2KUPA

Solution structure of the complex of the ptb domain of snt-2 and 19-residue peptide (aa 1571-1589) of halk
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
146
structure length
146
Chain Sequence
GSSGSSGLNRDSVPDNHPTKFKVTNVDDEGVELGSGVMELTQSELVLHLHRREAVRWPYLCLRRYGYDSNLFSFESGRRCQTGQGIFAFKCSRAEEIFNLLQDLMQCNSINVMEEPVIITRNSHPAELDLPRAPQPPNALGYTVSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein/oncoprotein
molecule keywords Fibroblast growth factor receptor substrate 3
publication title Structural basis for the recognition of nucleophosmin-anaplastic lymphoma kinase oncoprotein by the phosphotyrosine binding domain of Suc1-associated neurotrophic factor-induced tyrosine-phosphorylated target-2
pubmed doi rcsb
source organism Homo sapiens
total genus 21
structure length 146
sequence length 146
ec nomenclature
pdb deposition date 2010-02-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02174 IRS PTB domain (IRS-1 type)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2kupA01
4WJ7A 3KSYA 2YT1A 1WGUA 2H7EA 3X23A 1WI1A 5FI1A 1FAOA 2Y7BA 2Y8GA 2CY5A 3A8PA 1J19A 2DKQA 2P0HA 2Q13A 5D27A 3T06A 1H4RA 2R09A 2NMBA 1V5PA 3N7CA 2J59M 4NY0A 4HAUB 1UNPA 2ZPYA 2EMTA 5D3VA 1M7RA 4ZRKA 1Y19B 4KHOA 2K2UA 2DYNA 2COCA 5CLLB 1U29A 2GCLA 1FHXA 2LOXA 2MDXA 2M14A 4K2OA 1TQZA 5HE2A 2W2WA 1Z87A 2DTCA 2D10A 1PLSA 1ZVRA 4CYEA 1WJMA 2DN6A 2EC1A 5D3XA 1U27A 2COFA 2D9ZA 1DBHA 2YS1A 1FHOA 3TFMA 3P7ZA 1V5MA 3WYFB 1EF1A 2VSZA 3ML4A 2MKRA 2KUPA 1TXDA 1X1FA 3ZVRA 4K17A 3CXBB 4HAYB 4DX8A 3QWMA 4Z2MB 1V88A 4HAXB 5HE1A 1ZM0A 1FGZA 3MDBC 1BAKA 2ROVA 2YVCA 4K81A 2PZ1A 3ULBA 2CAYA 4NSWA 3LJUX 1QQGA 2P8VA 5DI9B 4EJNA 1SHCA 3AU4A 5HE0A 5LOPB 2YS3A 1FOEA 2RLOA 1AWEA 1XR0B 2UVMA 1GC7A 2DLWA 1MAIA 1MIZB 1B55A 4BBKA 3QBVB 4YL8A 2I5CA 3ULCA 4H8SA 3QIJA 2GS0A 4D0NB 2HTHB 4GMXB 2AL6A 3VOQA 3D8EA 2J0MA 2LG1A 4HHVA 4L6EA 4XWXA 3UZTA 2KCJA 2RNRB 5JHGA 3ZDTA 2Z0PA 1SGHA 3SO6A 4B6HA 2CRFA 1W1HA 5C16A 2YS5A 1DROA 1K5DB 1U2BA 2EJ8A 1MIXA 1DDWA 2AEHA 3FSSA 2JP2A 4ZRJA 1MK7B 1MPHA 4F7UP 3WA0A 4WSFA 3DXDA 1Y5OA 2NZ8B 2OTXA 3G9WA 4HDOA 1I2HA 5L81A 1K5GB 1PFJA 1Q67A 4HB0B 3V5WA 2IYBA 2K00A 1WVHA 4HAWB 3SYXA 5KCVA 1EGXA 2IFSA 4HAZB 3U8ZA 4HDQA 2D9VA 1U5DA 4CHMA 2YSZA 1V89A 4GN1A 3SUZA 1BTKA 2DFKA 2YF0A 4C0AA 4PNKA 4TKNA 3KY9A 1KI1B 2CODA 4KHAA 3A98B 3PP2A 2DHIA 5FI0A 2VKIA 3TO1A 3PEGA 3SV1A 1BTNA 2OQBA 1N3HA 2MFQA 1P6SA 4A6FB 1OMWA 1NI2A 4TYZA 4IAPA 1GG3A 5DH9B 1KZ7A 5J3TA 1MK9B 5JHHA 1U5FA 1U5GA 1E5WA 5D3YA 4EMOA 1XKEA 4A6FA 3GYOA 2L2IA 3HK0A 1UPRA 1EVHA 1NTVA 2D9WA 5DIFB 4A5KA 2HE7A 4MT7A 5JP4A 3GYPA 3D8DA 4MY6A 2CY4A 1M7EA 2DHJA 1RRPB 5EFXA 5J3YA 2LYDA 1FB8A 2DYQA 1KZGA 1ZC3B 1WG7A 2GCJA 2M38A 4K2PA 1U5EA 5KQ1A 3O96A 2Z0OA 1X11A 3ODWA 2ROZB 4IOYX 4Y94A 1W1DA 1GC6A 2E2XA 2UZRA 3M1IB 5C5BB 2I1JA 1PMSA 1ZC4B 4KHBB 1UNQA 3BINA 2P0DA 5KQ4A 2DA0A 3PVLA 4HB3B 2ELAA 1DDMA 1XCGA 3OANA 5C5BA 1UEFA 2MWNB 2XQNM 4F7HA 2DX5A 2UZSA 3F5RA 2D2QA 3U7DA 