2KUPA

Solution structure of the complex of the ptb domain of snt-2 and 19-residue peptide (aa 1571-1589) of halk
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
146
structure length
146
Chain Sequence
GSSGSSGLNRDSVPDNHPTKFKVTNVDDEGVELGSGVMELTQSELVLHLHRREAVRWPYLCLRRYGYDSNLFSFESGRRCQTGQGIFAFKCSRAEEIFNLLQDLMQCNSINVMEEPVIITRNSHPAELDLPRAPQPPNALGYTVSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for the recognition of nucleophosmin-anaplastic lymphoma kinase oncoprotein by the phosphotyrosine binding domain of Suc1-associated neurotrophic factor-induced tyrosine-phosphorylated target-2
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein/oncoprotein
molecule keywords Fibroblast growth factor receptor substrate 3
total genus 21
structure length 146
sequence length 146
ec nomenclature
pdb deposition date 2010-02-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02174 IRS PTB domain (IRS-1 type)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2kupA01
2DX5A 2DA0A 1Q67A 3VOQA 1W1DA 3KRXA 4EJNA 1FHWA 1PLSA 1DDMA 1MPHA 1TXDA 2I5FA 1MIXA 3D8EA 4CYEA 1MK7B 4HB0B 1AWEA 2D10A 2IYBA 2DHJA 1I2HA 2ROVA 2Q13A 2R0DA 2RLOA 2HE7A 5DH9B 4IFSA 5FI1A 2Y8GA 4HAVB 1KI1B 1OQNA 1BWNA 1WVHA 4IAPA 1K5DB 1SGHA 2CODA 1ZC4B 4H8SA 3HQCA 1V5PA 2J0JA 2MDXA 1NTVA 2K00A 2Y8FA 1P6SA 3SYXA 2I5CA 1ZM0A 5J3TA 2DLWA 3ODOA 1UNQA 4WSFA 4L6EA 4TYZA 2YRYA 1LW3A 4C0AA 4NSWA 1TQZA 3ODXA 4GPTB 3KY9A 1U27A 1MIZB 2D4QA 3FEHA 2NMBA 2P0HA 3HK0A 1MAIA 3ODWA 1RJ2A 4TKNA 2R09A 2D9YA 1EAZA 4Z2MB 2M38A 3UZTA 1X1GA 4ZRIA 3SV1A 1Z87A 3WA0A 2LG1A 4PQ0A 3SO6A 5C5BA 1DROA 4K2PA 1U5DA 1M7RA 4EMOA 2D9VA 4KHOA 1UNRA 4GXBA 3P7ZA 3VIAA 3QIJA 1NTYA 4PNKA 1IRSA 1DDVA 4K81A 4ZRJA 3DXEA 1EVHA 3SNHA 5KQ4A 1J19A 1P5TA 1UPRA 1U5FA 3KRWA 1J0WA 3P6AA 1X05A 3ULBA 2PZ1A 2KGXB 3BJIA 1DYNA 2RUKB 3QBVB 3V5WA 3FM8C 2W2XD 2YS3A 2D9WA 5KQ1A 2JP2A 1PFJA 2MWNB 5HE1A 4EKUA 5DIFB 2M14A 4A5KA 3RCPA 3IVFA 3HW2B 1NU2A 1GC6A 1XX0A 4MK0A 3F5RA 2LOXA 1BTNA 5EFXA 4P7IA 1V89A 2LOZA 2CY5A 2L2IA 3GYOA 2G35A 3SUZA 1FGYA 1MK9B 5CLQB 5C79A 3PP2A 1M7EA 2KUPA 1ZSQA 1X1FA 4HAWB 3M1IB 4A6FB 1TJ6A 2OQBA 3ZVRA 4IOYX 4HB4B 3O96A 2YS5A 1BAKA 2GCLA 3CIKA 5HE0A 2Z0PA 4HAZB 2GS0A 2AL6A 1FHXA 5KCVA 4F7HA 2DKQA 3F0WA 4YL8A 2N23A 1WJ1A 4Z2NA 2RSGA 3LJUX 1I7AA 3ML4A 5JHHA 2BCJA 2CAYA 1H4RA 2DX1A 1X11A 4GZUA 4A6FA 2DFKA 1LB1A 4HAXB 3TVVA 2E2XA 4HHVA 2CRFA 5D3YA 1B55A 2Z0OA 4K17A 5FI0A 2GJYA 3AU5A 2OTXA 2MKRA 4K2OA 2V76A 1OY2A 3PSCA 2RNRB 1H10A 1DDWA 5C6RA 1FOEA 5J3YA 1XD4A 2ELAA 3AU4A 1E5WA 1WGQA 5CLLB 2DHKA 5LONB 3CXBB 2UZSA 2DYNA 2DHIA 2DYQA 1WG7A 1UPQA 5HE3A 2D2QA 2IFSA 4DX90 3A8QA 1NI2A 1OMWA 1XCGA 2COFA 1ZC3B 3D8FA 3GYPA 3DXDA 2EMSA 4A6KA 1RRPB 1EGXA 1ISNA 1WGUA 1GG3A 3OANA 2DTCA 3X23A 1SHCA 5DHAB 1U5GA 2DKPA 3PEGA 1P3RA 3TO1A 2AEHA 4DBBA 1FHOA 2I1KA 3N7CA 1KZGA 5GOWB 4WJ7A 3PZDA 1Y19B 5HE2A 2YF0A 2YSZA 2QKMA 1QQGA 3AJ4A 5J3QA 1V5MA 2H7EA 2LYDA 4XWXA 2KCJA 2VSZA 2COAA 3TFMA 1U2BA 