7GSSA

Human glutathione s-transferase p1-1, complex with glutathione
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
209
structure length
209
Chain Sequence
PPYTVVYFPVRGRCAALRMLLADQGQSWKEEVVTVETWQEGSLKASCLYGQLPKFQDGDLTLYQSNTILRHLGRTLGLYGKDQQEAALVDMVNDGVEDLRCKYISLIYTNYEAGKDDYVKALPGQLKPFETLLSQNQGGKTFIVGDQISFADYNLLDLLLIHEVLAPGCLDAFPLLSAYVGRLSARPKLKAFLASPEYVNLPINGNGKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords GLUTATHIONE S-TRANSFERASE P1-1
publication title The structures of human glutathione transferase P1-1 in complex with glutathione and various inhibitors at high resolution.
pubmed doi rcsb
source organism Homo sapiens
total genus 81
structure length 209
sequence length 209
chains with identical sequence B
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 1997-08-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
A PF14497 GST_C_3 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 7gssA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 7gssA01
1X5DA 1EV4A 4P3YB 2BTOT 4MZCA 1SJIA 3TGZA 3PH9A 3C1RA 4I8BA 1MDIA 3HVVA 2OKAA 2GSSA 5ECLB 3KMOA 14GSA 3KIJA 4BVYA 3TJFA 1U6TA 5B6MA 1X5EA 5J3RA 4G0IA 3TOUA 2WGRA 2YOIA 2IFQA 3H4KA 3KH9A 3M1GA 1U3AA 5D93A 4RI6A 1FO5A 2OA7A 1XOAA 3VFIA 1K0MA 3EINA 1SU9A 3ZL5A 2EIQA 2RLIA 4POBA 3L78A 4IHUA 1FVJA 2PVOC 4N0ZA 3LXTA 3WT1A 3GTUA 3EYTA 2ON7A 3A2WA 1ERVA 5ECKB 5D73A 4HZ2A 1ZGNA 3RAZA 2HQTA 3H1NA 2ALBA 3EVIA 5C04A 3IBHA 5DVBA 1QXHA 3GYKA 4GCIA 4BA7A 2LSTA 3QD9A 3RPPA 3GSTA 5CRGA 1AQXA 4ML6A 4MK3A 5EPFA 4K7OA 5DAKB 3CTGA 4OFNA 2XC2A 4KA0A 3WYWA 4PURA 5KEJA 3DWVA 1AQVA 3VWVA 4Q5NA 2J9HA 4MH2A 5JWQB 5A5KA 2AJQB 3WGEA 4IP6A 2H01A 2TRXA 2HZFA 2KUCA 4PUFC 1OE7A 3I69A 2NPBA 3VI7A 3UVTA 3U6VA 4NAXA 2FUG2 3FKFA 3I9V2 1W4VA 2AHEA 2HSYA 3HHVA 4EF0A 4POLA 5LCZA 5H5QA 1VF2A 3FR3A 3L4NA 2YP6A 1WWJA 3LG6A 2H30A 2HSNB 2YV9A 5B6NA 3ZITA 1XXUA 2LEGA 2IPAA 2FLSA 2GZYA 4HS1A 4BL7A 3QCPA 3LXZA 3ZMKA 1XFLA 2VL2C 1PKZA 3AY8A 3PPUA 2A2RA 3Q19A 4DEJA 2V2GA 4IP1A 5GZZB 3GL3A 1TXXA 1FAAA 1SJ6A 4IELA 1ERUA 1TI1A 1GTAA 1SK2A 2IWTA 3CYNA 1FB0A 1TW9A 1O8XA 3C7MA 3KEBA 3QOUA 4PUAA 16GSA 4POMA 4ACSA 3ZRDA 1XVQA 2JSYA 2MMOA 4LMWA 3KMNA 4IQ1A 3I43A 1PD21 2LS5A 1GL8A 2UZ8A 4OMVA 3G7YA 4EC0A 5ABRA 4L5LA 1XW5A 3FZ5A 3KJYA 4X1UA 3D21A 1WRYA 1SL0B 3TKSE 1CQHA 2H73A 2YPMA 4WBJA 4AF2A 2JZTA 2HI7A 1SD9A 2RM5A 3LYPA 4ZXGA 2TRCP 3M9JA 2YZHA 1O85A 1V9WA 1Q98A 3C73A 2VCZA 4MF7A 1NW2A 2H19A 1FG4A 1SL1B 3H79A 5IO0A 3QMXA 5IMFA 1WP0A 3SBCA 1M9BA 2H70A 2WRTA 4GQCA 3TUEA 4DSSA 2NBSA 4H86A 4HQSA 5DQYA 3VK9A 1GNWA 3D5JA 3VWUA 4HJ2A 1A8LA 2LNTA 1GTBA 2H66A 1Z6MA 5CRDA 1TRUA 5CREA 3TJGA 4MLYA 1GUMA 5IPHA 4MH3A 3ZYWA 3KH7A 2PBJA 1T3BA 4IKHA 2OE0A 4XS4B 4L8EA 5G30A 5H5RA 5DJMA 5KN1A 2DJ3A 1A8YA 2FWGA 4ML1A 4MA9A 4YAPA 2FGXA 4RQRA 3IRAA 4OCFA 1AXDA 4J57E 3ZREA 5A4VA 4TXOA 5GSTA 1OKTA 1TTZA 1F9MA 1GSUA 1Z6NA 2CQ9A 2PUKC 4K1FA 4CW9A 5B8BA 2R4VA 4KX4A 5CNWA 2IMFA 1A0FA 4PX1A 4G9HA 3HCZA 1K0BA 4WXTA 1T4ZA 2F9SA 4EXJA 4HDEA 1IYHA 3L9UA 2E2MA 5KN0A 5JCWA 1F6MC 1Z9HA 2KHPA 1YKAA 4NMUA 1SYXA 3GX8A 3QPMA 2IN3A 2I3YA 4ILFA 4OO5A 4F0BA 2ZUPA 1HNCA 3N5OA 3GKNA 4DSRA 2XBQA 4KSMA 2CX4A 4IN0A 2J23A 4O7HA 1LJRA 3TKSA 1GRXA 4HOJA 1UVZA 4ZL8A 3Q18A 1FOVA 2GQMA 1SK0A 4IW9A 4IS0A 1Q4JA 3EE2A 2H6ZA 5AIVA 1E2YA 2P31A 3MWHA 2V32A 4ZBAA 2GQLA 2GGTA 2JL4A 1OC9B 5C00A 2P0GA 4TKYA 4WBRD 3UJ1A 1CQGA 5AN1A 3BOAA 1YF0A 3GH6A 3KP9A 4NXIA 3TDGA 4XCSA 4NHZA 1WE0A 4LL1B 4PXOA 1PGTA 3GL5A 1M0UA 4EE0A 2H0IA 3CRTA 5HQPA 2M72A 1FW1A 2H6YA 5HR1A 4OFMA 1FVKA 4OCEA 4PQHA 2F8FA 3KD0A 3GIXA 9GSSA 4HJMA 1R5AA 1WMJA 5LNKe 3LJRA 2YNXA 3CSJA 4FYBA 4WKWA 2R6KA 2C1YA 3IV4A 2E0QA 13GSA 3G9BA 1VRSD 2CVDA 3TKRA 2FD3A 5EVOA 2H0HA 4DSQA 5CRWA 1TDIA 1T8EB 1OVNA 4MJEA 5AIXA 4WEYA 3GH9A 4BWSA 3IOSA 11GSA 1EZKA 5DAKA 4AJ8A 3QAWA 3APOA 4YQMA 2ZCTA 1OC3A 2KOKA 2HRNA 2C0GA 1XWCA 1GSDA 3KXOA 1G7EA 1E6BA 1B4PA 1VF4A 4FO5A 6GSVA 3P8WA 2FWEA 2OBKA 3F3RA 2C0FA 7GSSA 3P2AA 5KN3A 1X9MB 3LEFA 1AAZA 2FHEA 1B9YC 1SL2B 3DEXA 3GKXA 4ECIA 1TK5B 1GUHA 2X99A 2LQOA 2YWOA 4N30A 3ISOA 10GSA 1PL1A 2CAIA 5J5NA 4GSNA 1V2AA 3LQ7A 1YDKA 2EIOA 1GSEA 4MDCA 1GSYA 3TB2A 3FR6A 3H8QA 1Y6EA 4MCUA 1DUGA 2L4QA 2V6OA 2O87A 4WR5A 1GUKA 4V1Ag 1M2BA 2O89A 2VUPA 3U5RE 2MMAA 2M80A 4TR4A 3IC8A 2HSMB 5CYYA 4TW5A 3QFBC 3DD3A 4KDXA 4G0KA 5F05A 1EV9A 1XWGA 2YN1A 1GSFA 1JZWA 3UIWA 2IL3A 2CZ3A 2WJUA 2CZ2A 5BMUA 2L57A 2L4CA 3FHKA 4KDYA 1X9SB 4TN8A 1JLWA 5ENUA 3TJBA 3WT2A 4NWYA 4KF9A 1SENA 1QGVA 4ZL9A 3VI5A 4L0WA 3RBTA 1EOGA 3TKQA 1U88A 1ZZYA 4K0GA 4F9ZA 2MZCA 1K0AA 2WULA 3LFLA 4MZBA 3DKSA 4G2EA 2AYTA 2X64A 1VGLA 3BD2A 4O32A 3CMIA 3QDNA 3BJ5A 3UEMA 3W6GA 6GSSA 3F4TA 4Q5RA 2I4AA 1PX7A 3F0IA 3EC3A 5ECNB 2X8GA 1K3LA 3UL3A 4N0VA 4HZ4A 1BYEA 4G0LA 5JWRB 2LUSA 4O5RA 5ELGA 1NSWA 2VD1A 4BVXB 3KCMA 1XBSA 3HVXA 4GXZA 4G10A 3NOFA 1KEBA 1I9DA 2DJJA 3TKPA 5KN2A 3ED3A 2HZEA 3BCKA 5INYA 4X0XA 4ECCA 2C0EA 4FYUA 4QL9A 5E59A 4OWYA 2GZZA 3DGQA 3WGDA 3FZ9A 2CA8A 1BAYA 4QQ7A 2MBSA 1IYIA 2KLXA 3C71A 2WB9A 3WD6A 4GLTA 4WETA 4IGJA 2L59A 4TR1A 1JFUA 3ME8A 2P5QA 1EGOA 3F3QA 2DJKA 2L6DA 4ISDA 2VCVA 1XW9A 1O73A 2V41A 3QAGA 1B8XA 3IHQA 1ZOFA 5IOXA 2OBIA 4PTSA 1T7PB 2PVQA 4MMMA 4J2FA 1UC7A 1USBA 2DSAA 2LRCA 4KCEA 4ECBA 1MEKA 4YH2A 4PQ1A 1Z7RA 2N5FA 2VAFA 3TOTA 2DMMA 5F07A 4K8MA 3KTLA 4TR3A 1TK8B 2OACA 2GT5A 2FA8A 2I81A 1AC1A 1TK0B 1ABAA 1OC9A 4ZBDA 1M2AA 1QK8A 2JADA 2RM6A 3ZVJA 2GSTA 5IPGA 1G0TA 3A2XA 3IXRA 3ZFBA 4K2DA 1A2LA 6GSWA 5IMAA 4L0UA 4XRAA 3LWAA 1YJ6A 4NHWA 4BPYA 2FCHA 5H5SA 1UA5A 1JLVA 2A2SA 1HQOA 1XWBA 4HU7A 1ZYQB 4XTSA 4K7IA 3E3EA 3FYGA 1YY7A 2VIMA 2VM1A 2OE3A 1K0NA 3ZTLA 3VWXA 4BVYB 12GSA 3HJPA 3F4RA 5CP1A 5ECIB 1QUWA 4ZIJA 5ID2B 2B6MA 1GSSA 3FR9A 2LJRA 2PGTA 3VPTA 2C0DA 3UVHA 3A5WA 1JZOA 2GT6A 1MDKA 3ZLPA 5COHA 2MBTA 2RUFA 4E8HA 4ZILA 3HZ4A 4JR6A 2C80A 4HEA2 1J0FA 4JU5A 3HJMA 3ZIVA 3WGXA 1SYRA 1JZDA 2YWMA 4GTUA 4KSOA 1EOHA 1HNAA 3GTUB 3GKKA 3UBKA 2VCTA 3G7JA 3HA9A 1GULA 1OE8A 5B8AA 1FHEA 2K8SA 1N2AA 4ZB8A 2H75A 3VPQA 4N10A 1B4QA 5DALA 4IJIA 2GSRA 3L9VA 3FRCA 1XW6A 1GNEA 1T00A 1XOBA 3L0HA 3O6TA 2DIYA 5JCGA 2CV4A 4TVEA 5JWOB 2HNLA 1PQNA 3VURA 4ID0A 3KM6A 5EL8A 1PRXA 1ACVA 2LTKA 4WR4A 1ILOA 2CVBA 3J7Yb 4NV2A 1Z7PA 1R26A 3E0UA 1BG5A 5EY6A 3GMFA 2LJAA 3K8NA 2VL9A 1S3CA 4LMVA 1O81A 2QKEA 5FT3A 2NVLA 3D4TA 5L71A 4GWRA 4AJ6A 2E7PA 4MJAA 1ZCPA 5ECSA 6GSUA 1THXA 1PKWA 2LJKA 4EDZA 4E8EA 1O8WA 3M3MA 3P90A 5DCHA 3FW2A 1MD4A 2IMIA 1SKSB 4I6XA 2MYGA 5ECPB 3IAM2 1HNBA 3HJOA 3NZNA 2PWJA 1VF3A 2CT6A 2VCQA 5DDLA 1BEDA 3R2QA 5F0GA 3US3A 4PNGA 4F2IA 4O92A 2C4JA 2OJLA 4FIWA 3GA4A 4JR4A 2C3TA 4TXVA 2VOCA 1GWCA 2IMEA 2YJ7A 3HXSA 3DRNA 1URMA 1G6WA 3GX0A 