1YEWC

Crystal structure of particulate methane monooxygenase
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
215
structure length
188
Chain Sequence
LLDKKWLTFALAIYTVFYLWVRWYEGVYGWSAGLDSFAPEFETYWMNFLYTEIVLEIVTASILWGYLWKTRDRNLAALTPREELRRNFTHLVWLVAYAWAIYWGASYFTEQDGTWHQTIVRDTDFTPSHIIEFYLSYPIYIITGFAAFIYAKTRLPFFAHTFWFMEELFVAPLHYGFVIFGWLALAVM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase, membrane protein
molecule keywords particulate methane monooxygenase, B subunit
publication title Crystal structure of a membrane-bound metalloenzyme that catalyses the biological oxidation of methane.
pubmed doi rcsb
source organism Methylococcus capsulatus
total genus 64
structure length 188
sequence length 215
chains with identical sequence G, K
ec nomenclature
pdb deposition date 2004-12-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF04896 AmoC Ammonia monooxygenase/methane monooxygenase, subunit C
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.50 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Particulate methane monooxygenase subunit c2. Chain: C 1yewC00
3CHXC 3RGBC 1YEWC 3RFRC 4PI2C 4PHZC 4PI0C
chains in the Genus database with same CATH superfamily
1PD21 2GSSA 4Q5FA 1U88A 5LD0A 2VD1A 1GLPA 6GSYA 4ISDA 4KF9A 3KJYA 4F0CA 5A1NA 2PVQA 4EDYA 1GSEA 3VK9A 3IR4A 4MF5A 1JLWA 2GTUA 2IMKA 3FYGA 5A34A 5DDLA 2IMIA 4AI6A 7GSSA 4OFMA 4BL7A 4EDZA 3DD3A 1I1IP 3CBUA 4BVXB 1IYHA 4KX4A 2EFDA 1PN9A 1A0FA 1K0AA 3G7IA 1PL1A 2AHEA 1GTIA 4Q5NA 1BG1A 4KAEA 4ECIA 3Q74A 2VCXA 1HNAA 4JEDA 1LBKA 1JLVA 5EL8A 1DUGA 1K0MA 1SVOA 3ZFBA 1AQWA 5ECMB 3TOUA 5J4UA 5G5EA 4E68A 22GSA 4DEJA 2VKZG 5LCZA 1K3OA 1PGTA 5F07A 3CRTA 5DAKB 2CAQA 2VCTA 2A2SA 1HNCA 2O36A 3F6FA 1PKWA 3IBHA 5A4UA 2VCVA 1OYJA 2UV8G 4G9HA 4G19A 3CSJA 1ZL9A 5ECIB 4USSA 1XW6A 5DCGA 1YQ1A 2C80A 2GSTA 5ECOB 3IK9A 4O7HA 2HSNB 1YDKA 4OFTA 5JCWA 1PKZA 4IJIA 5BMUA 1GSQA 3HKRA 4PI2C 4GSTA 2EFEA 2AAWA 1UA5A 1YEWC 5A5KA 4N3ZA 3L0HA 2ON5A 2WZSA 2A2RA 2WW2A 3RFRC 2WW3A 2FNOA 3U6VA 4K0NA 3O3TA 5FT3A 3CSHA 2H1LA 3PR8A 3I69A 4L5LA 3CHXC 4IS0A 3RGBC 1BX9A 1M99A 1V40A 1VF3A 3QAWA 4KH7A 1GULA 1MTCA 1K3LA 1KBNA 4FXYP 4YAVA 1EV4A 2PERA 1FHEA 2GDRA 4MK3A 2WB9A 2HRKA 1BG5A 