1YEWC

Crystal structure of particulate methane monooxygenase
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
215
structure length
188
Chain Sequence
LLDKKWLTFALAIYTVFYLWVRWYEGVYGWSAGLDSFAPEFETYWMNFLYTEIVLEIVTASILWGYLWKTRDRNLAALTPREELRRNFTHLVWLVAYAWAIYWGASYFTEQDGTWHQTIVRDTDFTPSHIIEFYLSYPIYIITGFAAFIYAKTRLPFFAHTFWFMEELFVAPLHYGFVIFGWLALAVM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords particulate methane monooxygenase, B subunit
publication title Crystal structure of a membrane-bound metalloenzyme that catalyses the biological oxidation of methane.
pubmed doi rcsb
source organism Methylococcus capsulatus
molecule tags Oxidoreductase, membrane protein
total genus 64
structure length 188
sequence length 215
chains with identical sequence G, K
ec nomenclature
pdb deposition date 2004-12-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF04896 AmoC Ammonia monooxygenase/methane monooxygenase, subunit C
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.50 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Particulate methane monooxygenase subunit c2. Chain: C 1yewC00
3RGBC 4PI0C 3RFRC 3CHXC 1YEWC 4PHZC 4PI2C
chains in the Genus database with same CATH superfamily
4ZB8A 3TOTA 5J40A 14GSA 4J2FA 4MF6A 3GSSA 3N5OA 4IS0A 4Q5FA 1EV9A 3M1GA 2CAQA 3EE2A 3RGBC 3VK9A 18GSA 3VI7A 1PL1A 3F63A 2HRKA 1K0MA 4TOPA 1AQWA 2R6KA 5A4WA 5J4VA 1GSQA 1GSEA 4FQUA 1OYJA 4AGSA 4JZQA 3VPTA 1LBKA 2A2RA 4G19A 8GSSA 3QR6A 2FHEA 1SVLA 3VWXA 2VD1A 4MPGA 1YJ6A 3LXZA 4HI7A 4YQMA 1MD4A 4OFMA 1BAYA 3IBHA 3EINA 3L0HA 3R3EA 1K0NA 1JZRA 3C8EA 3MAKA 2OADA 1YDKA 2PGTA 4Q5QA 1AW9A 4EDZA 3G7JA 17GSA 1Y1UA 4N0VA 3LXTA 4CHSA 1F3BA 2WRTA 5ECPB 3U6VA 1K3YA 4Q5RA 3RBTA 2F8FA 2OT3A 1GSDA 1OE7A 2VCVA 3GX0A 2ON7A 3FR3A 7GSSA 4PTSA 4IJIA 5DALA 5AIXA 1OE8A 2WVXA 5D9XA 1GNEA 2C3TA 4G0KA 1TU8A 2VCQA 4MZWA 1M99A 5FWGA 3LG6A 4AKIA 3UVHA 2R5GA 4YH2A 5AIVA 5F8BA 5EVOA 6GSWA 9GSSA 5KEJA 3FR9A 5A5HA 2IL3A 2WDUA 2JL4A 1XW5A 1XWKA 1GLQA 1G7OA 4KH7A 1VF2A 4F0CA 1V40A 4PI0C 2GSSA 1DUGA 2WJUA 5ECSA 1HQOA 3IC8A 5A4UA 2C80A 3GTUB 3FY7A 4KDYA 5ELAA 3VPQA 2CZ3A 1PN9A 2NTOA 4BL7B 4EC0A 2WB9A 3FRCA 3UAPA 3PGTA 3HMJG 1LJRA 10GSA 4ZBAA 5ECMB 3GSTA 1PA3A 