2KUPA

Solution structure of the complex of the ptb domain of snt-2 and 19-residue peptide (aa 1571-1589) of halk
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
146
structure length
146
Chain Sequence
GSSGSSGLNRDSVPDNHPTKFKVTNVDDEGVELGSGVMELTQSELVLHLHRREAVRWPYLCLRRYGYDSNLFSFESGRRCQTGQGIFAFKCSRAEEIFNLLQDLMQCNSINVMEEPVIITRNSHPAELDLPRAPQPPNALGYTVSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fibroblast growth factor receptor substrate 3
publication title Structural basis for the recognition of nucleophosmin-anaplastic lymphoma kinase oncoprotein by the phosphotyrosine binding domain of Suc1-associated neurotrophic factor-induced tyrosine-phosphorylated target-2
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein/oncoprotein
total genus 21
structure length 146
sequence length 146
ec nomenclature
pdb deposition date 2010-02-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02174 IRS PTB domain (IRS-1 type)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2kupA01
2Y8GA 4TKNA 2VRWB 3ULCA 2KGXB 2DYNA 1ZC3B 1MK9B 1FHWA 4F7GA 1PFJA 3ULBA 1UPRA 4A5KA 2MKRA 2W2XD 1NTVA 5FI1A 2EC1A 1XD4A 1M7EA 2H7DA 3FSSA 2KUPA 3P7ZA 2D9ZA 3TW1A 2CRFA 2YS1A 4ZRKA 2ZPYA 5J3YA 1SHCA 2D9WA 3NSUA 3GYOA 3WA0A 1P3RA 1U5DA 2I1JA 1Q67A 2MFQA 2BCJA 2PZ1A 4Z2NA 1EF1A 1V5UA 1FB8A 4CYEA 2ELBA 2LYDA 1X05A 1WGQA 5KQ1A 3D8DA 4HDQA 2EJ8A 3RCPA 1ZM0A 4HB2B 1DBHA 2VKIA 1WVHA 3KZ1A 3TVVA 1J0WA 2GS0A 3FEHA 5C5BA 5EFXA 3P6AA 4IAPA 1TXDA 2I5FA 1IRSA 4GMVA 1PMSA 2RGNB 2CODA 1P5TA 4DX90 4YL8A 3ODXA 2KCJA 1FAOA 2DHIA 1W1HA 4NSWA 1WJMA 1Y19B 1K5DB 2L2IA 5GOWB 1U27A 2D9VA 2N23A 3AU5A 3TCAA 4HAWB 1W1DA 3CXBB 1H10A 1XKEA 4MK0A 1WG7A 2DTCA 4GN1A 1BWNA 4HAVB 1QQGA 1OMWA 4CHJA 1FOEA 2LOXA 2Z0OA 5JHGA 2D9YA 2M14A 2UZRA 1TQZA 5L81A 4L6EA 2ELAA 1XR0B 2COAA 3PVWA 3HW2B 2DKPA 3VOQA 2Y7BA 4A6FB 1M7RA 5JLJB 5J3TA 1X11A 4WJ7A 1X1GA 3U7DA 2DLWA 3V5WA 2D10A 4HAUB 2FJLA 1LB1A 2DKQA 3DXCA 3MDBC 3F5RA 4HAZB 3LJUX 1ZVRA 3F0WA 5DH9B 1KI1B 3PVUA 2D4QA 3WYFB 4B6HA 2QKMA 3AU4A 2J0MA 4HATB 3KY9A 5JHHA 2DFKA 2R0DA 1MIZB 2P0DA 3HK0A 1U2BA 2LKOA 4HAXB 2GCLA 1MK7B 3M1IB 2W2WA 1I7AA 4ZRJA 4ZRIA 4HAYB 2COFA 2DA0A 2MWNB 5LONB 4WSFA 1XCGA 2J0JA 2DX5A 1U29A 1UNPA 4HHVA 1DDMA 4BBKA 2CY5A 1DROA 2ROVA 2P0HA 2K00A 1DYNA 5D3XA 4KHOA 2I5CA 1PLSA 2W2XC 1MPHA 1W1GA 5DIFB 2GJYA 4H8SA 4C0AA 1GG3A 2L1CA 3QIJA 4DX8A 1AWEA 1SGHA 3DXDA 1WI1A 5DHAB 2NZ8B 4K81A 1V88A 5HE0A 2NMBA 4PNKA 3PEGA 5D3VA 4IFSA 5JP4A 1Y5OA 1WJ1A 3SV1A 2M38A 2DHJA 3ODOA 4DXAB 1E5WA 2UVMA 1QC6A 2ADZA 1K5GB 2Z0QA 5D3WA 2DHKA 5KCVA 1EVHA 3IVFA 5HE2A 2X18A 1DDWA 3GYPA 2YT0A 4KHAA 3D8FA 5HE1A 3HQCA 2YVCA 2YS5A 1AQCA 2HTHB 5C16A 4HB3B 3VIAA 4KAXB 1H4RA 4Z2MB 1FGZA 2DX1A 2YS3A 3AJ4A 2Z0PA 4GZUA 4XWXA 1KZGA 1KZ7A 1ZSQA 5D27A 2D2QA 1Z87A 1UNRA 2YSZA 1MKEA 3PZDA 2OTXA 3BJIA 3QWMA 3UZTA 2RNRB 1X1FA 3QBVB 2H7EA 2K2JA 1B55A 2LOZA 1EAZA 1GC6A 3DXEA 1XX0A 2D9XA 5J3QA 4KVGB 2UZSA 2K2UA 2AEHA 1BAKA 5C79A 2EMTA 2LG1A 