4D0NB 3A98B 2Y7BA 2YVCA 2YT1A 2QKLA 1XODA 1U5EA 2P8VA 2ROZB 2Z0QA 2RGNB 4A6HA 4ZRKA 1WI1A 3ULCA 2EMTA 2J0KA 1UEFA 1AQCA 5DI9B 5D3VA 3A8PA 3T06A 3PVLA 4HDOA 3U8ZA 2COCA 4GN1A 2XQNM 2L1CA 4NY0A 2H7DA 4BBKA 2YS1A 2GCJA 4YONA 3FSSA 1XR0B 5L81A 1MKEA 1EF1A 5D3XA 4KVGB 3ZDTA 3TCAA 3NSUA 4DX8A 1FB8A 1DBHA 4CHMA 2EJ8A 1XKEA 4WVFB 5D27A 3PVUA 3G9WA 2P0DA 2P0FA 1PMSA 2X18A 2ZPYA 3D8DA 4DXAB 2HTHB 1FGZA 1W1HA 2ELBA 1V5UA 1FAOA 1X86A 3KZ1A 4KHAA 3PG7A 1N3HA 2W2WA 3DXCA 4KHBB 5JLJB 2MFQA 4HAUB 5C5BB 4GMVA 3QWMA 1QC6A 1V88A 2D9ZA 2VKIA 4B6HA 2ADZA 3TW1A 5C16A 3BINA 5JHGA 1W1GA 2J59M 3PVWA 4MT7A 1GC7A 4GMXB 1Y5OA 2NZ8B 2CY4A 2VRWB 2D11A 5JP4A 2W2XC 4HB2B 2LKOA 5LOPB 3MPXA 3WYFB 2N0YA 5DHFB 1UNPA 4HB3B 4HATB 3KSYA 2RVBB 2DN6A 2UZRA 4F7GA 3MDBC 2K2UA 4CHJA 1U29A 4HDQA 2EC1A 1V61A 4F7UP 2D9XA 4Y94A 1KZ7A 1K5GB 4MY6A 3U7DA 1WJMA 2K2JA 2LULA 1ZVRA 2UVMA 2J0MA 2I1JA 2FJLA 2YT0A 4KAXB 5D3WA 1BTKA 4HAYB
chains in the Genus database with same CATH superfamily
2DX5A 2DA0A 1Q67A 3VOQA 1W1DA 3KRXA 4EJNA 1ZYIA 1FHWA 1PLSA 1DDMA 1MPHA 1TXDA 2Z14A 2I5FA 1MIXA 3D8EA 4CYEA 1MK7B 4HB0B 1AWEA 2D10A 2IYBA 2DHJA 1I2HA 2ROVA 2Q13A 2R0DA 2RLOA 4DIXA 2HE7A 5DH9B 4IFSA 5FI1A 2Y8GA 4HAVB 2FJUB 1KI1B 1OQNA 1BWNA 1WVHA 4IAPA 1K5DB 1SGHA 2CODA 1ZC4B 4H8SA 2ZKMX 3HQCA 1V5PA 2J0JA 2MDXA 1NTVA 2K00A 2Y8FA 1P6SA 3SYXA 2I5CA 1ZM0A 5J3TA 2DLWA 3ODOA 1UNQA 4WSFA 4L6EA 4TYZA 2YRYA 1LW3A 3HIEA 2Z59A 4C0AA 4NSWA 1TQZA 3ODXA 4GPTB 2YT2A 3KY9A 1U27A 1MIZB 2D4QA 3FEHA 2KIGA 2NMBA 2P0HA 3HK0A 1MAIA 3ODWA 2K8EA 3NWDA 1RJ2A 4TKNA 2R09A 2D9YA 1EAZA 4L1RA 4Z2MB 2M38A 4QJ5B 3UZTA 1X1GA 4ZRIA 3SV1A 1Z87A 3WA0A 2LG1A 4PQ0A 3SO6A 5C5BA 5I2MA 1DROA 4K2PA 1U5DA 1M7RA 4EMOA 2D9VA 4KHOA 1UNRA 3NW8A 4GXBA 3P7ZA 3VIAA 3QIJA 1NTYA 4PNKA 1IRSA 1DDVA 4K81A 4ZRJA 3DXEA 1EVHA 3SNHA 5KQ4A 1J19A 3B77A 1P5TA 4OT1A 1UPRA 1U5FA 3KRWA 1J0WA 3P6AA 1X05A 3ULBA 2PZ1A 2KGXB 3BJIA 1DYNA 2RUKB 3QBVB 3V5WA 3FM8C 2W2XD 2YS3A 2D9WA 5KQ1A 2JP2A 1PFJA 5I2SA 2MWNB 5HE1A 4EKUA 2KUQA 5DIFB 1MI1A 2M14A 4A5KA 3RCPA 3FVCA 3HW2B 3IVFA 1NU2A 1GC6A 1XX0A 4MK0A 4QXAB 5IRSA 3F5RA 2LOXA 1BTNA 5EFXA 3A58A 4P7IA 1V89A 2LOZA 2CY5A 2L2IA 3GYOA 2G35A 3SUZA 1FGYA 1MK9B 5CLQB 5C79A 3PP2A 1M7EA 2KUPA 1ZSQA 1X1FA 4HAWB 3M1IB 4A6FB 1TJ6A 2OQBA 3ZVRA 4IOYX 4HB4B 3O96A 2YS5A 1BAKA 2GCLA 3CIKA 5HE0A 2Z0PA 4HAZB 2GS0A 2AL6A 1FHXA 2KIEA 5KCVA 4F7HA 2DKQA 3F0WA 4YL8A 2N23A 1WJ1A 4Z2NA 2RSGA 3LJUX 1I7AA 3ML4A 5JHHA 2BCJA 2CAYA 1H4RA 2DX1A 1X11A 4GZUA 4A6FA 2DFKA 1LB1A 4HAXB 3TVVA 2E2XA 4HHVA 2CRFA 5D3YA 1B55A 2Z0OA 4K17A 5FI0A 2GJYA 3AU5A 2OTXA 2MKRA 4K2OA 2V76A 1OY2A 3PSCA 2RNRB 1H10A 1DDWA 5C6RA 4QJ3B 1FOEA 5J3YA 1XD4A 2ELAA 3AU4A 1E5WA 1WGQA 5CLLB 2DHKA 5LONB 3CXBB 2UZSA 2DYNA 2DHIA 2DYQA 1WG7A 1UPQA 5HE3A 2D2QA 4CSQA 2IFSA 4DX90 3A8QA 1NI2A 1OMWA 1XCGA 2R2YA 2COFA 1ZC3B 3D8FA 3GYPA 3DXDA 2EMSA 4A6KA 1RRPB 1EGXA 1ISNA 1WGUA 1GG3A 3OANA 2DTCA 3U12A 3X23A 3DCXA 1SHCA 5DHAB 1U5GA 2DKPA 3PEGA 1P3RA 3TO1A 2AEHA 