2D9YA 3PVWA 3HW2B 1DYNA 2RVBB 5LONB 3P6AA 3TVVA 4KAXB 1W1GA 2ADZA 5GOWB 2DHKA 5CLQB 4KVGB 2COAA 1WGQA 2W2XD 3KRXA 1UPQA 5C79A 3KRWA 4HATB 2GJYA 1WJ1A 3ODOA 2LOZA 1UNRA 1DDVA 1P5TA 4MK0A 1H10A 4A6HA 2D4QA 3SNHA 2L1CA 3F0WA 2N23A 1OY2A 2D9XA 1XX0A 1EAZA 5JLJB 2X18A 2V76A 4A6KA 4CHJA 1V61A 5C6RA 2LKOA 2G35A 4GXBA 2W2XC 2N0YA 1ZSQA 2K2JA 4DX90 3KZ1A 1FHWA 5HE3A 3PVUA 3ODXA 3PSCA 1RJ2A 1QC6A 1BWNA 4P7IA 2QKMA 4IFSA 5D3WA 3CIKA 2FJLA 1TJ6A 1X05A 2BCJA 5DHFB 4GPTB 4DBBA 1LB1A 1LW3A 1MKEA 4YONA 3AJ4A 4GMVA 1X86A 2R0DA 3HQCA 1X1GA 3TCAA 2LULA 1FGYA 2H7DA 2YRYA 2YT0A 1AQCA 3MPXA 4DXAB 2VRWB 2RSGA 3VIAA 2RUKB 2DKPA 1XD4A 2RGNB 3A8QA 2QKLA 2J0KA 5DHAB 1I7AA 1P3RA 4Z2NA 2I5FA 3D8FA 2Z0QA 3BJIA 2EMSA 3FM8C 2I1KA 3DXCA 4PQ0A 2J0JA 3AU5A 5J3QA 1NU2A 3PG7A 3IVFA 2ELBA 4HAVB 3TW1A 2KGXB 2DX1A 1OQNA 4HB4B 1NTYA 3RCPA 2D11A 3NSUA 2P0FA 4HB2B 3PZDA 4GZUA 3DXEA 3FEHA 4EKUA 1J0WA 1V5UA 2Y8FA 4F7GA 1XODA 4WVFB 1IRSA 1ISNA 4ZRIA
chains in the Genus database with same CATH superfamily
4WJ7A 1T77A 3KSYA 2YT1A 1WGUA 2H7EA 3X23A 1WI1A 5FI1A 1FAOA 2Y7BA 2Y8GA 4DIXA 2CY5A 3A8PA 1J19A 2DKQA 2P0HA 2Q13A 5D27A 3T06A 1H4RA 2R09A 2NMBA 1V5PA 3N7CA 2J59M 4NY0A 2RRFA 4HAUB 4OT1A 1UNPA 2ZPYA 2EMTA 5D3VA 1M7RA 4ZRKA 1Y19B 4KHOA 2K2UA 2DYNA 2COCA 5CLLB 1U29A 2GCLA 1FHXA 2LOXA 2MDXA 2M14A 2YT2A 1TQZA 4K2OA 5HE2A 2W2WA 1Z87A 2DTCA 2Z4DA 2D10A 2KIGA 1PLSA 1ZVRA 4CYEA 1WJMA 2DN6A 2EC1A 5D3XA 1U27A 2COFA 2D9ZA 1DBHA 2YS1A 1FHOA 3TFMA 3P7ZA 1V5MA 2KIEA 3WYFB 1EF1A 2VSZA 3ML4A 2MKRA 2KUPA 1TXDA 1X1FA 3ZVRA 4K17A 3CXBB 4HAYB 3B77A 4DX8A 3QWMA 4Z2MB 3NW8A 1V88A 2K49A 4HAXB 5HE1A 1ZM0A 1MI1A 1FGZA 3DCXA 3MDBC 1BAKA 2ROVA 2YVCA 4K81A 2PZ1A 3ULBA 2CAYA 4NSWA 3LJUX 1QQGA 2P8VA 5DI9B 4EJNA 1SHCA 3AU4A 2KUQA 5HE0A 5LOPB 2YS3A 3FVCA 1FOEA 2RLOA 1AWEA 1XR0B 2UVMA 1GC7A 2DLWA 1MAIA 5IRSA 1MIZB 2Z13A 1B55A 4BBKA 3QBVB 4YL8A 2I5CA 3ULCA 4H8SA 3QIJA 4OSNA 2GS0A 4D0NB 2K8EA 2HTHB 4GMXB 2AL6A 3VOQA 3D8EA 2J0MA 2LG1A 4HHVA 4L6EA 5I2SA 4XWXA 3UZTA 2KCJA 2RNRB 5JHGA 3ZDTA 2Z0PA 1SGHA 3SO6A 4B6HA 2CRFA 1W1HA 5C16A 2YS5A 3NWFA 2NBVA 1DROA 1K5DB 1U2BA 2EJ8A 1MIXA 1DDWA 2AEHA 3FSSA 2JP2A 4ZRJA 1MK7B 1MPHA 4GOUA 4F7UP 3WA0A 4WSFA 3DXDA 1Y5OA 2NZ8B 2OTXA 3G9WA 4HDOA 1I2HA 5L81A 1K5GB 1PFJA 5I2MA 1Q67A 4HB0B 3V5WA 3HIEA 2IYBA 2K00A 1WVHA 4HAWB 3SYXA 5KCVA 1EGXA 2IFSA 4HAZB 3U8ZA 4QJ5B 4HDQA 2D9VA 1U5DA 4CHMA 2YSZA 1V89A 4GN1A 3SUZA 1BTKA 2DFKA 2YF0A 4C0AA 4PNKA 4TKNA 3KY9A 5M4YB 1KI1B 2CODA 4KHAA 3A98B 3PP2A 2DHIA 5FI0A 2R2YA 2VKIA 3TO1A 3PEGA 3SV1A 4HSIA 1BTNA 2Z14A 2OQBA 1N3HA 2MFQA 1P6SA 4A6FB 1OMWA 1NI2A 4TYZA 4IAPA 1GG3A 5DH9B 1KZ7A 5J3TA 1MK9B 5JHHA 1U5FA 1U5GA 1E5WA 3A58A 5D3YA 1XKEA 4EMOA 4A6FA 3GYOA 2L2IA 3HK0A 1UPRA 1EVHA 1NTVA 2D9WA 5DIFB 4A5KA 2Z59A 2HE7A 4MT7A 5JP4A 3GYPA 3D8DA 4MY6A 2CY4A 1M7EA 2DHJA 1RRPB 5EFXA 5J3YA 2LYDA 1FB8A 2KR0A 2DYQA 1KZGA 1ZC3B 1WG7A 2GCJA 4QJ4B 2M38A 4K2PA 1U5EA 5KQ1A 2Z0OA 3O96A 3NWAA 1X11A 3ODWA 2ROZB 4IOYX 4Y94A 1W1DA 1GC6A 