4A6FA 1FHXA 4K17A 4HDOA 5KQ4A 2P0FA 1UNQA 1FGYA 1UEFA 3SUZA 5CLLB 4PQ0A 4EMOA 2P8VA 5D3YA 1BTNA 1MAIA 5DI9B 2OQBA 1N3HA 3PP2A 3N7CA 2RUKB 3SO6A 1RRPB 1UPQA 2RVBB 2E2XA 1FHOA 4F7HA 3O96A 3A98B 2R09A 5CLQB 5C5BB 4WVFB 2DN6A 1I2HA 4K2OA 2DYQA 1U5EA 2HE7A 4HB0B 1BTKA 5DHFB 1LW3A 2JP2A 3MPXA 1DDVA 4GPTB 4MY6A 4IOYX 3PVLA 4F7UP 4Y94A 4EJNA 2IYBA 2Q13A 4K2PA 4KHBB 4HB4B 1NTYA 1V5PA 1NU2A 3ZVRA 1P6SA 1V5MA 2QKLA 1OQNA 1NI2A 2MDXA 2COCA 1U5GA 2IFSA 3PSCA 3TO1A 4A6HA 3A8QA 2RLOA 3FM8C 1ZC4B 1WGUA 2J59M 3KRXA 5C6RA 3TFMA 1U5FA 2YT1A 1J19A 3X23A 3ODWA 2V76A 2YF0A 1ISNA 3U8ZA 2YRYA 4A6KA 4NY0A 4D0NB 1V89A 2ROZB 2N0YA 1OY2A 5FI0A 2G35A 3G9WA 3SNHA 3KRWA 5LOPB 4EKUA 2LULA 2D11A 3ZDTA 2AL6A 4MT7A 3PG7A 1RJ2A 1EGXA 3ML4A 3BINA 3OANA 1MIXA 2Y8FA 2J0KA 4YONA 3CIKA 2GCJA 4GXBA 1V61A 3SYXA 1X86A 1XODA 1GC7A 2EMSA 2XQNM 3KSYA 2RSGA 1TJ6A 2CAYA 2CY4A 3T06A 4DBBA 3A8PA 5HE3A 4TYZA 3D8EA 4GMXB 4CHMA 4P7IA 2I1KA 2VSZA
chains in the Genus database with same CATH superfamily
2Y8GA 4TKNA 2VRWB 3ULCA 2KGXB 2RRFA 2DYNA 1ZC3B 1MK9B 1FHWA 4F7GA 1PFJA 3ULBA 1UPRA 3NWDA 4A5KA 2MKRA 5I2MA 2W2XD 1NTVA 5FI1A 2EC1A 3NWFA 1XD4A 1M7EA 2H7DA 3FSSA 2KUPA 3P7ZA 2D9ZA 3TW1A 5IRSA 2CRFA 2YS1A 4ZRKA 2ZPYA 5J3YA 1SHCA 2D9WA 3NSUA 3GYOA 3WA0A 1P3RA 1U5DA 2I1JA 1Q67A 2MFQA 3HIEA 2BCJA 2PZ1A 4Z2NA 1EF1A 1V5UA 1FB8A 4HSIA 4CYEA 2ELBA 2LYDA 1X05A 1WGQA 5KQ1A 3D8DA 4HDQA 2EJ8A 2KIEA 3RCPA 1ZM0A 4HB2B 1DBHA 2VKIA 1WVHA 3KZ1A 3TVVA 1J0WA 2GS0A 3FEHA 5C5BA 5EFXA 3P6AA 4IAPA 1TXDA 2I5FA 1IRSA 3HSAA 2ZKMX 4GMVA 1PMSA 2R2YA 2RGNB 2CODA 1P5TA 2Z4DA 4DX90 4YL8A 3ODXA 2KCJA 1FAOA 2DHIA 4KHBA 1W1HA 4NSWA 1WJMA 1Y19B 1K5DB 2L2IA 5GOWB 5LG4B 1U27A 2D9VA 2N23A 5I2SA 3AU5A 3TCAA 4HAWB 1W1DA 3CXBB 1H10A 1XKEA 4MK0A 1WG7A 2DTCA 4GN1A 1BWNA 4HAVB 1QQGA 1OMWA 4CHJA 1FOEA 2LOXA 2Z0OA 5JHGA 2D9YA 2M14A 2UZRA 1TQZA 5L81A 4L6EA 2KR0A 2ELAA 1XR0B 2COAA 3PVWA 3HW2B 2DKPA 3VOQA 2Y7BA 4A6FB 1M7RA 5JLJB 3A58A 5J3TA 1X11A 4WJ7A 1X1GA 3U7DA 2DLWA 4GNKB 3V5WA 2D10A 3FVCA 4HAUB 2FJLA 1LB1A 2DKQA 3DXCA 3MDBC 4OSNA 1T77A 3F5RA 4HAZB 3LJUX 1ZVRA 3F0WA 5DH9B 1KI1B 3PVUA 2D4QA 3WYFB 4B6HA 2QKMA 3AU4A 2J0MA 4HATB 2K49A 3KY9A 5JHHA 2DFKA 2R0DA 1MIZB 2P0DA 3HK0A 1U2BA 2LKOA 4HAXB 2GCLA 1MK7B 3M1IB 2W2WA 1I7AA 4ZRJA 4ZRIA 4HAYB 2COFA 2DA0A 2MWNB 5LONB 4WSFA 1XCGA 2J0JA 2DX5A 1U29A 1UNPA 4HHVA 1DDMA 4BBKA 2CY5A 1DROA 2ROVA 2P0HA 2K00A 1DYNA 5D3XA 4KHOA 2I5CA 1PLSA 2W2XC 1MPHA 1W1GA 5DIFB 2GJYA 4H8SA 4C0AA 1GG3A 2L1CA 3QIJA 4DX8A 1AWEA 1SGHA 3DXDA 1WI1A 5DHAB 2NZ8B 4K81A 1V88A 5HE0A 2NMBA 4PNKA 3PEGA 5D3VA 4IFSA 5JP4A 1Y5OA 1WJ1A 3SV1A 2M38A 2DHJA 1MI1A 3ODOA 4DXAB 1E5WA 2UVMA 1QC6A 2ADZA 1K5GB 2Z0QA 5D3WA 2DHKA 5KCVA 1EVHA 3IVFA 5HE2A 2X18A 1DDWA 3GYPA 2YT0A 4KHAA 3D8FA 5HE1A 3HQCA 2YVCA 2YS5A 1AQCA 2HTHB 5C16A 4HB3B 3VIAA 4KAXB 1H4RA 4Z2MB 1FGZA 2DX1A 2YS3A 3AJ4A 2Z0PA 4GZUA 4XWXA 1KZGA 1KZ7A 1ZSQA 5D27A 2D2QA 1Z87A 3B77A 1UNRA 4QXAB 5M4YB 2YSZA 1MKEA 3PZDA 2OTXA 4GOUA 3BJIA 3QWMA 