4I97A 3RHBA 1F2EA 1TU7A 1BX9A 2N5AA 1PN9A 2DMLA 5AISA 4KUNA 5HR0A 3UAPA 3I6AA 2B1KA 2YV7A 3F6DA 2AUVA 2QC7A 5DQSA 3DIEA 4IBPA 4YQUA 4PNFA 3KGKA 1NM3A 1ON4A 2REMA 5G5FA 4JZQA 5ECHB 1ST9A 4HI7A 3F9UA 3GNJA 1KBNA 1QQ2A 2L6CA 2DJ2A 4G19A 3A3TA 3QFAC 2VLUA 5AGYA 1M7TA 2LRTA 1TJDA 5D9WA 1V40A 5HR2A 4OO4A 3GUSA 6GSTA 2GVPA 1JZRA 4WF5A 1K0OA 3PINA 2C8UA 1V58A 1AQWA 5E4WA 4V2NA 3C8EA 2DC5A 4USSA 4EUYA 2X8CA 3IR4A 1Y25A 4MJCA 4CHSA 3DVWA 3IE3A 2QGVA 3M9KA 3DYRA 5J9CA 3TCOA 3UOMA 1G6YA 2AAWA 3MAKA 4BWQA 1LU4A 2N5BA 3HZ8A 2JU5A 1Z3EA 4TXOB 1SK1A 2YWNA 3APSA 2K18A 1LBKA 4F0CA 4MPFA 2XBIA 2ES7A 2XPEA 2GSQA 3ZFLA 3APQA 3GRXA 3P7XA 3D0ZA 3J7Yk 4XS6A 1OKDA 2PPTA 2B1LA 1TRWA 2DJ1A 4XHMA 1DBYA 1YZXA 4MPGA 3PR8A 2BMXA 3LYKA 1TKDB 4JEDA 3KZQA 2VLTA 1M99A 4RUVA 2YCDA 1R7HA 2D2ZA 5A4WA 4K7NA 5CAXA 4ULXA 3L9SA 1WIKA 1ERWA 1PX6A 2FY6A 4WF4A 4MF6A 2GDRA 1MTCA 2O7KA 2CAQA 4ZB9A 3CRUA 2OADA 4ECJA 2E2GA 1XWKA 1GLQA 1MD3A 4D73B 1F37A 5ID2A 2VD0A 2AB6A 2HRKB 4EVMA 1QFNA 20GSA 2R5GA 2XHFA 2H1AA 1SJZA 1TRVA 1DE1A 1GLPA 5IIZA 1R4WA 2VL3A 1F3AA 4NV5A 4HUAA 4K9ZA 1X0RA 5JCUA 1NHOA 2CVKA 3F4SA 1XVWA 3GFKA 3QAVA 2HRFA 5G1KA 1MDJA 3TJJA 4GSTA 4MZWA 3HYPA 1OAZA 2IIYA 5IQYA 1RK4A 2GQKA 2BJXA 2B5EA 4KW6A 2PERA 2B5YA 2WS2A 4KDUA 1Z5YE 2WFCA 1SKWB 2K6VA 4FH8A 1XWAA 4OD7A 4F82A 4XS4A 2FNOA 2V6KA 2WZ9A 5DCGA 1GTIA 4L5OA 4XS1A 2G2QA 3D22A 1A2JA 5D9TA 5IO2A 2HLSA 3F8UA 2O85A 4MP4A 4Z7XA 5J9BA 4JBBA 2I9HA 3GHAA 2IMDA 1ML6A 4Q5QA 4XIHA 2FWHA 2P5RA 1TOFA 3ZMLA 2YANA 3CBUA 1K0DA 4KCAA 1KNGA 4GQFA 2B5XA 1RQMA 4TOPA 2GTUA 2H8LA 1A0RP 1EP7A 1WPIA 2ZNMA 1X5CA 4QL7A 2XPDA 3CXGA 5D8IA 1VF1A 1RW1A 2DLXA 3FZ4A 2HSHA 4RQXA 4HQZA 5HFGA 2CX3A 2EIRA 2C3NA 4EDYA 1DSBA 2H76A 5F8BA 3MNGA 18GSA 1M2DA 1M9AA 4TR0A 3D6IA 3CSIA 1EEJA 3TRXA 2IMKA 4F03A 5J4UA 4K6XA 2R2JA 4LL4B 3F6FA 2TIRA 2NDOA 2AV4A 3HDCA 1ZYEA 3BCIA 4JE1A 1TRSA 5HFIA 3V1WA 3IC4A 2MMNA 4AGSA 1I5GA 4IQAA 2K8VA 3TKSC 2VO4A 1YQ1A 5IMCA 1YEPA 3HD5A 3H93A 3G7IA 2H1DA 4I2TA 3IA1A 3BBYA 2YZUA 3ERWA 3M8NA 3W8JA 1GTUA 3CSHA 5IMDA 2R37A 3HKRA 3A2VA 3GKMA 2F3MA 4YAVA 1H4OA 3IDVA 3ZIJA 1THOA 4Q5FA 1QMVA 4ZBBA 1XPVA 5HR3A 2RIIA 2V1MA 5G2ZA 5ECOB 1N8JA 3VLNA 2JZRA 2IFQB 5IOWA 2HT9A 2PU9C 2YJHA 2OE1A 3GURA 4GSSA 1GSQA 2PN8A 5G1LA 3KP8A 4ZL7A 3GN3A 1T4YA 1U87A 2G0FA 1UN2A 2B3SA 1PSQA 1EWXA 3IK7A 2LNSA 3GSSA 2DIZA 2A4VA 5ECRB 1R5PA 3GV1A 3EU3A 1B48A 5G31A 1DE2A 1SD8A 3EURA 4EKZA 1AIUA 3TJKA 1X9WB 2WCIA 2F8AA 2H0GA 5GSSA 3O3TA 4IJ3A 2H1BA 3ZZXA 5CO3A 1YKCA 3MDKA 2FWFA 3MSZA 3N9JA 5IMVA 4TRXA 2RUEA 2GLRA 3S9FA 3ERGA 3PGTA 1EGRA 4PQIA 5J41A 4FQUA 2QSIA 5IM9A 2EC4A 17GSA 5D9XA 1G7OA 4KB3A 4JRRA 2HZEB 2K9FA 1AUCA 4XRDA 5DBQA 5ECMB 2LKUA 3Q6OA 3HY2A 4MABA 1K0CA 3D4MA 22GSA 3QR6A 4I5QA 3ERFA 2VL2A 3FY7A 4TR1B 3O76A 1OC8A 5DJLA 2DBCA 2HFDA 4YQVA 4PGTA 1A2MA 4EL1A 2HYXA 2GS3A 2HSMA 1SKRB 1GH2A 2VCXA 1XIYA 5A4UA 4BL7B 2KP1A 2L5LA 3DVXA 3TRQA 1F3BA 1J9BA 1BQ7A 4HU9A 1HYUA 6GSXA 4OFTA 3LSZA 2I1UA 2B7KA 2IJYA 4KGIA 4V1Ap 4KAEA 3NIVA 1S3AA 4NPBA 3ZVJD 4AJ7A 4D73A 1O6JA 2Z9SA 2LV3A 2M46A 1XZOA 1YF1A 2H71A 3UBLA 2DJ0A 1TI3A 5B7CA 3SWLA 4DVCA 4EO3A 2HRKA 2L5OA 5LD0A 4N11A 3C1SA 2NTOA 4KE3A 4RI7A 3Q74A 1V98A 1PMTA 1K3YA 1GP1A 2LRNA 1ERTA 2GZPA 1AW9A 3R3EA 5GAND 5D96A 3UMAA 3RHCA 4ZB6A 2H6XA 2LQQA 3LORA 3FK8A 4POKA 5CRHA 1EP8A 1WJKA 3EU4A 1PL2A 2B7JA 1EEMA 2H72A 4GF0A 1O7UA 1NHYA 4LA1A 1S3DA 4X43A 1HD2A 3HVSA 1U3IA 3UARA 5IMZA 1A23A 5FWGA 6GSYA 4MJBA 1C72A 4BVXA 3F63A 3E9JB 4LLRA 3TRPA 4DSSB 1ZL9A 3VWWA 3M0FA 4FYCA 1A24A 1XCCA 4IVFA 5ELAA 2JACA 3CTFA 2F51A 1K3OA 5ECQB 3W8SA 3EMXA 8GSSA 2MMZA 2YWIA 1T1VA 5F06A 2ON5A 3FEUA 2JZSA 1ZMAA 2WDUA 2VCWA 1B9XC 2VLVA 3DXBA 1OYJA 2C3QA 1H75A 2KP2A 5DALB 4CDOA 4J56E 1TU8A 3IK9A 2HRAA 4KNDA 4V2LA 1TP9A 19GSA 1V57A 1FB6A 2R3XA 1YEXA 3EMPA 2HXKA 5D9VA 1BJXA 2X8HA 2PMTA 3JCML 5HFKA 4KH7A 3RDWA 1WOUA 5FHIA 4MF5A 3ME7A 3IPZA 3OR5A 5G5EA 2H74A 2VM2A 2FA4A 4K0NA 3IAS2 1JHBA 3RPNA 1W89A 3KTBA 3EWLA 4I2UA 1J08A 3DMLA 2HE3A 3LGCA 2O8VB 2H1GA 3FZAA 1KTEA 4GRFA 5GAPD 4V2MA 2JSZA 1PA3A
chains in the Genus database with same CATH superfamily
1X5DA 1EV4A 4P3YB 2BTOT 2R0CA 4MZCA 2QA2A 1SJIA 3TGZA 3PH9A 3C1RA 4I8BA 1MDIA 3HVVA 4Z2TA 2OKAA 2GSSA 5ECLB 2R0GA 3KMOA 14GSA 3KIJA 4BVYA 3TJFA 4ICYA 1U6TA 5B6MA 1X5EA 5J3RA 4G0IA 3TOUA 2WGRA 2YOIA 2IFQA 3H4KA 3KH9A 4BIKA 3M1GA 1ZYNA 1U3AA 5D93A 1I1IP 4RI6A 1FO5A 2OA7A 1XOAA 3VFIA 1K0MA 3EINA 1SU9A 3ZL5A 2EIQA 2RLIA 4POBA 3L78A 4IHUA 1FVJA 2PVOC 4N0ZA 3LXTA 3WT1A 3GTUA 3EYTA 2ON7A 2H1LA 3A2WA 1ERVA 5ECKB 5D73A 4HZ2A 1ZGNA 3RAZA 2HQTA 3H1NA 2ALBA 3EVIA 5C04A 1SVMA 5A1NA 3IBHA 5DVBA 1QXHA 3GYKA 4GCIA 4BA7A 2LSTA 3QD9A 3RPPA 3GSTA 5CRGA 1AQXA 4ML6A 4MK3A 5EPFA 4K7OA 5DAKB 3CTGA 4OFNA 2XC2A 4KA0A 3WYWA 4PURA 5KEJA 3DWVA 1AQVA 3VWVA 4Q5NA 2J9HA 4MH2A 5JWQB 5A5KA 2AJQB 3WGEA 4IP6A 2H01A 2TRXA 2HZFA 2KUCA 4PUFC 1OE7A 3I69A 2NPBA 3VI7A 3UVTA 3U6VA 4NAXA 2FUG2 3FKFA 3I9V2 1W4VA 2AHEA 2HSYA 3HHVA 4EF0A 4POLA 5LCZA 2A2PA 5H5QA 1VF2A 3FR3A 3L4NA 2YP6A 1WWJA 3LG6A 2H30A 2HSNB 2YV9A 5B6NA 3ZITA 1XXUA 2LEGA 3MIXA 2IPAA 2FLSA 2GZYA 4HS1A 4BL7A 3QCPA 3LXZA 3ZMKA 1XFLA 2VL2C 1PKZA 3AY8A 3PPUA 2A2RA 3Q19A 4DEJA 2V2GA 4IP1A 5GZZB 3GL3A 1TXXA 1FAAA 1SJ6A 4IELA 1ERUA 1TI1A 1GTAA 1SK2A 2IWTA 3CYNA 1FB0A 1TW9A 1O8XA 3C7MA 3KEBA 3QOUA 4PUAA 16GSA 4POMA 4ACSA 3ZRDA 1XVQA 2JSYA 2MMOA 4LMWA 3KMNA 4QMKA 4IQ1A 3I43A 1PD21 2WW3A 2LS5A 1GL8A 2UZ8A 4OMVA 3G7YA 4EC0A 5ABRA 4L5LA 1XW5A 3FZ5A 3KJYA 4X1UA 3D21A 1WRYA 1SL0B 3TKSE 1CQHA 2H73A 2YPMA 4WBJA 4AF2A 2JZTA 2HI7A 1SD9A 2WW0A 2RM5A 3LYPA 4ZXGA 2TRCP 3M9JA 2YZHA 1O85A 1V9WA 1Q98A 3C73A 2VCZA 4MF7A 1NW2A 2H19A 1FG4A 5A34A 1SL1B 3H79A 5IO0A 3QMXA 5IMFA 1WP0A 3SBCA 1M9BA 2H70A 2WRTA 4GQCA 3TUEA 4DSSA 2NBSA 4H86A 4HQSA 5DQYA 3VK9A 1GNWA 3D5JA 3VWUA 4HJ2A 1A8LA 2LNTA 1GTBA 2H66A 1Z6MA 5CRDA 1TRUA 5CREA 3TJGA 4MLYA 1GUMA 5IPHA 4MH3A 3ZYWA 3KH7A 2PBJA 1T3BA 4IKHA 2OE0A 4XS4B 4L8EA 5G30A 5H5RA 5DJMA 3LW9A 5KN1A 2DJ3A 1A8YA 2FWGA 4ML1A 4MA9A 4YAPA 2FGXA 4RQRA 3IRAA 4OCFA 1AXDA 2WVYA 4J57E 3ZREA 5A4VA 4TXOA 5GSTA 1OKTA 1TTZA 1F9MA 1GSUA 1Z6NA 2CQ9A 2PUKC 4K1FA 4CW9A 5B8BA 2R4VA 4KX4A 5CNWA 2IMFA 1A0FA 4PX1A 4G9HA 3HCZA 1K0BA 4WXTA 1T4ZA 2F9SA 4EXJA 4HDEA 1IYHA 3L9UA 2E2MA 5KN0A 5JCWA 1F6MC 1Z9HA 2KHPA 1YKAA 4NMUA 1SYXA 3GX8A 3QPMA 2IN3A 2I3YA 4ILFA 4OO5A 4F0BA 2ZUPA 1HNCA 3N5OA 3GKNA 4DSRA 2XBQA 4KSMA 2CX4A 4IN0A 2J23A 4O7HA 1LJRA 3TKSA 1GRXA 4HOJA 1UVZA 4ZL8A 3Q18A 1FOVA 5KOXA 2GQMA 1SK0A 4IW9A 4IS0A 1Q4JA 3EE2A 2H6ZA 4O5QA 5AIVA 1E2YA 2P31A 3MWHA 2V32A 4ZBAA 2GQLA 2GGTA 2JL4A 1OC9B 5C00A 2P0GA 4TKYA 4WBRD 3UJ1A 1CQGA 5AN1A 3BOAA 1YF0A 3GH6A 3KP9A 4NXIA 3TDGA 4XCSA 4NHZA 1WE0A 4LL1B 4N3ZA 