4DBBA 5M4YB 1FHOA 2I1KA 3N7CA 1KZGA 5GOWB 4WJ7A 3HSAA 3PZDA 1Y19B 5HE2A 2YF0A 2YSZA 2QKMA 1QQGA 3AJ4A 3OHMB 2KR0A 5J3QA 1V5MA 2H7EA 2LYDA 4XWXA 2KCJA 2VSZA 2COAA 3TFMA 1U2BA 4KHBA 4D0NB 3A98B 2Y7BA 2YVCA 2YT1A 2QKLA 1XODA 1U5EA 2P8VA 2ROZB 2Z0QA 2RGNB 4A6HA 4ZRKA 1WI1A 3ULCA 2EMTA 2J0KA 1UEFA 1AQCA 5DI9B 5D3VA 3A8PA 3T06A 3PVLA 4HDOA 3U8ZA 2COCA 4GOUA 4GN1A 2XQNM 2L1CA 4NY0A 2H7DA 4BBKA 2YS1A 2GCJA 4YONA 3FSSA 2K49A 1XR0B 5L81A 1MKEA 1EF1A 5D3XA 4KVGB 3ZDTA 2Z13A 3TCAA 3NWFA 3NSUA 4DX8A 1FB8A 1DBHA 4CHMA 2EJ8A 1XKEA 4WVFB 5D27A 3PVUA 3G9WA 2P0DA 2P0FA 1PMSA 2X18A 2ZPYA 3D8DA 4DXAB 2HTHB 1FGZA 1W1HA 2ELBA 1V5UA 1FAOA 1X86A 3KZ1A 4KHAA 3PG7A 1N3HA 2W2WA 3DXCA 4KHBB 5JLJB 2MFQA 2GUMA 4HAUB 5C5BB 4GMVA 3QWMA 1QC6A 1V88A 2D9ZA 2VKIA 4B6HA 2ADZA 3TW1A 5C16A 3BINA 5JHGA 1W1GA 2Z4DA 2J59M 3PVWA 3NWAA 4MT7A 1GC7A 4GMXB 1Y5OA 2NZ8B 2CY4A 4OSNA 4HSIA 2VRWB 2D11A 5JP4A 2W2XC 4HB2B 2LKOA 5LOPB 3MPXA 5LG4B 3WYFB 2N0YA 2RRFA 4QJ4B 5DHFB 1UNPA 4D6WA 4HB3B 4HATB 3KSYA 2RVBB 2DN6A 2UZRA 2NBVA 4F7GA 3MDBC 2K2UA 4CHJA 1U29A 4HDQA 2EC1A 1V61A 4GNKB 4F7UP 2D9XA 4Y94A 1KZ7A 1K5GB 4MY6A 1T77A 3U7DA 1WJMA 2K2JA 2LULA 1ZVRA 2UVMA 2J0MA 2I1JA 2FJLA 2YT0A 4KAXB 5D3WA 1BTKA 4HAYB
chains in the Genus database with same CATH topology
2DX5A 2DA0A 1Q67A 3VOQA 1W1DA 3KRXA 4EJNA 1FHWA 1PLSA 1DDMA 1MPHA 1TXDA 2I5FA 1MIXA 3D8EA 4CYEA 1MK7B 4HB0B 1AWEA 2D10A 2IYBA 2DHJA 1I2HA 2ROVA 2Q13A 2R0DA 2RLOA 2HE7A 5DH9B 4IFSA 5FI1A 2Y8GA 4HAVB 1KI1B 1OQNA 1BWNA 1WVHA 4IAPA 1K5DB 1SGHA 2CODA 1ZC4B 4H8SA 3HQCA 1V5PA 2J0JA 2MDXA 1NTVA 2K00A 2Y8FA 1P6SA 3SYXA 2I5CA 1ZM0A 5J3TA 2DLWA 3ODOA 1UNQA 4WSFA 4L6EA 4TYZA 2YRYA 1LW3A 4C0AA 4NSWA 1TQZA 3ODXA 4GPTB 3KY9A 1U27A 1MIZB 2D4QA 3FEHA 2NMBA 2P0HA 3HK0A 1MAIA 3ODWA 1RJ2A 4TKNA 2R09A 2D9YA 1EAZA 4Z2MB 2M38A 3UZTA 1X1GA 4ZRIA 3SV1A 1Z87A 3WA0A 2LG1A 4PQ0A 3SO6A 5C5BA 1DROA 4K2PA 1U5DA 1M7RA 4EMOA 2D9VA 4KHOA 1UNRA 4GXBA 3P7ZA 3VIAA 3QIJA 1NTYA 4PNKA 1IRSA 1DDVA 4K81A 4ZRJA 3DXEA 1EVHA 3SNHA 5KQ4A 1J19A 1P5TA 1UPRA 1U5FA 3KRWA 1J0WA 3P6AA 1X05A 3ULBA 2PZ1A 2KGXB 3BJIA 1DYNA 2RUKB 3QBVB 3V5WA 3FM8C 2W2XD 2YS3A 2D9WA 5KQ1A 2JP2A 1PFJA 2MWNB 5HE1A 4EKUA 5DIFB 2M14A 4A5KA 3RCPA 3IVFA 3HW2B 1NU2A 1GC6A 1XX0A 4MK0A 3F5RA 2LOXA 1BTNA 5EFXA 4P7IA 1V89A 2LOZA 2CY5A 2L2IA 3GYOA 2G35A 3SUZA 1FGYA 1MK9B 5CLQB 5C79A 3PP2A 1M7EA 2KUPA 1ZSQA 1X1FA 4HAWB 3M1IB 4A6FB 1TJ6A 2OQBA 3ZVRA 4IOYX 4HB4B 3O96A 2YS5A 1BAKA 2GCLA 3CIKA 5HE0A 2Z0PA 4HAZB 2GS0A 2AL6A 1FHXA 5KCVA 4F7HA 2DKQA 3F0WA 4YL8A 2N23A 1WJ1A 4Z2NA 2RSGA 3LJUX 1I7AA 3ML4A 5JHHA 2BCJA 2CAYA 1H4RA 2DX1A 1X11A 4GZUA 4A6FA 2DFKA 1LB1A 4HAXB 3TVVA 2E2XA 4HHVA 2CRFA 5D3YA 1B55A 2Z0OA 4K17A 5FI0A 2GJYA 3AU5A 2OTXA 2MKRA 4K2OA 2V76A 1OY2A 3PSCA 2RNRB 1H10A 1DDWA 5C6RA 1FOEA 5J3YA 1XD4A 2ELAA 3AU4A 1E5WA 1WGQA 5CLLB 2DHKA 5LONB 3CXBB 2UZSA 2DYNA 2DHIA 2DYQA 1WG7A 1UPQA 5HE3A 2D2QA 2IFSA 4DX90 3A8QA 1NI2A 1OMWA 1XCGA 2COFA 1ZC3B 3D8FA 3GYPA 3DXDA 2EMSA 4A6KA 1RRPB 