1YEWC

Crystal structure of particulate methane monooxygenase
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
215
structure length
188
Chain Sequence
LLDKKWLTFALAIYTVFYLWVRWYEGVYGWSAGLDSFAPEFETYWMNFLYTEIVLEIVTASILWGYLWKTRDRNLAALTPREELRRNFTHLVWLVAYAWAIYWGASYFTEQDGTWHQTIVRDTDFTPSHIIEFYLSYPIYIITGFAAFIYAKTRLPFFAHTFWFMEELFVAPLHYGFVIFGWLALAVM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords particulate methane monooxygenase, B subunit
publication title Crystal structure of a membrane-bound metalloenzyme that catalyses the biological oxidation of methane.
pubmed doi rcsb
source organism Methylococcus capsulatus
molecule tags Oxidoreductase, membrane protein
total genus 64
structure length 188
sequence length 215
chains with identical sequence G, K
ec nomenclature
pdb deposition date 2004-12-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF04896 AmoC Ammonia monooxygenase/methane monooxygenase, subunit C
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.50 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Particulate methane monooxygenase subunit c2. Chain: C 1yewC00
4PHZC 3RFRC 4PI0C 4PI2C 3RGBC 1YEWC 3CHXC
chains in the Genus database with same CATH superfamily
1M99A 1B8XA 5EL8A 1TU8A 4PNGA 1PL1A 1C72A 1G7OA 4K0NA 3TOUA 2DSAA 3MDKA 5B7CA 4E8EA 11GSA 2OACA 4IKHA 4IVFA 1GNWA 2YV9A 1GULA 2OADA 1PX6A 2WRTA 4F0CA 1AW9A 4Q5QA 4Q5FA 3RFRC 3G7JA 4G10A 4BVXA 3HMJG 5J4VA 1PGTA 1SVLA 4YAVA 1U87A 1BF5A 3LG6A 1ML6A 4O7HA 4G0KA 3VPQA 2R4VA 1PD21 1YY7A 3GURA 2WW1A 5DJLA 5IQYA 1TXUA 2VCZA 1SVMA 4ECCA 1VF1A 3KMNA 2EFEA 3R3EA 3VWXA 1F3AA 1Z9HA 4NAXA 1B4PA 3QR6A 3N5OA 3C8EA 2DC5A 4KF9A 5DDLA 4PHZC 3FR6A 4WR4A 2J9HA 4HZ4A 3QAGA 2VCVA 3VI7A 4O92A 4ECIA 5GSTA 5F06A 5F8BA 1K3YA 1MTCA 4F0BA 6GSWA 4JZQA 1VF4A 3BBYA 4GF0A 4L5OA 3ZMKA 4CHSA 5J5NA 3RGBC 4AGSA 2WJUA 2CAQA 2D2ZA 3GSSA 1YQ1A 1ZL9A 3IBHA 1B48A 4W66A 1AQWA 5D9TA 4ECBA 1GLPA 2CA8A 2VCQA 4IW9A 5J4YA 3Q18A 1Y6EA 5ECMB 1XW5A 4G9HA 4EC0A 3IR4A 1K0BA 4G0IA 1EV4A 4I97A 2HRAA 2NTOA 5DJMA 1GTAA 4PI2C 4MZWA 3LXZA 4TOPA 1PKWA 1AQXA 5ECIB 3FRCA 4N0VA 3LJRA 4GLTA 2F8FA 3L0HA 5ELGA 4FXYP 2GSQA 1ZGNA 4RI6A 2PBJA 1M9AA 16GSA 4IJIA 1R5AA 4PQHA 1GNEA 3I6AA 2WW0A 