2E2XA 2UZRA 3M1IB 5C5BB 2I1JA 1PMSA 1ZC4B 4KHBB 1UNQA 3BINA 2P0DA 5KQ4A 2DA0A 3PVLA 1ZYIA 4HB3B 2ELAA 1DDMA 1XCGA 3OANA 5C5BA 1UEFA 2MWNB 2XQNM 4F7HA 2DX5A 2ZKMX 2UZSA 3F5RA 4KHBA 2D2QA 2FJUB 3U7DA 2D9YA 3PVWA 3HW2B 1DYNA 2RVBB 5LONB 3P6AA 2GUMA 3TVVA 4KAXB 1W1GA 2ADZA 5GOWB 2DHKA 5CLQB 4KVGB 2COAA 1WGQA 2W2XD 3KRXA 3OHMB 1UPQA 5C79A 3KRWA 4HATB 2GJYA 1WJ1A 3ODOA 2LOZA 1UNRA 1DDVA 1P5TA 4MK0A 1H10A 4A6HA 2D4QA 4QJ3B 3SNHA 2L1CA 3F0WA 2N23A 1OY2A 3NWDA 2D9XA 1XX0A 1EAZA 5JLJB 2X18A 2V76A 4A6KA 4CHJA 1V61A 5C6RA 2LKOA 4CSQA 3HSAA 2G35A 4GXBA 2W2XC 2N0YA 4QXAB 1ZSQA 2K2JA 4DX90 3KZ1A 1FHWA 5HE3A 3PVUA 3ODXA 3PSCA 1RJ2A 1QC6A 1BWNA 4P7IA 2QKMA 4IFSA 5D3WA 3CIKA 2FJLA 1TJ6A 1X05A 2BCJA 5DHFB 4D6WA 4L1RA 4GPTB 4DBBA 1LB1A 1LW3A 1MKEA 4YONA 3AJ4A 4GMVA 1X86A 2R0DA 3HQCA 1X1GA 3TCAA 2LULA 1FGYA 2H7DA 2YRYA 2YT0A 1AQCA 3MPXA 4DXAB 2VRWB 2RSGA 3VIAA 2RUKB 2DKPA 1XD4A 2RGNB 3A8QA 2QKLA 2J0KA 5DHAB 1I7AA 1P3RA 4Z2NA 2I5FA 3D8FA 2Z0QA 3BJIA 2EMSA 3FM8C 2I1KA 3DXCA 5LG4B 4PQ0A 2J0JA 3AU5A 5J3QA 1NU2A 3PG7A 3IVFA 2ELBA 4HAVB 3TW1A 2KGXB 2DX1A 1OQNA 4HB4B 1NTYA 3RCPA 2D11A 3NSUA 2P0FA 4GNKB 4HB2B 3U12A 3PZDA 4GZUA 3DXEA 3FEHA 4EKUA 1J0WA 1V5UA 2Y8FA 4F7GA 1XODA 4WVFB 1IRSA 1ISNA 4ZRIA
chains in the Genus database with same CATH topology
4WJ7A 3KSYA 2YT1A 1WGUA 2H7EA 3X23A 1WI1A 5FI1A 1FAOA 2Y7BA 2Y8GA 2CY5A 3A8PA 1J19A 2DKQA 2P0HA 2Q13A 5D27A 3T06A 1H4RA 2R09A 2NMBA 1V5PA 3N7CA 2J59M 4NY0A 4HAUB 1UNPA 2ZPYA 2EMTA 5D3VA 1M7RA 4ZRKA 1Y19B 4KHOA 2K2UA 2DYNA 2COCA 5CLLB 1U29A 2GCLA 1FHXA 2LOXA 2MDXA 2M14A 4K2OA 1TQZA 5HE2A 2W2WA 1Z87A 2DTCA 2D10A 1PLSA 1ZVRA 4CYEA 1WJMA 2DN6A 2EC1A 5D3XA 1U27A 2COFA 2D9ZA 1DBHA 2YS1A 1FHOA 3TFMA 3P7ZA 1V5MA 3WYFB 1EF1A 2VSZA 3ML4A 2MKRA 2KUPA 1TXDA 1X1FA 3ZVRA 4K17A 3CXBB 4HAYB 4DX8A 3QWMA 4Z2MB 1V88A 4HAXB 5HE1A 1ZM0A 1FGZA 3MDBC 1BAKA 2ROVA 2YVCA 4K81A 2PZ1A 3ULBA 2CAYA 4NSWA 3LJUX 1QQGA 2P8VA 5DI9B 4EJNA 1SHCA 3AU4A 5HE0A 5LOPB 2YS3A 1FOEA 2RLOA 1AWEA 1XR0B 2UVMA 1GC7A 2DLWA 1MAIA 1MIZB 1B55A 4BBKA 3QBVB 4YL8A 2I5CA 3ULCA 4H8SA 3QIJA 2GS0A 4D0NB 2HTHB 4GMXB 2AL6A 3VOQA 3D8EA 2J0MA 2LG1A 4HHVA 4L6EA 4XWXA 3UZTA 2KCJA 2RNRB 5JHGA 3ZDTA 2Z0PA 1SGHA 3SO6A 4B6HA 2CRFA 1W1HA 5C16A 2YS5A 1DROA 1K5DB 1U2BA 2EJ8A 1MIXA 1DDWA 2AEHA 3FSSA 2JP2A 4ZRJA 1MK7B 1MPHA 4F7UP 3WA0A 4WSFA 3DXDA 1Y5OA 2NZ8B 2OTXA 3G9WA 4HDOA 1I2HA 5L81A 1K5GB 1PFJA 1Q67A 4HB0B 3V5WA 2IYBA 2K00A 1WVHA 4HAWB 3SYXA 5KCVA 1EGXA 2IFSA 4HAZB 3U8ZA 4HDQA 2D9VA 1U5DA 4CHMA 2YSZA 1V89A 4GN1A 3SUZA 1BTKA 2DFKA 2YF0A 4C0AA 4PNKA 4TKNA 3KY9A 1KI1B 2CODA 4KHAA 3A98B 3PP2A 2DHIA 5FI0A 2VKIA 3TO1A 3PEGA 3SV1A 1BTNA 2OQBA 1N3HA 2MFQA 1P6SA 4A6FB 1OMWA 1NI2A 4TYZA 4IAPA 1GG3A 5DH9B 1KZ7A 5J3TA 1MK9B 5JHHA 1U5FA 1U5GA 1E5WA 5D3YA 4EMOA 1XKEA 4A6FA 3GYOA 2L2IA 3HK0A 1UPRA 1EVHA 1NTVA 2D9WA 5DIFB 4A5KA 2HE7A 4MT7A 5JP4A 3GYPA 3D8DA 4MY6A 2CY4A 1M7EA 2DHJA 1RRPB 5EFXA 5J3YA 2LYDA 1FB8A 2DYQA 1KZGA 1ZC3B 1WG7A 2GCJA 2M38A 4K2PA 1U5EA 