1EGXA 1ISNA 1WGUA 1GG3A 3OANA 2DTCA 3X23A 1SHCA 5DHAB 1U5GA 2DKPA 3PEGA 1P3RA 3TO1A 2AEHA 4DBBA 1FHOA 2I1KA 3N7CA 1KZGA 5GOWB 4WJ7A 3PZDA 1Y19B 5HE2A 2YF0A 2YSZA 2QKMA 1QQGA 3AJ4A 5J3QA 1V5MA 2H7EA 2LYDA 4XWXA 2KCJA 2VSZA 2COAA 3TFMA 1U2BA 4D0NB 3A98B 2Y7BA 2YVCA 2YT1A 2QKLA 1XODA 1U5EA 2P8VA 2ROZB 2Z0QA 2RGNB 4A6HA 4ZRKA 1WI1A 3ULCA 2EMTA 2J0KA 1UEFA 1AQCA 5DI9B 5D3VA 3A8PA 3T06A 3PVLA 4HDOA 3U8ZA 2COCA 4GN1A 2XQNM 2L1CA 4NY0A 2H7DA 4BBKA 2YS1A 2GCJA 4YONA 3FSSA 1XR0B 5L81A 1MKEA 1EF1A 5D3XA 4KVGB 3ZDTA 3TCAA 3NSUA 4DX8A 1FB8A 1DBHA 4CHMA 2EJ8A 1XKEA 4WVFB 5D27A 3PVUA 3G9WA 2P0DA 2P0FA 1PMSA 2X18A 2ZPYA 3D8DA 4DXAB 2HTHB 1FGZA 1W1HA 2ELBA 1V5UA 1FAOA 1X86A 3KZ1A 4KHAA 3PG7A 1N3HA 2W2WA 3DXCA 4KHBB 5JLJB 2MFQA 4HAUB 5C5BB 4GMVA 3QWMA 1QC6A 1V88A 2D9ZA 2VKIA 4B6HA 2ADZA 3TW1A 5C16A 3BINA 5JHGA 1W1GA 2J59M 3PVWA 4MT7A 1GC7A 4GMXB 1Y5OA 2NZ8B 2CY4A 2VRWB 2D11A 5JP4A 2W2XC 4HB2B 2LKOA 5LOPB 3MPXA 3WYFB 2N0YA 5DHFB 1UNPA 4HB3B 4HATB 3KSYA 2RVBB 2DN6A 2UZRA 4F7GA 3MDBC 2K2UA 4CHJA 1U29A 4HDQA 2EC1A 1V61A 4F7UP 2D9XA 4Y94A 1KZ7A 1K5GB 4MY6A 3U7DA 1WJMA 2K2JA 2LULA 1ZVRA 2UVMA 2J0MA 2I1JA 2FJLA 2YT0A 4KAXB 5D3WA 1BTKA 4HAYB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DX5 A;  2DA0 A;  1Q67 A;  3VOQ A;  1W1D A;  3KRX A;  4EJN A;  1FHW A;  1PLS A;  1DDM A;  1MPH A;  1TXD A;  2I5F A;  1MIX A;  3D8E A;  4CYE A;  1MK7 B;  4HB0 B;  1AWE A;  2D10 A;  2IYB A;  2DHJ A;  1I2H A;  2ROV A;  2Q13 A;  2R0D A;  2RLO A;  2HE7 A;  5DH9 B;  4IFS A;  5FI1 A;  2Y8G A;  4HAV B;  1KI1 B;  1OQN A;  1BWN A;  1WVH A;  4IAP A;  1K5D B;  1SGH A;  2COD A;  1ZC4 B;  4H8S A;  3HQC A;  1V5P A;  2J0J A;  2MDX A;  1NTV A;  2K00 A;  2Y8F A;  1P6S A;  3SYX A;  2I5C A;  1ZM0 A;  5J3T A;  2DLW A;  3ODO A;  1UNQ A;  4WSF A;  4L6E A;  4TYZ A;  2YRY A;  1LW3 A;  4C0A A;  4NSW A;  1TQZ A;  3ODX A;  4GPT B;  3KY9 A;  1U27 A;  1MIZ B;  2D4Q A;  3FEH A;  2NMB A;  2P0H A;  3HK0 A;  1MAI A;  3ODW A;  1RJ2 A;  4TKN A;  2R09 A;  2D9Y A;  1EAZ A;  4Z2M B;  2M38 A;  3UZT A;  1X1G A;  4ZRI A;  3SV1 A;  1Z87 A;  3WA0 A;  2LG1 A;  4PQ0 A;  3SO6 A;  5C5B A;  1DRO A;  4K2P A;  1U5D A;  1M7R A;  4EMO A;  2D9V A;  4KHO A;  1UNR A;  4GXB A;  3P7Z A;  3VIA A;  3QIJ A;  1NTY A;  4PNK A;  1IRS A;  1DDV A;  4K81 A;  4ZRJ A;  3DXE A;  1EVH A;  3SNH A;  5KQ4 A;  1J19 A;  1P5T A;  1UPR A;  1U5F A;  3KRW A;  1J0W A;  3P6A A;  1X05 A;  3ULB A;  2PZ1 A;  2KGX B;  3BJI A;  1DYN A;  2RUK B;  3QBV B;  3V5W A;  3FM8 C;  2W2X D;  2YS3 A;  2D9W A;  5KQ1 A;  2JP2 A;  1PFJ A;  2MWN B;  5HE1 A;  4EKU A;  5DIF B;  2M14 A;  4A5K A;  3RCP A;  3IVF A;  3HW2 B;  1NU2 A;  1GC6 A;  1XX0 A;  4MK0 A;  3F5R A;  2LOX A;  1BTN A;  5EFX A;  4P7I A;  1V89 A;  2LOZ A;  2CY5 A;  2L2I A;  3GYO A;  2G35 A;  3SUZ A;  1FGY A;  1MK9 B;  5CLQ B;  5C79 A;  3PP2 A;  1M7E A;  2KUP A;  1ZSQ A;  1X1F A;  4HAW B;  3M1I B;  4A6F B;  1TJ6 A;  2OQB A;  3ZVR A;  4IOY X;  4HB4 B;  3O96 A;  2YS5 A;  1BAK A;  2GCL A;  3CIK A;  5HE0 A;  2Z0P A;  4HAZ B;  2GS0 A;  2AL6 A;  1FHX A;  5KCV A;  4F7H A;  2DKQ A;  3F0W A;  4YL8 A;  2N23 A;  1WJ1 A;  4Z2N A;  2RSG A;  3LJU X;  1I7A A;  3ML4 A;  5JHH A;  2BCJ A;  2CAY A;  1H4R A;  2DX1 A;  1X11 A;  4GZU A;  4A6F A;  2DFK A;  1LB1 A;  4HAX B;  3TVV A;  2E2X A;  4HHV A;  2CRF A;  5D3Y A;  1B55 A;  2Z0O A;  4K17 A;  5FI0 A;  2GJY A;  3AU5 A;  2OTX A;  2MKR A;  4K2O A;  2V76 A;  1OY2 A;  3PSC A;  2RNR B;  1H10 A;  1DDW A;  5C6R A;  1FOE A;  5J3Y A;  1XD4 A;  2ELA A;  3AU4 A;  1E5W A;  1WGQ A;  5CLL B;  2DHK A;  5LON B;  3CXB B;  2UZS A;  2DYN A;  2DHI A;  2DYQ A;  1WG7 A;  1UPQ A;  5HE3 A;  2D2Q A;  2IFS A;  4DX9 0;  3A8Q A;  1NI2 A;  1OMW A;  1XCG A;  2COF A;  1ZC3 B;  3D8F A;  3GYP A;  3DXD A;  2EMS A;  4A6K A;  1RRP B;  1EGX A;  1ISN A;  1WGU A;  1GG3 A;  3OAN A;  2DTC A;  3X23 A;  1SHC A;  5DHA B;  1U5G A;  2DKP A;  3PEG A;  1P3R A;  3TO1 A;  2AEH A;  4DBB A;  1FHO A;  2I1K A;  3N7C A;  1KZG A;  5GOW B;  4WJ7 A;  3PZD A;  1Y19 B;  5HE2 A;  2YF0 A;  2YSZ A;  2QKM A;  1QQG A;  3AJ4 A;  5J3Q A;  1V5M A;  2H7E A;  2LYD A;  4XWX A;  2KCJ A;  2VSZ A;  2COA A;  3TFM A;  1U2B A;  4D0N B;  3A98 B;  2Y7B A;  2YVC A;  2YT1 A;  2QKL A;  1XOD A;  1U5E A;  2P8V A;  2ROZ B;  2Z0Q A;  2RGN B;  4A6H A;  4ZRK A;  1WI1 A;  3ULC A;  2EMT A;  2J0K A;  1UEF A;  1AQC A;  5DI9 B;  5D3V A;  3A8P A;  3T06 A;  3PVL A;  4HDO A;  3U8Z A;  2COC A;  4GN1 A;  2XQN M;  2L1C A;  4NY0 A;  2H7D A;  4BBK A;  2YS1 A;  2GCJ A;  4YON A;  3FSS A;  1XR0 B;  5L81 A;  1MKE A;  1EF1 A;  5D3X A;  4KVG B;  3ZDT A;  3TCA A;  3NSU A;  4DX8 A;  1FB8 A;  1DBH A;  4CHM A;  2EJ8 A;  1XKE A;  4WVF B;  5D27 A;  3PVU A;  3G9W A;  2P0D A;  2P0F A;  1PMS A;  2X18 A;  2ZPY A;  3D8D A;  4DXA B;  2HTH B;  1FGZ A;  1W1H A;  2ELB A;  1V5U A;  1FAO A;  1X86 A;  3KZ1 A;  4KHA A;  3PG7 A;  1N3H A;  2W2W A;  3DXC A;  4KHB B;  5JLJ B;  2MFQ A;  4HAU B;  5C5B B;  4GMV A;  3QWM A;  1QC6 A;  1V88 A;  2D9Z A;  2VKI A;  4B6H A;  2ADZ A;  3TW1 A;  5C16 A;  3BIN A;  5JHG A;  1W1G A;  2J59 M;  3PVW A;  4MT7 A;  1GC7 A;  4GMX B;  1Y5O A;  2NZ8 B;  2CY4 A;  2VRW B;  2D11 A;  5JP4 A;  2W2X C;  4HB2 B;  2LKO A;  5LOP B;  3MPX A;  3WYF B;  2N0Y A;  5DHF B;  1UNP A;  4HB3 B;  4HAT B;  3KSY A;  2RVB B;  2DN6 A;  2UZR A;  4F7G A;  3MDB C;  2K2U A;  4CHJ A;  1U29 A;  4HDQ A;  2EC1 A;  1V61 A;  4F7U P;  2D9X A;  4Y94 A;  1KZ7 A;  1K5G B;  4MY6 A;  3U7D A;  1WJM A;  2K2J A;  2LUL A;  1ZVR A;  2UVM A;  2J0M A;  2I1J A;  2FJL A;  2YT0 A;  4KAX B;  5D3W A;  1BTK A;  4HAY B; 
#chains in the Genus database with same CATH topology
