1YEWC

Crystal structure of particulate methane monooxygenase
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
215
structure length
188
Chain Sequence
b'LLDKKWLTFALAIYTVFYLWVRWYEGVYGWSAGLDSFAPEFETYWMNFLYTEIVLEIVTASILWGYLWKTRDRNLAALTPREELRRNFTHLVWLVAYAWAIYWGASYFTEQDGTWHQTIVRDTDFTPSHIIEFYLSYPIYIITGFAAFIYAKTRLPFFAHTFWFMEELFVAPLHYGFVIFGWLALAVM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords particulate methane monooxygenase, B subunit
publication title Crystal structure of a membrane-bound metalloenzyme that catalyses the biological oxidation of methane.
pubmed doi rcsb
source organism Methylococcus capsulatus
molecule tags Oxidoreductase, membrane protein
total genus 64
structure length 188
sequence length 215
chains with identical sequence G, K
ec nomenclature
pdb deposition date 2004-12-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF04896 AmoC Ammonia monooxygenase/methane monooxygenase, subunit C
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.50 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Particulate methane monooxygenase subunit c2. Chain: C 1yewC00
1YEWC 4PI2C 4PHZC 3RGBC 4PI0C 3CHXC 3RFRC
chains in the Genus database with same CATH superfamily
4AKXB 3O3TA 1VF3A 4GSNA 1BG1A 8GSSA 1AQWA 3LJRA 2PGTA 3FRCA 4I97A 1YY7A 4PI0C 4IGJA 2X64A 5D9TA 4IVFA 4ZXGA 2HSMA 2R6KA 3FR3A 1M9BA 3GSSA 13GSA 4OMVA 6GSVA 1BAYA 4FQUA 4AKIA 1XWGA 4MZWA 4HOJA 3PPUA 5ELGA 2H1LA 3VWXA 6GSSA 2WJUA 1LJRA 5DCGA 4J2FA 1GSSA 1AQXA 5ECRB 1USBA 4MF6A 1EV4A 5J4UA 4IW9A 5ECLB 2AAWA 3DGQA 4YQVA 2PMTA 4MDCA 9GSSA 2VCXA 1PKWA 4BVYA 1PL1A 1F3AA 3FR6A 4KE3A 5D9WA 3QAWA 4JBBA 1G7OA 1K0NA 2UZ8A 2CAIA 7GSSA 5A4UA 1IYIA 1BX9A 1GWCA 3CWGA 5LD0A 1K0BA 1JLWA 3VPQA 1S4BP 11GSA 5BMUA 3TOUA 2PBJA 4MK3A 1GNWA 5G5EA 3L0HA 1K3YA 2N5FA 4BL7B 1K3LA 4KDYA 3IE3A 22GSA 1U3IA 1YJ6A 3VPTA 1ZGNA 3PGTA 3GTUB 4GSSA 5F05A 5A4WA 2O3EA 2CA8A 2VCVA 2WW3A 4GDFA 2CZ3A 2WS2A 3P8WA 1C72A 1HNAA 4L5LA 4ECCA 4EDYA 3RGBC 1K0AA 5ECNB 4KSMA 4N0VA 2PVQA 2AB6A 2IMIA 4WR4A 3TGZA 4G19A 5FHIA 5A5HA 5JCUA 1PX7A 1TW9A 2WVYA 1GUMA 1GSFA 5ECPB 4YH2A 4HZ2A 1EV9A 3UAPA 1YVLA 1N2AA 4JZQA 5GSTA 1GULA 2VCZA 3FR9A 3SWLA 1Y6EA 3D0ZA 3N5OA 2D2ZA 1K0OA 4IQ1A 