2WW2A 2O5VA 4PXOA 1PGTA 3GL5A 1M0UA 4EE0A 2H0IA 3CRTA 5HQPA 2M72A 1FW1A 2H6YA 5HR1A 4OFMA 1FVKA 4OCEA 4PQHA 2F8FA 5KOWA 3KD0A 3GIXA 9GSSA 4HJMA 1R5AA 1WMJA 5LNKe 3LJRA 2YNXA 3CSJA 4FYBA 4WKWA 2R6KA 2C1YA 3IV4A 3MYDA 2E0QA 5J4YA 13GSA 3G9BA 1VRSD 2CVDA 3IHGA 3TKRA 2FD3A 4AKGA 5EVOA 2H0HA 4DSQA 5CRWA 2WZSA 1TDIA 1T8EB 1OVNA 4MJEA 5AIXA 4WEYA 3GH9A 4BWSA 3IOSA 11GSA 1EZKA 5DAKA 4AJ8A 3QAWA 3APOA 4YQMA 2ZCTA 1OC3A 2KOKA 2HRNA 2C0GA 1XWCA 1GSDA 3KXOA 1G7EA 1E6BA 1B4PA 1VF4A 4FO5A 6GSVA 3P8WA 2FWEA 2OBKA 1M3JA 3F3RA 2C0FA 7GSSA 3P2AA 5KN3A 1X9MB 4MNNA 3LEFA 1AAZA 4A5PA 2HSNA 2FHEA 1B9YC 1SL2B 3DEXA 3GKXA 4ECIA 1TK5B 1GUHA 2X99A 2R0PA 2LQOA 2YWOA 1XG8A 4N30A 3ISOA 10GSA 1PL1A 2CAIA 5J5NA 4GSNA 1V2AA 3LQ7A 1YDKA 2EIOA 1GSEA 4MDCA 1GSYA 3TB2A 3FR6A 3RFRC 3H8QA 1Y6EA 4MCUA 1DUGA 2L4QA 2V6OA 2O87A 4WR5A 1GUKA 4V1Ag 1M2BA 2O89A 2VUPA 3U5RE 2MMAA 2M80A 4TR4A 3IC8A 2HSMB 5CYYA 4TW5A 3QFBC 3DD3A 4KDXA 4G0KA 5F05A 1EV9A 1XWGA 2YN1A 1GSFA 1JZWA 3UIWA 2IL3A 2CZ3A 2WVXA 4AKIA 2WJUA 2CZ2A 1S4BP 5BMUA 2L57A 2L4CA 4HSCX 3CQFA 3FHKA 4KDYA 1X9SB 4TN8A 1JLWA 5ENUA 3TJBA 3WT2A 4NWYA 4KF9A 4PI2C 1SENA 1QGVA 4ZL9A 3VI5A 4L0WA 3RBTA 1EOGA 3TKQA 1U88A 1ZZYA 4K0GA 4F9ZA 2MZCA 1K0AA 2WULA 3LFLA 4MZBA 3DKSA 4G2EA 2AYTA 2X64A 1VGLA 3BD2A 4O32A 3CMIA 3QDNA 3BJ5A 3UEMA 3W6GA 6GSSA 3F4TA 4Q5RA 2I4AA 1PX7A 3F0IA 3EC3A 5ECNB 2X8GA 1K3LA 3UL3A 4N0VA 4HZ4A 2WW1A 1BYEA 4G0LA 5JWRB 2LUSA 4O5RA 5ELGA 1NSWA 2VD1A 4BVXB 3KCMA 1XBSA 3HVXA 4GXZA 4G10A 3NOFA 1KEBA 1I9DA 2DJJA 3TKPA 5KN2A 3ED3A 2HZEA 3BCKA 5INYA 4X0XA 4ECCA 2C0EA 4FYUA 1BG1A 4QL9A 5E59A 4OWYA 2GZZA 3DGQA 3WGDA 3FZ9A 2CA8A 1BAYA 4QQ7A 2MBSA 1IYIA 2KLXA 3C71A 2WB9A 3WD6A 4GLTA 4WETA 4IGJA 2L59A 4TR1A 1JFUA 3ME8A 2P5QA 1EGOA 3F3QA 2DJKA 2L6DA 4ISDA 2VCVA 1XW9A 1O73A 2V41A 3QAGA 1B8XA 3IHQA 1ZOFA 5IOXA 2OBIA 4Z2RA 4PTSA 3RGBC 1T7PB 2PVQA 4MMMA 4J2FA 1UC7A 1USBA 1M3IA 2DSAA 2LRCA 4KCEA 4ECBA 1MEKA 4YH2A 4PQ1A 1Z7RA 2N5FA 2VAFA 4O5UA 3TOTA 2DMMA 5F07A 4K8MA 3KTLA 4TR3A 1TK8B 2OACA 4EIPA 2GT5A 2FA8A 2I81A 1AC1A 1TK0B 1ABAA 2X4AA 1OC9A 4ZBDA 1M2AA 1QK8A 2JADA 2RM6A 3ZVJA 2GSTA 5IPGA 1G0TA 3A2XA 3IXRA 3ZFBA 4K2DA 1A2LA 6GSWA 5IMAA 4L0UA 4XRAA 3LWAA 1YJ6A 4NHWA 4BPYA 2FCHA 5H5SA 1UA5A 1JLVA 2A2SA 1HQOA 4K5RA 1XWBA 4HU7A 1ZYQB 4XTSA 4K7IA 3E3EA 3FYGA 1YY7A 2VIMA 2VM1A 2OE3A 1K0NA 3ZTLA 3VWXA 4BVYB 12GSA 3HJPA 3F4RA 5CP1A 5ECIB 1QUWA 4ZIJA 5ID2B 2B6MA 1GSSA 3FR9A 2LJRA 2PGTA 3VPTA 2C0DA 3UVHA 3A5WA 1JZOA 2GT6A 1MDKA 4PHZC 3ZLPA 2EFHA 5COHA 2EFDA 2MBTA 2RUFA 4E8HA 4ZILA 3HZ4A 4JR6A 2C80A 4HEA2 1J0FA 4JU5A 3HJMA 5A5HA 3ZIVA 3WGXA 1SYRA 1JZDA 2YWMA 4GTUA 4KSOA 1EOHA 1HNAA 3GTUB 3GKKA 3UBKA 2VCTA 3G7JA 3HA9A 1GULA 1OE8A 5B8AA 1FHEA 2K8SA 1N2AA 4ZB8A 2H75A 3VPQA 4N10A 1B4QA 5A1NB 5DALA 4IJIA 2GSRA 3L9VA 3HVNA 3FRCA 1XW6A 1GNEA 1T00A 1XOBA 3L0HA 3O6TA 2DIYA 5JCGA 2CV4A 4TVEA 5JWOB 2HNLA 1PQNA 3VURA 4ID0A 3KM6A 5EL8A 1PRXA 1ACVA 2LTKA 4WR4A 5BRTA 1ILOA 2CVBA 3J7Yb 4NV2A 4AKHA 1Z7PA 1R26A 3E0UA 1BG5A 5EY6A 3GMFA 2WVZA 2LJAA 3K8NA 2VL9A 4YKGA 1S3CA 4W66A 4LMVA 1O81A 2QKEA 5FT3A 2NVLA 3D4TA 5L71A 4GWRA 4AJ6A 2E7PA 4MJAA 1ZCPA 5ECSA 6GSUA 1THXA 4PI0C 1PKWA 2DKHA 2LJKA 4EDZA 4E8EA 4X4JA 1O8WA 3M3MA 3P90A 5DCHA 3FW2A 1MD4A 2IMIA 1SKSB 1PFOA 4I6XA 2MYGA 4CY8A 5ECPB 3IAM2 1HNBA 3HJOA 3NZNA 2PWJA 1VF3A 2CT6A 2VCQA 5DDLA 1BEDA 3R2QA 5F0GA 2X49A 4AKXB 3US3A 4PNGA 4F2IA 4O92A 2C4JA 2OJLA 4FIWA 3GA4A 4JR4A 3CWGA 2C3TA 4TXVA 2VOCA 1GWCA 2IMEA 2YJ7A 3HXSA 3DRNA 1URMA 1G6WA 3GX0A 4I97A 3RHBA 1F2EA 1TU7A 1BX9A 2N5AA 1PN9A 2DMLA 5AISA 4KUNA 5HR0A 3UAPA 3I6AA 2B1KA 2YV7A 3F6DA 2AUVA 2QC7A 5DQSA 3DIEA 4IBPA 4YQUA 5J47A 4PNFA 3KGKA 1NM3A 1ON4A 2REMA 5G5FA 4JZQA 5ECHB 1ST9A 4HI7A 3F9UA 3GNJA 1KBNA 1QQ2A 2L6CA 2DJ2A 4G19A 3A3TA 3QFAC 2VLUA 5AGYA 1M7TA 2LRTA 1TJDA 5D9WA 1V40A 5HR2A 4OO4A 3GUSA 6GSTA 2GVPA 1JZRA 4WF5A 1K0OA 3PINA 2C8UA 1V58A 1AQWA 5E4WA 3CHXC 4V2NA 3C8EA 2DC5A 4USSA 4EUYA 2X8CA 3IR4A 1Y25A 4MJCA 4CHSA 3DVWA 3IE3A 2QGVA 3M9KA 3DYRA 5J9CA 3TCOA 3UOMA 1G6YA 2AAWA 3MAKA 4BWQA 1LU4A 2N5BA 3HZ8A 2JU5A 1Z3EA 4TXOB 1SK1A 2YWNA 3APSA 2K18A 1LBKA 4F0CA 4MPFA 2XBIA 2ES7A 2XPEA 2GSQA 3ZFLA 3FMWA 3APQA 3GRXA 3P7XA 3D0ZA 3J7Yk 4XS6A 1OKDA 2PPTA 2B1LA 1TRWA 2DJ1A 4XHMA 1DBYA 1YZXA 4MPGA 3PR8A 2BMXA 3LYKA 1TKDB 4JEDA 3KZQA 2VLTA 1M99A 4RUVA 2YCDA 1R7HA 2D2ZA 5A4WA 5J40A 4K7NA 5CAXA 4ULXA 3L9SA 1WIKA 1ERWA 5J4VA 1PX6A 1YVLA 2FY6A 4WF4A 4MF6A 2GDRA 1MTCA 2O7KA 2CAQA 4ZB9A 1FOHA 3CRUA 2OADA 2EFEA 4ECJA 2E2GA 1XWKA 1GLQA 1MD3A 4D73B 1F37A 5ID2A 2VD0A 2AB6A 2HRKB 4EVMA 1QFNA 20GSA 2R5GA 2XHFA 2H1AA 1SJZA 1TRVA 1DE1A 1GLPA 5IIZA 1R4WA 2VL3A 1F3AA 4NV5A 1SVOA 4HUAA 4K9ZA 3TU3B 1X0RA 5JCUA 1NHOA 2CVKA 3F4SA 1XVWA 3GFKA 3QAVA 2HRFA 5G1KA 1MDJA 3TJJA 4GSTA 4MZWA 3HYPA 1OAZA 2IIYA 5IQYA 1RK4A 2GQKA 2BJXA 2B5EA 4KW6A 2PERA 2B5YA 2WS2A 4KDUA 1Z5YE 2WFCA 1SKWB 2K6VA 4FH8A 1XWAA 4OD7A 4F82A 4XS4A 2FNOA 2V6KA 2WZ9A 5DCGA 1GTIA 4L5OA 4XS1A 2G2QA 3D22A 1A2JA 5D9TA 5IO2A 2HLSA 3F8UA 2O85A 4MP4A 4Z7XA 2OT3A 5J9BA 3A5IA 4JBBA 2I9HA 3GHAA 2IMDA 1ML6A 4Q5QA 4XIHA 2FWHA 2P5RA 1TOFA 3ZMLA 2YANA 3CBUA 1K0DA 4KCAA 1KNGA 4GQFA 2B5XA 1RQMA 4TOPA 2GTUA 2H8LA 1A0RP 1EP7A 1WPIA 2ZNMA 1X5CA 4QL7A 2XPDA 3CXGA 5D8IA 1VF1A 1RW1A 2VKZG 2DLXA 3FZ4A 2HSHA 4RQXA 4HQZA 5HFGA 2CX3A 2EIRA 2C3NA 4EDYA 1DSBA 2H76A 5F8BA 3MNGA 18GSA 1M2DA 1M9AA 4TR0A 3D6IA 3CSIA 1EEJA 3TRXA 2IMKA 4F03A 5J4UA 4K6XA 2R2JA 4LL4B 3F6FA 2TIRA 2NDOA 2AV4A 3HDCA 1ZYEA 3BCIA 4JE1A 1TRSA 5HFIA 3V1WA 3IC4A 2MMNA 4AGSA 1I5GA 4IQAA 2K8VA 3TKSC 4K2XA 2VO4A 1YQ1A 5IMCA 1YEPA 3HD5A 3H93A 3G7IA 2H1DA 4I2TA 3IA1A 4FXYP 3BBYA 2YZUA 3ERWA 2O3EA 3M8NA 3W8JA 2WVXB 1GTUA 3CSHA 5IMDA 2R37A 3HKRA 3A2VA 3GKMA 5BMUB 2F3MA 4YAVA 1H4OA 3IDVA 3ZIJA 1THOA 4Q5FA 1QMVA 4ZBBA 1XPVA 5HR3A 2RIIA 2V1MA 5G2ZA 5ECOB 1N8JA 3VLNA 2JZRA 2IFQB 5IOWA 2HT9A 2PU9C 2YJHA 3HMJG 2OE1A 3GURA 4GSSA 1GSQA 2PN8A 5G1LA 3KP8A 4ZL7A 3GN3A 1T4YA 1U87A 2G0FA 1UN2A 2B3SA 1PSQA 1EWXA 3IK7A 2LNSA 3GSSA 2DIZA 2A4VA 5ECRB 2A4HA 1R5PA 3GV1A 4K5SA 3EU3A 1B48A 5G31A 1DE2A 1SD8A 3EURA 4EKZA 1AIUA 3TJKA 1X9WB 2WCIA 2F8AA 2H0GA 5GSSA 3O3TA 4IJ3A 2H1BA 3ZZXA 5CO3A 1YKCA 3MDKA 2FWFA 3MSZA 3N9JA 5IMVA 4TRXA 2RUEA 2GLRA 3S9FA 3ERGA 3PGTA 1EGRA 4PQIA 5J41A 4FQUA 2QSIA 5IM9A 2EC4A 17GSA 5D9XA 1S3RA 1G7OA 4KB3A 4JRRA 2HZEB 2K9FA 1AUCA 4XRDA 5DBQA 1TXUA 5ECMB 2LKUA 2O36A 3Q6OA 2EFCA 3HY2A 4MABA 1K0CA 3D4MA 22GSA 2UV8G 3QR6A 4I5QA 4GDFA 3ERFA 2VL2A 3FY7A 4TR1B 3O76A 1OC8A 5DJLA 2DBCA 2DKIA 2HFDA 4YQVA 4PGTA 1A2MA 1ZYPA 4EL1A 2HYXA 2GS3A 2HSMA 1SKRB 1GH2A 2VCXA 1XIYA 5A4UA 4BL7B 2KP1A 2L5LA 3DVXA 2QA1A 3TRQA 1F3BA 1J9BA 1BQ7A 4HU9A 1HYUA 6GSXA 4OFTA 3LSZA 2I1UA 2B7KA 2IJYA 4KGIA 