19GSA 2WVZA 4WR5A 4NHZA 4GF0A 2A2SA 4IW9A 1K0BA 5A34B 2OACA 4MF5A 1A0FA 4IQAA 1IYHA 2VO4A 4ECCA 2WZSA 4ACSA 2C3NA 5BMUB 6GSYA 4L8EA 1F3AA 4BL7A 2X64A 1GSYA 1GWCA 4IBPA 2F3MA 3ZFBA 4DEJA 3FR6A 4ECBA 1AXDA 3O3TA 3PPUA 22GSA 1YY7A 2HNLA 5A34A 5A1NA 3IE3A 4OFNA 4PQIA 4KAEA 3CHXC 1GSFA 3W8SA 3HKRA 1R5AA 1K3LA 4GLTA 4O7HA 3KXOA 1EEMA 1TW9A 4FXYP 2WS2A 5EY6A 4EXJA 5DDLA 2EFHA 4OMVA 5AGYA 4ZBDA 12GSA 4W66A 5ECHB 3FYGA 3QAGA 3RFRC 1GTBA 4F0BA 4BVXB 2H1LA 1PKWA 3SWLA 4PNGA 1M9BA 16GSA 3NIVA 2WW1A 1FW1A 3ZFLA 1EOHA 4BVYB 4AI6A 1GTIA 4KE3A 1U3IA 2UZ8A 2GDRA 2VCXA 4JEDA 3CSJA 4KX4A 1BYEA 1ZGNA 3M8NA 3F6DA 5ECNB 2WVYA 4LMVA 5J47A 4JBBA 1Z9HA 1BG5A 1VF4A 4O92A 4YAVA 4IGJA 1K0CA 3LSZA 6GSVA 2AHEA 5ECRB 5AISA 1GLPA 1BG1A 1F2EA 3I6AA 3KTLA 1YQ1A 5IQYA 4GCIA 5GSTA 5F07A 6GSXA 3UARA 1GUHA 1IYIA 1TU7A 5ECQB 2IMKA 5HFKA 1I1IP 3DGQA 3ERGA 4YQUA 2GSRA 4HOJA 1YEWC 5F06A 4ISDA 1AQVA 4K0GA 2R4VA 1GTAA 1OKTA 4EDYA 2HSMB 2VKZG 3ZMLA 2ON5A 5J41A 3ISOA 2DC5A 2C4JA 1PX6A 3GURA 3PR8A 5F0GA 4ZB6A 3CSHA 4NAXA 3KM6A 3ZMKA 4GTUA 1XW6A 1Y6EA 2C3QA 2PBJA 2VCWA 4F03A 3UBKA 1HNCA 4IVFA 2GLRA 2AAWA 5LD0A 5GZZB 5D9WA 2O3EA 1Q4JA 5JCUA 4L5LA 2O36A 5A5KA 4E8HA 1B8XA 5DQSA 4KDXA 4QQ7A 2R3XA 1BF5A 4G10A 1U87A 2FNOA 4MDCA 4MPFA 4HJ2A 4G0LA 4G9HA 3IK9A 4MK3A 5J4YA 2HRAA 2WW0A 5G5FA 1B48A 3CRUA 1UA5A 4G0IA 5EL8A 4IELA 3ERFA 4KF9A 2GTUA 3LJRA 4L5OA 3LQ7A 1YKCA 5ECOB 6GSUA 3GUSA 2HSNB 20GSA 3GTUA 4HZ4A 1HNBA 2AB6A 1SVMA 3HJMA 1MTCA 5D9TA 5J4UA 3TU3B 4E8EA 3Q74A 11GSA 2LJRA 4WR4A 2DSAA 3WYWA 1ML6A 3H1NA 1VF3A 2GSTA 4ZXGA 1GUMA 2OA7A 1GUKA 4PGTA 5ECLB 5FHIA 3KMNA 4HZ2A 13GSA 2HRKB 4KGIA 1FHEA 3AY8A 3R2QA 5J5NA 1ZL9A 4N3ZA 4Q5NA 3CBUA 5D73A 5BMUA 3HJOA 3M0FA 2C8UA 3P90A 1GNWA 1KBNA 4EE0A 4PQHA 2N5FA 2VD0A 3IR4A 1XWGA 4RI7A 2EFDA 1MD3A 3LYPA 4IKHA 2PMTA 4PXOA 3KMOA 4QMKA 4ZB7A 3CSIA 3VLNA 4MP4A 4ECJA 3QAWA 4OFTA 1TDIA 2EFCA 5GSSA 1K0OA 2VCTA 5DCGA 1BX9A 6GSTA 1GULA 2D2ZA 4E68A 3TGZA 3GH6A 3WD6A 1C72A 1B4PA 1VF1A 2O5VA 2YV9A 1N25A 4BVXA 1RK4A 1N2AA 2CZ2A 2VCZA 4RI6A 6GSSA 1K3OA 1TXUA 2GSQA 4ECIA 2CVDA 2PVQA 5DALB 2WW3A 4PHZC 3CWGA 3LFLA 4I97A 4USSA 2WVXB 5DAKB 1SVOA 4BVYA 4MF7A 4NHWA 3M3MA 3Q18A 1GSUA 5DJLA 3IK7A 4ZBBA 1NHYA 3P8WA 5AN1A 2CAIA 5F05A 4ZB9A 4YQVA 