3UZTA 2RNRB 1X1FA 3QBVB 4OT1A 2H7EA 2K2JA 1B55A 2LOZA 1EAZA 1GC6A 3DXEA 1XX0A 2D9XA 5J3QA 4KVGB 2UZSA 2K2UA 2AEHA 1BAKA 2Z13A 5C79A 2EMTA 2LG1A 4A6FA 1FHXA 4K17A 4HDOA 5KQ4A 2P0FA 1UNQA 3OHMB 1FGYA 1UEFA 4QJ5B 3SUZA 5CLLB 4PQ0A 4EMOA 2P8VA 5D3YA 1BTNA 1MAIA 5DI9B 2OQBA 1N3HA 3PP2A 3N7CA 3NW8A 2RUKB 3SO6A 1RRPB 1UPQA 2RVBB 2E2XA 1FHOA 4F7HA 3A98B 3O96A 2GUMA 2R09A 5CLQB 5C5BB 4WVFB 2DN6A 1I2HA 4K2OA 4L1RA 2DYQA 1U5EA 2HE7A 4HB0B 1BTKA 4CSQA 5DHFB 1LW3A 2JP2A 1ZYIA 4DIXA 3MPXA 1DDVA 4GPTB 4MY6A 4IOYX 3PVLA 4F7UP 2K8EA 4Y94A 2IYBA 2Q13A 4K2PA 4KHBB 4HB4B 4EJNA 1NTYA 3U12A 1V5PA 2NBVA 1NU2A 3ZVRA 1P6SA 1V5MA 2QKLA 1OQNA 1NI2A 2KUQA 2MDXA 2COCA 1U5GA 2IFSA 3PSCA 3TO1A 4A6HA 3A8QA 2RLOA 3FM8C 1ZC4B 1WGUA 2J59M 3KRXA 4QJ4B 5C6RA 3TFMA 1U5FA 2YT1A 1J19A 3DCXA 3X23A 4D6WA 3ODWA 2V76A 2YF0A 1ISNA 3U8ZA 2YRYA 4A6KA 4NY0A 4D0NB 1V89A 2ROZB 2N0YA 1OY2A 5FI0A 2G35A 2Z14A 3G9WA 3SNHA 3KRWA 4QJ3B 5LOPB 4EKUA 2LULA 2D11A 3ZDTA 2AL6A 4MT7A 3PG7A 1RJ2A 1EGXA 3ML4A 3NWAA 3BINA 3OANA 1MIXA 2Y8FA 2J0KA 4YONA 3CIKA 2GCJA 4GXBA 1V61A 3SYXA 1X86A 1XODA 1GC7A 2EMSA 2XQNM 2Z59A 3KSYA 2KIGA 2YT2A 2RSGA 1TJ6A 2CAYA 2CY4A 3T06A 4DBBA 3A8PA 5HE3A 4TYZA 3D8EA 4GMXB 4CHMA 2FJUB 4P7IA 2I1KA 2VSZA
chains in the Genus database with same CATH topology
2Y8GA 4TKNA 2VRWB 3ULCA 2KGXB 2DYNA 1ZC3B 1MK9B 1FHWA 4F7GA 1PFJA 3ULBA 1UPRA 4A5KA 2MKRA 2W2XD 1NTVA 5FI1A 2EC1A 1XD4A 1M7EA 2H7DA 3FSSA 2KUPA 3P7ZA 2D9ZA 3TW1A 2CRFA 2YS1A 4ZRKA 2ZPYA 5J3YA 1SHCA 2D9WA 3NSUA 3GYOA 3WA0A 1P3RA 1U5DA 2I1JA 1Q67A 2MFQA 2BCJA 2PZ1A 4Z2NA 1EF1A 1V5UA 1FB8A 4CYEA 2ELBA 2LYDA 1X05A 1WGQA 5KQ1A 3D8DA 4HDQA 2EJ8A 3RCPA 1ZM0A 4HB2B 1DBHA 2VKIA 1WVHA 3KZ1A 3TVVA 1J0WA 2GS0A 3FEHA 5C5BA 5EFXA 3P6AA 4IAPA 1TXDA 2I5FA 1IRSA 4GMVA 1PMSA 2RGNB 2CODA 1P5TA 4DX90 4YL8A 3ODXA 2KCJA 1FAOA 2DHIA 1W1HA 4NSWA 1WJMA 1Y19B 1K5DB 2L2IA 5GOWB 1U27A 2D9VA 2N23A 3AU5A 3TCAA 4HAWB 1W1DA 3CXBB 1H10A 1XKEA 4MK0A 1WG7A 2DTCA 4GN1A 1BWNA 4HAVB 1QQGA 1OMWA 4CHJA 1FOEA 2LOXA 2Z0OA 5JHGA 2D9YA 2M14A 2UZRA 1TQZA 5L81A 4L6EA 2ELAA 1XR0B 2COAA 3PVWA 3HW2B 2DKPA 3VOQA 2Y7BA 4A6FB 1M7RA 5JLJB 5J3TA 1X11A 4WJ7A 1X1GA 3U7DA 2DLWA 3V5WA 2D10A 4HAUB 2FJLA 1LB1A 2DKQA 3DXCA 3MDBC 3F5RA 4HAZB 3LJUX 1ZVRA 3F0WA 5DH9B 1KI1B 3PVUA 2D4QA 3WYFB 4B6HA 2QKMA 3AU4A 2J0MA 4HATB 3KY9A 5JHHA 2DFKA 2R0DA 1MIZB 2P0DA 3HK0A 1U2BA 2LKOA 4HAXB 2GCLA 1MK7B 3M1IB 2W2WA 1I7AA 4ZRJA 4ZRIA 4HAYB 2COFA 2DA0A 2MWNB 5LONB 4WSFA 1XCGA 2J0JA 2DX5A 1U29A 1UNPA 4HHVA 1DDMA 4BBKA 2CY5A 1DROA 2ROVA 2P0HA 2K00A 1DYNA 5D3XA 4KHOA 2I5CA 1PLSA 2W2XC 1MPHA 1W1GA 5DIFB 2GJYA 4H8SA 4C0AA 1GG3A 2L1CA 3QIJA 4DX8A 1AWEA 1SGHA 3DXDA 1WI1A 5DHAB 2NZ8B 4K81A 1V88A 5HE0A 2NMBA 4PNKA 3PEGA 5D3VA 4IFSA 5JP4A 1Y5OA 1WJ1A 3SV1A 2M38A 2DHJA 3ODOA 4DXAB 1E5WA 2UVMA 1QC6A 2ADZA 1K5GB 2Z0QA 5D3WA 2DHKA 5KCVA 1EVHA 3IVFA 5HE2A 2X18A 1DDWA 3GYPA 2YT0A 4KHAA 3D8FA 5HE1A 3HQCA 2YVCA 2YS5A 1AQCA 2HTHB 5C16A 4HB3B 3VIAA 4KAXB 1H4RA 4Z2MB 1FGZA 2DX1A 