4V1Ap 4KAEA 3NIVA 1S3AA 4NPBA 3ZVJD 1N25A 4AJ7A 4D73A 1O6JA 2Z9SA 2LV3A 2M46A 1XZOA 1YF1A 2H71A 3UBLA 2DJ0A 1TI3A 5B7CA 1Y1UA 3SWLA 4DVCA 4EO3A 2HRKA 2L5OA 5LD0A 4N11A 3C1SA 2NTOA 4KE3A 4RI7A 3Q74A 1V98A 1PMTA 1K3YA 1GP1A 2LRNA 1ERTA 2GZPA 1AW9A 3R3EA 5GAND 5D96A 3UMAA 3RHCA 4ZB6A 2H6XA 2LQQA 3LORA 3FK8A 4POKA 5CRHA 1EP8A 1WJKA 3EU4A 1PL2A 2B7JA 1EEMA 2H72A 4GF0A 1O7UA 1BF5A 1NHYA 4LA1A 1S3DA 5A34B 4X43A 1HD2A 3HVSA 1U3IA 3UARA 5IMZA 1A23A 5FWGA 6GSYA 4MJBA 1C72A 4BVXA 3F63A 3E9JB 4LLRA 3TRPA 4DSSB 1ZL9A 3VWWA 3M0FA 4FYCA 4EIQA 1A24A 1XCCA 4IVFA 5ELAA 2JACA 3CTFA 4G01A 5A5HB 2F51A 1K3OA 5ECQB 3W8SA 3EMXA 8GSSA 2MMZA 2YWIA 1T1VA 5F06A 2ON5A 3FEUA 2JZSA 1ZMAA 2WDUA 2VCWA 1B9XC 2VLVA 1PN0A 3DXBA 1OYJA 2C3QA 1H75A 2KP2A 1YEWC 5DALB 4CDOA 4J56E 1TU8A 3IK9A 4AI6A 2HRAA 4KNDA 4V2LA 4ZB7A 1TP9A 19GSA 1V57A 1FB6A 2R3XA 1YEXA 3EMPA 2HXKA 5D9VA 1BJXA 2X8HA 2PMTA 4Z2UA 3JCML 3EPTA 5HFKA 4KH7A 3RDWA 1WOUA 1SVLA 5FHIA 4MF5A 3ME7A 3IPZA 3OR5A 5G5EA 2H74A 2VM2A 2FA4A 4E68A 4K0NA 3IAS2 1JHBA 3RPNA 1W89A 3KTBA 3EWLA 4I2UA 4CY6A 1J08A 3DMLA 2HE3A 3LGCA 2O8VB 2H1GA 3FZAA 1KTEA 4GRFA 4YKFA 5GAPD 4V2MA 2JSZA 1PA3A
chains in the Genus database with same CATH topology
1X5DA 1EV4A 4P3YB 2BTOT 2R0CA 4MZCA 2QA2A 1SJIA 3TGZA 3PH9A 3C1RA 4I8BA 1MDIA 3HVVA 4Z2TA 2OKAA 2GSSA 5ECLB 2R0GA 3KMOA 14GSA 3KIJA 4BVYA 3TJFA 4ICYA 1U6TA 5B6MA 1X5EA 5J3RA 4G0IA 3TOUA 2WGRA 2YOIA 2IFQA 3H4KA 3KH9A 3M1GA 1ZYNA 1U3AA 5D93A 4RI6A 1FO5A 2OA7A 1XOAA 3VFIA 1K0MA 3EINA 1SU9A 3ZL5A 2EIQA 2RLIA 4POBA 3L78A 4IHUA 1FVJA 2PVOC 4N0ZA 3LXTA 3WT1A 3GTUA 3EYTA 2ON7A 2H1LA 3A2WA 1ERVA 5ECKB 5D73A 4HZ2A 1ZGNA 3RAZA 2HQTA 3H1NA 2ALBA 3EVIA 5C04A 1SVMA 5A1NA 3IBHA 5DVBA 1QXHA 3GYKA 4GCIA 4BA7A 2LSTA 3QD9A 3RPPA 3GSTA 5CRGA 1AQXA 4ML6A 4MK3A 5EPFA 4K7OA 5DAKB 3CTGA 4OFNA 2XC2A 4KA0A 3WYWA 4PURA 5KEJA 3DWVA 1AQVA 3VWVA 4Q5NA 2J9HA 4MH2A 5JWQB 5A5KA 2AJQB 3WGEA 4IP6A 2H01A 2TRXA 2HZFA 2KUCA 4PUFC 1OE7A 3I69A 2NPBA 3VI7A 3UVTA 3U6VA 4NAXA 2FUG2 3FKFA 3I9V2 1W4VA 2AHEA 2HSYA 3HHVA 4EF0A 4POLA 5LCZA 2A2PA 5H5QA 1VF2A 3FR3A 3L4NA 2YP6A 1WWJA 3LG6A 2H30A 2HSNB 2YV9A 5B6NA 3ZITA 1XXUA 2LEGA 3MIXA 2IPAA 2FLSA 2GZYA 4HS1A 4BL7A 3QCPA 3LXZA 3ZMKA 1XFLA 2VL2C 1PKZA 3AY8A 3PPUA 2A2RA 3Q19A 4DEJA 2V2GA 4IP1A 5GZZB 3GL3A 1TXXA 1FAAA 1SJ6A 4IELA 1ERUA 1TI1A 1GTAA 1SK2A 2IWTA 3CYNA 1FB0A 1TW9A 1O8XA 3C7MA 3KEBA 3QOUA 4PUAA 16GSA 4POMA 4ACSA 3ZRDA 1XVQA 2JSYA 2MMOA 4LMWA 3KMNA 4QMKA 4IQ1A 3I43A 1PD21 2LS5A 1GL8A 2UZ8A 4OMVA 3G7YA 4EC0A 5ABRA 4L5LA 1XW5A 3FZ5A 3KJYA 4X1UA 3D21A 1WRYA 1SL0B 3TKSE 1CQHA 2H73A 2YPMA 4WBJA 4AF2A 2JZTA 2HI7A 1SD9A 2RM5A 3LYPA 4ZXGA 2TRCP 3M9JA 2YZHA 1O85A 1V9WA 1Q98A 3C73A 2VCZA 4MF7A 1NW2A 2H19A 1FG4A 5A34A 1SL1B 3H79A 5IO0A 3QMXA 5IMFA 1WP0A 3SBCA 1M9BA 2H70A 2WRTA 4GQCA 3TUEA 4DSSA 2NBSA 4H86A 4HQSA 5DQYA 3VK9A 1GNWA 3D5JA 3VWUA 4HJ2A 1A8LA 2LNTA 1GTBA 2H66A 1Z6MA 5CRDA 1TRUA 5CREA 3TJGA 4MLYA 1GUMA 5IPHA 4MH3A 3ZYWA 3KH7A 2PBJA 1T3BA 4IKHA 2OE0A 4XS4B 4L8EA 5G30A 5H5RA 5DJMA 3LW9A 5KN1A 2DJ3A 1A8YA 2FWGA 4ML1A 4MA9A 4YAPA 2FGXA 4RQRA 3IRAA 4OCFA 1AXDA 4J57E 3ZREA 5A4VA 4TXOA 5GSTA 1OKTA 1TTZA 1F9MA 1GSUA 1Z6NA 2CQ9A 2PUKC 4K1FA 4CW9A 5B8BA 2R4VA 4KX4A 5CNWA 2IMFA 1A0FA 4PX1A 4G9HA 3HCZA 1K0BA 4WXTA 1T4ZA 2F9SA 4EXJA 4HDEA 1IYHA 3L9UA 2E2MA 5KN0A 5JCWA 1F6MC 1Z9HA 2KHPA 1YKAA 4NMUA 1SYXA 3GX8A 3QPMA 2IN3A 2I3YA 4ILFA 4OO5A 4F0BA 2ZUPA 1HNCA 3N5OA 3GKNA 4DSRA 2XBQA 4KSMA 2CX4A 4IN0A 2J23A 4O7HA 1LJRA 3TKSA 1GRXA 4HOJA 1UVZA 4ZL8A 3Q18A 1FOVA 5KOXA 2GQMA 1SK0A 4IW9A 4IS0A 1Q4JA 3EE2A 2H6ZA 4O5QA 5AIVA 1E2YA 2P31A 3MWHA 2V32A 4ZBAA 2GQLA 2GGTA 2JL4A 1OC9B 5C00A 2P0GA 4TKYA 4WBRD 3UJ1A 1CQGA 5AN1A 3BOAA 1YF0A 3GH6A 3KP9A 4NXIA 3TDGA 4XCSA 4NHZA 1WE0A 4LL1B 4N3ZA 2O5VA 4PXOA 1PGTA 3GL5A 1M0UA 4EE0A 2H0IA 3CRTA 5HQPA 2M72A 1FW1A 2H6YA 5HR1A 4OFMA 1FVKA 4OCEA 4PQHA 2F8FA 5KOWA 3KD0A 3GIXA 9GSSA 4HJMA 1R5AA 1WMJA 5LNKe 3LJRA 2YNXA 3CSJA 4FYBA 4WKWA 2R6KA 2C1YA 3IV4A 3MYDA 2E0QA 5J4YA 13GSA 3G9BA 1VRSD 2CVDA 3IHGA 3TKRA 2FD3A 4AKGA 5EVOA 2H0HA 4DSQA 5CRWA 1TDIA 1T8EB 1OVNA 4MJEA 5AIXA 4WEYA 3GH9A 4BWSA 3IOSA 11GSA 1EZKA 5DAKA 4AJ8A 3QAWA 3APOA 4YQMA 2ZCTA 1OC3A 2KOKA 2HRNA 2C0GA 1XWCA 1GSDA 3KXOA 1G7EA 1E6BA 1B4PA 1VF4A 4FO5A 6GSVA 3P8WA 2FWEA 2OBKA 3F3RA 2C0FA 7GSSA 3P2AA 5KN3A 1X9MB 4MNNA 3LEFA 1AAZA 4A5PA 2HSNA 2FHEA 1B9YC 1SL2B 3DEXA 3GKXA 4ECIA 1TK5B 1GUHA 2X99A 2R0PA 2LQOA 2YWOA 4N30A 3ISOA 10GSA 1PL1A 2CAIA 5J5NA 4GSNA 1V2AA 3LQ7A 1YDKA 2EIOA 1GSEA 4MDCA 1GSYA 3TB2A 3FR6A 3H8QA 1Y6EA 4MCUA 1DUGA 2L4QA 2V6OA 2O87A 4WR5A 1GUKA 4V1Ag 1M2BA 2O89A 2VUPA 3U5RE 2MMAA 2M80A 4TR4A 3IC8A 2HSMB 5CYYA 4TW5A 3QFBC 3DD3A 4KDXA 4G0KA 5F05A 1EV9A 1XWGA 2YN1A 1GSFA 1JZWA 3UIWA 2IL3A 2CZ3A 4AKIA 2WJUA 2CZ2A 5BMUA 2L57A 2L4CA 3FHKA 4KDYA 1X9SB 4TN8A 1JLWA 5ENUA 3TJBA 3WT2A 4NWYA 4KF9A 1SENA 1QGVA 4ZL9A 3VI5A 4L0WA 3RBTA 1EOGA 3TKQA 1U88A 1ZZYA 4K0GA 4F9ZA 2MZCA 1K0AA 2WULA 3LFLA 4MZBA 3DKSA 4G2EA 2AYTA 2X64A 1VGLA 3BD2A 4O32A 3CMIA 3QDNA 3BJ5A 3UEMA 3W6GA 6GSSA 3F4TA 4Q5RA 2I4AA 1PX7A 3F0IA 3EC3A 5ECNB 2X8GA 1K3LA 3UL3A 4N0VA 4HZ4A 1BYEA 4G0LA 5JWRB 2LUSA 4O5RA 5ELGA 1NSWA 2VD1A 4BVXB 3KCMA 1XBSA 3HVXA 4GXZA 4G10A 3NOFA 1KEBA 1I9DA 2DJJA 3TKPA 5KN2A 3ED3A 2HZEA 3BCKA 5INYA 4X0XA 4ECCA 2C0EA 4FYUA 1BG1A 4QL9A 5E59A 4OWYA 2GZZA 3DGQA 3WGDA 3FZ9A 2CA8A 1BAYA 4QQ7A 2MBSA 1IYIA 2KLXA 3C71A 2WB9A 3WD6A 4GLTA 4WETA 4IGJA 2L59A 4TR1A 1JFUA 3ME8A 2P5QA 1EGOA 3F3QA 2DJKA 2L6DA 4ISDA 2VCVA 1XW9A 1O73A 2V41A 3QAGA 1B8XA 3IHQA 1ZOFA 5IOXA 2OBIA 4Z2RA 4PTSA 1T7PB 2PVQA 4MMMA 4J2FA 1UC7A 1USBA 2DSAA 2LRCA 4KCEA 4ECBA 1MEKA 4YH2A 4PQ1A 1Z7RA 2N5FA 2VAFA 4O5UA 3TOTA 2DMMA 5F07A 4K8MA 3KTLA 4TR3A 1TK8B 2OACA 4EIPA 2GT5A 2FA8A 2I81A 1AC1A 1TK0B 1ABAA 2X4AA 1OC9A 4ZBDA 1M2AA 1QK8A 2JADA 2RM6A 3ZVJA 2GSTA 5IPGA 1G0TA 3A2XA 3IXRA 3ZFBA 4K2DA 1A2LA 6GSWA 5IMAA 4L0UA 4XRAA 3LWAA 1YJ6A 4NHWA 4BPYA 2FCHA 5H5SA 1UA5A 1JLVA 2A2SA 1HQOA 4K5RA 1XWBA 4HU7A 1ZYQB 4XTSA 4K7IA 3E3EA 3FYGA 1YY7A 2VIMA 2VM1A 2OE3A 1K0NA 3ZTLA 3VWXA 4BVYB 12GSA 3HJPA 3F4RA 5CP1A 5ECIB 1QUWA 4ZIJA 5ID2B 2B6MA 1GSSA 3FR9A 2LJRA 2PGTA 3VPTA 2C0DA 3UVHA 3A5WA 1JZOA 2GT6A 1MDKA 3ZLPA 2EFHA 5COHA 2EFDA 2MBTA 2RUFA 4E8HA 4ZILA 3HZ4A 4JR6A 2C80A 4HEA2 1J0FA 4JU5A 3HJMA 5A5HA 3ZIVA 3WGXA 1SYRA 1JZDA 2YWMA 4GTUA 4KSOA 1EOHA 1HNAA 3GTUB 3GKKA 3UBKA 2VCTA 3G7JA 3HA9A 1GULA 1OE8A 5B8AA 1FHEA 2K8SA 1N2AA 4ZB8A 2H75A 3VPQA 4N10A 1B4QA 5A1NB 5DALA 4IJIA 2GSRA 3L9VA 3FRCA 1XW6A 1GNEA 1T00A 1XOBA 3L0HA 3O6TA 2DIYA 5JCGA 2CV4A 4TVEA 5JWOB 2HNLA 1PQNA 3VURA 4ID0A 3KM6A 5EL8A 1PRXA 1ACVA 2LTKA 4WR4A 5BRTA 1ILOA 2CVBA 3J7Yb 4NV2A 4AKHA 1Z7PA 1R26A 3E0UA 