5KQ1A 3O96A 2Z0OA 1X11A 3ODWA 2ROZB 4IOYX 4Y94A 1W1DA 1GC6A 2E2XA 2UZRA 3M1IB 5C5BB 2I1JA 1PMSA 1ZC4B 4KHBB 1UNQA 3BINA 2P0DA 5KQ4A 2DA0A 3PVLA 4HB3B 2ELAA 1DDMA 1XCGA 3OANA 5C5BA 1UEFA 2MWNB 2XQNM 4F7HA 2DX5A 2UZSA 3F5RA 2D2QA 3U7DA 2D9YA 3PVWA 3HW2B 1DYNA 2RVBB 5LONB 3P6AA 3TVVA 4KAXB 1W1GA 2ADZA 5GOWB 2DHKA 5CLQB 4KVGB 2COAA 1WGQA 2W2XD 3KRXA 1UPQA 5C79A 3KRWA 4HATB 2GJYA 1WJ1A 3ODOA 2LOZA 1UNRA 1DDVA 1P5TA 4MK0A 1H10A 4A6HA 2D4QA 3SNHA 2L1CA 3F0WA 2N23A 1OY2A 2D9XA 1XX0A 1EAZA 5JLJB 2X18A 2V76A 4A6KA 4CHJA 1V61A 5C6RA 2LKOA 2G35A 4GXBA 2W2XC 2N0YA 1ZSQA 2K2JA 4DX90 3KZ1A 1FHWA 5HE3A 3PVUA 3ODXA 3PSCA 1RJ2A 1QC6A 1BWNA 4P7IA 2QKMA 4IFSA 5D3WA 3CIKA 2FJLA 1TJ6A 1X05A 2BCJA 5DHFB 4GPTB 4DBBA 1LB1A 1LW3A 1MKEA 4YONA 3AJ4A 4GMVA 1X86A 2R0DA 3HQCA 1X1GA 3TCAA 2LULA 1FGYA 2H7DA 2YRYA 2YT0A 1AQCA 3MPXA 4DXAB 2VRWB 2RSGA 3VIAA 2RUKB 2DKPA 1XD4A 2RGNB 3A8QA 2QKLA 2J0KA 5DHAB 1I7AA 1P3RA 4Z2NA 2I5FA 3D8FA 2Z0QA 3BJIA 2EMSA 3FM8C 2I1KA 3DXCA 4PQ0A 2J0JA 3AU5A 5J3QA 1NU2A 3PG7A 3IVFA 2ELBA 4HAVB 3TW1A 2KGXB 2DX1A 1OQNA 4HB4B 1NTYA 3RCPA 2D11A 3NSUA 2P0FA 4HB2B 3PZDA 4GZUA 3DXEA 3FEHA 4EKUA 1J0WA 1V5UA 2Y8FA 4F7GA 1XODA 4WVFB 1IRSA 1ISNA 4ZRIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WJ7 A;  3KSY A;  2YT1 A;  1WGU A;  2H7E A;  3X23 A;  1WI1 A;  5FI1 A;  1FAO A;  2Y7B A;  2Y8G A;  2CY5 A;  3A8P A;  1J19 A;  2DKQ A;  2P0H A;  2Q13 A;  5D27 A;  3T06 A;  1H4R A;  2R09 A;  2NMB A;  1V5P A;  3N7C A;  2J59 M;  4NY0 A;  4HAU B;  1UNP A;  2ZPY A;  2EMT A;  5D3V A;  1M7R A;  4ZRK A;  1Y19 B;  4KHO A;  2K2U A;  2DYN A;  2COC A;  5CLL B;  1U29 A;  2GCL A;  1FHX A;  2LOX A;  2MDX A;  2M14 A;  4K2O A;  1TQZ A;  5HE2 A;  2W2W A;  1Z87 A;  2DTC A;  2D10 A;  1PLS A;  1ZVR A;  4CYE A;  1WJM A;  2DN6 A;  2EC1 A;  5D3X A;  1U27 A;  2COF A;  2D9Z A;  1DBH A;  2YS1 A;  1FHO A;  3TFM A;  3P7Z A;  1V5M A;  3WYF B;  1EF1 A;  2VSZ A;  3ML4 A;  2MKR A;  2KUP A;  1TXD A;  1X1F A;  3ZVR A;  4K17 A;  3CXB B;  4HAY B;  4DX8 A;  3QWM A;  4Z2M B;  1V88 A;  4HAX B;  5HE1 A;  1ZM0 A;  1FGZ A;  3MDB C;  1BAK A;  2ROV A;  2YVC A;  4K81 A;  2PZ1 A;  3ULB A;  2CAY A;  4NSW A;  3LJU X;  1QQG A;  2P8V A;  5DI9 B;  4EJN A;  1SHC A;  3AU4 A;  5HE0 A;  5LOP B;  2YS3 A;  1FOE A;  2RLO A;  1AWE A;  1XR0 B;  2UVM A;  1GC7 A;  2DLW A;  1MAI A;  1MIZ B;  1B55 A;  4BBK A;  3QBV B;  4YL8 A;  2I5C A;  3ULC A;  4H8S A;  3QIJ A;  2GS0 A;  4D0N B;  2HTH B;  4GMX B;  2AL6 A;  3VOQ A;  3D8E A;  2J0M A;  2LG1 A;  4HHV A;  4L6E A;  4XWX A;  3UZT A;  2KCJ A;  2RNR B;  5JHG A;  3ZDT A;  2Z0P A;  1SGH A;  3SO6 A;  4B6H A;  2CRF A;  1W1H A;  5C16 A;  2YS5 A;  1DRO A;  1K5D B;  1U2B A;  2EJ8 A;  1MIX A;  1DDW A;  2AEH A;  3FSS A;  2JP2 A;  4ZRJ A;  1MK7 B;  1MPH A;  4F7U P;  3WA0 A;  4WSF A;  3DXD A;  1Y5O A;  2NZ8 B;  2OTX A;  3G9W A;  4HDO A;  1I2H A;  5L81 A;  1K5G B;  1PFJ A;  1Q67 A;  4HB0 B;  3V5W A;  2IYB A;  2K00 A;  1WVH A;  4HAW B;  3SYX A;  