2YS3A 3AJ4A 2Z0PA 4GZUA 4XWXA 1KZGA 1KZ7A 1ZSQA 5D27A 2D2QA 1Z87A 1UNRA 2YSZA 1MKEA 3PZDA 2OTXA 3BJIA 3QWMA 3UZTA 2RNRB 1X1FA 3QBVB 2H7EA 2K2JA 1B55A 2LOZA 1EAZA 1GC6A 3DXEA 1XX0A 2D9XA 5J3QA 4KVGB 2UZSA 2K2UA 2AEHA 1BAKA 5C79A 2EMTA 2LG1A 4A6FA 1FHXA 4K17A 4HDOA 5KQ4A 2P0FA 1UNQA 1FGYA 1UEFA 3SUZA 5CLLB 4PQ0A 4EMOA 2P8VA 5D3YA 1BTNA 1MAIA 5DI9B 2OQBA 1N3HA 3PP2A 3N7CA 2RUKB 3SO6A 1RRPB 1UPQA 2RVBB 2E2XA 1FHOA 4F7HA 3O96A 3A98B 2R09A 5CLQB 5C5BB 4WVFB 2DN6A 1I2HA 4K2OA 2DYQA 1U5EA 2HE7A 4HB0B 1BTKA 5DHFB 1LW3A 2JP2A 3MPXA 1DDVA 4GPTB 4MY6A 4IOYX 3PVLA 4F7UP 4Y94A 4EJNA 2IYBA 2Q13A 4K2PA 4KHBB 4HB4B 1NTYA 1V5PA 1NU2A 3ZVRA 1P6SA 1V5MA 2QKLA 1OQNA 1NI2A 2MDXA 2COCA 1U5GA 2IFSA 3PSCA 3TO1A 4A6HA 3A8QA 2RLOA 3FM8C 1ZC4B 1WGUA 2J59M 3KRXA 5C6RA 3TFMA 1U5FA 2YT1A 1J19A 3X23A 3ODWA 2V76A 2YF0A 1ISNA 3U8ZA 2YRYA 4A6KA 4NY0A 4D0NB 1V89A 2ROZB 2N0YA 1OY2A 5FI0A 2G35A 3G9WA 3SNHA 3KRWA 5LOPB 4EKUA 2LULA 2D11A 3ZDTA 2AL6A 4MT7A 3PG7A 1RJ2A 1EGXA 3ML4A 3BINA 3OANA 1MIXA 2Y8FA 2J0KA 4YONA 3CIKA 2GCJA 4GXBA 1V61A 3SYXA 1X86A 1XODA 1GC7A 2EMSA 2XQNM 3KSYA 2RSGA 1TJ6A 2CAYA 2CY4A 3T06A 4DBBA 3A8PA 5HE3A 4TYZA 3D8EA 4GMXB 4CHMA 4P7IA 2I1KA 2VSZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Y8G A;  4TKN A;  2VRW B;  3ULC A;  2KGX B;  2DYN A;  1ZC3 B;  1MK9 B;  1FHW A;  4F7G A;  1PFJ A;  3ULB A;  1UPR A;  4A5K A;  2MKR A;  2W2X D;  1NTV A;  5FI1 A;  2EC1 A;  1XD4 A;  1M7E A;  2H7D A;  3FSS A;  2KUP A;  3P7Z A;  2D9Z A;  3TW1 A;  2CRF A;  2YS1 A;  4ZRK A;  2ZPY A;  5J3Y A;  1SHC A;  2D9W A;  3NSU A;  3GYO A;  3WA0 A;  1P3R A;  1U5D A;  2I1J A;  1Q67 A;  2MFQ A;  2BCJ A;  2PZ1 A;  4Z2N A;  1EF1 A;  1V5U A;  1FB8 A;  4CYE A;  2ELB A;  2LYD A;  1X05 A;  1WGQ A;  5KQ1 A;  3D8D A;  4HDQ A;  2EJ8 A;  3RCP A;  1ZM0 A;  4HB2 B;  1DBH A;  2VKI A;  1WVH A;  3KZ1 A;  3TVV A;  1J0W A;  2GS0 A;  3FEH A;  5C5B A;  5EFX A;  3P6A A;  4IAP A;  1TXD A;  2I5F A;  1IRS A;  4GMV A;  1PMS A;  2RGN B;  2COD A;  1P5T A;  4DX9 0;  4YL8 A;  3ODX A;  2KCJ A;  1FAO A;  2DHI A;  1W1H A;  4NSW A;  1WJM A;  1Y19 B;  1K5D B;  2L2I A;  5GOW B;  1U27 A;  2D9V A;  2N23 A;  3AU5 A;  3TCA A;  4HAW B;  1W1D A;  3CXB B;  1H10 A;  1XKE A;  4MK0 A;  1WG7 A;  2DTC A;  4GN1 A;  1BWN A;  4HAV B;  1QQG A;  1OMW A;  4CHJ A;  1FOE A;  2LOX A;  2Z0O A;  5JHG A;  2D9Y A;  2M14 A;  2UZR A;  1TQZ A;  5L81 A;  4L6E A;  2ELA A;  1XR0 B;  2COA A;  3PVW A;  3HW2 B;  2DKP A;  3VOQ A;  2Y7B A;  4A6F B;  1M7R A;  5JLJ B;  5J3T A;  1X11 A;  4WJ7 A;  1X1G A;  3U7D A;  2DLW A;  3V5W A;  2D10 A;  4HAU B;  2FJL A;  1LB1 A;  2DKQ A;  3DXC A;  3MDB C;  3F5R A;  4HAZ B;  3LJU X;  1ZVR A;  3F0W A;  5DH9 B;  1KI1 B;  3PVU A;  2D4Q A;  3WYF B;  4B6H A;  2QKM A;  3AU4 A;  2J0M A;  4HAT B;  3KY9 A;  5JHH A;  2DFK A;  2R0D A;  1MIZ B;  2P0D A;  3HK0 A;  1U2B A;  2LKO A;  4HAX B;  2GCL A;  1MK7 B;  3M1I B;  2W2W A;  1I7A A;  4ZRJ A;  4ZRI A;  4HAY B;  2COF A;  2DA0 A;  2MWN B;  5LON B;  4WSF A;  1XCG A;  2J0J A;  2DX5 A;  1U29 A;  1UNP A;  4HHV A;  1DDM A;  4BBK A;  2CY5 A;  1DRO A;  2ROV A;  2P0H A;  2K00 A;  1DYN A;  5D3X A;  4KHO A;  2I5C A;  1PLS A;  2W2X C;  1MPH A;  1W1G A;  5DIF B;  2GJY A;  4H8S A;  4C0A A;  1GG3 A;  2L1C A;  3QIJ A;  4DX8 A;  1AWE A;  1SGH A;  3DXD A;  1WI1 A;  5DHA B;  2NZ8 B;  4K81 A;  1V88 A;  5HE0 A;  2NMB A;  4PNK A;  3PEG A;  5D3V A;  4IFS A;  5JP4 A;  1Y5O A;  1WJ1 A;  3SV1 A;  2M38 A;  2DHJ A;  3ODO A;  4DXA B;  1E5W A;  2UVM A;  1QC6 A;  2ADZ A;  1K5G B;  2Z0Q A;  5D3W A;  2DHK A;  5KCV A;  1EVH A;  3IVF A;  5HE2 A;  2X18 A;  1DDW A;  3GYP A;  2YT0 A;  4KHA A;  3D8F A;  5HE1 A;  3HQC A;  2YVC A;  2YS5 A;  1AQC A;  2HTH B;  5C16 A;  4HB3 B;  3VIA A;  4KAX B;  1H4R A;  4Z2M B;  1FGZ A;  2DX1 A;  2YS3 A;  3AJ4 A;  2Z0P A;  4GZU A;  4XWX A;  1KZG A;  1KZ7 A;  1ZSQ A;  5D27 A;  2D2Q A;  1Z87 A;  1UNR A;  2YSZ A;  1MKE A;  3PZD A;  2OTX A;  3BJI A;  3QWM A;  3UZT A;  2RNR B;  1X1F A;  3QBV B;  2H7E A;  2K2J A;  1B55 A;  2LOZ A;  1EAZ A;  1GC6 A;  3DXE A;  1XX0 A;  2D9X A;  5J3Q A;  4KVG B;  2UZS A;  2K2U A;  2AEH A;  1BAK A;  5C79 A;  2EMT A;  2LG1 A;  4A6F A;  1FHX A;  4K17 A;  4HDO A;  5KQ4 A;  2P0F A;  1UNQ A;  1FGY A;  1UEF A;  3SUZ A;  5CLL B;  4PQ0 A;  4EMO A;  2P8V A;  5D3Y A;  1BTN A;  1MAI A;  5DI9 B;  2OQB A;  1N3H A;  3PP2 A;  3N7C A;  2RUK B;  3SO6 A;  1RRP B;  1UPQ A;  2RVB B;  2E2X A;  1FHO A;  4F7H A;  3O96 A;  3A98 B;  2R09 A;  5CLQ B;  5C5B B;  4WVF B;  2DN6 A;  1I2H A;  4K2O A;  2DYQ A;  1U5E A;  2HE7 A;  4HB0 B;  1BTK A;  5DHF B;  1LW3 A;  2JP2 A;  3MPX A;  1DDV A;  4GPT B;  4MY6 A;  4IOY X;  3PVL A;  4F7U P;  4Y94 A;  4EJN A;  2IYB A;  2Q13 A;  4K2P A;  4KHB B;  4HB4 B;  1NTY A;  1V5P A;  1NU2 A;  3ZVR A;  1P6S A;  1V5M A;  2QKL A;  1OQN A;  1NI2 A;  2MDX A;  2COC A;  1U5G A;  2IFS A;  3PSC A;  3TO1 A;  4A6H A;  3A8Q A;  2RLO A;  3FM8 C;  1ZC4 B;  1WGU A;  2J59 M;  3KRX A;  5C6R A;  3TFM A;  1U5F A;  2YT1 A;  1J19 A;  3X23 A;  3ODW A;  2V76 A;  2YF0 A;  1ISN A;  3U8Z A;  2YRY A;  4A6K A;  4NY0 A;  4D0N B;  1V89 A;  2ROZ B;  2N0Y A;  1OY2 A;  5FI0 A;  2G35 A;  3G9W A;  3SNH A;  3KRW A;  5LOP B;  4EKU A;  2LUL A;  2D11 A;  3ZDT A;  2AL6 A;  4MT7 A;  3PG7 A;  1RJ2 A;  1EGX A;  3ML4 A;  3BIN A;  3OAN A;  1MIX A;  2Y8F A;  2J0K A;  4YON A;  3CIK A;  2GCJ A;  4GXB A;  1V61 A;  3SYX A;  1X86 A;  1XOD A;  1GC7 A;  2EMS A;  2XQN M;  3KSY A;  2RSG A;  1TJ6 A;  2CAY A;  2CY4 A;  3T06 A;  4DBB A;  3A8P A;  5HE3 A;  4TYZ A;  3D8E A;  4GMX B;  4CHM A;  4P7I A;  2I1K A;  2VSZ A; 
#chains in the Genus database with same CATH topology