1BG5A 5EY6A 3GMFA 2LJAA 3K8NA 2VL9A 4YKGA 1S3CA 4W66A 4LMVA 1O81A 2QKEA 5FT3A 2NVLA 3D4TA 5L71A 4GWRA 4AJ6A 2E7PA 4MJAA 1ZCPA 5ECSA 6GSUA 1THXA 1PKWA 2DKHA 2LJKA 4EDZA 4E8EA 4X4JA 1O8WA 3M3MA 3P90A 5DCHA 3FW2A 1MD4A 2IMIA 1SKSB 4I6XA 2MYGA 4CY8A 5ECPB 3IAM2 1HNBA 3HJOA 3NZNA 2PWJA 1VF3A 2CT6A 2VCQA 5DDLA 1BEDA 3R2QA 5F0GA 2X49A 4AKXB 3US3A 4PNGA 4F2IA 4O92A 2C4JA 2OJLA 4FIWA 3GA4A 4JR4A 3CWGA 2C3TA 4TXVA 2VOCA 1GWCA 2IMEA 2YJ7A 3HXSA 3DRNA 1URMA 1G6WA 3GX0A 4I97A 3RHBA 1F2EA 1TU7A 1BX9A 2N5AA 1PN9A 2DMLA 5AISA 4KUNA 5HR0A 3UAPA 3I6AA 2B1KA 2YV7A 3F6DA 2AUVA 2QC7A 5DQSA 3DIEA 4IBPA 4YQUA 5J47A 4PNFA 3KGKA 1NM3A 1ON4A 2REMA 5G5FA 4JZQA 5ECHB 1ST9A 4HI7A 3F9UA 3GNJA 1KBNA 1QQ2A 2L6CA 2DJ2A 4G19A 3A3TA 3QFAC 2VLUA 5AGYA 1M7TA 2LRTA 1TJDA 5D9WA 1V40A 5HR2A 4OO4A 3GUSA 6GSTA 2GVPA 1JZRA 4WF5A 1K0OA 3PINA 2C8UA 1V58A 1AQWA 5E4WA 4V2NA 3C8EA 2DC5A 4USSA 4EUYA 2X8CA 3IR4A 1Y25A 4MJCA 4CHSA 3DVWA 3IE3A 2QGVA 3M9KA 3DYRA 5J9CA 3TCOA 3UOMA 1G6YA 2AAWA 3MAKA 4BWQA 1LU4A 2N5BA 3HZ8A 2JU5A 1Z3EA 4TXOB 1SK1A 2YWNA 3APSA 2K18A 1LBKA 4F0CA 4MPFA 2XBIA 2ES7A 2XPEA 2GSQA 3ZFLA 3FMWA 3APQA 3GRXA 3P7XA 3D0ZA 3J7Yk 4XS6A 1OKDA 2PPTA 2B1LA 1TRWA 2DJ1A 4XHMA 1DBYA 1YZXA 4MPGA 3PR8A 2BMXA 3LYKA 1TKDB 4JEDA 3KZQA 2VLTA 1M99A 4RUVA 2YCDA 1R7HA 2D2ZA 5A4WA 5J40A 4K7NA 5CAXA 4ULXA 3L9SA 1WIKA 1ERWA 5J4VA 1PX6A 1YVLA 2FY6A 4WF4A 4MF6A 2GDRA 1MTCA 2O7KA 2CAQA 4ZB9A 1FOHA 3CRUA 2OADA 2EFEA 4ECJA 2E2GA 1XWKA 1GLQA 1MD3A 4D73B 1F37A 5ID2A 2VD0A 2AB6A 2HRKB 4EVMA 1QFNA 20GSA 2R5GA 2XHFA 2H1AA 1SJZA 1TRVA 1DE1A 1GLPA 5IIZA 1R4WA 2VL3A 1F3AA 4NV5A 1SVOA 4HUAA 4K9ZA 3TU3B 1X0RA 5JCUA 1NHOA 2CVKA 3F4SA 1XVWA 3GFKA 3QAVA 2HRFA 5G1KA 1MDJA 3TJJA 4GSTA 4MZWA 3HYPA 1OAZA 2IIYA 5IQYA 1RK4A 2GQKA 2BJXA 2B5EA 4KW6A 2PERA 2B5YA 2WS2A 4KDUA 1Z5YE 2WFCA 1SKWB 2K6VA 4FH8A 1XWAA 4OD7A 4F82A 4XS4A 2FNOA 2V6KA 2WZ9A 5DCGA 1GTIA 4L5OA 4XS1A 2G2QA 3D22A 1A2JA 5D9TA 5IO2A 2HLSA 3F8UA 2O85A 4MP4A 4Z7XA 2OT3A 5J9BA 3A5IA 4JBBA 2I9HA 3GHAA 2IMDA 1ML6A 4Q5QA 4XIHA 2FWHA 2P5RA 1TOFA 3ZMLA 2YANA 3CBUA 1K0DA 4KCAA 1KNGA 4GQFA 2B5XA 1RQMA 4TOPA 2GTUA 2H8LA 1A0RP 1EP7A 1WPIA 2ZNMA 1X5CA 4QL7A 2XPDA 3CXGA 5D8IA 1VF1A 1RW1A 2VKZG 2DLXA 3FZ4A 2HSHA 4RQXA 4HQZA 5HFGA 2CX3A 2EIRA 2C3NA 4EDYA 1DSBA 2H76A 5F8BA 3MNGA 18GSA 1M2DA 1M9AA 4TR0A 3D6IA 3CSIA 1EEJA 3TRXA 2IMKA 4F03A 5J4UA 4K6XA 2R2JA 4LL4B 3F6FA 2TIRA 2NDOA 2AV4A 3HDCA 1ZYEA 3BCIA 4JE1A 1TRSA 5HFIA 3V1WA 3IC4A 2MMNA 4AGSA 1I5GA 4IQAA 2K8VA 3TKSC 4K2XA 2VO4A 1YQ1A 5IMCA 1YEPA 3HD5A 3H93A 3G7IA 2H1DA 4I2TA 3IA1A 3BBYA 2YZUA 3ERWA 3M8NA 3W8JA 1GTUA 3CSHA 5IMDA 2R37A 3HKRA 3A2VA 3GKMA 5BMUB 2F3MA 4YAVA 1H4OA 3IDVA 3ZIJA 1THOA 4Q5FA 1QMVA 4ZBBA 1XPVA 5HR3A 2RIIA 2V1MA 5G2ZA 5ECOB 1N8JA 3VLNA 2JZRA 2IFQB 5IOWA 2HT9A 2PU9C 2YJHA 3HMJG 2OE1A 3GURA 4GSSA 1GSQA 2PN8A 5G1LA 3KP8A 4ZL7A 3GN3A 1T4YA 1U87A 2G0FA 1UN2A 2B3SA 1PSQA 1EWXA 3IK7A 2LNSA 3GSSA 2DIZA 2A4VA 5ECRB 2A4HA 1R5PA 3GV1A 4K5SA 3EU3A 1B48A 5G31A 1DE2A 1SD8A 3EURA 4EKZA 1AIUA 3TJKA 1X9WB 2WCIA 2F8AA 2H0GA 5GSSA 3O3TA 4IJ3A 2H1BA 3ZZXA 5CO3A 1YKCA 3MSZA 3MDKA 2FWFA 3N9JA 5IMVA 4TRXA 2RUEA 2GLRA 3S9FA 3ERGA 3PGTA 1EGRA 4PQIA 5J41A 4FQUA 2QSIA 5IM9A 2EC4A 17GSA 5D9XA 1G7OA 4KB3A 4JRRA 2HZEB 2K9FA 1AUCA 4XRDA 5DBQA 1TXUA 5ECMB 2LKUA 3Q6OA 2EFCA 3HY2A 4MABA 1K0CA 3D4MA 22GSA 2UV8G 3QR6A 4I5QA 4GDFA 3ERFA 2VL2A 3FY7A 4TR1B 3O76A 1OC8A 5DJLA 2DBCA 2DKIA 2HFDA 4YQVA 4PGTA 1A2MA 1ZYPA 4EL1A 2HYXA 2GS3A 2HSMA 1SKRB 1GH2A 2VCXA 1XIYA 5A4UA 4BL7B 2KP1A 2L5LA 3DVXA 2QA1A 3TRQA 1F3BA 1J9BA 1BQ7A 4HU9A 1HYUA 6GSXA 4OFTA 3LSZA 2I1UA 2B7KA 2IJYA 4KGIA 4V1Ap 4KAEA 3NIVA 1S3AA 4NPBA 3ZVJD 1N25A 4AJ7A 4D73A 1O6JA 2Z9SA 2LV3A 2M46A 1XZOA 1YF1A 2H71A 3UBLA 2DJ0A 1TI3A 5B7CA 1Y1UA 3SWLA 4DVCA 4EO3A 2HRKA 2L5OA 5LD0A 4N11A 3C1SA 2NTOA 4KE3A 4RI7A 3Q74A 1V98A 1PMTA 1K3YA 1GP1A 2LRNA 1ERTA 2GZPA 1AW9A 3R3EA 5GAND 5D96A 3UMAA 3RHCA 4ZB6A 2H6XA 2LQQA 3LORA 3FK8A 4POKA 5CRHA 1EP8A 1WJKA 3EU4A 1PL2A 2B7JA 1EEMA 2H72A 4GF0A 1O7UA 1BF5A 1NHYA 4LA1A 1S3DA 5A34B 4X43A 1HD2A 3HVSA 1U3IA 3UARA 5IMZA 1A23A 5FWGA 6GSYA 4MJBA 1C72A 4BVXA 3F63A 3E9JB 4LLRA 3TRPA 4DSSB 1ZL9A 3VWWA 3M0FA 4FYCA 4EIQA 1A24A 1XCCA 4IVFA 5ELAA 2JACA 3CTFA 4G01A 5A5HB 2F51A 1K3OA 5ECQB 3W8SA 3EMXA 8GSSA 2MMZA 2YWIA 1T1VA 5F06A 2ON5A 3FEUA 2JZSA 1ZMAA 2WDUA 2VCWA 1B9XC 2VLVA 1PN0A 3DXBA 1OYJA 2C3QA 1H75A 2KP2A 5DALB 4CDOA 4J56E 1TU8A 3IK9A 4AI6A 2HRAA 4KNDA 4V2LA 4ZB7A 1TP9A 19GSA 1V57A 1FB6A 2R3XA 1YEXA 3EMPA 2HXKA 5D9VA 1BJXA 2X8HA 2PMTA 4Z2UA 3JCML 3EPTA 5HFKA 4KH7A 3RDWA 1WOUA 1SVLA 5FHIA 4MF5A 3ME7A 3IPZA 3OR5A 5G5EA 2H74A 2VM2A 2FA4A 4E68A 4K0NA 3IAS2 1JHBA 3RPNA 1W89A 3KTBA 3EWLA 4I2UA 4CY6A 1J08A 3DMLA 2HE3A 3LGCA 2O8VB 2H1GA 3FZAA 1KTEA 4GRFA 4YKFA 5GAPD 4V2MA 2JSZA 1PA3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1X5D A;  1EV4 A;  4P3Y B;  2BTO T;  4MZC A;  1SJI A;  3TGZ A;  3PH9 A;  3C1R A;  4I8B A;  1MDI A;  3HVV A;  2OKA A;  2GSS A;  5ECL B;  3KMO A;  14GS A;  3KIJ A;  4BVY A;  3TJF A;  1U6T A;  5B6M A;  1X5E A;  5J3R A;  4G0I A;  3TOU A;  2WGR A;  2YOI A;  2IFQ A;  3H4K A;  3KH9 A;  3M1G A;  1U3A A;  5D93 A;  4RI6 A;  1FO5 A;  2OA7 A;  1XOA A;  3VFI A;  1K0M A;  3EIN A;  1SU9 A;  3ZL5 A;  2EIQ A;  2RLI A;  4POB A;  3L78 A;  4IHU A;  1FVJ A;  2PVO C;  4N0Z A;  3LXT A;  3WT1 A;  3GTU A;  3EYT A;  2ON7 A;  3A2W A;  1ERV A;  5ECK B;  5D73 A;  4HZ2 A;  1ZGN A;  3RAZ A;  2HQT A;  3H1N A;  2ALB A;  3EVI A;  5C04 A;  3IBH A;  5DVB A;  1QXH A;  3GYK A;  4GCI A;  4BA7 A;  2LST A;  3QD9 A;  3RPP A;  3GST A;  5CRG A;  1AQX A;  4ML6 A;  4MK3 A;  5EPF A;  4K7O A;  5DAK B;  3CTG A;  4OFN A;  2XC2 A;  4KA0 A;  3WYW A;  4PUR A;  5KEJ A;  3DWV A;  1AQV A;  3VWV A;  4Q5N A;  2J9H A;  4MH2 A;  5JWQ B;  5A5K A;  2AJQ B;  3WGE A;  4IP6 A;  2H01 A;  2TRX A;  2HZF A;  2KUC A;  4PUF C;  1OE7 A;  3I69 A;  2NPB A;  3VI7 A;  3UVT A;  3U6V A;  4NAX A;  2FUG 2;  3FKF A;  3I9V 2;  1W4V A;  2AHE A;  2HSY A;  3HHV A;  4EF0 A;  4POL A;  5LCZ A;  5H5Q A;  1VF2 A;  3FR3 A;  3L4N A;  2YP6 A;  1WWJ A;  3LG6 A;  2H30 A;  2HSN B;  2YV9 A;  5B6N A;  3ZIT A;  1XXU A;  2LEG A;  2IPA A;  2FLS A;  2GZY A;  4HS1 A;  4BL7 A;  3QCP A;  3LXZ A;  3ZMK A;  1XFL A;  2VL2 C;  1PKZ A;  3AY8 A;  3PPU A;  2A2R A;  3Q19 A;  4DEJ A;  2V2G A;  4IP1 A;  5GZZ B;  3GL3 A;  1TXX A;  1FAA A;  1SJ6 A;  4IEL A;  1ERU A;  1TI1 A;  1GTA A;  1SK2 A;  2IWT A;  3CYN A;  1FB0 A;  1TW9 A;  1O8X A;  3C7M A;  3KEB A;  3QOU A;  4PUA A;  16GS A;  4POM A;  4ACS A;  3ZRD A;  1XVQ A;  2JSY A;  2MMO A;  4LMW A;  3KMN A;  4IQ1 A;  3I43 A;  1PD2 1;  2LS5 A;  1GL8 A;  2UZ8 A;  4OMV A;  3G7Y A;  4EC0 