5KCV A;  1EGX A;  2IFS A;  4HAZ B;  3U8Z A;  4HDQ A;  2D9V A;  1U5D A;  4CHM A;  2YSZ A;  1V89 A;  4GN1 A;  3SUZ A;  1BTK A;  2DFK A;  2YF0 A;  4C0A A;  4PNK A;  4TKN A;  3KY9 A;  1KI1 B;  2COD A;  4KHA A;  3A98 B;  3PP2 A;  2DHI A;  5FI0 A;  2VKI A;  3TO1 A;  3PEG A;  3SV1 A;  1BTN A;  2OQB A;  1N3H A;  2MFQ A;  1P6S A;  4A6F B;  1OMW A;  1NI2 A;  4TYZ A;  4IAP A;  1GG3 A;  5DH9 B;  1KZ7 A;  5J3T A;  1MK9 B;  5JHH A;  1U5F A;  1U5G A;  1E5W A;  5D3Y A;  4EMO A;  1XKE A;  4A6F A;  3GYO A;  2L2I A;  3HK0 A;  1UPR A;  1EVH A;  1NTV A;  2D9W A;  5DIF B;  4A5K A;  2HE7 A;  4MT7 A;  5JP4 A;  3GYP A;  3D8D A;  4MY6 A;  2CY4 A;  1M7E A;  2DHJ A;  1RRP B;  5EFX A;  5J3Y A;  2LYD A;  1FB8 A;  2DYQ A;  1KZG A;  1ZC3 B;  1WG7 A;  2GCJ A;  2M38 A;  4K2P A;  1U5E A;  5KQ1 A;  3O96 A;  2Z0O A;  1X11 A;  3ODW A;  2ROZ B;  4IOY X;  4Y94 A;  1W1D A;  1GC6 A;  2E2X A;  2UZR A;  3M1I B;  5C5B B;  2I1J A;  1PMS A;  1ZC4 B;  4KHB B;  1UNQ A;  3BIN A;  2P0D A;  5KQ4 A;  2DA0 A;  3PVL A;  4HB3 B;  2ELA A;  1DDM A;  1XCG A;  3OAN A;  5C5B A;  1UEF A;  2MWN B;  2XQN M;  4F7H A;  2DX5 A;  2UZS A;  3F5R A;  2D2Q A;  3U7D A;  2D9Y A;  3PVW A;  3HW2 B;  1DYN A;  2RVB B;  5LON B;  3P6A A;  3TVV A;  4KAX B;  1W1G A;  2ADZ A;  5GOW B;  2DHK A;  5CLQ B;  4KVG B;  2COA A;  1WGQ A;  2W2X D;  3KRX A;  1UPQ A;  5C79 A;  3KRW A;  4HAT B;  2GJY A;  1WJ1 A;  3ODO A;  2LOZ A;  1UNR A;  1DDV A;  1P5T A;  4MK0 A;  1H10 A;  4A6H A;  2D4Q A;  3SNH A;  2L1C A;  3F0W A;  2N23 A;  1OY2 A;  2D9X A;  1XX0 A;  1EAZ A;  5JLJ B;  2X18 A;  2V76 A;  4A6K A;  4CHJ A;  1V61 A;  5C6R A;  2LKO A;  2G35 A;  4GXB A;  2W2X C;  2N0Y A;  1ZSQ A;  2K2J A;  4DX9 0;  3KZ1 A;  1FHW A;  5HE3 A;  3PVU A;  3ODX A;  3PSC A;  1RJ2 A;  1QC6 A;  1BWN A;  4P7I A;  2QKM A;  4IFS A;  5D3W A;  3CIK A;  2FJL A;  1TJ6 A;  1X05 A;  2BCJ A;  5DHF B;  4GPT B;  4DBB A;  1LB1 A;  1LW3 A;  1MKE A;  4YON A;  3AJ4 A;  4GMV A;  1X86 A;  2R0D A;  3HQC A;  1X1G A;  3TCA A;  2LUL A;  1FGY A;  2H7D A;  2YRY A;  2YT0 A;  1AQC A;  3MPX A;  4DXA B;  2VRW B;  2RSG A;  3VIA A;  2RUK B;  2DKP A;  1XD4 A;  2RGN B;  3A8Q A;  2QKL A;  2J0K A;  5DHA B;  1I7A A;  1P3R A;  4Z2N A;  2I5F A;  3D8F A;  2Z0Q A;  3BJI A;  2EMS A;  3FM8 C;  2I1K A;  3DXC A;  4PQ0 A;  2J0J A;  3AU5 A;  5J3Q A;  1NU2 A;  3PG7 A;  3IVF A;  2ELB A;  4HAV B;  3TW1 A;  2KGX B;  2DX1 A;  1OQN A;  4HB4 B;  1NTY A;  3RCP A;  2D11 A;  3NSU A;  2P0F A;  4HB2 B;  3PZD A;  4GZU A;  3DXE A;  3FEH A;  4EKU A;  1J0W A;  1V5U A;  2Y8F A;  4F7G A;  1XOD A;  4WVF B;  1IRS A;  1ISN A;  4ZRI A; 
#chains in the Genus database with same CATH topology