2F8FA 2OT3A 4QQ7A 5ECPB 5F0GA 2UZ8A 4AKGA 5D9VA 5DALA 2HRAA 5JCUA 1M9AA 3D0ZA 4IELA 1N2AA 12GSA 2FHEA 4KDUA 3UARA 4IBPA 2EFHA 4NHWA 1GLQA 5F8BA 5A5HA 4ZB9A 1GTUA 1IYIA 5J5NA 1V2AA 5G5FA 1YKCA 19GSA 5HFKA 2YV9A 1JZRA 1YVLA 3I6AA 4ID0A 2JL4A 1K0DA 4KDYA 1EOGA 4QMKA 1XWGA 2R6KA 4MF7A 4ECJA 2C3NA 2PBJA 1YY7A 2YV7A 4JZQA 3LQ7A 4WR5A 4E8EA 5A4VA 3LXZA 4ZXGA 2WW0A 1M9BA 2HSMB 4CHSA 2C3TA 5A4WA 3F6DA 3QAVA 3TU3B 1GUMA 4ZB7A 1AXDA 3KXOA 4ECCA 4BVXA 1GSFA 5ECLB 5EVOA 4L5OA 4ZBBA 5ECNB 3FRCA 3LYKA 5DJLA 2DSAA 5AN1A 3IC8A 3LG6A 4KSMA 2F3MA 2R4VA 3PPUA 1K0NA 2CZ2A 4MPFA 5IQYA 2OA7A 4WR4A 3N9JA 1PL2A 4ZBDA 2WW1A 6GSUA 4MDCA 4G0IA 4Q5QA 2CA8A 1G7OA 1K0OA 5DAKA 1FW1A 1TXUA 1NHYA 1B8XA 3H1NA 3ZFLA 4EXJA 3ZMKA 5A34B 4GCIA 1PX6A 4G10A 4BL7B 4KGIA 5ECQB 5J41A 4RI6A 5F06A 13GSA 3FR9A 3FY7A 4YQUA 2C4JA 2R3XA 3KMOA 3HJMA 4EE0A 4HZ2A 4HOJA 2GSQA 3GTUB 4BVYA 1TDIA 1G6YA 2HSNA 5DJMA 2HQTA 1AW9A 4I97A 6GSVA 5AIVA 6GSWA 4MP4A 1ZGNA 4HJ2A 1BF5A 1OE7A 2IL3A 3C8EA 4AKIA 1AQVA 1PMTA 3GUSA 1VF2A 3M3MA 3LXTA 4NHZA 1MD3A 1RK4A 2WRTA 1R5AA 3FR3A 5ELGA 3KM6A 2X64A 4GF0A 4PUAA 5FWGA 4OMVA 4IGJA 4GTUA 4J2FA 4G01A 5ECRB 18GSA 4W66A 1Y6EA 1G6WA 4L8EA 2C3QA 3VI7A 2WVXB 5J4VA 3TOTA 4YH2A 3UBKA 3VPQA 3HJOA 1ML6A 2WDUA 5GZZB 3Q19A 2VCQA 2OADA 3VPTA 2CZ3A 3M0FA 16GSA 2GSRA 4MF6A 2D2ZA 3VWXA 3N5OA 1GSSA 3RBTA 2R5GA 4MZWA 2PMTA 2CAIA 4YQVA 4OFNA 1XWKA 4O92A 1F3AA 2HSMA 2HRKB 1M0UA 4IQ1A 3P8WA 3M1GA 5ELAA 1U87A 4K0GA 1GUKA 4PX1A 5DALB 1VF1A 5D9TA 1LJRA 4PNFA 3ZMLA 3QR6A 4GSNA 9GSSA 1YJ6A 5A5HB 3HMJG 1Y1UA 5D73A 4FQUA 6GSTA 2WVZA 2O5VA 1EV9A 5KEJA 2DC5A 1SVMA 3SWLA 4ECBA 4GDFA 3KTLA 4HI7A 3M8NA 1HQOA 1XW5A 3DGQA 2LJRA 1N25A 2NTOA 5ECKB 1EOHA 2VCZA 4F03A 3UAPA 3AY8A 4MPGA 4AKHA 5ECSA 5GSSA 1Q4JA 5A1NB 1HNBA 1BYEA 4ZBAA 4PQHA 2OACA 5B7CA 1GWCA 1TW9A 5AIXA 3IK7A 4F0BA 6GSXA 1OKTA 1F3BA 1GSUA 5AISA 3F63A 3GURA 3GTUA 3LFLA 4PTSA 5F05A 11GSA 3IE3A 3TGZA 1BAYA 4G0LA 4KE3A 3GH6A 4IQAA 4E8HA 3ERFA 4HZ4A 1MD4A 14GSA 1GSYA 4PXOA 3NIVA 4GLTA 3UBLA 1GNEA 3MDKA 1VF4A 2J9HA 5D9WA 1SVLA 3ISOA 3CSIA 3EINA 3VLNA 4PNGA 1S4BP 2HNLA 3GX0A 3GSSA 3FR6A 3R2QA 1B48A 2EFCA 5ECHB 1K0BA 1U3IA 8GSSA 4EC0A 2C8UA 3Q18A 3UVHA 2ON7A 4PHZC 5J47A 1EEMA 3LYPA 3WD6A 2WVXA 4BVYB 1Z9HA 