 2Y8G A;  4TKN A;  2VRW B;  3ULC A;  2KGX B;  2RRF A;  2DYN A;  1ZC3 B;  1MK9 B;  1FHW A;  4F7G A;  1PFJ A;  3ULB A;  1UPR A;  3NWD A;  4A5K A;  2MKR A;  5I2M A;  2W2X D;  1NTV A;  5FI1 A;  2EC1 A;  3NWF A;  1XD4 A;  1M7E A;  2H7D A;  3FSS A;  2KUP A;  3P7Z A;  2D9Z A;  3TW1 A;  5IRS A;  2CRF A;  2YS1 A;  4ZRK A;  2ZPY A;  5J3Y A;  1SHC A;  2D9W A;  3NSU A;  3GYO A;  3WA0 A;  1P3R A;  1U5D A;  2I1J A;  1Q67 A;  2MFQ A;  3HIE A;  2BCJ A;  2PZ1 A;  4Z2N A;  1EF1 A;  1V5U A;  1FB8 A;  4HSI A;  4CYE A;  2ELB A;  2LYD A;  1X05 A;  1WGQ A;  5KQ1 A;  3D8D A;  4HDQ A;  2EJ8 A;  2KIE A;  3RCP A;  1ZM0 A;  4HB2 B;  1DBH A;  2VKI A;  1WVH A;  3KZ1 A;  3TVV A;  1J0W A;  2GS0 A;  3FEH A;  5C5B A;  5EFX A;  3P6A A;  4IAP A;  1TXD A;  2I5F A;  1IRS A;  3HSA A;  2ZKM X;  4GMV A;  1PMS A;  2R2Y A;  2RGN B;  2COD A;  1P5T A;  2Z4D A;  4DX9 0;  4YL8 A;  3ODX A;  2KCJ A;  1FAO A;  2DHI A;  4KHB A;  1W1H A;  4NSW A;  1WJM A;  1Y19 B;  1K5D B;  2L2I A;  5GOW B;  5LG4 B;  1U27 A;  2D9V A;  2N23 A;  5I2S A;  3AU5 A;  3TCA A;  4HAW B;  1W1D A;  3CXB B;  1H10 A;  1XKE A;  4MK0 A;  1WG7 A;  2DTC A;  4GN1 A;  1BWN A;  4HAV B;  1QQG A;  1OMW A;  4CHJ A;  1FOE A;  2LOX A;  2Z0O A;  5JHG A;  2D9Y A;  2M14 A;  2UZR A;  1TQZ A;  5L81 A;  4L6E A;  2KR0 A;  2ELA A;  1XR0 B;  2COA A;  3PVW A;  3HW2 B;  2DKP A;  3VOQ A;  2Y7B A;  4A6F B;  1M7R A;  5JLJ B;  3A58 A;  5J3T A;  1X11 A;  4WJ7 A;  1X1G A;  3U7D A;  2DLW A;  4GNK B;  3V5W A;  2D10 A;  3FVC A;  4HAU B;  2FJL A;  1LB1 A;  2DKQ A;  3DXC A;  3MDB C;  4OSN A;  1T77 A;  3F5R A;  4HAZ B;  3LJU X;  1ZVR A;  3F0W A;  5DH9 B;  1KI1 B;  3PVU A;  2D4Q A;  3WYF B;  4B6H A;  2QKM A;  3AU4 A;  2J0M A;  4HAT B;  2K49 A;  3KY9 A;  5JHH A;  2DFK A;  2R0D A;  1MIZ B;  2P0D A;  3HK0 A;  1U2B A;  2LKO A;  4HAX B;  2GCL A;  1MK7 B;  3M1I B;  2W2W A;  1I7A A;  4ZRJ A;  4ZRI A;  4HAY B;  2COF A;  2DA0 A;  2MWN B;  5LON B;  4WSF A;  1XCG A;  2J0J A;  2DX5 A;  1U29 A;  1UNP A;  4HHV A;  1DDM A;  4BBK A;  2CY5 A;  1DRO A;  2ROV A;  2P0H A;  2K00 A;  1DYN A;  5D3X A;  4KHO A;  2I5C A;  1PLS A;  2W2X C;  1MPH A;  1W1G A;  5DIF B;  2GJY A;  4H8S A;  4C0A A;  1GG3 A;  2L1C A;  3QIJ A;  4DX8 A;  1AWE A;  1SGH A;  3DXD A;  1WI1 A;  5DHA B;  2NZ8 B;  4K81 A;  1V88 A;  5HE0 A;  2NMB A;  4PNK A;  3PEG A;  5D3V A;  4IFS A;  5JP4 A;  1Y5O A;  1WJ1 A;  3SV1 A;  2M38 A;  2DHJ A;  1MI1 A;  3ODO A;  4DXA B;  1E5W A;  2UVM A;  1QC6 A;  2ADZ A;  1K5G B;  2Z0Q A;  5D3W A;  2DHK A;  5KCV A;  1EVH A;  3IVF A;  5HE2 A;  2X18 A;  1DDW A;  3GYP A;  2YT0 A;  4KHA A;  3D8F A;  5HE1 A;  3HQC A;  2YVC A;  2YS5 A;  1AQC A;  2HTH B;  5C16 A;  4HB3 B;  3VIA A;  4KAX B;  1H4R A;  4Z2M B;  1FGZ A;  2DX1 A;  2YS3 A;  3AJ4 A;  2Z0P A;  4GZU A;  4XWX A;  1KZG A;  1KZ7 A;  1ZSQ A;  5D27 A;  2D2Q A;  1Z87 A;  3B77 A;  1UNR A;  4QXA B;  5M4Y B;  2YSZ A;  1MKE A;  3PZD A;  2OTX A;  4GOU A;  3BJI A;  3QWM A;  3UZT A;  2RNR B;  1X1F A;  3QBV B;  4OT1 A;  2H7E A;  2K2J A;  1B55 A;  2LOZ A;  1EAZ A;  1GC6 A;  3DXE A;  1XX0 A;  2D9X A;  5J3Q A;  4KVG B;  2UZS A;  2K2U A;  2AEH A;  1BAK A;  2Z13 A;  5C79 A;  2EMT A;  2LG1 A;  4A6F A;  1FHX A;  4K17 A;  4HDO A;  5KQ4 A;  2P0F A;  1UNQ A;  3OHM B;  1FGY A;  1UEF A;  4QJ5 B;  3SUZ A;  