A;  5ABR A;  4L5L A;  1XW5 A;  3FZ5 A;  3KJY A;  4X1U A;  3D21 A;  1WRY A;  1SL0 B;  3TKS E;  1CQH A;  2H73 A;  2YPM A;  4WBJ A;  4AF2 A;  2JZT A;  2HI7 A;  1SD9 A;  2RM5 A;  3LYP A;  4ZXG A;  2TRC P;  3M9J A;  2YZH A;  1O85 A;  1V9W A;  1Q98 A;  3C73 A;  2VCZ A;  4MF7 A;  1NW2 A;  2H19 A;  1FG4 A;  1SL1 B;  3H79 A;  5IO0 A;  3QMX A;  5IMF A;  1WP0 A;  3SBC A;  1M9B A;  2H70 A;  2WRT A;  4GQC A;  3TUE A;  4DSS A;  2NBS A;  4H86 A;  4HQS A;  5DQY A;  3VK9 A;  1GNW A;  3D5J A;  3VWU A;  4HJ2 A;  1A8L A;  2LNT A;  1GTB A;  2H66 A;  1Z6M A;  5CRD A;  1TRU A;  5CRE A;  3TJG A;  4MLY A;  1GUM A;  5IPH A;  4MH3 A;  3ZYW A;  3KH7 A;  2PBJ A;  1T3B A;  4IKH A;  2OE0 A;  4XS4 B;  4L8E A;  5G30 A;  5H5R A;  5DJM A;  5KN1 A;  2DJ3 A;  1A8Y A;  2FWG A;  4ML1 A;  4MA9 A;  4YAP A;  2FGX A;  4RQR A;  3IRA A;  4OCF A;  1AXD A;  4J57 E;  3ZRE A;  5A4V A;  4TXO A;  5GST A;  1OKT A;  1TTZ A;  1F9M A;  1GSU A;  1Z6N A;  2CQ9 A;  2PUK C;  4K1F A;  4CW9 A;  5B8B A;  2R4V A;  4KX4 A;  5CNW A;  2IMF A;  1A0F A;  4PX1 A;  4G9H A;  3HCZ A;  1K0B A;  4WXT A;  1T4Z A;  2F9S A;  4EXJ A;  4HDE A;  1IYH A;  3L9U A;  2E2M A;  5KN0 A;  5JCW A;  1F6M C;  1Z9H A;  2KHP A;  1YKA A;  4NMU A;  1SYX A;  3GX8 A;  3QPM A;  2IN3 A;  2I3Y A;  4ILF A;  4OO5 A;  4F0B A;  2ZUP A;  1HNC A;  3N5O A;  3GKN A;  4DSR A;  2XBQ A;  4KSM A;  2CX4 A;  4IN0 A;  2J23 A;  4O7H A;  1LJR A;  3TKS A;  1GRX A;  4HOJ A;  1UVZ A;  4ZL8 A;  3Q18 A;  1FOV A;  2GQM A;  1SK0 A;  4IW9 A;  4IS0 A;  1Q4J A;  3EE2 A;  2H6Z A;  5AIV A;  1E2Y A;  2P31 A;  3MWH A;  2V32 A;  4ZBA A;  2GQL A;  2GGT A;  2JL4 A;  1OC9 B;  5C00 A;  2P0G A;  4TKY A;  4WBR D;  3UJ1 A;  1CQG A;  5AN1 A;  3BOA A;  1YF0 A;  3GH6 A;  3KP9 A;  4NXI A;  3TDG A;  4XCS A;  4NHZ A;  1WE0 A;  4LL1 B;  4PXO A;  1PGT A;  3GL5 A;  1M0U A;  4EE0 A;  2H0I A;  3CRT A;  5HQP A;  2M72 A;  1FW1 A;  2H6Y A;  5HR1 A;  4OFM A;  1FVK A;  4OCE A;  4PQH A;  2F8F A;  3KD0 A;  3GIX A;  9GSS A;  4HJM A;  1R5A A;  1WMJ A;  5LNK e;  3LJR A;  2YNX A;  3CSJ A;  4FYB A;  4WKW A;  2R6K A;  2C1Y A;  3IV4 A;  2E0Q A;  13GS A;  3G9B A;  1VRS D;  2CVD A;  3TKR A;  2FD3 A;  5EVO A;  2H0H A;  4DSQ A;  5CRW A;  1TDI A;  1T8E B;  1OVN A;  4MJE A;  5AIX A;  4WEY A;  3GH9 A;  4BWS A;  3IOS A;  11GS A;  1EZK A;  5DAK A;  4AJ8 A;  3QAW A;  3APO A;  4YQM A;  2ZCT A;  1OC3 A;  2KOK A;  2HRN A;  2C0G A;  1XWC A;  1GSD A;  3KXO A;  1G7E A;  1E6B A;  1B4P A;  1VF4 A;  4FO5 A;  6GSV A;  3P8W A;  2FWE A;  2OBK A;  3F3R A;  2C0F A;  7GSS A;  3P2A A;  5KN3 A;  1X9M B;  3LEF A;  1AAZ A;  2FHE A;  1B9Y C;  1SL2 B;  3DEX A;  3GKX A;  4ECI A;  1TK5 B;  1GUH A;  2X99 A;  2LQO A;  2YWO A;  4N30 A;  3ISO A;  10GS A;  1PL1 A;  2CAI A;  5J5N A;  4GSN A;  1V2A A;  3LQ7 A;  1YDK A;  2EIO A;  1GSE A;  4MDC A;  1GSY A;  3TB2 A;  3FR6 A;  3H8Q A;  1Y6E A;  4MCU A;  1DUG A;  2L4Q A;  2V6O A;  2O87 A;  4WR5 A;  1GUK A;  4V1A g;  1M2B A;  2O89 A;  2VUP A;  3U5R E;  2MMA A;  2M80 A;  4TR4 A;  3IC8 A;  2HSM B;  5CYY A;  4TW5 A;  3QFB C;  3DD3 A;  4KDX A;  4G0K A;  5F05 A;  1EV9 A;  1XWG A;  2YN1 A;  1GSF A;  1JZW A;  3UIW A;  2IL3 A;  2CZ3 A;  2WJU A;  2CZ2 A;  5BMU A;  2L57 A;  2L4C A;  3FHK A;  4KDY A;  1X9S B;  4TN8 A;  1JLW A;  5ENU A;  3TJB A;  3WT2 A;  4NWY A;  4KF9 A;  1SEN A;  1QGV A;  4ZL9 A;  3VI5 A;  4L0W A;  3RBT A;  1EOG A;  3TKQ A;  1U88 A;  1ZZY A;  4K0G A;  4F9Z A;  2MZC A;  1K0A A;  2WUL A;  3LFL A;  4MZB A;  3DKS A;  4G2E A;  2AYT A;  2X64 A;  1VGL A;  3BD2 A;  4O32 A;  3CMI A;  3QDN A;  3BJ5 A;  3UEM A;  3W6G A;  6GSS A;  3F4T A;  4Q5R A;  2I4A A;  1PX7 A;  3F0I A;  3EC3 A;  5ECN B;  2X8G A;  1K3L A;  3UL3 A;  4N0V A;  4HZ4 A;  1BYE A;  4G0L A;  5JWR B;  2LUS A;  4O5R A;  5ELG A;  1NSW A;  2VD1 A;  4BVX B;  3KCM A;  1XBS A;  3HVX A;  4GXZ A;  4G10 A;  3NOF A;  1KEB A;  1I9D A;  2DJJ A;  3TKP A;  5KN2 A;  3ED3 A;  2HZE A;  3BCK A;  5INY A;  4X0X A;  4ECC A;  2C0E A;  4FYU A;  4QL9 A;  5E59 A;  4OWY A;  2GZZ A;  3DGQ A;  3WGD A;  3FZ9 A;  2CA8 A;  1BAY A;  4QQ7 A;  2MBS A;  1IYI A;  2KLX A;  3C71 A;  2WB9 A;  3WD6 A;  4GLT A;  4WET A;  4IGJ A;  2L59 A;  4TR1 A;  1JFU A;  3ME8 A;  2P5Q A;  1EGO A;  3F3Q A;  2DJK A;  2L6D A;  4ISD A;  2VCV A;  1XW9 A;  1O73 A;  2V41 A;  3QAG A;  1B8X A;  3IHQ A;  1ZOF A;  5IOX A;  2OBI A;  4PTS A;  1T7P B;  2PVQ A;  4MMM A;  4J2F A;  1UC7 A;  1USB A;  2DSA A;  2LRC A;  4KCE A;  4ECB A;  1MEK A;  4YH2 A;  4PQ1 A;  1Z7R A;  2N5F A;  2VAF A;  3TOT A;  2DMM A;  5F07 A;  4K8M A;  3KTL A;  4TR3 A;  1TK8 B;  2OAC A;  2GT5 A;  2FA8 A;  2I81 A;  1AC1 A;  1TK0 B;  1ABA A;  1OC9 A;  4ZBD A;  1M2A A;  1QK8 A;  2JAD A;  2RM6 A;  3ZVJ A;  2GST A;  5IPG A;  1G0T A;  3A2X A;  3IXR A;  3ZFB A;  4K2D A;  1A2L A;  6GSW A;  5IMA A;  4L0U A;  4XRA A;  3LWA A;  1YJ6 A;  4NHW A;  4BPY A;  2FCH A;  5H5S A;  1UA5 A;  1JLV A;  2A2S A;  1HQO A;  1XWB A;  4HU7 A;  1ZYQ B;  4XTS A;  4K7I A;  3E3E A;  3FYG A;  1YY7 A;  2VIM A;  2VM1 A;  2OE3 A;  1K0N A;  3ZTL A;  3VWX A;  4BVY B;  12GS A;  3HJP A;  3F4R A;  5CP1 A;  5ECI B;  1QUW A;  4ZIJ A;  5ID2 B;  2B6M A;  1GSS A;  3FR9 A;  2LJR A;  2PGT A;  3VPT A;  2C0D A;  3UVH A;  3A5W A;  1JZO A;  2GT6 A;  1MDK A;  3ZLP A;  5COH A;  2MBT A;  2RUF A;  4E8H A;  4ZIL A;  3HZ4 A;  4JR6 A;  2C80 A;  4HEA 2;  1J0F A;  4JU5 A;  3HJM A;  3ZIV A;  3WGX A;  1SYR A;  1JZD A;  2YWM A;  4GTU A;  4KSO A;  1EOH A;  1HNA A;  3GTU B;  3GKK A;  3UBK A;  2VCT A;  3G7J A;  3HA9 A;  1GUL A;  1OE8 A;  5B8A A;  1FHE A;  2K8S A;  1N2A A;  4ZB8 A;  2H75 A;  3VPQ A;  4N10 A;  1B4Q A;  5DAL A;  4IJI A;  2GSR A;  3L9V A;  3FRC A;  1XW6 A;  1GNE A;  1T00 A;  1XOB A;  3L0H A;  3O6T A;  2DIY A;  5JCG A;  2CV4 A;  4TVE A;  5JWO B;  2HNL A;  1PQN A;  3VUR A;  4ID0 A;  3KM6 A;  5EL8 A;  1PRX A;  1ACV A;  2LTK A;  4WR4 A;  1ILO A;  2CVB A;  3J7Y b;  4NV2 A;  1Z7P A;  1R26 A;  3E0U A;  1BG5 A;  5EY6 A;  3GMF A;  2LJA A;  3K8N A;  2VL9 A;  1S3C A;  4LMV A;  1O81 A;  2QKE A;  5FT3 A;  2NVL A;  3D4T A;  5L71 A;  4GWR A;  4AJ6 A;  2E7P A;  4MJA A;  1ZCP A;  5ECS A;  6GSU A;  1THX A;  1PKW A;  2LJK A;  4EDZ A;  4E8E A;  1O8W A;  3M3M A;  3P90 A;  5DCH A;  3FW2 A;  1MD4 A;  2IMI A;  1SKS B;  4I6X A;  2MYG A;  5ECP B;  3IAM 2;  1HNB A;  3HJO A;  3NZN A;  2PWJ A;  1VF3 A;  2CT6 A;  2VCQ A;  5DDL A;  1BED A;  3R2Q A;  5F0G A;  3US3 A;  4PNG A;  4F2I A;  4O92 A;  2C4J A;  2OJL A;  4FIW A;  3GA4 A;  4JR4 A;  2C3T A;  4TXV A;  2VOC A;  1GWC A;  2IME A;  2YJ7 A;  3HXS A;  3DRN A;  1URM A;  1G6W A;  3GX0 A;  4I97 A;  3RHB A;  1F2E A;  1TU7 A;  1BX9 A;  2N5A A;  1PN9 A;  2DML