  4GZU A;  2MKR A;  2MFQ A;  4K2O A;  4HB2 B;  3PEG A;  4A6K A;  1W1D A;  1OY2 A;  2HTH B;  4GPT B;  1DBH A;  2K2U A;  1OMW A;  4IOY X;  1T77 A;  2KIG A;  3SUZ A;  3F0W A;  5JHG A;  2D9V A;  2EMS A;  2VRW B;  3ODO A;  4CYE A;  2XQN M;  3KY9 A;  4NSW A;  3SO6 A;  1U5D A;  2CRF A;  1UPQ A;  2DFK A;  1BTN A;  1I2H A;  2COD A;  5KCV A;  3BIN A;  2YS5 A;  3TFM A;  3A8P A;  1FB8 A;  4HDQ A;  3DXC A;  2YT0 A;  2NZ8 B;  3PVL A;  2DHI A;  1W1G A;  1V5U A;  4MK0 A;  3MDB C;  5KQ4 A;  2AL6 A;  1BWN A;  2Z0O A;  1UEF A;  4A6H A;  5I2S A;  1KZ7 A;  1NTV A;  1W1H A;  2D4Q A;  3TVV A;  2HE7 A;  2RVB B;  3HQC A;  5HE1 A;  4HDO A;  4HB0 B;  5JP4 A;  5D3Y A;  4ZRI A;  4F7U P;  3ZVR A;  2I5C A;  1UNR A;  1EVH A;  1ISN A;  1MPH A;  3QIJ A;  3U12 A;  1LW3 A;  2ZKM X;  3DCX A;  4YL8 A;  4GNK B;  2RNR B;  1NU2 A;  3ULC A;  4A6F A;  5M4Y B;  5CLL B; 
#chains in the Genus database with same CATH homology
 1X1F A;  1V5M A;  1TXD A;  3DXE A;  4TYZ A;  3M1I B;  2YF0 A;  2J0M A;  1DDM A;  4HAX B;  1MAI A;  2KUP A;  2D10 A;  1TJ6 A;  3UZT A;  2D11 A;  2W2X C;  1OQN A;  5HE0 A;  2M14 A;  2YS3 A;  2N0Y A;  4KVG B;  3HK0 A;  3O96 A;  1Y19 B;  1IRS A;  4WJ7 A;  1P3R A;  1I7A A;  5D3W A;  5DIF B;  2YVC A;  1TQZ A;  1WGU A;  2J0J A;  1NTY A;  1BAK A;  3CIK A;  5DI9 B;  3FSS A;  3GYP A;  2L2I A;  4HAT B;  4ZRJ A;  1GC6 A;  5KQ1 A;  1PLS A;  4IAP A;  2NMB A;  4A6F B;  4CHJ A;  2YSZ A;  1FAO A;  2N23 A;  5DHF B;  2KGX B;  2Z0P A;  1KZG A;  3PVU A;  1RRP B;  4HAU B;  4NY0 A;  3ULB A;  1U2B A;  5DH9 B;  4YON A;  1V89 A;  2P0D A;  1K5G B;  3PVW A;  3PSC A;  2GJY A;  1UNQ A;  4BBK A;  5FI0 A;  1H4R A;  1MK7 B;  3WYF B;  1FHO A;  2UZR A;  1ZC3 B;  1U5E A;  2DKP A;  1P6S A;  2ROV A;  1FHX A;  2GS0 A;  3X23 A;  2E2X A;  4HAZ B;  3D8D A;  2YRY A;  5D27 A;  5D3V A;  2IFS A;  2J0K A;  4C0A A;  1V5P A;  4KAX B;  1EAZ A;  3KRW A;  3PG7 A;  1WI1 A;  2R09 A;  4H8S A;  5L81 A;  3P7Z A;  2RGN B;  3LJU X;  1FGY A;  1Z87 A;  4GN1 A;  4MT7 A;  4CHM A;  4DXA B;  1WG7 A;  2DX5 A;  1DDV A;  3FM8 C;  4B6H A;  4GMV A;  2QKL A;  1RJ2 A;  4EMO A;  1PFJ A;  3V5W A;  3KRX A;  4HAV B;  2ELB A;  5C6R A;  1X1G A;  2ELA A;  3WA0 A;  2VKI A;  3OAN A;  3ML4 A;  1DRO A;  1V88 A;  5GOW B;  1MIX A;  2CAY A;  2OQB A;  1MIZ B;  1Y5O A;  2EJ8 A;  2LOX A;  5JHH A;  4IFS A;  1ZVR A;  3VOQ A;  2D9W A;  4HB3 B;  3N7C A;  2V76 A;  1P5T A;  5LOP B;  2K00 A;  1M7R A;  4DX9 0;  3P6A A;  2YS1 A;  2Y7B A;  5C5B A;  4GXB A;  2LOZ A;  1H10 A;  4K2P A;  4Z2N A;  2UZS A;  2Y8G A;  2ROZ B;  3D8E A;  1SHC A;  1Q67 A;  2DHJ A;  2LYD A;  2EMT A;  1EGX A;  2H7E A;  1QC6 A;  1EF1 A;  2EC1 