3CRUA 2YCDA 4LMWA 1K0CA 1USBA 4ACSA 4YQMA 1TU8A 1F2EA 4JBBA 4Q5RA 1GSDA 1K3YA 2WJUA 3O76A 1TU7A 1GTBA 3R3EA 5J4YA 3VI5A 3P90A 5BMUB 1E6BA 4IW9A 4KDXA 4TOPA 2VO4A 1AQXA 3VURA 3ERGA 1GUHA 5EY6A 5GSTA 3WYWA 2VCWA 5D9XA 17GSA 4LMVA 4N0VA 4PGTA 1PA3A 1B4PA 4G0KA 2WS2A 1PX7A 6GSSA 20GSA 1C72A 4ZB6A 4AKXB 3BBYA 4RI7A 3LJRA 4AGSA 2AB6A 5DQSA 4NAXA 4PQIA 2O3EA 4ZB8A 2V6KA 5J40A 2PGTA 5FHIA 2VD0A 4YAPA 3G7JA 3LSZA 3MAKA 5AGYA 1GTAA 4GSSA 3PGTA 2GLRA 4IKHA 1GNWA 2N5FA 3W8SA 3EE2A 3KMNA 3QAGA 4IVFA 4PURA 3CWGA 3GSTA 10GSA 2CVDA 4PI0C 2WVYA 1OE8A
chains in the Genus database with same CATH topology
3CHXC 3RGBC 1YEWC 3RFRC 4PI2C 4PHZC 4PI0C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CHX C;  3RGB C;  1YEW C;  3RFR C;  4PI2 C;  4PHZ C;  4PI0 C; 
#chains in the Genus database with same CATH topology
 1PD2 1;  2GSS A;  4Q5F A;  1U88 A;  5LD0 A;  2VD1 A;  1GLP A;  6GSY A;  4ISD A;  4KF9 A;  3KJY A;  4F0C A;  5A1N A;  2PVQ A;  4EDY A;  1GSE A;  3VK9 A;  3IR4 A;  4MF5 A;  1JLW A;  2GTU A;  2IMK A;  3FYG A;  5A34 A;  5DDL A;  2IMI A;  4AI6 A;  7GSS A;  4OFM A;  4BL7 A;  4EDZ A;  3DD3 A;  1I1I P;  3CBU A;  4BVX B;  1IYH A;  4KX4 A;  2EFD A;  1PN9 A;  1A0F A;  1K0A A;  3G7I A;  1PL1 A;  2AHE A;  1GTI A;  4Q5N A;  1BG1 A;  4KAE A;  4ECI A;  3Q74 A;  2VCX A;  1HNA A;  4JED A;  1LBK A;  1JLV A;  5EL8 A;  1DUG A;  1K0M A;  1SVO A;  3ZFB A;  1AQW A;  5ECM B;  3TOU A;  5J4U A;  5G5E A;  4E68 A;  22GS A;  4DEJ A;  2VKZ G;  5LCZ A;  1K3O A;  1PGT A;  5F07 A;  3CRT A;  5DAK B;  2CAQ A;  2VCT A;  2A2S A;  1HNC A;  2O36 A;  3F6F A;  1PKW A;  3IBH A;  5A4U A;  2VCV A;  1OYJ A;  2UV8 G;  4G9H A;  4G19 A;  3CSJ A;  1ZL9 A;  5ECI B;  4USS A;  1XW6 A;  5DCG A;  1YQ1 A;  2C80 A;  2GST A;  5ECO B;  3IK9 A;  4O7H A;  2HSN B;  1YDK A;  4OFT A;  5JCW A;  1PKZ A;  4IJI A;  5BMU A;  1GSQ A;  3HKR A;  4PI2 C;  4GST A;  2EFE A;  2AAW A;  1UA5 A;  1YEW C;  5A5K A;  4N3Z A;  3L0H A;  2ON5 A;  2WZS A;  2A2R A;  2WW2 A;  3RFR C;  2WW3 A;  2FNO A;  3U6V A;  4K0N A;  3O3T A;  5FT3 A;  3CSH A;  2H1L A;  3PR8 A;  3I69 A;  4L5L A;  3CHX C;  4IS0 A;  3RGB C;  1BX9 A;  1M99 A;  1V40 A;  1VF3 A;  3QAW A;  4KH7 A;  1GUL A;  1MTC A;  1K3L A;  1KBN A;  