A;  5AIS A;  4KUN A;  5HR0 A;  3UAP A;  3I6A A;  2B1K A;  2YV7 A;  3F6D A;  2AUV A;  2QC7 A;  5DQS A;  3DIE A;  4IBP A;  4YQU A;  4PNF A;  3KGK A;  1NM3 A;  1ON4 A;  2REM A;  5G5F A;  4JZQ A;  5ECH B;  1ST9 A;  4HI7 A;  3F9U A;  3GNJ A;  1KBN A;  1QQ2 A;  2L6C A;  2DJ2 A;  4G19 A;  3A3T A;  3QFA C;  2VLU A;  5AGY A;  1M7T A;  2LRT A;  1TJD A;  5D9W A;  1V40 A;  5HR2 A;  4OO4 A;  3GUS A;  6GST A;  2GVP A;  1JZR A;  4WF5 A;  1K0O A;  3PIN A;  2C8U A;  1V58 A;  1AQW A;  5E4W A;  4V2N A;  3C8E A;  2DC5 A;  4USS A;  4EUY A;  2X8C A;  3IR4 A;  1Y25 A;  4MJC A;  4CHS A;  3DVW A;  3IE3 A;  2QGV A;  3M9K A;  3DYR A;  5J9C A;  3TCO A;  3UOM A;  1G6Y A;  2AAW A;  3MAK A;  4BWQ A;  1LU4 A;  2N5B A;  3HZ8 A;  2JU5 A;  1Z3E A;  4TXO B;  1SK1 A;  2YWN A;  3APS A;  2K18 A;  1LBK A;  4F0C A;  4MPF A;  2XBI A;  2ES7 A;  2XPE A;  2GSQ A;  3ZFL A;  3APQ A;  3GRX A;  3P7X A;  3D0Z A;  3J7Y k;  4XS6 A;  1OKD A;  2PPT A;  2B1L A;  1TRW A;  2DJ1 A;  4XHM A;  1DBY A;  1YZX A;  4MPG A;  3PR8 A;  2BMX A;  3LYK A;  1TKD B;  4JED A;  3KZQ A;  2VLT A;  1M99 A;  4RUV A;  2YCD A;  1R7H A;  2D2Z A;  5A4W A;  4K7N A;  5CAX A;  4ULX A;  3L9S A;  1WIK A;  1ERW A;  1PX6 A;  2FY6 A;  4WF4 A;  4MF6 A;  2GDR A;  1MTC A;  2O7K A;  2CAQ A;  4ZB9 A;  3CRU A;  2OAD A;  4ECJ A;  2E2G A;  1XWK A;  1GLQ A;  1MD3 A;  4D73 B;  1F37 A;  5ID2 A;  2VD0 A;  2AB6 A;  2HRK B;  4EVM A;  1QFN A;  20GS A;  2R5G A;  2XHF A;  2H1A A;  1SJZ A;  1TRV A;  1DE1 A;  1GLP A;  5IIZ A;  1R4W A;  2VL3 A;  1F3A A;  4NV5 A;  4HUA A;  4K9Z A;  1X0R A;  5JCU A;  1NHO A;  2CVK A;  3F4S A;  1XVW A;  3GFK A;  3QAV A;  2HRF A;  5G1K A;  1MDJ A;  3TJJ A;  4GST A;  4MZW A;  3HYP A;  1OAZ A;  2IIY A;  5IQY A;  1RK4 A;  2GQK A;  2BJX A;  2B5E A;  4KW6 A;  2PER A;  2B5Y A;  2WS2 A;  4KDU A;  1Z5Y E;  2WFC A;  1SKW B;  2K6V A;  4FH8 A;  1XWA A;  4OD7 A;  4F82 A;  4XS4 A;  2FNO A;  2V6K A;  2WZ9 A;  5DCG A;  1GTI A;  4L5O A;  4XS1 A;  2G2Q A;  3D22 A;  1A2J A;  5D9T A;  5IO2 A;  2HLS A;  3F8U A;  2O85 A;  4MP4 A;  4Z7X A;  5J9B A;  4JBB A;  2I9H A;  3GHA A;  2IMD A;  1ML6 A;  4Q5Q A;  4XIH A;  2FWH A;  2P5R A;  1TOF A;  3ZML A;  2YAN A;  3CBU A;  1K0D A;  4KCA A;  1KNG A;  4GQF A;  2B5X A;  1RQM A;  4TOP A;  2GTU A;  2H8L A;  1A0R P;  1EP7 A;  1WPI A;  2ZNM A;  1X5C A;  4QL7 A;  2XPD A;  3CXG A;  5D8I A;  1VF1 A;  1RW1 A;  2DLX A;  3FZ4 A;  2HSH A;  4RQX A;  4HQZ A;  5HFG A;  2CX3 A;  2EIR A;  2C3N A;  4EDY A;  1DSB A;  2H76 A;  5F8B A;  3MNG A;  18GS A;  1M2D A;  1M9A A;  4TR0 A;  3D6I A;  3CSI A;  1EEJ A;  3TRX A;  2IMK A;  4F03 A;  5J4U A;  4K6X A;  2R2J A;  4LL4 B;  3F6F A;  2TIR A;  2NDO A;  2AV4 A;  3HDC A;  1ZYE A;  3BCI A;  4JE1 A;  1TRS A;  5HFI A;  3V1W A;  3IC4 A;  2MMN A;  4AGS A;  1I5G A;  4IQA A;  2K8V A;  3TKS C;  2VO4 A;  1YQ1 A;  5IMC A;  1YEP A;  3HD5 A;  3H93 A;  3G7I A;  2H1D A;  4I2T A;  3IA1 A;  3BBY A;  2YZU A;  3ERW A;  3M8N A;  3W8J A;  1GTU A;  3CSH A;  5IMD A;  2R37 A;  3HKR A;  3A2V A;  3GKM A;  2F3M A;  4YAV A;  1H4O A;  3IDV A;  3ZIJ A;  1THO A;  4Q5F A;  1QMV A;  4ZBB A;  1XPV A;  5HR3 A;  2RII A;  2V1M A;  5G2Z A;  5ECO B;  1N8J A;  3VLN A;  2JZR A;  2IFQ B;  5IOW A;  2HT9 A;  2PU9 C;  2YJH A;  2OE1 A;  3GUR A;  4GSS A;  1GSQ A;  2PN8 A;  5G1L A;  3KP8 A;  4ZL7 A;  3GN3 A;  1T4Y A;  1U87 A;  2G0F A;  1UN2 A;  2B3S A;  1PSQ A;  1EWX A;  3IK7 A;  2LNS A;  3GSS A;  2DIZ A;  2A4V A;  5ECR B;  1R5P A;  3GV1 A;  3EU3 A;  1B48 A;  5G31 A;  1DE2 A;  1SD8 A;  3EUR A;  4EKZ A;  1AIU A;  3TJK A;  1X9W B;  2WCI A;  2F8A A;  2H0G A;  5GSS A;  3O3T A;  4IJ3 A;  2H1B A;  3ZZX A;  5CO3 A;  1YKC A;  3MDK A;  2FWF A;  3MSZ A;  3N9J A;  5IMV A;  4TRX A;  2RUE A;  2GLR A;  3S9F A;  3ERG A;  3PGT A;  1EGR A;  4PQI A;  5J41 A;  4FQU A;  2QSI A;  5IM9 A;  2EC4 A;  17GS A;  5D9X A;  1G7O A;  4KB3 A;  4JRR A;  2HZE B;  2K9F A;  1AUC A;  4XRD A;  5DBQ A;  5ECM B;  2LKU A;  3Q6O A;  3HY2 A;  4MAB A;  1K0C A;  3D4M A;  22GS A;  3QR6 A;  4I5Q A;  3ERF A;  2VL2 A;  3FY7 A;  4TR1 B;  3O76 A;  1OC8 A;  5DJL A;  2DBC A;  2HFD A;  4YQV A;  4PGT A;  1A2M A;  4EL1 A;  2HYX A;  2GS3 A;  2HSM A;  1SKR B;  1GH2 A;  2VCX A;  1XIY A;  5A4U A;  4BL7 B;  2KP1 A;  2L5L A;  3DVX A;  3TRQ A;  1F3B A;  1J9B A;  1BQ7 A;  4HU9 A;  1HYU A;  6GSX A;  4OFT A;  3LSZ A;  2I1U A;  2B7K A;  2IJY A;  4KGI A;  4V1A p;  4KAE A;  3NIV A;  1S3A A;  4NPB A;  3ZVJ D;  4AJ7 A;  4D73 A;  1O6J A;  2Z9S A;  2LV3 A;  2M46 A;  1XZO A;  1YF1 A;  2H71 A;  3UBL A;  2DJ0 A;  1TI3 A;  5B7C A;  3SWL A;  4DVC A;  4EO3 A;  2HRK A;  2L5O A;  5LD0 A;  4N11 A;  3C1S A;  2NTO A;  4KE3 A;  4RI7 A;  3Q74 A;  1V98 A;  1PMT A;  1K3Y A;  1GP1 A;  2LRN A;  1ERT A;  2GZP A;  1AW9 A;  3R3E A;  5GAN D;  5D96 A;  3UMA A;  3RHC A;  4ZB6 A;  2H6X A;  2LQQ A;  3LOR A;  3FK8 A;  4POK A;  5CRH A;  1EP8 A;  1WJK A;  3EU4 A;  1PL2 A;  2B7J A;  1EEM A;  2H72 A;  4GF0 A;  1O7U A;  1NHY A;  4LA1 A;  1S3D A;  4X43 A;  1HD2 A;  3HVS A;  1U3I A;  3UAR A;  5IMZ A;  1A23 A;  5FWG A;  6GSY A;  4MJB A;  1C72 A;  4BVX A;  3F63 A;  3E9J B;  4LLR A;  3TRP A;  4DSS B;  1ZL9 A;  3VWW A;  3M0F A;  4FYC A;  1A24 A;  1XCC A;  4IVF A;  5ELA A;  2JAC A;  3CTF A;  2F51 A;  1K3O A;  5ECQ B;  3W8S A;  3EMX A;  8GSS A;  2MMZ A;  2YWI A;  1T1V A;  5F06 A;  2ON5 A;  3FEU A;  2JZS A;  1ZMA A;  2WDU A;  2VCW A;  1B9X C;  2VLV A;  3DXB A;  1OYJ A;  2C3Q A;  1H75 A;  2KP2 A;  5DAL B;  4CDO A;  4J56 E;  1TU8 A;  3IK9 A;  2HRA A;  4KND A;  4V2L A;  1TP9 A;  19GS A;  1V57 A;  1FB6 A;  2R3X A;  1YEX A;  3EMP A;  2HXK A;  5D9V A;  1BJX A;  2X8H A;  2PMT A;  3JCM L;  5HFK A;  4KH7 A;  3RDW A;  1WOU A;  5FHI A;  4MF5 A;  3ME7 A;  3IPZ A;  3OR5 A;  5G5E A;  2H74 A;  2VM2 A;  2FA4 A;  4K0N A;  3IAS 2;  1JHB A;  3RPN A;  1W89 A;  3KTB A;  3EWL A;  4I2U A;  1J08 A;  3DML A;  2HE3 A;  3LGC A;  2O8V B;  2H1G A;  3FZA A;  1KTE A;  4GRF A;  5GAP D;  4V2M A;  2JSZ A;  1PA3 A; 
#chains in the Genus database with same CATH topology