5DCGA 3SWLA 4EDZA 3IE3A 4L8EA 2IMIA 4HZ2A 3KTLA 2GLRA 2WB9A 4KE3A 5LCZA 1Q4JA 1NHYA 8GSSA 2R3XA 3FR9A 6GSTA 2CZ3A 3VK9A 1FW1A 3QAWA 5HFKA 4AKIA 3NIVA 3O76A 1XWKA 1GUHA 3CSJA 5G5EA 2PMTA 3CRUA 13GSA 1TDIA 5GZZB 5ECHB 5ECQB 1K3LA 1FHEA 3PR8A 1HNBA 2A2RA 3EE2A 2R6KA 6GSYA 4PGTA 1V40A 4E68A 4F03A 1GTIA 2HRKA 10GSA 3CSIA 5A1NB 2WW2A 3GTUB 5KEJA 4L5LA 3TGZA 2VO4A 3UBLA 5BMUB 1VF2A 1JLWA 3ERFA 1PN9A 1GTUA 3VI5A 2O36A 1PMTA 4ACSA 6GSSA 3LYPA 4BVYB 3G7IA 2FHEA 3CBUA 3M8NA 4OMVA 5AN1A 19GSA 5DAKB 4PX1A 6GSVA 3ZFLA 5JCWA 1EOGA 2H1LA 5J4UA 1MD3A 1YKCA 2WS2A 4GSTA 1HNCA 4PI0C 3UBKA 3WD6A 2WVYA 2A2SA 5FT3A 3P90A 5LD0A 4BL7A 1F2EA 1XW6A 4KSMA 3U6VA 1G6WA 3IK9A 4MP4A 3PPUA 4GSSA 4DEJA 5ECPB 1IYIA 1U88A 4K0GA 2O3EA 22GSA 1USBA 2F3MA 4ISDA 4PURA 5ECRB 1M9BA 4HOJA 4WR5A 3KMOA 1E6BA 4FQUA 5F07A 1VF3A 4YAPA 2C3QA 2CZ2A 5F0GA 1JLVA 3F63A 1GSSA 2VCXA 5G5FA 5A4VA 5ECOB 4QQ7A 1EEMA 1TU7A 1V2AA 1K3OA 4KAEA 5ECNB 1HNAA 3P8WA 4ID0A 2WVXB 5A5HB 2EFDA 2N5FA 3R2QA 1GSYA 2IMKA 4EDYA 3KXOA 2GSRA 5BMUA 4IGJA 5DALB 4KDUA 3KM6A 4G0LA 17GSA 1GTBA 1YEWC 2WDUA 3ERGA 4Q5NA 5ECLB 4MK3A 1U3IA 3VPTA 4ZBDA 3HKRA 5F05A 6GSXA 6GSUA 3AY8A 2C3TA 4PUAA 4BVXB 1OKTA 4JBBA 5A4UA 1PX7A 1N25A 3LFLA 5GSSA 5AGYA 1K0AA 1K0CA 3UARA 3LXTA 1HQOA 4GTUA 2WW3A 4YQMA 3GH6A 4YQVA 3IK7A 4IELA 1GSEA 3N9JA 3UVHA 4MDCA 4ZB6A 3PGTA 2X64A 4KH7A 4YQUA 3F6FA 1OYJA 4ECJA 1GUKA 4EXJA 1EOHA 5EY6A 3CHXC 3FR3A 4KDXA 2C3NA 1UA5A 4PTSA 2EFCA 4NHWA 4HJ2A 4ZB9A 1EV9A 3F6DA 4AKXB 4AKGA 3VLNA 4MPGA 5FWGA 2C4JA 3FYGA 4JEDA 1BAYA 4ZB7A 3FY7A 5D9XA 2HSNB 1BG1A 5D73A 2CAIA 12GSA 3WYWA 4IBPA 18GSA 4E8HA 1PL2A 2LJRA 1GWCA 2WVXA 5J40A 2O5VA 2VKZG 3LSZA 1DUGA 3HJOA 5A34B 1S4BP 2AAWA 5DALA 1GSQA 1PKZA 7GSSA 1LJRA 2VD1A 2OA7A 1PA3A 3CRTA 4PXOA 2HQTA 2R5GA 5AIXA 2GSTA 4MF6A 4AI6A 3VURA 5ELAA 1GSDA 2ON7A 2VCWA 3M0FA 4GCIA 4ZBBA 5JCUA 1LBKA 1GUMA 5D9VA 2HSMB 3TU3B 1A0FA 1M0UA 1F3BA 4PQIA 1K0MA 5FHIA 2FNOA 5EVOA 1OE8A 3TOTA 2WVZA 3RBTA 1N2AA 3IC8A 4MF5A 3M1GA 4QMKA 2C8UA 5DQSA 5J41A 5D9WA 1GLQA 3ZMLA 4J2FA 2EFHA 4GDFA 4YH2A 1XWGA 3GX0A 5AISA 4EE0A 4HI7A 4OFTA 4ZB8A 4N3ZA 4KGIA 3D0ZA 4Q5RA 3LYKA 4GSNA 5A4WA 3H1NA 2HSNA 4IQ1A 1SVOA 4RI7A 2ON5A 5A1NA 3GTUA 4KX4A 2PERA 2PGTA 5AIVA 1JZRA 4PNFA 2UV8G 4USSA 