4FXY P;  4YAV A;  1EV4 A;  2PER A;  1FHE A;  2GDR A;  4MK3 A;  2WB9 A;  2HRK A;  1BG5 A;  2F8F A;  2OT3 A;  4QQ7 A;  5ECP B;  5F0G A;  2UZ8 A;  4AKG A;  5D9V A;  5DAL A;  2HRA A;  5JCU A;  1M9A A;  3D0Z A;  4IEL A;  1N2A A;  12GS A;  2FHE A;  4KDU A;  3UAR A;  4IBP A;  2EFH A;  4NHW A;  1GLQ A;  5F8B A;  5A5H A;  4ZB9 A;  1GTU A;  1IYI A;  5J5N A;  1V2A A;  5G5F A;  1YKC A;  19GS A;  5HFK A;  2YV9 A;  1JZR A;  1YVL A;  3I6A A;  4ID0 A;  2JL4 A;  1K0D A;  4KDY A;  1EOG A;  4QMK A;  1XWG A;  2R6K A;  4MF7 A;  4ECJ A;  2C3N A;  2PBJ A;  1YY7 A;  2YV7 A;  4JZQ A;  3LQ7 A;  4WR5 A;  4E8E A;  5A4V A;  3LXZ A;  4ZXG A;  2WW0 A;  1M9B A;  2HSM B;  4CHS A;  2C3T A;  5A4W A;  3F6D A;  3QAV A;  3TU3 B;  1GUM A;  4ZB7 A;  1AXD A;  3KXO A;  4ECC A;  4BVX A;  1GSF A;  5ECL B;  5EVO A;  4L5O A;  4ZBB A;  5ECN B;  3FRC A;  3LYK A;  5DJL A;  2DSA A;  5AN1 A;  3IC8 A;  3LG6 A;  4KSM A;  2F3M A;  2R4V A;  3PPU A;  1K0N A;  2CZ2 A;  4MPF A;  5IQY A;  2OA7 A;  4WR4 A;  3N9J A;  1PL2 A;  4ZBD A;  2WW1 A;  6GSU A;  4MDC A;  4G0I A;  4Q5Q A;  2CA8 A;  1G7O A;  1K0O A;  5DAK A;  1FW1 A;  1TXU A;  1NHY A;  1B8X A;  3H1N A;  3ZFL A;  4EXJ A;  3ZMK A;  5A34 B;  4GCI A;  1PX6 A;  4G10 A;  4BL7 B;  4KGI A;  5ECQ B;  5J41 A;  4RI6 A;  5F06 A;  13GS A;  3FR9 A;  3FY7 A;  4YQU A;  2C4J A;  2R3X A;  3KMO A;  3HJM A;  4EE0 A;  4HZ2 A;  4HOJ A;  2GSQ A;  3GTU B;  4BVY A;  1TDI A;  1G6Y A;  2HSN A;  5DJM A;  2HQT A;  1AW9 A;  4I97 A;  6GSV A;  5AIV A;  6GSW A;  4MP4 A;  1ZGN A;  4HJ2 A;  1BF5 A;  1OE7 A;  2IL3 A;  3C8E A;  4AKI A;  1AQV A;  1PMT A;  3GUS A;  1VF2 A;  3M3M A;  3LXT A;  4NHZ A;  1MD3 A;  1RK4 A;  2WRT A;  1R5A A;  3FR3 A;  5ELG A;  3KM6 A;  2X64 A;  4GF0 A;  4PUA A;  5FWG A;  4OMV A;  4IGJ A;  4GTU A;  4J2F A;  4G01 A;  5ECR B;  18GS A;  4W66 A;  1Y6E A;  1G6W A;  4L8E A;  2C3Q A;  3VI7 A;  2WVX B;  5J4V A;  3TOT A;  4YH2 A;  3UBK A;  3VPQ A;  3HJO A;  1ML6 A;  2WDU A;  5GZZ B;  3Q19 A;  2VCQ A;  2OAD A;  3VPT A;  2CZ3 A;  3M0F A;  16GS A;  2GSR A;  4MF6 A;  2D2Z A;  3VWX A;  3N5O A;  1GSS A;  3RBT A;  2R5G A;  4MZW A;  2PMT A;  2CAI A;  4YQV A;  4OFN A;  1XWK A;  4O92 A;  1F3A A;  2HSM A;  2HRK B;  1M0U A;  4IQ1 A;  3P8W