 2DX5 A;  2DA0 A;  1Q67 A;  3VOQ A;  1W1D A;  3KRX A;  4EJN A;  1ZYI A;  1FHW A;  1PLS A;  1DDM A;  1MPH A;  1TXD A;  2Z14 A;  2I5F A;  1MIX A;  3D8E A;  4CYE A;  1MK7 B;  4HB0 B;  1AWE A;  2D10 A;  2IYB A;  2DHJ A;  1I2H A;  2ROV A;  2Q13 A;  2R0D A;  2RLO A;  4DIX A;  2HE7 A;  5DH9 B;  4IFS A;  5FI1 A;  2Y8G A;  4HAV B;  2FJU B;  1KI1 B;  1OQN A;  1BWN A;  1WVH A;  4IAP A;  1K5D B;  1SGH A;  2COD A;  1ZC4 B;  4H8S A;  2ZKM X;  3HQC A;  1V5P A;  2J0J A;  2MDX A;  1NTV A;  2K00 A;  2Y8F A;  1P6S A;  3SYX A;  2I5C A;  1ZM0 A;  5J3T A;  2DLW A;  3ODO A;  1UNQ A;  4WSF A;  4L6E A;  4TYZ A;  2YRY A;  1LW3 A;  3HIE A;  2Z59 A;  4C0A A;  4NSW A;  1TQZ A;  3ODX A;  4GPT B;  2YT2 A;  3KY9 A;  1U27 A;  1MIZ B;  2D4Q A;  3FEH A;  2KIG A;  2NMB A;  2P0H A;  3HK0 A;  1MAI A;  3ODW A;  2K8E A;  3NWD A;  1RJ2 A;  4TKN A;  2R09 A;  2D9Y A;  1EAZ A;  4L1R A;  4Z2M B;  2M38 A;  4QJ5 B;  3UZT A;  1X1G A;  4ZRI A;  3SV1 A;  1Z87 A;  3WA0 A;  2LG1 A;  4PQ0 A;  3SO6 A;  5C5B A;  5I2M A;  1DRO A;  4K2P A;  1U5D A;  1M7R A;  4EMO A;  2D9V A;  4KHO A;  1UNR A;  3NW8 A;  4GXB A;  3P7Z A;  3VIA A;  3QIJ A;  1NTY A;  4PNK A;  1IRS A;  1DDV A;  4K81 A;  4ZRJ A;  3DXE A;  1EVH A;  3SNH A;  5KQ4 A;  1J19 A;  3B77 A;  1P5T A;  4OT1 A;  1UPR A;  1U5F A;  3KRW A;  1J0W A;  3P6A A;  1X05 A;  3ULB A;  2PZ1 A;  2KGX B;  3BJI A;  1DYN A;  2RUK B;  3QBV B;  3V5W A;  3FM8 C;  2W2X D;  2YS3 A;  2D9W A;  5KQ1 A;  2JP2 A;  1PFJ A;  5I2S A;  2MWN B;  5HE1 A;  4EKU A;  2KUQ A;  5DIF B;  1MI1 A;  2M14 A;  4A5K A;  3RCP A;  3FVC A;  3HW2 B;  3IVF A;  1NU2 A;  1GC6 A;  1XX0 A;  4MK0 A;  4QXA B;  5IRS A;  3F5R A;  2LOX A;  1BTN A;  5EFX A;  3A58 A;  4P7I A;  1V89 A;  2LOZ A;  2CY5 A;  2L2I A;  3GYO A;  2G35 A;  3SUZ A;  1FGY A;  1MK9 B;  5CLQ B;  5C79 A;  3PP2 A;  1M7E A;  2KUP A;  1ZSQ A;  1X1F A;  4HAW B;  3M1I B;  4A6F B;  1TJ6 A;  2OQB A;  3ZVR A;  4IOY X;  4HB4 B;  3O96 A;  2YS5 A;  1BAK A;  2GCL A;  3CIK A;  5HE0 A;  2Z0P A;  4HAZ B;  2GS0 A;  2AL6 A;  1FHX A;  2KIE A;  5KCV A;  4F7H A;  2DKQ A;  3F0W A;  4YL8 A;  2N23 A;  1WJ1 A;  4Z2N A;  2RSG A;  3LJU X;  1I7A A;  3ML4 A;  5JHH A;  2BCJ A;  2CAY A;  1H4R A;  2DX1 A;  1X11 A;  4GZU A;  4A6F A;  2DFK A;  1LB1 A;  4HAX B;  3TVV A;  2E2X A;  4HHV A;  2CRF A;  5D3Y A;  1B55 A;  2Z0O A;  4K17 A;  5FI0 A;  2GJY A;  3AU5 A;  2OTX A;  2MKR A;  4K2O A;  2V76 A;  1OY2 A;  3PSC A;  2RNR B;  1H10 A;  1DDW A;  5C6R A;  4QJ3 B;  1FOE A;  5J3Y A;  1XD4 A;  2ELA A;  3AU4 A;  1E5W A;  1WGQ A;  5CLL B;  2DHK A;  5LON B;  3CXB B;  2UZS A;  2DYN A;  2DHI A;  2DYQ A;  1WG7 A;  1UPQ A;  5HE3 A;  2D2Q A;  4CSQ A;  2IFS A;  4DX9 0;  3A8Q A;  1NI2 A;  1OMW A;  1XCG A;  2R2Y A;  2COF A;  1ZC3 B;  3D8F A;  3GYP A;  3DXD A;  2EMS A;  4A6K A;  1RRP B;  1EGX A;  1ISN A;  1WGU A;  1GG3 A;  3OAN A;  2DTC A;  3U12 A;  3X23 A;  3DCX A;  1SHC A;  5DHA B;  1U5G A;  2DKP A;  3PEG A;  1P3R A;  3TO1 A;  2AEH A;  4DBB A;  5M4Y B;  1FHO A;  2I1K A;  3N7C A;  1KZG A;  5GOW B;  4WJ7 A;  3HSA A;  3PZD A;  1Y19 B;  5HE2 A;  2YF0 A;  2YSZ A;  2QKM A;  1QQG A;  3AJ4 A;  3OHM B;  2KR0 A;  5J3Q A;  1V5M A;  2H7E A;  2LYD A;  4XWX A;  2KCJ A;  2VSZ A;  2COA A;  3TFM A;  1U2B A;  4KHB A;  4D0N B;  3A98 B;  2Y7B A;  2YVC A;  2YT1 A;  