1ZL9A 1K0CA 3I69A 3G7IA 1G6YA 1TU8A 2GLRA 2VCWA 3TU3B 6GSYA 4DEJA 3UBLA 4F0CA 3KM6A 4ECBA 3QR6A 3VI5A 4O7HA 5AIXA 2VKZG 4ZB9A 4RI7A 1PMTA 4PQHA 3QAVA 1Y1UA 1GUKA 5A1NB 5A34B 5J41A 4PURA 1M99A 2WB9A 5DALA 2DC5A 3F63A 3KMOA 3HJMA 19GSA 2OADA 2C3QA 2WW2A 4MP4A 3Q19A 4K0GA 5EVOA 5F06A 1U87A 4PNGA 5J40A 1N25A 4AKGA 1PL2A 5B7CA 3VK9A 1GTIA 4GLTA 4BVXB 4NHZA 3KJYA 4OFTA 1GSYA 3FY7A 4KGIA 4HJ2A 5DAKB 3U6VA 1MD4A 5DDLA 1UA5A 1GSDA 4K0NA 1B48A 2PERA 4USSA 3VLNA 1IYHA 2GSQA 4F03A 4YAPA 5AISA 6GSXA 1VF1A 3IK9A 4IKHA 3LXTA 1GTUA 4G10A 4G9HA 18GSA 4W66A 1PD21 1SVLA 12GSA 1GUHA 2CVDA 2GSSA 4NHWA 5KEJA 1AW9A 1RK4A 3M1GA 2A2SA 3ISOA 20GSA 4BL7A 2EFCA 16GSA 4ZBAA 2EFEA 2HRAA 4HZ4A 2HRKB 2IL3A 4OFMA 4G0IA 1U88A 1F3BA 1MD3A 3LYKA 3GTUA 2C80A 3GUSA 1GLPA 5F0GA 2ON7A 1FHEA 1M0UA 1GLQA 3IK7A 3VI7A 4EE0A 1EOGA 3LFLA 4Q5RA 4MPFA 3LG6A 2VD0A 4QMKA 3LYPA 2DSAA 1OE8A 4AI6A 1GTBA 4F0BA 1XW5A 1G6WA 3RBTA 3CRTA 5ECKB 3DD3A 2V6KA 4IELA 1K0MA 3ZMKA 10GSA 4KH7A 4ZBBA 3WD6A 4PI2C 1I1IP 2GTUA 2HSNB 1AQVA 3LSZA 3CSHA 2JL4A 5ELAA 3P90A 2ON5A 2HSNA 1HNBA 5IQYA 3R3EA 4WR5A 5J47A 4PXOA 1PA3A 1BG5A 1PKZA 1F2EA 2C8UA 2CAQA 1DUGA 3F6DA 1AXDA 3HMJG 4PHZC 2VO4A 1SVOA 4ISDA 3ZFBA 3KTLA 1V40A 4Q5NA 1GTAA 4N3ZA 5AIVA 4YAVA 1OE7A 1K0DA 1B4PA 4E68A 3Q74A 4ID0A 6GSUA 14GSA 1LBKA 5A1NA 5A34A 1JLVA 3WYWA 5A5KA 5JCWA 2WVXB 4ECJA 4KAEA 1ML6A 3IC8A 2HQTA 1Z9HA 5EL8A 2O36A 2AHEA 1GSEA 4L5OA 4ACSA 4E8HA 4O92A 5F07A 2O5VA 2WW1A 5J4YA 1MTCA 4IJIA 1E6BA 4IS0A 4EDZA 1NHYA 1TXUA 2WW0A 3N9JA 4BVXA 2GSRA 3CHXC 3CSJA 4PGTA 3RFRC 2FHEA 5D73A 5DJLA 4EXJA 5DAKA 3TOTA 1BYEA 4G0KA 2YV9A 2GDRA 17GSA 1OKTA 4ZB6A 1JZRA 2OACA 3HJOA 5GZZB 1VF2A 3UBKA 4Q5FA 2HSMB 4MF7A 3Q18A 4KDUA 5J4VA 2HNLA 5FWGA 3NIVA 5D9VA 1GSQA 3AY8A 4GF0A 2F8FA 1Q4JA 5ECQB 1HQOA 2VCTA 2YV7A 2R4VA 4G01A 4KDXA 5ECOB 4AKHA 2F3MA 3KMNA 3ZMLA 1OYJA 2OT3A 4GSTA 2WVZA 1PX6A 2GSTA 3UARA 2YCDA 1YQ1A 1SVMA 4BVYB 4KF9A 2EFDA 4PQIA 2CZ2A 5ECHB 4G0LA 3GH6A 3EINA 3BBYA 2EFHA 3CRUA 2UV8G 2HRKA 4ZB8A 2FNOA 2WRTA 1R5AA 1B8XA 5BMUB 1EEMA 2J9HA 3F6FA 5EY6A 2IMKA 4YQUA 2LJRA 1PN9A 4GCIA 2WDUA 3LQ7A 5GSSA 4IBPA 1YEWC 1M9AA 1HNCA 6GSTA 1YDKA 3M3MA 3MDKA 3VURA 3EE2A 5AGYA 5A4VA 2A2RA 4KX4A 4PTSA 3GURA 4NAXA 4CHSA 2WZSA 1YKCA 5D9XA 