5A5HB 1PGTA 2UV8G 4PX1A 3LYKA 5D9VA 5DAKA 1EV4A 3UBLA 5ECIB 1JLVA 3QAVA 5B7CA 5DJMA 2YV7A 4PI2C 2YCDA 4KSMA 4PURA 3N9JA 2WW2A 4GSNA 2IMIA 3BBYA 4AKGA 2HQTA 4YAPA 5LCZA 1M0UA 1EOGA 4AKXB 4IQ1A 1PL2A 2J9HA 2HSMA 1AQXA 4GSSA 4KDUA 5ECKB 2CA8A 2PERA 1V2AA 1GTUA 3DD3A 3D0ZA 3I69A 4PUAA 3MDKA 4GSTA 4GDFA 5G5EA 3F6FA 1YVLA 1PX7A 1S4BP 4PNFA 1PMTA 1PKZA 3CRTA 4G01A 5FT3A 3VI5A 3TOUA 3G7IA 1U88A 1E6BA 1K0DA 1HNAA 5A4VA 3O76A 1GSSA 2V6KA 1K0AA 1USBA 4AKHA 5ELGA 2EFEA 3KJYA 1PD21 3VURA 1G6WA 3Q19A 5JCWA 5A1NB 1JLWA 1M9AA 4K0NA 1G6YA 4ID0A 2HSNA 4LMWA
chains in the Genus database with same CATH topology
3RGBC 4PI0C 3RFRC 3CHXC 1YEWC 4PHZC 4PI2C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RGB C;  4PI0 C;  3RFR C;  3CHX C;  1YEW C;  4PHZ C;  4PI2 C; 
#chains in the Genus database with same CATH topology
 4ZB8 A;  3TOT A;  5J40 A;  14GS A;  4J2F A;  4MF6 A;  3GSS A;  3N5O A;  4IS0 A;  4Q5F A;  1EV9 A;  3M1G A;  2CAQ A;  3EE2 A;  3RGB C;  3VK9 A;  18GS A;  3VI7 A;  1PL1 A;  3F63 A;  2HRK A;  1K0M A;  4TOP A;  1AQW A;  2R6K A;  5A4W A;  5J4V A;  1GSQ A;  1GSE A;  4FQU A;  1OYJ A;  4AGS A;  4JZQ A;  3VPT A;  1LBK A;  2A2R A;  4G19 A;  8GSS A;  3QR6 A;  2FHE A;  1SVL A;  3VWX A;  2VD1 A;  4MPG A;  1YJ6 A;  3LXZ A;  4HI7 A;  4YQM A;  1MD4 A;  4OFM A;  1BAY A;  3IBH A;  3EIN A;  3L0H A;  3R3E A;  1K0N A;  1JZR A;  3C8E A;  3MAK A;  2OAD A;  1YDK A;  2PGT A;  4Q5Q A;  1AW9 A;  4EDZ A;  3G7J A;  17GS A;  1Y1U A;  4N0V A;  3LXT A;  4CHS A;  1F3B A;  2WRT A;  5ECP B;  3U6V A;  1K3Y A;  4Q5R A;  3RBT A;  2F8F A;  2OT3 A;  1GSD A;  1OE7 A;  2VCV A;  3GX0 A;  2ON7 A;  3FR3 A;  7GSS A;  4PTS A;  4IJI A;  5DAL A;  5AIX A;  1OE8 A;  2WVX A;  5D9X A;  1GNE A;  2C3T A;  4G0K A;  1TU8 A;  2VCQ A;  4MZW A;  1M99 A;  5FWG A;  3LG6 A;  4AKI A;  3UVH A;  2R5G A;  4YH2 A;  5AIV A;  5F8B A;  5EVO A;  6GSW A;  9GSS A;  5KEJ A;  3FR9 A;  5A5H A;  2IL3 A;  2WDU A;  2JL4 A;  1XW5 A;  1XWK A;  1GLQ A;  1G7O A;  4KH7 A;  1VF2 A;  4F0C A;  1V40 A;  4PI0 C;  2GSS A;  1DUG A;  2WJU A;  5ECS A;  1HQO A;  3IC8 A;  5A4U A;  2C80 A;  3GTU B;  3FY7 A;  4KDY A;  5ELA A;  3VPQ A;  2CZ3 A;  1PN9 A;  2NTO A;  4BL7 B;  4EC0 A;  2WB9 A;  3FRC A;  3UAP