2QKL A;  1XOD A;  1U5E A;  2P8V A;  2ROZ B;  2Z0Q A;  2RGN B;  4A6H A;  4ZRK A;  1WI1 A;  3ULC A;  2EMT A;  2J0K A;  1UEF A;  1AQC A;  5DI9 B;  5D3V A;  3A8P A;  3T06 A;  3PVL A;  4HDO A;  3U8Z A;  2COC A;  4GOU A;  4GN1 A;  2XQN M;  2L1C A;  4NY0 A;  2H7D A;  4BBK A;  2YS1 A;  2GCJ A;  4YON A;  3FSS A;  2K49 A;  1XR0 B;  5L81 A;  1MKE A;  1EF1 A;  5D3X A;  4KVG B;  3ZDT A;  2Z13 A;  3TCA A;  3NWF A;  3NSU A;  4DX8 A;  1FB8 A;  1DBH A;  4CHM A;  2EJ8 A;  1XKE A;  4WVF B;  5D27 A;  3PVU A;  3G9W A;  2P0D A;  2P0F A;  1PMS A;  2X18 A;  2ZPY A;  3D8D A;  4DXA B;  2HTH B;  1FGZ A;  1W1H A;  2ELB A;  1V5U A;  1FAO A;  1X86 A;  3KZ1 A;  4KHA A;  3PG7 A;  1N3H A;  2W2W A;  3DXC A;  4KHB B;  5JLJ B;  2MFQ A;  2GUM A;  4HAU B;  5C5B B;  4GMV A;  3QWM A;  1QC6 A;  1V88 A;  2D9Z A;  2VKI A;  4B6H A;  2ADZ A;  3TW1 A;  5C16 A;  3BIN A;  5JHG A;  1W1G A;  2Z4D A;  2J59 M;  3PVW A;  3NWA A;  4MT7 A;  1GC7 A;  4GMX B;  1Y5O A;  2NZ8 B;  2CY4 A;  4OSN A;  4HSI A;  2VRW B;  2D11 A;  5JP4 A;  2W2X C;  4HB2 B;  2LKO A;  5LOP B;  3MPX A;  5LG4 B;  3WYF B;  2N0Y A;  2RRF A;  4QJ4 B;  5DHF B;  1UNP A;  4D6W A;  4HB3 B;  4HAT B;  3KSY A;  2RVB B;  2DN6 A;  2UZR A;  2NBV A;  4F7G A;  3MDB C;  2K2U A;  4CHJ A;  1U29 A;  4HDQ A;  2EC1 A;  1V61 A;  4GNK B;  4F7U P;  2D9X A;  4Y94 A;  1KZ7 A;  1K5G B;  4MY6 A;  1T77 A;  3U7D A;  1WJM A;  2K2J A;  2LUL A;  1ZVR A;  2UVM A;  2J0M A;  2I1J A;  2FJL A;  2YT0 A;  4KAX B;  5D3W A;  1BTK A;  4HAY B; 
#chains in the Genus database with same CATH homology
 2DX5 A;  2DA0 A;  1Q67 A;  3VOQ A;  1W1D A;  3KRX A;  4EJN A;  1FHW A;  1PLS A;  1DDM A;  1MPH A;  1TXD A;  2I5F A;  1MIX A;  3D8E A;  4CYE A;  1MK7 B;  4HB0 B;  1AWE A;  2D10 A;  2IYB A;  2DHJ A;  1I2H A;  2ROV A;  2Q13 A;  2R0D A;  2RLO A;  2HE7 A;  5DH9 B;  4IFS A;  5FI1 A;  2Y8G A;  4HAV B;  1KI1 B;  1OQN A;  1BWN A;  1WVH A;  4IAP A;  1K5D B;  1SGH A;  2COD A;  1ZC4 B;  4H8S A;  3HQC A;  1V5P A;  2J0J A;  2MDX A;  1NTV A;  2K00 A;  2Y8F A;  1P6S A;  3SYX A;  2I5C A;  1ZM0 A;  5J3T A;  2DLW A;  3ODO A;  1UNQ A;  4WSF A;  4L6E A;  4TYZ A;  2YRY A;  1LW3 A;  4C0A A;  4NSW A;  1TQZ A;  3ODX A;  4GPT B;  3KY9 A;  1U27 A;  1MIZ B;  2D4Q A;  3FEH A;  2NMB A;  2P0H A;  3HK0 A;  1MAI A;  3ODW A;  1RJ2 A;  4TKN A;  2R09 A;  2D9Y A;  1EAZ A;  4Z2M B;  2M38 A;  3UZT A;  1X1G A;  4ZRI A;  3SV1 A;  1Z87 A;  3WA0 A;  2LG1 A;  4PQ0 A;  3SO6 A;  5C5B A;  1DRO A;  4K2P A;  1U5D A;  1M7R A;  4EMO A;  2D9V A;  4KHO A;  1UNR A;  4GXB A;  3P7Z A;  3VIA A;  3QIJ A;  1NTY A;  4PNK A;  1IRS A;  1DDV A;  4K81 A;  4ZRJ A;  3DXE A;  1EVH A;  3SNH A;  5KQ4 A;  1J19 A;  1P5T A;  1UPR A;  1U5F A;  3KRW A;  1J0W A;  3P6A A;  1X05 A;  3ULB A;  2PZ1 A;  2KGX B;  3BJI A;  1DYN A;  2RUK B;  3QBV B;  3V5W A;  3FM8 C;  2W2X D;  2YS3 A;  2D9W A;  5KQ1 A;  2JP2 A;  1PFJ A;  2MWN B;  5HE1 A;  4EKU A;  5DIF B;  2M14 A;  4A5K A;  3RCP A;  3IVF A;  3HW2 B;  1NU2 