5ECMB 4PX1A 5J5NA 5AN1A 2C3TA 3W8SA 1VF4A 5A5HB 2C4JA 2C3NA 1XWKA 4PUAA 5DQSA 6GSWA 2OA7A 3GX0A 4JEDA 5FT3A 3FYGA 5HFKA 3GSTA 3ERGA 4MF5A 1PGTA 1GSUA 4TOPA 4AGSA 2VD1A 2R3XA 4GTUA 3QAGA 1GNEA 4QQ7A 4EC0A 4LMVA 5ECIB 3M8NA 3UVHA 3G7JA 5G5FA 3C8EA 4MPGA 4ECIA 3IR4A 3LXZA 4IQAA 4ZB7A 5F8BA 5DJMA 2VCQA 3MAKA 4LMWA 1TDIA 1K3OA 1V2AA 3KXOA 2WVXA 1FW1A 3M0FA 3PR8A 4L8EA 4OFNA 3ERFA 3H1NA 3O76A 4FXYP 5LCZA 3ZFLA 4YQMA 5ECSA 1A0FA 4Q5QA 4PNFA 1KBNA 1XW6A 3CBUA 4E8EA 1TU7A 2NTOA 4ZBDA 1BF5A 3I6AA 5DALB 3CSIA 1EOHA 4RI6A 4HI7A 3IBHA 3R2QA 3HKRA 2R5GA
chains in the Genus database with same CATH topology
1YEWC 4PI2C 4PHZC 3RGBC 4PI0C 3CHXC 3RFRC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YEW C;  4PI2 C;  4PHZ C;  3RGB C;  4PI0 C;  3CHX C;  3RFR C; 
#chains in the Genus database with same CATH topology
 4AKX B;  3O3T A;  1VF3 A;  4GSN A;  1BG1 A;  8GSS A;  1AQW A;  3LJR A;  2PGT A;  3FRC A;  4I97 A;  1YY7 A;  4PI0 C;  4IGJ A;  2X64 A;  5D9T A;  4IVF A;  4ZXG A;  2HSM A;  2R6K A;  3FR3 A;  1M9B A;  3GSS A;  13GS A;  4OMV A;  6GSV A;  1BAY A;  4FQU A;  4AKI A;  1XWG A;  4MZW A;  4HOJ A;  3PPU A;  5ELG A;  2H1L A;  3VWX A;  6GSS A;  2WJU A;  1LJR A;  5DCG A;  4J2F A;  1GSS A;  1AQX A;  5ECR B;  1USB A;  4MF6 A;  1EV4 A;  5J4U A;  4IW9 A;  5ECL B;  2AAW A;  3DGQ A;  4YQV A;  2PMT A;  4MDC A;  9GSS A;  2VCX A;  1PKW A;  4BVY A;  1PL1 A;  1F3A A;  3FR6 A;  4KE3 A;  5D9W A;  3QAW A;  4JBB A;  1G7O A;  1K0N A;  2UZ8 A;  2CAI A;  7GSS A;  5A4U A;  1IYI A;  1BX9 A;  1GWC A;  3CWG A;  5LD0 A;  1K0B A;  1JLW A;  3VPQ A;  1S4B P;  11GS A;  5BMU A;  3TOU A;  2PBJ A;  4MK3 A;  1GNW A;  5G5E A;  3L0H A;  1K3Y A;  2N5F A;  4BL7 B;  1K3L A;  4KDY A;  3IE3 A;  22GS A;  1U3I A;  1YJ6 A;  3VPT A;  1ZGN A;  3PGT A;  3GTU B;  4GSS A;  5F05 A;  5A4W A;  2O3E A;  2CA8 A;  2VCV A;  2WW3 A;  4GDF A;  2CZ3 A;  2WS2 A;  3P8W A;  1C72 A;  1HNA A;  4L5L A;  4ECC A;  4EDY A;  3RGB C;  1K0A A;  5ECN B;  4KSM A;  4N0V A;  2PVQ A;  2AB6 A;  2IMI A;  4WR4 A;  3TGZ A;  4G19 A;  5FHI A;  5A5H A;  5JCU A;  1PX7 A;  1TW9 A;  2WVY A;  1GUM A;  1GSF A;  5ECP B;  4YH2 A;  4HZ2 A;  1EV9 A;  3UAP A;  1YVL A;  1N2A A;  4JZQ A;  5GST A;  1GUL A;  2VCZ A;  3FR9 A;  3SWL A;  1Y6E A;  3D0Z A;  3N5O A;  2D2Z A;  1K0O A;  4IQ1 A;  1ZL9 A;  1K0C A;  3I69 A;  3G7I A;  1G6Y A;  1TU8 A;  2GLR A;  2VCW A;  3TU3 B;  6GSY A;  4DEJ A;  3UBL A;  4F0C A;  3KM6 A;  4ECB A;  3QR6 A;  3VI5 A;  4O7H A;  5AIX A;  2VKZ G;  4ZB9 A;  4RI7 A;  1PMT A;  4PQH A;  3QAV A;  1Y1U A;  1GUK A;  5A1N B;  5A34 B;  5J41 A;  4PUR A;  1M99 A;  2WB9 A;  5DAL A;  2DC5 A;  3F63 A;  3KMO A;  3HJM A;  19GS A;  2OAD A;  2C3Q A;  2WW2 A;  4MP4 A;  3Q19 A;  4K0G A;  5EVO A;  5F06 A;  1U87 A;  4PNG A;  5J40 A;  1N25 A;  4AKG A;  1PL2 A;  5B7C A;  3VK9 A;  1GTI A;  4GLT A;  4BVX B;  4NHZ A;  3KJY A;  4OFT A;  1GSY A;  3FY7 A;  4KGI A;  4HJ2 A;  5DAK B;  3U6V A;  1MD4 A;  5DDL A;  1UA5 A;  1GSD A;  4K0N A;  1B48 A;  2PER A;  4USS A;  3VLN A;  1IYH A;  2GSQ A;  4F03 A;  4YAP A;  5AIS A;  6GSX A;  1VF1 A;  3IK9 A;  4IKH A;  3LXT A;  1GTU A;  4G10 A;  4G9H A;  18GS A;  4W66 A;  1PD2 1;  1SVL A;  12GS A;  1GUH A;  2CVD A;  2GSS A;  4NHW A;  5KEJ A;  1AW9 A;  1RK4 A;  3M1G A;  2A2S A;  3ISO A;  20GS A;  4BL7 A;  2EFC A;  16GS A;  4ZBA A;  2EFE A;  2HRA A;  4HZ4 A;  2HRK B;  2IL3 A;  4OFM A;  4G0I A;  1U88 A;  1F3B A;  1MD3 A;  3LYK A;  3GTU A;  2C80 A;  3GUS A;  1GLP A;  5F0G A;  2ON7 A;  1FHE A;  1M0U A;  1GLQ A;  3IK7 A;  3VI7 A;  4EE0 A;  1EOG A;  3LFL A;  4Q5R A;  4MPF A;  3LG6 A;  2VD0 A;  4QMK A;  3LYP A;  2DSA A;  1OE8 A;  4AI6 A;  1GTB A;  4F0B A;  1XW5 A;  1G6W A;  3RBT A;  3CRT A;  5ECK B;  3DD3 A;  2V6K A;  4IEL A;  1K0M A;  3ZMK A;  10GS A;  4KH7 A;  4ZBB A;  3WD6 A;  4PI2 C;  1I1I P;  2GTU A;  2HSN B;  1AQV A;  3LSZ A;  3CSH A;  2JL4 A;  5ELA A;  3P90 A;  2ON5 A;  2HSN A;  1HNB A;  5IQY A;  3R3E A;  4WR5 A;  5J47 A;  4PXO A;  1PA3 A;  1BG5 A;  1PKZ A;  1F2E A;  2C8U A;  2CAQ A;  1DUG A;  3F6D A;  1AXD A;  3HMJ G;  4PHZ C;  2VO4 A;  1SVO A;  4ISD A;  3ZFB A;  3KTL A;  1V40 A;  4Q5N A;  1GTA A;  4N3Z A;  5AIV A;  4YAV A;  1OE7 A;  1K0D A;  1B4P A;  4E68 A;  3Q74 A;  4ID0 A;  6GSU A;  14GS A;  1LBK A;  5A1N A;  5A34 A;  1JLV A;  3WYW A;  5A5K A;  5JCW A;  2WVX B;  4ECJ A;  4KAE A;  1ML6 A;  3IC8 A;  2HQT A;  1Z9H A;  5EL8 A;  2O36 A;  2AHE A;  1GSE A;  4L5O A;  4ACS A;  4E8H A;  4O92 A;  5F07 