5CLL B;  4PQ0 A;  4EMO A;  2P8V A;  5D3Y A;  1BTN A;  1MAI A;  5DI9 B;  2OQB A;  1N3H A;  3PP2 A;  3N7C A;  3NW8 A;  2RUK B;  3SO6 A;  1RRP B;  1UPQ A;  2RVB B;  2E2X A;  1FHO A;  4F7H A;  3A98 B;  3O96 A;  2GUM A;  2R09 A;  5CLQ B;  5C5B B;  4WVF B;  2DN6 A;  1I2H A;  4K2O A;  4L1R A;  2DYQ A;  1U5E A;  2HE7 A;  4HB0 B;  1BTK A;  4CSQ A;  5DHF B;  1LW3 A;  2JP2 A;  1ZYI A;  4DIX A;  3MPX A;  1DDV A;  4GPT B;  4MY6 A;  4IOY X;  3PVL A;  4F7U P;  2K8E A;  4Y94 A;  2IYB A;  2Q13 A;  4K2P A;  4KHB B;  4HB4 B;  4EJN A;  1NTY A;  3U12 A;  1V5P A;  2NBV A;  1NU2 A;  3ZVR A;  1P6S A;  1V5M A;  2QKL A;  1OQN A;  1NI2 A;  2KUQ A;  2MDX A;  2COC A;  1U5G A;  2IFS A;  3PSC A;  3TO1 A;  4A6H A;  3A8Q A;  2RLO A;  3FM8 C;  1ZC4 B;  1WGU A;  2J59 M;  3KRX A;  4QJ4 B;  5C6R A;  3TFM A;  1U5F A;  2YT1 A;  1J19 A;  3DCX A;  3X23 A;  4D6W A;  3ODW A;  2V76 A;  2YF0 A;  1ISN A;  3U8Z A;  2YRY A;  4A6K A;  4NY0 A;  4D0N B;  1V89 A;  2ROZ B;  2N0Y A;  1OY2 A;  5FI0 A;  2G35 A;  2Z14 A;  3G9W A;  3SNH A;  3KRW A;  4QJ3 B;  5LOP B;  4EKU A;  2LUL A;  2D11 A;  3ZDT A;  2AL6 A;  4MT7 A;  3PG7 A;  1RJ2 A;  1EGX A;  3ML4 A;  3NWA A;  3BIN A;  3OAN A;  1MIX A;  2Y8F A;  2J0K A;  4YON A;  3CIK A;  2GCJ A;  4GXB A;  1V61 A;  3SYX A;  1X86 A;  1XOD A;  1GC7 A;  2EMS A;  2XQN M;  2Z59 A;  3KSY A;  2KIG A;  2YT2 A;  2RSG A;  1TJ6 A;  2CAY A;  2CY4 A;  3T06 A;  4DBB A;  3A8P A;  5HE3 A;  4TYZ A;  3D8E A;  4GMX B;  4CHM A;  2FJU B;  4P7I A;  2I1K A;  2VSZ A; 
#chains in the Genus database with same CATH homology
 2Y8G A;  4TKN A;  2VRW B;  3ULC A;  2KGX B;  2DYN A;  1ZC3 B;  1MK9 B;  1FHW A;  4F7G A;  1PFJ A;  3ULB A;  1UPR A;  4A5K A;  2MKR A;  2W2X D;  1NTV A;  5FI1 A;  2EC1 A;  1XD4 A;  1M7E A;  2H7D A;  3FSS A;  2KUP A;  3P7Z A;  2D9Z A;  3TW1 A;  2CRF A;  2YS1 A;  4ZRK A;  2ZPY A;  5J3Y A;  1SHC A;  2D9W A;  3NSU A;  3GYO A;  3WA0 A;  1P3R A;  1U5D A;  2I1J A;  1Q67 A;  2MFQ A;  2BCJ A;  2PZ1 A;  4Z2N A;  1EF1 A;  1V5U A;  1FB8 A;  4CYE A;  2ELB A;  2LYD A;  1X05 A;  1WGQ A;  5KQ1 A;  3D8D A;  4HDQ A;  2EJ8 A;  3RCP A;  1ZM0 A;  4HB2 B;  1DBH A;  2VKI A;  1WVH A;  3KZ1 A;  3TVV A;  1J0W A;  2GS0 A;  3FEH A;  5C5B A;  5EFX A;  3P6A A;  4IAP A;  1TXD A;  2I5F A;  1IRS A;  4GMV A;  1PMS A;  2RGN B;  2COD A;  1P5T A;  4DX9 0;  4YL8 A;  3ODX A;  2KCJ A;  1FAO A;  2DHI A;  1W1H A;  4NSW A;  1WJM A;  1Y19 B;  1K5D B;  2L2I A;  5GOW B;  1U27 A;  2D9V A;  2N23 A;  3AU5 A;  3TCA A;  4HAW B;  1W1D A;  3CXB B;  1H10 A;  1XKE A;  4MK0 A;  1WG7 A;  2DTC A;  4GN1 A;  1BWN A;  4HAV B;  1QQG A;  1OMW A;  4CHJ A;  1FOE A;  2LOX A;  2Z0O A;  5JHG A;  2D9Y A;  2M14 A;  2UZR A;  1TQZ A;  5L81 A;  4L6E A;  2ELA A;  1XR0 B;  2COA A;  3PVW A;  3HW2 B;  2DKP A;  3VOQ A;  2Y7B A;  4A6F B;  1M7R A;  5JLJ B;  5J3T A;  1X11 A;  4WJ7 A;  1X1G A;  3U7D A;  2DLW A;  3V5W A;  2D10 A;  4HAU B;  2FJL A;  1LB1 A;  2DKQ A;  3DXC A;  3MDB C;  3F5R A;  4HAZ B;  