A;  1GC6 A;  1XX0 A;  4MK0 A;  3F5R A;  2LOX A;  1BTN A;  5EFX A;  4P7I A;  1V89 A;  2LOZ A;  2CY5 A;  2L2I A;  3GYO A;  2G35 A;  3SUZ A;  1FGY A;  1MK9 B;  5CLQ B;  5C79 A;  3PP2 A;  1M7E A;  2KUP A;  1ZSQ A;  1X1F A;  4HAW B;  3M1I B;  4A6F B;  1TJ6 A;  2OQB A;  3ZVR A;  4IOY X;  4HB4 B;  3O96 A;  2YS5 A;  1BAK A;  2GCL A;  3CIK A;  5HE0 A;  2Z0P A;  4HAZ B;  2GS0 A;  2AL6 A;  1FHX A;  5KCV A;  4F7H A;  2DKQ A;  3F0W A;  4YL8 A;  2N23 A;  1WJ1 A;  4Z2N A;  2RSG A;  3LJU X;  1I7A A;  3ML4 A;  5JHH A;  2BCJ A;  2CAY A;  1H4R A;  2DX1 A;  1X11 A;  4GZU A;  4A6F A;  2DFK A;  1LB1 A;  4HAX B;  3TVV A;  2E2X A;  4HHV A;  2CRF A;  5D3Y A;  1B55 A;  2Z0O A;  4K17 A;  5FI0 A;  2GJY A;  3AU5 A;  2OTX A;  2MKR A;  4K2O A;  2V76 A;  1OY2 A;  3PSC A;  2RNR B;  1H10 A;  1DDW A;  5C6R A;  1FOE A;  5J3Y A;  1XD4 A;  2ELA A;  3AU4 A;  1E5W A;  1WGQ A;  5CLL B;  2DHK A;  5LON B;  3CXB B;  2UZS A;  2DYN A;  2DHI A;  2DYQ A;  1WG7 A;  1UPQ A;  5HE3 A;  2D2Q A;  2IFS A;  4DX9 0;  3A8Q A;  1NI2 A;  1OMW A;  1XCG A;  2COF A;  1ZC3 B;  3D8F A;  3GYP A;  3DXD A;  2EMS A;  4A6K A;  1RRP B;  1EGX A;  1ISN A;  1WGU A;  1GG3 A;  3OAN A;  2DTC A;  3X23 A;  1SHC A;  5DHA B;  1U5G A;  2DKP A;  3PEG A;  1P3R A;  3TO1 A;  2AEH A;  4DBB A;  1FHO A;  2I1K A;  3N7C A;  1KZG A;  5GOW B;  4WJ7 A;  3PZD A;  1Y19 B;  5HE2 A;  2YF0 A;  2YSZ A;  2QKM A;  1QQG A;  3AJ4 A;  5J3Q A;  1V5M A;  2H7E A;  2LYD A;  4XWX A;  2KCJ A;  2VSZ A;  2COA A;  3TFM A;  1U2B A;  4D0N B;  3A98 B;  2Y7B A;  2YVC A;  2YT1 A;  2QKL A;  1XOD A;  1U5E A;  2P8V A;  2ROZ B;  2Z0Q A;  2RGN B;  4A6H A;  4ZRK A;  1WI1 A;  3ULC A;  2EMT A;  2J0K A;  1UEF A;  1AQC A;  5DI9 B;  5D3V A;  3A8P A;  3T06 A;  3PVL A;  4HDO A;  3U8Z A;  2COC A;  4GN1 A;  2XQN M;  2L1C A;  4NY0 A;  2H7D A;  4BBK A;  2YS1 A;  2GCJ A;  4YON A;  3FSS A;  1XR0 B;  5L81 A;  1MKE A;  1EF1 A;  5D3X A;  4KVG B;  3ZDT A;  3TCA A;  3NSU A;  4DX8 A;  1FB8 A;  1DBH A;  4CHM A;  2EJ8 A;  1XKE A;  4WVF B;  5D27 A;  3PVU A;  3G9W A;  2P0D A;  2P0F A;  1PMS A;  2X18 A;  2ZPY A;  3D8D A;  4DXA B;  2HTH B;  1FGZ A;  1W1H A;  2ELB A;  1V5U A;  1FAO A;  1X86 A;  3KZ1 A;  4KHA A;  3PG7 A;  1N3H A;  2W2W A;  3DXC A;  4KHB B;  5JLJ B;  2MFQ A;  4HAU B;  5C5B B;  4GMV A;  3QWM A;  1QC6 A;  1V88 A;  2D9Z A;  2VKI A;  4B6H A;  2ADZ A;  3TW1 A;  5C16 A;  3BIN A;  5JHG A;  1W1G A;  2J59 M;  3PVW A;  4MT7 A;  1GC7 A;  4GMX B;  1Y5O A;  2NZ8 B;  2CY4 A;  2VRW B;  2D11 A;  5JP4 A;  2W2X C;  4HB2 B;  2LKO A;  5LOP B;  3MPX A;  3WYF B;  2N0Y A;  5DHF B;  1UNP A;  4HB3 B;  4HAT B;  3KSY A;  2RVB B;  2DN6 A;  2UZR A;  4F7G A;  3MDB C;  2K2U A;  4CHJ A;  1U29 A;  4HDQ A;  2EC1 A;  1V61 A;  4F7U P;  2D9X A;  4Y94 A;  1KZ7 A;  1K5G B;  4MY6 A;  3U7D A;  1WJM A;  2K2J A;  2LUL A;  1ZVR A;  2UVM A;  2J0M A;  2I1J A;  2FJL A;  2YT0 A;  4KAX B;  5D3W A;  1BTK A;  4HAY B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...