5A34A 4AKHA 4MF7A 5ECKB 3DGQA 4BVYA 14GSA 3Q19A 4IQAA 2IL3A 2HRKB 4KDYA 3ZFBA 1IYHA 2GSSA 5DAKA 1YJ6A 2AHEA 2C80A 2PVQA 2JL4A 2CVDA 1OE7A 1Y1UA 3KJYA 4LMVA 2VD0A 3QAVA 4OFMA 3O3TA 1AQVA 1AXDA 4G01A 4ZXGA 1YDKA 20GSA 3I69A 1RK4A 1K0DA 2HSMA 3W8SA 3GSTA 3CWGA 1I1IP 2YV7A 1BX9A 4ZBAA 3ISOA 2AB6A 3EINA 3LQ7A 4NHZA 1BYEA 2VCTA 3HJMA 1GSUA 1BG5A 1KBNA 2WZSA 3GUSA 2GTUA 2OT3A 4IS0A 4OFNA 2V6KA 4G19A 3M3MA 3UAPA 4MPFA 4BL7B 3DD3A 2UZ8A 3MAKA 1MD4A 3Q74A 2GDRA 4LMWA 2YCDA 2HNLA 3CSHA 5J47A 1K0NA 1YVLA 5ECSA 5A5KA 1G6YA 1TW9A 1K0OA 5A5HA 1GSFA 9GSSA
chains in the Genus database with same CATH topology
4PHZC 3RFRC 4PI0C 4PI2C 3RGBC 1YEWC 3CHXC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PHZ C;  3RFR C;  4PI0 C;  4PI2 C;  3RGB C;  1YEW C;  3CHX C; 
#chains in the Genus database with same CATH topology
 1M99 A;  1B8X A;  5EL8 A;  1TU8 A;  4PNG A;  1PL1 A;  1C72 A;  1G7O A;  4K0N A;  3TOU A;  2DSA A;  3MDK A;  5B7C A;  4E8E A;  11GS A;  2OAC A;  4IKH A;  4IVF A;  1GNW A;  2YV9 A;  1GUL A;  2OAD A;  1PX6 A;  2WRT A;  4F0C A;  1AW9 A;  4Q5Q A;  4Q5F A;  3RFR C;  3G7J A;  4G10 A;  4BVX A;  3HMJ G;  5J4V A;  1PGT A;  1SVL A;  4YAV A;  1U87 A;  1BF5 A;  3LG6 A;  1ML6 A;  4O7H A;  4G0K A;  3VPQ A;  2R4V A;  1PD2 1;  1YY7 A;  3GUR A;  2WW1 A;  5DJL A;  5IQY A;  1TXU A;  2VCZ A;  1SVM A;  4ECC A;  1VF1 A;  3KMN A;  2EFE A;  3R3E A;  3VWX A;  1F3A A;  1Z9H A;  4NAX A;  1B4P A;  3QR6 A;  3N5O A;  3C8E A;  2DC5 A;  4KF9 A;  5DDL A;  4PHZ C;  3FR6 A;  4WR4 A;  2J9H A;  4HZ4 A;  3QAG A;  2VCV A;  3VI7 A;  4O92 A;  4ECI A;  5GST A;  5F06 A;  5F8B A;  1K3Y A;  1MTC A;  4F0B A;  6GSW A;  4JZQ A;  1VF4 A;  3BBY A;  4GF0 A;  4L5O A;  3ZMK A;  4CHS A;  5J5N A;  3RGB C;  4AGS A;  2WJU A;  2CAQ A;  2D2Z A;  3GSS A;  1YQ1 A;  1ZL9 A;  3IBH A;  1B48 A;  4W66 A;  1AQW A;  5D9T A;  4ECB A;  1GLP A;  2CA8 A;  2VCQ A;  4IW9 A;  5J4Y A;  3Q18 A;  1Y6E A;  5ECM B;  1XW5 A;  4G9H A;  4EC0 A;  3IR4 A;  1K0B A;  4G0I A;  1EV4 A;  4I97 A;  2HRA A;  2NTO A;  5DJM A;  1GTA A;  4PI2 C;  4MZW A;  3LXZ A;  4TOP A;  1PKW A;  1AQX A;  5ECI B;  3FRC A;  4N0V A;  3LJR A;  4GLT A;  2F8F A;  3L0H A;  5ELG A;  4FXY P;  2GSQ A;  1ZGN A;  4RI6 A;  2PBJ A;  1M9A A;  16GS A;  4IJI A;  1R5A A;  4PQH A;  1GNE A;  3I6A A;  2WW0 A;  5DCG A;  3SWL A;  4EDZ A;  3IE3 A;  4L8E A;  2IMI A;  4HZ2 A;  3KTL A;  2GLR A;  2WB9 A;  4KE3 A;  5LCZ A;  1Q4J A;  1NHY A;  8GSS A;  2R3X A;  3FR9 A;  6GST A;  2CZ3 A;  3VK9 A;  1FW1 A;  3QAW A;  5HFK A;  4AKI A;  3NIV A;  3O76 A;  1XWK A;  1GUH A;  3CSJ A;  5G5E A;  2PMT A;  3CRU A;  13GS A;  1TDI A;  5GZZ B;  5ECH B;  5ECQ B;  1K3L A;  1FHE A;  3PR8 A;  1HNB A;  2A2R A;  3EE2 A;  2R6K A;  6GSY A;  4PGT A;  1V40 A;  4E68 A;  4F03 A;  1GTI A;  2HRK A;  10GS A;  3CSI A;  5A1N B;  2WW2 A;  3GTU B;  5KEJ A;  4L5L A;  3TGZ A;  2VO4 A;  3UBL A;  5BMU B;  1VF2 A;  1JLW A;  3ERF A;  1PN9 A;  1GTU A;  3VI5 A;  2O36 A;  1PMT A;  4ACS A;  6GSS A;  3LYP A;  4BVY B;  3G7I A;  2FHE A;  3CBU A;  3M8N A;  4OMV A;  5AN1 A;  19GS A;  5DAK B;  4PX1 A;  6GSV A;  3ZFL A;  5JCW A;  1EOG A;  2H1L A;  5J4U A;  1MD3 A;  1YKC A;  2WS2 A;  4GST A;  1HNC A;  4PI0 C;  3UBK A;  3WD6 A;  2WVY A;  2A2S A;  5FT3 A;  3P90 A;  5LD0 A;  4BL7 A;  1F2E A;  1XW6 A;  4KSM A;  3U6V A;  1G6W A;  3IK9 A;  4MP4 A;  3PPU A;  4GSS A;  4DEJ A;  5ECP B;  1IYI A;  1U88 A;  4K0G A;  2O3E A;  22GS A;  1USB A;  2F3M A;  4ISD A;  4PUR A;  5ECR B;  1M9B A;  4HOJ A;  4WR5 A;  3KMO A;  1E6B A;  4FQU A;  5F07 A;  1VF3 A;  4YAP A;  2C3Q A;  2CZ2 A;  5F0G A;  1JLV A;  3F63 A;  1GSS A;  2VCX A;  5G5F A;  5A4V A;  5ECO B;  4QQ7 A;  1EEM A;  1TU7 A;  1V2A A;  1K3O A;  4KAE A;  5ECN B;  1HNA A;  3P8W A;  4ID0 A;  2WVX B;  5A5H B;  2EFD A;  2N5F A;  3R2Q A;  1GSY A;  2IMK A;  4EDY A;  3KXO A;  2GSR A;  5BMU A;  4IGJ A;  5DAL B;  4KDU A;  3KM6 A;  4G0L A;  17GS A;  1GTB A;  1YEW C;  2WDU A;  3ERG A;  4Q5N A;  5ECL B;  4MK3 A;  1U3I A;  3VPT A;  4ZBD A;  3HKR A;  5F05 A;  6GSX A;  6GSU A;  3AY8 A;  2C3T A;  4PUA A;  4BVX B;  1OKT A;  4JBB A;  5A4U A;  1PX7 A;  1N25 A;  3LFL A;  5GSS A;  5AGY A;  1K0A A;  1K0C A;  3UAR A;  3LXT A;  1HQO A;  4GTU A;  2WW3 A;  4YQM A;  3GH6 A;  4YQV A;  3IK7 A;  4IEL A;  1GSE A;  3N9J A;  3UVH A;  4MDC A;  4ZB6 A;  3PGT A;  2X64 A;  4KH7 A;  4YQU A;  3F6F A;  1OYJ A;  4ECJ A;  1GUK A;  4EXJ A;  1EOH A;  5EY6 A;  3CHX C;  3FR3 A;  4KDX A;  2C3N A;  1UA5 A;  4PTS