A;  3PGT A;  3HMJ G;  1LJR A;  10GS A;  4ZBA A;  5ECM B;  3GST A;  1PA3 A;  19GS A;  2WVZ A;  4WR5 A;  4NHZ A;  4GF0 A;  2A2S A;  4IW9 A;  1K0B A;  5A34 B;  2OAC A;  4MF5 A;  1A0F A;  4IQA A;  1IYH A;  2VO4 A;  4ECC A;  2WZS A;  4ACS A;  2C3N A;  5BMU B;  6GSY A;  4L8E A;  1F3A A;  4BL7 A;  2X64 A;  1GSY A;  1GWC A;  4IBP A;  2F3M A;  3ZFB A;  4DEJ A;  3FR6 A;  4ECB A;  1AXD A;  3O3T A;  3PPU A;  22GS A;  1YY7 A;  2HNL A;  5A34 A;  5A1N A;  3IE3 A;  4OFN A;  4PQI A;  4KAE A;  3CHX C;  1GSF A;  3W8S A;  3HKR A;  1R5A A;  1K3L A;  4GLT A;  4O7H A;  3KXO A;  1EEM A;  1TW9 A;  4FXY P;  2WS2 A;  5EY6 A;  4EXJ A;  5DDL A;  2EFH A;  4OMV A;  5AGY A;  4ZBD A;  12GS A;  4W66 A;  5ECH B;  3FYG A;  3QAG A;  3RFR C;  1GTB A;  4F0B A;  4BVX B;  2H1L A;  1PKW A;  3SWL A;  4PNG A;  1M9B A;  16GS A;  3NIV A;  2WW1 A;  1FW1 A;  3ZFL A;  1EOH A;  4BVY B;  4AI6 A;  1GTI A;  4KE3 A;  1U3I A;  2UZ8 A;  2GDR A;  2VCX A;  4JED A;  3CSJ A;  4KX4 A;  1BYE A;  1ZGN A;  3M8N A;  3F6D A;  5ECN B;  2WVY A;  4LMV A;  5J47 A;  4JBB A;  1Z9H A;  1BG5 A;  1VF4 A;  4O92 A;  4YAV A;  4IGJ A;  1K0C A;  3LSZ A;  6GSV A;  2AHE A;  5ECR B;  5AIS A;  1GLP A;  1BG1 A;  1F2E A;  3I6A A;  3KTL A;  1YQ1 A;  5IQY A;  4GCI A;  5GST A;  5F07 A;  6GSX A;  3UAR A;  1GUH A;  1IYI A;  1TU7 A;  5ECQ B;  2IMK A;  5HFK A;  1I1I P;  3DGQ A;  3ERG A;  4YQU A;  2GSR A;  4HOJ A;  1YEW C;  5F06 A;  4ISD A;  1AQV A;  4K0G A;  2R4V A;  1GTA A;  1OKT A;  4EDY A;  2HSM B;  2VKZ G;  3ZML A;  2ON5 A;  5J41 A;  3ISO A;  2DC5 A;  2C4J A;  1PX6 A;  3GUR A;  3PR8 A;  5F0G A;  4ZB6 A;  3CSH A;  4NAX A;  3KM6 A;  3ZMK A;  4GTU A;  1XW6 A;  1Y6E A;  2C3Q A;  2PBJ A;  2VCW A;  4F03 A;  3UBK A;  1HNC A;  4IVF A;  2GLR A;  2AAW A;  5LD0 A;  5GZZ B;  5D9W A;  2O3E A;  1Q4J A;  5JCU A;  4L5L A;  2O36 A;  5A5K A;  4E8H A;  1B8X A;  5DQS A;  4KDX A;  4QQ7 A;  2R3X A;  1BF5 A;  4G10 A;  1U87 A;  2FNO A;  4MDC A;  4MPF A;  4HJ2 A;  4G0L A;  4G9H A;  3IK9 A;  4MK3 A;  5J4Y A;  2HRA A;  2WW0 A;  5G5F A;  1B48 A;  3CRU A;  1UA5 A;  4G0I A;  5EL8 A;  4IEL A;  3ERF A;  4KF9 A;  2GTU A;  3LJR A;  4L5O A;  3LQ7 A;  1YKC A;  5ECO B;  6GSU A;  3GUS A;  2HSN B;  20GS A;  3GTU A;  4HZ4 A;  