 4WJ7 A;  1T77 A;  3KSY A;  2YT1 A;  1WGU A;  2H7E A;  3X23 A;  1WI1 A;  5FI1 A;  1FAO A;  2Y7B A;  2Y8G A;  4DIX A;  2CY5 A;  3A8P A;  1J19 A;  2DKQ A;  2P0H A;  2Q13 A;  5D27 A;  3T06 A;  1H4R A;  2R09 A;  2NMB A;  1V5P A;  3N7C A;  2J59 M;  4NY0 A;  2RRF A;  4HAU B;  4OT1 A;  1UNP A;  2ZPY A;  2EMT A;  5D3V A;  1M7R A;  4ZRK A;  1Y19 B;  4KHO A;  2K2U A;  2DYN A;  2COC A;  5CLL B;  1U29 A;  2GCL A;  1FHX A;  2LOX A;  2MDX A;  2M14 A;  2YT2 A;  1TQZ A;  4K2O A;  5HE2 A;  2W2W A;  1Z87 A;  2DTC A;  2Z4D A;  2D10 A;  2KIG A;  1PLS A;  1ZVR A;  4CYE A;  1WJM A;  2DN6 A;  2EC1 A;  5D3X A;  1U27 A;  2COF A;  2D9Z A;  1DBH A;  2YS1 A;  1FHO A;  3TFM A;  3P7Z A;  1V5M A;  2KIE A;  3WYF B;  1EF1 A;  2VSZ A;  3ML4 A;  2MKR A;  2KUP A;  1TXD A;  1X1F A;  3ZVR A;  4K17 A;  3CXB B;  4HAY B;  3B77 A;  4DX8 A;  3QWM A;  4Z2M B;  3NW8 A;  1V88 A;  2K49 A;  4HAX B;  5HE1 A;  1ZM0 A;  1MI1 A;  1FGZ A;  3DCX A;  3MDB C;  1BAK A;  2ROV A;  2YVC A;  4K81 A;  2PZ1 A;  3ULB A;  2CAY A;  4NSW A;  3LJU X;  1QQG A;  2P8V A;  5DI9 B;  4EJN A;  1SHC A;  3AU4 A;  2KUQ A;  5HE0 A;  5LOP B;  2YS3 A;  3FVC A;  1FOE A;  2RLO A;  1AWE A;  1XR0 B;  2UVM A;  1GC7 A;  2DLW A;  1MAI A;  5IRS A;  1MIZ B;  2Z13 A;  1B55 A;  4BBK A;  3QBV B;  4YL8 A;  2I5C A;  3ULC A;  4H8S A;  3QIJ A;  4OSN A;  2GS0 A;  4D0N B;  2K8E A;  2HTH B;  4GMX B;  2AL6 A;  3VOQ A;  3D8E A;  2J0M A;  2LG1 A;  4HHV A;  4L6E A;  5I2S A;  4XWX A;  3UZT A;  2KCJ A;  2RNR B;  5JHG A;  3ZDT A;  2Z0P A;  1SGH A;  3SO6 A;  4B6H A;  2CRF A;  1W1H A;  5C16 A;  2YS5 A;  3NWF A;  2NBV A;  1DRO A;  1K5D B;  1U2B A;  2EJ8 A;  1MIX A;  1DDW A;  2AEH A;  3FSS A;  2JP2 A;  4ZRJ A;  1MK7 B;  1MPH A;  4GOU A;  4F7U P;  3WA0 A;  4WSF A;  3DXD A;  1Y5O A;  2NZ8 B;  2OTX A;  3G9W A;  4HDO A;  1I2H A;  5L81 A;  1K5G B;  1PFJ A;  5I2M A;  1Q67 A;  4HB0 B;  3V5W A;  3HIE A;  2IYB A;  2K00 A;  1WVH A;  4HAW B;  3SYX A;  5KCV A;  1EGX A;  2IFS A;  4HAZ B;  3U8Z A;  4QJ5 B;  4HDQ A;  2D9V A;  1U5D A;  4CHM A;  2YSZ A;  1V89 A;  4GN1 A;  3SUZ A;  1BTK A;  2DFK A;  2YF0 A;  4C0A A;  4PNK A;  4TKN A;  3KY9 A;  5M4Y B;  1KI1 B;  2COD A;  4KHA A;  3A98 B;  3PP2 A;  2DHI A;  5FI0 A;  2R2Y A;  2VKI A;  3TO1 A;  3PEG A;  3SV1 A;  4HSI A;  1BTN A;  2Z14 A;  2OQB A;  1N3H A;  2MFQ A;  1P6S A;  4A6F B;  1OMW A;  1NI2 A;  4TYZ A;  4IAP A;  1GG3 A;  5DH9 B;  1KZ7 A;  5J3T A;  1MK9 B;  5JHH A;  1U5F A;  1U5G A;  1E5W A;  3A58 A;  5D3Y A;  1XKE A;  4EMO A;  4A6F A;  3GYO A;  2L2I A;  3HK0 A;  1UPR A;  1EVH A;  1NTV A;  2D9W A;  5DIF B;  4A5K A;  2Z59 A;  2HE7 A;  4MT7 A;  5JP4 A;  3GYP A;  3D8D A;  4MY6 A;  2CY4 A;  1M7E A;  2DHJ A;  1RRP B;  5EFX A;  5J3Y A;  2LYD A;  1FB8 A;  2KR0 A;  2DYQ A;  1KZG A;  1ZC3 B;  1WG7 A;  2GCJ A;  4QJ4 B;  2M38 A;  4K2P A;  1U5E A;  5KQ1 A;  2Z0O A;  3O96 A;  3NWA A;  1X11 A;  3ODW A;  2ROZ B;  4IOY X;  4Y94 A;  1W1D A;  1GC6 A;  2E2X A;  2UZR A;  3M1I B;  5C5B B;  2I1J A;  1PMS A;  1ZC4 B;  4KHB B;  1UNQ A;  3BIN A;  2P0D A;  5KQ4 A;  2DA0 A;  3PVL A;  1ZYI A;  4HB3 B;  2ELA A;  1DDM A;  1XCG A;  3OAN A;  5C5B A;  1UEF A;  2MWN B;  2XQN M;  4F7H A;  2DX5 A;  2ZKM X;  2UZS A;  3F5R A;  4KHB A;  2D2Q A;  2FJU B;  3U7D A;  2D9Y A;  3PVW A;  3HW2 B;  1DYN A;  