A;  2EFC A;  4NHW A;  4HJ2 A;  4ZB9 A;  1EV9 A;  3F6D A;  4AKX B;  4AKG A;  3VLN A;  4MPG A;  5FWG A;  2C4J A;  3FYG A;  4JED A;  1BAY A;  4ZB7 A;  3FY7 A;  5D9X A;  2HSN B;  1BG1 A;  5D73 A;  2CAI A;  12GS A;  3WYW A;  4IBP A;  18GS A;  4E8H A;  1PL2 A;  2LJR A;  1GWC A;  2WVX A;  5J40 A;  2O5V A;  2VKZ G;  3LSZ A;  1DUG A;  3HJO A;  5A34 B;  1S4B P;  2AAW A;  5DAL A;  1GSQ A;  1PKZ A;  7GSS A;  1LJR A;  2VD1 A;  2OA7 A;  1PA3 A;  3CRT A;  4PXO A;  2HQT A;  2R5G A;  5AIX A;  2GST A;  4MF6 A;  4AI6 A;  3VUR A;  5ELA A;  1GSD A;  2ON7 A;  2VCW A;  3M0F A;  4GCI A;  4ZBB A;  5JCU A;  1LBK A;  1GUM A;  5D9V A;  2HSM B;  3TU3 B;  1A0F A;  1M0U A;  1F3B A;  4PQI A;  1K0M A;  5FHI A;  2FNO A;  5EVO A;  1OE8 A;  3TOT A;  2WVZ A;  3RBT A;  1N2A A;  3IC8 A;  4MF5 A;  3M1G A;  4QMK A;  2C8U A;  5DQS A;  5J41 A;  5D9W A;  1GLQ A;  3ZML A;  4J2F A;  2EFH A;  4GDF A;  4YH2 A;  1XWG A;  3GX0 A;  5AIS A;  4EE0 A;  4HI7 A;  4OFT A;  4ZB8 A;  4N3Z A;  4KGI A;  3D0Z A;  4Q5R A;  3LYK A;  4GSN A;  5A4W A;  3H1N A;  2HSN A;  4IQ1 A;  1SVO A;  4RI7 A;  2ON5 A;  5A1N A;  3GTU A;  4KX4 A;  2PER A;  2PGT A;  5AIV A;  1JZR A;  4PNF A;  2UV8 G;  4USS A;  5A34 A;  4AKH A;  4MF7 A;  5ECK B;  3DGQ A;  4BVY A;  14GS A;  3Q19 A;  4IQA A;  2IL3 A;  2HRK B;  4KDY A;  3ZFB A;  1IYH A;  2GSS A;  5DAK A;  1YJ6 A;  2AHE A;  2C80 A;  2PVQ A;  2JL4 A;  2CVD A;  1OE7 A;  1Y1U A;  3KJY A;  4LMV A;  2VD0 A;  3QAV A;  4OFM A;  3O3T A;  1AQV A;  1AXD A;  4G01 A;  4ZXG A;  1YDK A;  20GS A;  3I69 A;  1RK4 A;  1K0D A;  2HSM A;  3W8S A;  3GST A;  3CWG A;  1I1I P;  2YV7 A;  1BX9 A;  4ZBA A;  3ISO A;  2AB6 A;  3EIN A;  3LQ7 A;  4NHZ A;  1BYE A;  2VCT A;  3HJM A;  1GSU A;  1BG5 A;  1KBN A;  2WZS A;  3GUS A;  2GTU A;  2OT3 A;  4IS0 A;  4OFN A;  2V6K A;  4G19 A;  3M3M A;  3UAP A;  4MPF A;  4BL7 B;  3DD3 A;  2UZ8 A;  3MAK A;  1MD4 A;  3Q74 A;  2GDR A;  4LMW A;  2YCD A;  2HNL A;  3CSH A;  5J47 A;  1K0N A;  1YVL A;  5ECS A;  5A5K A;  1G6Y A;  1TW9 A;  1K0O A;  5A5H A;  1GSF A;  9GSS A; 
#chains in the Genus database with same CATH homology
 4PHZ C;  3RFR C;  4PI0 C;  4PI2 C;  3RGB C;  1YEW C;  3CHX C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...