A;  3M1G A;  5ELA A;  1U87 A;  4K0G A;  1GUK A;  4PX1 A;  5DAL B;  1VF1 A;  5D9T A;  1LJR A;  4PNF A;  3ZML A;  3QR6 A;  4GSN A;  9GSS A;  1YJ6 A;  5A5H B;  3HMJ G;  1Y1U A;  5D73 A;  4FQU A;  6GST A;  2WVZ A;  2O5V A;  1EV9 A;  5KEJ A;  2DC5 A;  1SVM A;  3SWL A;  4ECB A;  4GDF A;  3KTL A;  4HI7 A;  3M8N A;  1HQO A;  1XW5 A;  3DGQ A;  2LJR A;  1N25 A;  2NTO A;  5ECK B;  1EOH A;  2VCZ A;  4F03 A;  3UAP A;  3AY8 A;  4MPG A;  4AKH A;  5ECS A;  5GSS A;  1Q4J A;  5A1N B;  1HNB A;  1BYE A;  4ZBA A;  4PQH A;  2OAC A;  5B7C A;  1GWC A;  1TW9 A;  5AIX A;  3IK7 A;  4F0B A;  6GSX A;  1OKT A;  1F3B A;  1GSU A;  5AIS A;  3F63 A;  3GUR A;  3GTU A;  3LFL A;  4PTS A;  5F05 A;  11GS A;  3IE3 A;  3TGZ A;  1BAY A;  4G0L A;  4KE3 A;  3GH6 A;  4IQA A;  4E8H A;  3ERF A;  4HZ4 A;  1MD4 A;  14GS A;  1GSY A;  4PXO A;  3NIV A;  4GLT A;  3UBL A;  1GNE A;  3MDK A;  1VF4 A;  2J9H A;  5D9W A;  1SVL A;  3ISO A;  3CSI A;  3EIN A;  3VLN A;  4PNG A;  1S4B P;  2HNL A;  3GX0 A;  3GSS A;  3FR6 A;  3R2Q A;  1B48 A;  2EFC A;  5ECH B;  1K0B A;  1U3I A;  8GSS A;  4EC0 A;  2C8U A;  3Q18 A;  3UVH A;  2ON7 A;  4PHZ C;  5J47 A;  1EEM A;  3LYP A;  3WD6 A;  2WVX A;  4BVY B;  1Z9H A;  3CRU A;  2YCD A;  4LMW A;  1K0C A;  1USB A;  4ACS A;  4YQM A;  1TU8 A;  1F2E A;  4JBB A;  4Q5R A;  1GSD A;  1K3Y A;  2WJU A;  3O76 A;  1TU7 A;  1GTB A;  3R3E A;  5J4Y A;  3VI5 A;  3P90 A;  5BMU B;  1E6B A;  4IW9 A;  4KDX A;  4TOP A;  2VO4 A;  1AQX A;  3VUR A;  3ERG A;  1GUH A;  5EY6 A;  5GST A;  3WYW A;  2VCW A;  5D9X A;  17GS A;  4LMV A;  4N0V A;  4PGT A;  1PA3 A;  1B4P A;  4G0K A;  2WS2 A;  1PX7 A;  6GSS A;  20GS A;  1C72 A;  4ZB6 A;  4AKX B;  3BBY A;  4RI7 A;  3LJR A;  4AGS A;  2AB6 A;  5DQS A;  4NAX A;  4PQI A;  2O3E A;  4ZB8 A;  2V6K A;  5J40 A;  2PGT A;  5FHI A;  2VD0 A;  4YAP A;  3G7J A;  3LSZ A;  3MAK A;  5AGY A;  1GTA A;  4GSS A;  3PGT A;  2GLR A;  4IKH A;  1GNW A;  2N5F A;  3W8S A;  3EE2 A;  3KMN A;  3QAG A;  4IVF A;  4PUR A;  3CWG A;  3GST A;  10GS A;  2CVD A;  4PI0 C;  2WVY A;  1OE8 A; 
#chains in the Genus database with same CATH homology
 3CHX C;  3RGB C;  1YEW C;  3RFR C;  4PI2 C;  4PHZ C;  4PI0 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...