3LJU X;  1ZVR A;  3F0W A;  5DH9 B;  1KI1 B;  3PVU A;  2D4Q A;  3WYF B;  4B6H A;  2QKM A;  3AU4 A;  2J0M A;  4HAT B;  3KY9 A;  5JHH A;  2DFK A;  2R0D A;  1MIZ B;  2P0D A;  3HK0 A;  1U2B A;  2LKO A;  4HAX B;  2GCL A;  1MK7 B;  3M1I B;  2W2W A;  1I7A A;  4ZRJ A;  4ZRI A;  4HAY B;  2COF A;  2DA0 A;  2MWN B;  5LON B;  4WSF A;  1XCG A;  2J0J A;  2DX5 A;  1U29 A;  1UNP A;  4HHV A;  1DDM A;  4BBK A;  2CY5 A;  1DRO A;  2ROV A;  2P0H A;  2K00 A;  1DYN A;  5D3X A;  4KHO A;  2I5C A;  1PLS A;  2W2X C;  1MPH A;  1W1G A;  5DIF B;  2GJY A;  4H8S A;  4C0A A;  1GG3 A;  2L1C A;  3QIJ A;  4DX8 A;  1AWE A;  1SGH A;  3DXD A;  1WI1 A;  5DHA B;  2NZ8 B;  4K81 A;  1V88 A;  5HE0 A;  2NMB A;  4PNK A;  3PEG A;  5D3V A;  4IFS A;  5JP4 A;  1Y5O A;  1WJ1 A;  3SV1 A;  2M38 A;  2DHJ A;  3ODO A;  4DXA B;  1E5W A;  2UVM A;  1QC6 A;  2ADZ A;  1K5G B;  2Z0Q A;  5D3W A;  2DHK A;  5KCV A;  1EVH A;  3IVF A;  5HE2 A;  2X18 A;  1DDW A;  3GYP A;  2YT0 A;  4KHA A;  3D8F A;  5HE1 A;  3HQC A;  2YVC A;  2YS5 A;  1AQC A;  2HTH B;  5C16 A;  4HB3 B;  3VIA A;  4KAX B;  1H4R A;  4Z2M B;  1FGZ A;  2DX1 A;  2YS3 A;  3AJ4 A;  2Z0P A;  4GZU A;  4XWX A;  1KZG A;  1KZ7 A;  1ZSQ A;  5D27 A;  2D2Q A;  1Z87 A;  1UNR A;  2YSZ A;  1MKE A;  3PZD A;  2OTX A;  3BJI A;  3QWM A;  3UZT A;  2RNR B;  1X1F A;  3QBV B;  2H7E A;  2K2J A;  1B55 A;  2LOZ A;  1EAZ A;  1GC6 A;  3DXE A;  1XX0 A;  2D9X A;  5J3Q A;  4KVG B;  2UZS A;  2K2U A;  2AEH A;  1BAK A;  5C79 A;  2EMT A;  2LG1 A;  4A6F A;  1FHX A;  4K17 A;  4HDO A;  5KQ4 A;  2P0F A;  1UNQ A;  1FGY A;  1UEF A;  3SUZ A;  5CLL B;  4PQ0 A;  4EMO A;  2P8V A;  5D3Y A;  1BTN A;  1MAI A;  5DI9 B;  2OQB A;  1N3H A;  3PP2 A;  3N7C A;  2RUK B;  3SO6 A;  1RRP B;  1UPQ A;  2RVB B;  2E2X A;  1FHO A;  4F7H A;  3O96 A;  3A98 B;  2R09 A;  5CLQ B;  5C5B B;  4WVF B;  2DN6 A;  1I2H A;  4K2O A;  2DYQ A;  1U5E A;  2HE7 A;  4HB0 B;  1BTK A;  5DHF B;  1LW3 A;  2JP2 A;  3MPX A;  1DDV A;  4GPT B;  4MY6 A;  4IOY X;  3PVL A;  4F7U P;  4Y94 A;  4EJN A;  2IYB A;  2Q13 A;  4K2P A;  4KHB B;  4HB4 B;  1NTY A;  1V5P A;  1NU2 A;  3ZVR A;  1P6S A;  1V5M A;  2QKL A;  1OQN A;  1NI2 A;  2MDX A;  2COC A;  1U5G A;  2IFS A;  3PSC A;  3TO1 A;  4A6H A;  3A8Q A;  2RLO A;  3FM8 C;  1ZC4 B;  1WGU A;  2J59 M;  3KRX A;  5C6R A;  3TFM A;  1U5F A;  2YT1 A;  1J19 A;  3X23 A;  3ODW A;  2V76 A;  2YF0 A;  1ISN A;  3U8Z A;  2YRY A;  4A6K A;  4NY0 A;  4D0N B;  1V89 A;  2ROZ B;  2N0Y A;  1OY2 A;  5FI0 A;  2G35 A;  3G9W A;  3SNH A;  3KRW A;  5LOP B;  4EKU A;  2LUL A;  2D11 A;  3ZDT A;  2AL6 A;  4MT7 A;  3PG7 A;  1RJ2 A;  1EGX A;  3ML4 A;  3BIN A;  3OAN A;  1MIX A;  2Y8F A;  2J0K A;  4YON A;  3CIK A;  2GCJ A;  4GXB A;  1V61 A;  3SYX A;  1X86 A;  1XOD A;  1GC7 A;  2EMS A;  2XQN M;  3KSY A;  2RSG A;  1TJ6 A;  2CAY A;  2CY4 A;  3T06 A;  4DBB A;  3A8P A;  5HE3 A;  4TYZ A;  3D8E A;  4GMX B;  4CHM A;  4P7I A;  2I1K A;  2VSZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...