A;  1XD4 A;  4K81 A;  2MDX A;  3AJ4 A;  3HW2 B;  1X86 A;  2COF A;  1UPR A;  3GYO A;  5J3T A;  2D2Q A;  1AWE A;  1SGH A;  2DKQ A;  3TO1 A;  4PQ0 A;  2CY4 A;  1FHW A;  4DX8 A;  4PNK A;  1DDW A;  4MY6 A;  4DBB A;  1BTK A;  5C79 A;  1J19 A;  2ADZ A;  4WSF A;  3SYX A;  3TCA A;  2JP2 A;  5HE2 A;  3CXB B;  2YT1 A;  2DN6 A;  3F5R A;  3D8F A;  1U29 A;  2DLW A;  5J3Y A;  2W2X D;  1U5G A;  5C5B B;  3ZDT A;  1K5D B;  3RCP A;  3BJI A;  2D9X A;  2X18 A;  2ZPY A;  4KHO A;  5C16 A;  3PZD A;  1GG3 A;  2AEH A;  1X11 A;  2L1C A;  4TKN A;  1PMS A;  1DYN A;  4A5K A;  2J59 M;  5JLJ B;  1WVH A;  3AU4 A;  4Y94 A;  1U27 A;  1X05 A;  4HAY B;  3U7D A;  2KCJ A;  3DXD A;  1FGZ A;  2COA A;  2CY5 A;  2COC A;  4F7G A;  2D9Z A;  2K2J A;  1N3H A;  1WJM A;  3KSY A;  3QWM A;  1J0W A;  1ZSQ A;  1GC7 A;  3ODW A;  4Z2M B;  1LB1 A;  2Y8F A;  3U8Z A;  1KI1 B;  4P7I A;  2DTC A;  3IVF A;  4ZRK A;  4XWX A;  3T06 A;  2I5F A;  2MWN B;  4D0N B;  1XR0 B;  3PP2 A;  5J3Q A;  4K17 A;  3G9W A;  3MPX A;  2P0H A;  5CLQ B;  2BCJ A;  4KHB B;  2RUK B;  1ZC4 B;  2LG1 A;  3KZ1 A;  2QKM A;  2I1K A;  5LON B;  1XOD A;  1XKE A;  5EFX A;  5HE3 A;  1FOE A;  3SNH A;  3QBV B;  2P8V A;  3FEH A;  2LUL A;  3A8Q A;  3A98 B;  4GMX B;  3AU5 A;  4KHA A;  4HHV A;  2PZ1 A;  4EJN A;  1ZM0 A;  2DYN A;  2P0F A;  4L6E A;  5FI1 A;  1E5W A;  4WVF B;  5D3X A;  2DA0 A;  1U5F A;  2Z0Q A;  1MK9 B;  2R0D A;  3VIA A;  2DHK A;  4HB4 B;  2DX1 A;  1AQC A;  2GCJ A;  2I1J A;  4HAW B;  2RSG A;  1XX0 A;  1WGQ A;  3SV1 A;  5DHA B;  2LKO A;  3TW1 A;  4F7H A;  1QQG A;  2VSZ A;  2RLO A;  2UVM A;  1M7E A;  1UNP A;  2Q13 A;  1WJ1 A;  2DYQ A;  2OTX A;  1MKE A;  2D9Y A;  2IYB A;  4EKU A;  1NI2 A;  2H7D A;  3NSU A;  3ODX A;  1B55 A;  2GCL A;  1XCG A;  2G35 A;  2W2W A;  2M38 A;  1V61 A;  2FJL A;  4GZU A;  2MKR A;  2MFQ A;  4K2O A;  4HB2 B;  3PEG A;  4A6K A;  1W1D A;  1OY2 A;  2HTH B;  4GPT B;  1DBH A;  2K2U A;  1OMW A;  4IOY X;  3SUZ A;  3F0W A;  5JHG A;  3ODO A;  2D9V A;  2EMS A;  2VRW B;  4CYE A;  2XQN M;  3KY9 A;  4NSW A;  3SO6 A;  1U5D A;  2CRF A;  1UPQ A;  2DFK A;  1BTN A;  1I2H A;  2COD A;  5KCV A;  3BIN A;  2YS5 A;  3TFM A;  3A8P A;  1FB8 A;  4HDQ A;  3DXC A;  2YT0 A;  2NZ8 B;  3PVL A;  2DHI A;  1W1G A;  1V5U A;  4MK0 A;  3MDB C;  5KQ4 A;  2AL6 A;  1BWN A;  2Z0O A;  1UEF A;  4A6H A;  1KZ7 A;  1NTV A;  1W1H A;  2D4Q A;  3TVV A;  2HE7 A;  2RVB B;  3HQC A;  5HE1 A;  4HDO A;  4HB0 B;  5JP4 A;  5D3Y A;  4ZRI A;  4F7U P;  3ZVR A;  2I5C A;  1UNR A;  1EVH A;  1ISN A;  1MPH A;  3QIJ A;  1LW3 A;  4YL8 A;  2RNR B;  1NU2 A;  3ULC A;  4A6F A;  5CLL B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...