1HNB A;  2AB6 A;  1SVM A;  3HJM A;  1MTC A;  5D9T A;  5J4U A;  3TU3 B;  4E8E A;  3Q74 A;  11GS A;  2LJR A;  4WR4 A;  2DSA A;  3WYW A;  1ML6 A;  3H1N A;  1VF3 A;  2GST A;  4ZXG A;  1GUM A;  2OA7 A;  1GUK A;  4PGT A;  5ECL B;  5FHI A;  3KMN A;  4HZ2 A;  13GS A;  2HRK B;  4KGI A;  1FHE A;  3AY8 A;  3R2Q A;  5J5N A;  1ZL9 A;  4N3Z A;  4Q5N A;  3CBU A;  5D73 A;  5BMU A;  3HJO A;  3M0F A;  2C8U A;  3P90 A;  1GNW A;  1KBN A;  4EE0 A;  4PQH A;  2N5F A;  2VD0 A;  3IR4 A;  1XWG A;  4RI7 A;  2EFD A;  1MD3 A;  3LYP A;  4IKH A;  2PMT A;  4PXO A;  3KMO A;  4QMK A;  4ZB7 A;  3CSI A;  3VLN A;  4MP4 A;  4ECJ A;  3QAW A;  4OFT A;  1TDI A;  2EFC A;  5GSS A;  1K0O A;  2VCT A;  5DCG A;  1BX9 A;  6GST A;  1GUL A;  2D2Z A;  4E68 A;  3TGZ A;  3GH6 A;  3WD6 A;  1C72 A;  1B4P A;  1VF1 A;  2O5V A;  2YV9 A;  1N25 A;  4BVX A;  1RK4 A;  1N2A A;  2CZ2 A;  2VCZ A;  4RI6 A;  6GSS A;  1K3O A;  1TXU A;  2GSQ A;  4ECI A;  2CVD A;  2PVQ A;  5DAL B;  2WW3 A;  4PHZ C;  3CWG A;  3LFL A;  4I97 A;  4USS A;  2WVX B;  5DAK B;  1SVO A;  4BVY A;  4MF7 A;  4NHW A;  3M3M A;  3Q18 A;  1GSU A;  5DJL A;  3IK7 A;  4ZBB A;  1NHY A;  3P8W A;  5AN1 A;  2CAI A;  5F05 A;  4ZB9 A;  4YQV A;  5A5H B;  1PGT A;  2UV8 G;  4PX1 A;  3LYK A;  5D9V A;  5DAK A;  1EV4 A;  3UBL A;  5ECI B;  1JLV A;  3QAV A;  5B7C A;  5DJM A;  2YV7 A;  4PI2 C;  2YCD A;  4KSM A;  4PUR A;  3N9J A;  2WW2 A;  4GSN A;  2IMI A;  3BBY A;  4AKG A;  2HQT A;  4YAP A;  5LCZ A;  1M0U A;  1EOG A;  4AKX B;  4IQ1 A;  1PL2 A;  2J9H A;  2HSM A;  1AQX A;  4GSS A;  4KDU A;  5ECK B;  2CA8 A;  2PER A;  1V2A A;  1GTU A;  3DD3 A;  3D0Z A;  3I69 A;  4PUA A;  3MDK A;  4GST A;  4GDF A;  5G5E A;  3F6F A;  1YVL A;  1PX7 A;  1S4B P;  4PNF A;  1PMT A;  1PKZ A;  3CRT A;  4G01 A;  5FT3 A;  3VI5 A;  3TOU A;  3G7I A;  1U88 A;  1E6B A;  1K0D A;  1HNA A;  5A4V A;  3O76 A;  1GSS A;  2V6K A;  1K0A A;  1USB A;  4AKH A;  5ELG A;  2EFE A;  3KJY A;  1PD2 1;  3VUR A;  1G6W A;  3Q19 A;  5JCW A;  5A1N B;  1JLW A;  1M9A A;  4K0N A;  1G6Y A;  4ID0 A;  2HSN A;  4LMW A; 
#chains in the Genus database with same CATH homology
 3RGB C;  4PI0 C;  3RFR C;  3CHX C;  1YEW C;  4PHZ C;  4PI2 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...