2RVB B;  5LON B;  3P6A A;  2GUM A;  3TVV A;  4KAX B;  1W1G A;  2ADZ A;  5GOW B;  2DHK A;  5CLQ B;  4KVG B;  2COA A;  1WGQ A;  2W2X D;  3KRX A;  3OHM B;  1UPQ A;  5C79 A;  3KRW A;  4HAT B;  2GJY A;  1WJ1 A;  3ODO A;  2LOZ A;  1UNR A;  1DDV A;  1P5T A;  4MK0 A;  1H10 A;  4A6H A;  2D4Q A;  4QJ3 B;  3SNH A;  2L1C A;  3F0W A;  2N23 A;  1OY2 A;  3NWD A;  2D9X A;  1XX0 A;  1EAZ A;  5JLJ B;  2X18 A;  2V76 A;  4A6K A;  4CHJ A;  1V61 A;  5C6R A;  2LKO A;  4CSQ A;  3HSA A;  2G35 A;  4GXB A;  2W2X C;  2N0Y A;  4QXA B;  1ZSQ A;  2K2J A;  4DX9 0;  3KZ1 A;  1FHW A;  5HE3 A;  3PVU A;  3ODX A;  3PSC A;  1RJ2 A;  1QC6 A;  1BWN A;  4P7I A;  2QKM A;  4IFS A;  5D3W A;  3CIK A;  2FJL A;  1TJ6 A;  1X05 A;  2BCJ A;  5DHF B;  4D6W A;  4L1R A;  4GPT B;  4DBB A;  1LB1 A;  1LW3 A;  1MKE A;  4YON A;  3AJ4 A;  4GMV A;  1X86 A;  2R0D A;  3HQC A;  1X1G A;  3TCA A;  2LUL A;  1FGY A;  2H7D A;  2YRY A;  2YT0 A;  1AQC A;  3MPX A;  4DXA B;  2VRW B;  2RSG A;  3VIA A;  2RUK B;  2DKP A;  1XD4 A;  2RGN B;  3A8Q A;  2QKL A;  2J0K A;  5DHA B;  1I7A A;  1P3R A;  4Z2N A;  2I5F A;  3D8F A;  2Z0Q A;  3BJI A;  2EMS A;  3FM8 C;  2I1K A;  3DXC A;  5LG4 B;  4PQ0 A;  2J0J A;  3AU5 A;  5J3Q A;  1NU2 A;  3PG7 A;  3IVF A;  2ELB A;  4HAV B;  3TW1 A;  2KGX B;  2DX1 A;  1OQN A;  4HB4 B;  1NTY A;  3RCP A;  2D11 A;  3NSU A;  2P0F A;  4GNK B;  4HB2 B;  3U12 A;  3PZD A;  4GZU A;  3DXE A;  3FEH A;  4EKU A;  1J0W A;  1V5U A;  2Y8F A;  4F7G A;  1XOD A;  4WVF B;  1IRS A;  1ISN A;  4ZRI A; 
#chains in the Genus database with same CATH homology
 4WJ7 A;  3KSY A;  2YT1 A;  1WGU A;  2H7E A;  3X23 A;  1WI1 A;  5FI1 A;  1FAO A;  2Y7B A;  2Y8G A;  2CY5 A;  3A8P A;  1J19 A;  2DKQ A;  2P0H A;  2Q13 A;  5D27 A;  3T06 A;  1H4R A;  2R09 A;  2NMB A;  1V5P A;  3N7C A;  2J59 M;  4NY0 A;  4HAU B;  1UNP A;  2ZPY A;  2EMT A;  5D3V A;  1M7R A;  4ZRK A;  1Y19 B;  4KHO A;  2K2U A;  2DYN A;  2COC A;  5CLL B;  1U29 A;  2GCL A;  1FHX A;  2LOX A;  2MDX A;  2M14 A;  4K2O A;  1TQZ A;  5HE2 A;  2W2W A;  1Z87 A;  2DTC A;  2D10 A;  1PLS A;  1ZVR A;  4CYE A;  1WJM A;  2DN6 A;  2EC1 A;  5D3X A;  1U27 A;  2COF A;  2D9Z A;  1DBH A;  2YS1 A;  1FHO A;  3TFM A;  3P7Z A;  1V5M A;  3WYF B;  1EF1 A;  2VSZ A;  3ML4 A;  2MKR A;  2KUP A;  1TXD A;  1X1F A;  3ZVR A;  4K17 A;  3CXB B;  4HAY B;  4DX8 A;  3QWM A;  4Z2M B;  1V88 A;  4HAX B;  5HE1 A;  1ZM0 A;  1FGZ A;  3MDB C;  1BAK A;  2ROV A;  2YVC A;  4K81 A;  2PZ1 A;  3ULB A;  2CAY A;  4NSW A;  3LJU X;  1QQG A;  2P8V A;  5DI9 B;  4EJN A;  1SHC A;  3AU4 A;  5HE0 A;  5LOP B;  2YS3 A;  1FOE A;  2RLO A;  1AWE A;  1XR0 B;  2UVM A;  1GC7 A;  2DLW A;  1MAI A;  1MIZ B;  1B55 A;  4BBK A;  3QBV B;  4YL8 A;  2I5C A;  3ULC A;  4H8S A;  3QIJ A;  2GS0 A;  4D0N B;  2HTH B;  4GMX B;  2AL6 A;  3VOQ A;  3D8E A;  2J0M A;  2LG1 A;  4HHV A;  4L6E A;  4XWX A;  3UZT A;  2KCJ A;  2RNR B;  5JHG A;  3ZDT A;  2Z0P A;  1SGH A;  3SO6 A;  4B6H A;  2CRF A;  1W1H A;  5C16 A;  2YS5 