A;  2O5V A;  2WW1 A;  5J4Y A;  1MTC A;  4IJI A;  1E6B A;  4IS0 A;  4EDZ A;  1NHY A;  1TXU A;  2WW0 A;  3N9J A;  4BVX A;  2GSR A;  3CHX C;  3CSJ A;  4PGT A;  3RFR C;  2FHE A;  5D73 A;  5DJL A;  4EXJ A;  5DAK A;  3TOT A;  1BYE A;  4G0K A;  2YV9 A;  2GDR A;  17GS A;  1OKT A;  4ZB6 A;  1JZR A;  2OAC A;  3HJO A;  5GZZ B;  1VF2 A;  3UBK A;  4Q5F A;  2HSM B;  4MF7 A;  3Q18 A;  4KDU A;  5J4V A;  2HNL A;  5FWG A;  3NIV A;  5D9V A;  1GSQ A;  3AY8 A;  4GF0 A;  2F8F A;  1Q4J A;  5ECQ B;  1HQO A;  2VCT A;  2YV7 A;  2R4V A;  4G01 A;  4KDX A;  5ECO B;  4AKH A;  2F3M A;  3KMN A;  3ZML A;  1OYJ A;  2OT3 A;  4GST A;  2WVZ A;  1PX6 A;  2GST A;  3UAR A;  2YCD A;  1YQ1 A;  1SVM A;  4BVY B;  4KF9 A;  2EFD A;  4PQI A;  2CZ2 A;  5ECH B;  4G0L A;  3GH6 A;  3EIN A;  3BBY A;  2EFH A;  3CRU A;  2UV8 G;  2HRK A;  4ZB8 A;  2FNO A;  2WRT A;  1R5A A;  1B8X A;  5BMU B;  1EEM A;  2J9H A;  3F6F A;  5EY6 A;  2IMK A;  4YQU A;  2LJR A;  1PN9 A;  4GCI A;  2WDU A;  3LQ7 A;  5GSS A;  4IBP A;  1YEW C;  1M9A A;  1HNC A;  6GST A;  1YDK A;  3M3M A;  3MDK A;  3VUR A;  3EE2 A;  5AGY A;  5A4V A;  2A2R A;  4KX4 A;  4PTS A;  3GUR A;  4NAX A;  4CHS A;  2WZS A;  1YKC A;  5D9X A;  5ECM B;  4PX1 A;  5J5N A;  5AN1 A;  2C3T A;  3W8S A;  1VF4 A;  5A5H B;  2C4J A;  2C3N A;  1XWK A;  4PUA A;  5DQS A;  6GSW A;  2OA7 A;  3GX0 A;  4JED A;  5FT3 A;  3FYG A;  5HFK A;  3GST A;  3ERG A;  4MF5 A;  1PGT A;  1GSU A;  4TOP A;  4AGS A;  2VD1 A;  2R3X A;  4GTU A;  3QAG A;  1GNE A;  4QQ7 A;  4EC0 A;  4LMV A;  5ECI B;  3M8N A;  3UVH A;  3G7J A;  5G5F A;  3C8E A;  4MPG A;  4ECI A;  3IR4 A;  3LXZ A;  4IQA A;  4ZB7 A;  5F8B A;  5DJM A;  2VCQ A;  3MAK A;  4LMW A;  1TDI A;  1K3O A;  1V2A A;  3KXO A;  2WVX A;  1FW1 A;  3M0F A;  3PR8 A;  4L8E A;  4OFN A;  3ERF A;  3H1N A;  3O76 A;  4FXY P;  5LCZ A;  3ZFL A;  4YQM A;  5ECS A;  1A0F A;  4Q5Q A;  4PNF A;  1KBN A;  1XW6 A;  3CBU A;  4E8E A;  1TU7 A;  2NTO A;  4ZBD A;  1BF5 A;  3I6A A;  5DAL B;  3CSI A;  1EOH A;  4RI6 A;  4HI7 A;  3IBH A;  3R2Q A;  3HKR A;  2R5G A; 
#chains in the Genus database with same CATH homology
 1YEW C;  4PI2 C;  4PHZ C;  3RGB C;  4PI0 C;  3CHX C;  3RFR C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...