A;  1DRO A;  1K5D B;  1U2B A;  2EJ8 A;  1MIX A;  1DDW A;  2AEH A;  3FSS A;  2JP2 A;  4ZRJ A;  1MK7 B;  1MPH A;  4F7U P;  3WA0 A;  4WSF A;  3DXD A;  1Y5O A;  2NZ8 B;  2OTX A;  3G9W A;  4HDO A;  1I2H A;  5L81 A;  1K5G B;  1PFJ A;  1Q67 A;  4HB0 B;  3V5W A;  2IYB A;  2K00 A;  1WVH A;  4HAW B;  3SYX A;  5KCV A;  1EGX A;  2IFS A;  4HAZ B;  3U8Z A;  4HDQ A;  2D9V A;  1U5D A;  4CHM A;  2YSZ A;  1V89 A;  4GN1 A;  3SUZ A;  1BTK A;  2DFK A;  2YF0 A;  4C0A A;  4PNK A;  4TKN A;  3KY9 A;  1KI1 B;  2COD A;  4KHA A;  3A98 B;  3PP2 A;  2DHI A;  5FI0 A;  2VKI A;  3TO1 A;  3PEG A;  3SV1 A;  1BTN A;  2OQB A;  1N3H A;  2MFQ A;  1P6S A;  4A6F B;  1OMW A;  1NI2 A;  4TYZ A;  4IAP A;  1GG3 A;  5DH9 B;  1KZ7 A;  5J3T A;  1MK9 B;  5JHH A;  1U5F A;  1U5G A;  1E5W A;  5D3Y A;  4EMO A;  1XKE A;  4A6F A;  3GYO A;  2L2I A;  3HK0 A;  1UPR A;  1EVH A;  1NTV A;  2D9W A;  5DIF B;  4A5K A;  2HE7 A;  4MT7 A;  5JP4 A;  3GYP A;  3D8D A;  4MY6 A;  2CY4 A;  1M7E A;  2DHJ A;  1RRP B;  5EFX A;  5J3Y A;  2LYD A;  1FB8 A;  2DYQ A;  1KZG A;  1ZC3 B;  1WG7 A;  2GCJ A;  2M38 A;  4K2P A;  1U5E A;  5KQ1 A;  3O96 A;  2Z0O A;  1X11 A;  3ODW A;  2ROZ B;  4IOY X;  4Y94 A;  1W1D A;  1GC6 A;  2E2X A;  2UZR A;  3M1I B;  5C5B B;  2I1J A;  1PMS A;  1ZC4 B;  4KHB B;  1UNQ A;  3BIN A;  2P0D A;  5KQ4 A;  2DA0 A;  3PVL A;  4HB3 B;  2ELA A;  1DDM A;  1XCG A;  3OAN A;  5C5B A;  1UEF A;  2MWN B;  2XQN M;  4F7H A;  2DX5 A;  2UZS A;  3F5R A;  2D2Q A;  3U7D A;  2D9Y A;  3PVW A;  3HW2 B;  1DYN A;  2RVB B;  5LON B;  3P6A A;  3TVV A;  4KAX B;  1W1G A;  2ADZ A;  5GOW B;  2DHK A;  5CLQ B;  4KVG B;  2COA A;  1WGQ A;  2W2X D;  3KRX A;  1UPQ A;  5C79 A;  3KRW A;  4HAT B;  2GJY A;  1WJ1 A;  3ODO A;  2LOZ A;  1UNR A;  1DDV A;  1P5T A;  4MK0 A;  1H10 A;  4A6H A;  2D4Q A;  3SNH A;  2L1C A;  3F0W A;  2N23 A;  1OY2 A;  2D9X A;  1XX0 A;  1EAZ A;  5JLJ B;  2X18 A;  2V76 A;  4A6K A;  4CHJ A;  1V61 A;  5C6R A;  2LKO A;  2G35 A;  4GXB A;  2W2X C;  2N0Y A;  1ZSQ A;  2K2J A;  4DX9 0;  3KZ1 A;  1FHW A;  5HE3 A;  3PVU A;  3ODX A;  3PSC A;  1RJ2 A;  1QC6 A;  1BWN A;  4P7I A;  2QKM A;  4IFS A;  5D3W A;  3CIK A;  2FJL A;  1TJ6 A;  1X05 A;  2BCJ A;  5DHF B;  4GPT B;  4DBB A;  1LB1 A;  1LW3 A;  1MKE A;  4YON A;  3AJ4 A;  4GMV A;  1X86 A;  2R0D A;  3HQC A;  1X1G A;  3TCA A;  2LUL A;  1FGY A;  2H7D A;  2YRY A;  2YT0 A;  1AQC A;  3MPX A;  4DXA B;  2VRW B;  2RSG A;  3VIA A;  2RUK B;  2DKP A;  1XD4 A;  2RGN B;  3A8Q A;  2QKL A;  2J0K A;  5DHA B;  1I7A A;  1P3R A;  4Z2N A;  2I5F A;  3D8F A;  2Z0Q A;  3BJI A;  2EMS A;  3FM8 C;  2I1K A;  3DXC A;  4PQ0 A;  2J0J A;  3AU5 A;  5J3Q A;  1NU2 A;  3PG7 A;  3IVF A;  2ELB A;  4HAV B;  3TW1 A;  2KGX B;  2DX1 A;  1OQN A;  4HB4 B;  1NTY A;  3RCP A;  2D11 A;  3NSU A;  2P0F A;  4HB2 B;  3PZD A;  4GZU A;  3DXE A;  3FEH A;  4EKU A;  1J0W A;  1V5U A;  2Y8F A;  4F7G A;  1XOD A;  4WVF B;  1IRS A;  1ISN A;  4ZRI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...