 1X5D A;  1EV4 A;  4P3Y B;  2BTO T;  2R0C A;  4MZC A;  2QA2 A;  1SJI A;  3TGZ A;  3PH9 A;  3C1R A;  4I8B A;  1MDI A;  3HVV A;  4Z2T A;  2OKA A;  2GSS A;  5ECL B;  2R0G A;  3KMO A;  14GS A;  3KIJ A;  4BVY A;  3TJF A;  4ICY A;  1U6T A;  5B6M A;  1X5E A;  5J3R A;  4G0I A;  3TOU A;  2WGR A;  2YOI A;  2IFQ A;  3H4K A;  3KH9 A;  4BIK A;  3M1G A;  1ZYN A;  1U3A A;  5D93 A;  1I1I P;  4RI6 A;  1FO5 A;  2OA7 A;  1XOA A;  3VFI A;  1K0M A;  3EIN A;  1SU9 A;  3ZL5 A;  2EIQ A;  2RLI A;  4POB A;  3L78 A;  4IHU A;  1FVJ A;  2PVO C;  4N0Z A;  3LXT A;  3WT1 A;  3GTU A;  3EYT A;  2ON7 A;  2H1L A;  3A2W A;  1ERV A;  5ECK B;  5D73 A;  4HZ2 A;  1ZGN A;  3RAZ A;  2HQT A;  3H1N A;  2ALB A;  3EVI A;  5C04 A;  1SVM A;  5A1N A;  3IBH A;  5DVB A;  1QXH A;  3GYK A;  4GCI A;  4BA7 A;  2LST A;  3QD9 A;  3RPP A;  3GST A;  5CRG A;  1AQX A;  4ML6 A;  4MK3 A;  5EPF A;  4K7O A;  5DAK B;  3CTG A;  4OFN A;  2XC2 A;  4KA0 A;  3WYW A;  4PUR A;  5KEJ A;  3DWV A;  1AQV A;  3VWV A;  4Q5N A;  2J9H A;  4MH2 A;  5JWQ B;  5A5K A;  2AJQ B;  3WGE A;  4IP6 A;  2H01 A;  2TRX A;  2HZF A;  2KUC A;  4PUF C;  1OE7 A;  3I69 A;  2NPB A;  3VI7 A;  3UVT A;  3U6V A;  4NAX A;  2FUG 2;  3FKF A;  3I9V 2;  1W4V A;  2AHE A;  2HSY A;  3HHV A;  4EF0 A;  4POL A;  5LCZ A;  2A2P A;  5H5Q A;  1VF2 A;  3FR3 A;  3L4N A;  2YP6 A;  1WWJ A;  3LG6 A;  2H30 A;  2HSN B;  2YV9 A;  5B6N A;  3ZIT A;  1XXU A;  2LEG A;  3MIX A;  2IPA A;  2FLS A;  2GZY A;  4HS1 A;  4BL7 A;  3QCP A;  3LXZ A;  3ZMK A;  1XFL A;  2VL2 C;  1PKZ A;  3AY8 A;  3PPU A;  2A2R A;  3Q19 A;  4DEJ A;  2V2G A;  4IP1 A;  5GZZ B;  3GL3 A;  1TXX A;  1FAA A;  1SJ6 A;  4IEL A;  1ERU A;  1TI1 A;  1GTA A;  1SK2 A;  2IWT A;  3CYN A;  1FB0 A;  1TW9 A;  1O8X A;  3C7M A;  3KEB A;  3QOU A;  4PUA A;  16GS A;  4POM A;  4ACS A;  3ZRD A;  1XVQ A;  2JSY A;  2MMO A;  4LMW A;  3KMN A;  4QMK A;  4IQ1 A;  3I43 A;  1PD2 1;  2WW3 A;  2LS5 A;  1GL8 A;  2UZ8 A;  4OMV A;  3G7Y A;  4EC0 A;  5ABR A;  4L5L A;  1XW5 A;  3FZ5 A;  3KJY A;  4X1U A;  3D21 A;  1WRY A;  1SL0 B;  3TKS E;  1CQH A;  2H73 A;  2YPM A;  4WBJ A;  4AF2 A;  2JZT A;  2HI7 A;  1SD9 A;  2WW0 A;  2RM5 A;  3LYP A;  4ZXG A;  2TRC P;  3M9J A;  2YZH A;  1O85 A;  1V9W A;  1Q98 A;  3C73 A;  2VCZ A;  4MF7 A;  1NW2 A;  2H19 A;  1FG4 A;  5A34 A;  1SL1 B;  3H79 A;  5IO0 A;  3QMX A;  5IMF A;  1WP0 A;  3SBC A;  1M9B A;  2H70 A;  2WRT A;  4GQC A;  3TUE A;  4DSS A;  2NBS A;  4H86 A;  4HQS A;  5DQY A;  3VK9 A;  1GNW A;  3D5J A;  3VWU A;  4HJ2 A;  1A8L A;  2LNT A;  1GTB A;  2H66 A;  1Z6M A;  5CRD A;  1TRU A;  5CRE A;  3TJG A;  4MLY A;  1GUM A;  5IPH A;  4MH3 A;  3ZYW A;  3KH7 A;  2PBJ A;  1T3B A;  4IKH A;  2OE0 A;  4XS4 B;  4L8E A;  5G30 A;  5H5R A;  5DJM A;  3LW9 A;  5KN1 A;  2DJ3 A;  1A8Y A;  2FWG A;  4ML1 A;  4MA9 A;  4YAP A;  2FGX A;  4RQR A;  3IRA A;  4OCF A;  1AXD A;  2WVY A;  4J57 E;  3ZRE A;  5A4V A;  4TXO A;  5GST A;  1OKT A;  1TTZ A;  1F9M A;  1GSU A;  1Z6N A;  2CQ9 A;  2PUK C;  4K1F A;  4CW9 A;  5B8B A;  2R4V A;  4KX4 A;  5CNW A;  2IMF A;  1A0F A;  4PX1 A;  4G9H A;  3HCZ A;  1K0B A;  4WXT A;  1T4Z A;  2F9S A;  4EXJ A;  4HDE A;  1IYH A;  3L9U A;  2E2M A;  5KN0 A;  5JCW A;  1F6M C;  1Z9H A;  2KHP A;  1YKA A;  4NMU A;  1SYX A;  3GX8 A;  3QPM A;  2IN3 A;  2I3Y A;  4ILF A;  4OO5 A;  4F0B A;  2ZUP A;  1HNC A;  3N5O A;  3GKN A;  4DSR A;  2XBQ A;  4KSM A;  2CX4 A;  4IN0 A;  2J23 A;  4O7H A;  1LJR A;  3TKS A;  1GRX A;  4HOJ A;  1UVZ A;  4ZL8 A;  3Q18 A;  1FOV A;  5KOX A;  2GQM A;  1SK0 A;  4IW9 A;  4IS0 A;  1Q4J A;  3EE2 A;  2H6Z A;  4O5Q A;  5AIV A;  1E2Y A;  2P31 A;  3MWH A;  2V32 A;  4ZBA A;  2GQL A;  2GGT A;  2JL4 A;  1OC9 B;  5C00 A;  2P0G A;  4TKY A;  4WBR D;  3UJ1 A;  1CQG A;  5AN1 A;  3BOA A;  1YF0 A;  3GH6 A;  3KP9 A;  4NXI A;  3TDG A;  4XCS A;  4NHZ A;  1WE0 A;  4LL1 B;  4N3Z A;  2WW2 A;  2O5V A;  4PXO A;  1PGT A;  3GL5 A;  1M0U A;  4EE0 A;  2H0I A;  3CRT A;  5HQP A;  2M72 A;  1FW1 A;  2H6Y A;  5HR1 A;  4OFM A;  1FVK A;  4OCE A;  4PQH A;  2F8F A;  5KOW A;  3KD0 A;  3GIX A;  9GSS A;  4HJM A;  1R5A A;  1WMJ A;  5LNK e;  3LJR A;  2YNX A;  3CSJ A;  4FYB A;  4WKW A;  2R6K A;  2C1Y A;  3IV4 A;  3MYD A;  2E0Q A;  5J4Y A;  13GS A;  3G9B A;  1VRS D;  2CVD A;  3IHG A;  3TKR A;  2FD3 A;  4AKG A;  5EVO A;  2H0H A;  4DSQ A;  5CRW A;  2WZS A;  1TDI A;  1T8E B;  1OVN A;  4MJE A;  5AIX A;  4WEY A;  3GH9 A;  4BWS A;  3IOS A;  11GS A;  1EZK A;  5DAK A;  4AJ8 A;  3QAW A;  3APO A;  4YQM A;  2ZCT A;  1OC3 A;  2KOK A;  2HRN A;  2C0G A;  1XWC A;  1GSD A;  3KXO A;  1G7E A;  1E6B A;  1B4P A;  1VF4 A;  4FO5 A;  6GSV A;  3P8W A;  2FWE A;  2OBK A;  1M3J A;  3F3R A;  2C0F A;  7GSS A;  3P2A A;  5KN3 A;  1X9M B;  4MNN A;  3LEF A;  1AAZ A;  4A5P A;  2HSN A;  2FHE A;  1B9Y C;  1SL2 B;  3DEX A;  3GKX A;  4ECI A;  1TK5 B;  1GUH A;  2X99 A;  2R0P A;  2LQO A;  2YWO A;  1XG8 A;  4N30 A;  3ISO A;  10GS A;  1PL1 A;  2CAI A;  5J5N A;  4GSN A;  1V2A A;  3LQ7 A;  1YDK A;  2EIO A;  1GSE A;  4MDC A;  1GSY A;  3TB2 A;  3FR6 A;  3RFR C;  3H8Q A;  1Y6E A;  4MCU A;  1DUG A;  2L4Q A;  2V6O A;  2O87 A;  4WR5 A;  1GUK A;  4V1A g;  1M2B A;  2O89 A;  2VUP A;  3U5R E;  2MMA A;  2M80 A;  4TR4 A;  3IC8 A;  2HSM B;  5CYY A;  4TW5 A;  3QFB C;  3DD3 A;  4KDX A;  4G0K A;  5F05 A;  1EV9 A;  1XWG A;  2YN1 A;  1GSF A;  1JZW A;  3UIW A;  2IL3 A;  2CZ3 A;  2WVX A;  4AKI A;  2WJU A;  2CZ2 A;  1S4B P;  5BMU A;  2L57 A;  2L4C A;  4HSC X;  3CQF A;  3FHK A;  4KDY A;  1X9S B;  4TN8 A;  1JLW A;  5ENU A;  3TJB A;  3WT2 A;  4NWY A;  4KF9 A;  4PI2 C;  1SEN A;  1QGV A;  4ZL9 A;  3VI5 A;  4L0W A;  3RBT A;  1EOG A;  3TKQ A;  1U88 A;  1ZZY A;  4K0G A;  4F9Z A;  2MZC A;  1K0A A;  2WUL A;  3LFL A;  4MZB A;  3DKS A;  4G2E A;  2AYT A;  2X64 A;  1VGL A;  3BD2 A;  4O32 A;  3CMI A;  3QDN A;  3BJ5 A;  3UEM A;  3W6G A;  6GSS A;  3F4T A;  4Q5R A;  2I4A A;  1PX7 A;  3F0I A;  3EC3 A;  5ECN B;  2X8G A;  1K3L A;  3UL3 A;  4N0V A;  4HZ4 A;  2WW1 A;  1BYE A;  4G0L A;  5JWR B;  2LUS A;  4O5R A;  5ELG A;  1NSW A;  2VD1 A;  4BVX B;  3KCM A;  1XBS A;  3HVX A;  4GXZ A;  4G10 A;  3NOF A;  1KEB A;  1I9D A;  2DJJ A;  3TKP A;  5KN2 A;  3ED3 A;  2HZE A;  3BCK A;  5INY A;  4X0X A;  4ECC A;  2C0E A;  4FYU A;  1BG1 A;  4QL9 A;  5E59 A;  4OWY A;  2GZZ A;  3DGQ A;  3WGD A;  3FZ9 A;  2CA8 A;  1BAY A;  4QQ7 A;  2MBS A;  1IYI A;  2KLX A;  3C71 A;  2WB9 A;  3WD6 A;  4GLT A;  4WET A;  4IGJ A;  2L59 A;  4TR1 A;  1JFU A;  3ME8 A;  2P5Q A;  1EGO A;  3F3Q A;  2DJK A;  2L6D A;  4ISD A;  2VCV A;  1XW9 A;  1O73 A;  2V41 A;  3QAG A;  1B8X A;  3IHQ A;  1ZOF A;  5IOX A;  2OBI A;  4Z2R A;  4PTS A;  3RGB C;  1T7P B;  2PVQ A;  4MMM A;  4J2F A;  1UC7 A;  1USB A;  1M3I A;  2DSA A;  2LRC A;  4KCE A;  4ECB A;  1MEK A;  4YH2 A;  4PQ1 A;  1Z7R A;  2N5F A;  2VAF A;  4O5U A;  3TOT A;  2DMM A;  5F07 A;  4K8M A;  3KTL A;  4TR3 A;  1TK8 B;  2OAC A;  4EIP A;  2GT5 A;  2FA8 A;  2I81 A;  1AC1 A;  1TK0 B;  1ABA A;  2X4A A;  1OC9 A;  4ZBD A;  1M2A A;  1QK8 A;  2JAD A;  2RM6 A;  3ZVJ A;  2GST A;  5IPG A;  1G0T A;  3A2X A;  3IXR A;  3ZFB A;  4K2D A;  1A2L A;  6GSW A;  5IMA A;  4L0U A;  4XRA A;  3LWA A;  1YJ6 A;  4NHW A;  4BPY A;  2FCH A;  5H5S A;  1UA5 A;  1JLV A;  2A2S A;  1HQO A;  4K5R A;  1XWB A;  4HU7 A;  1ZYQ B;  4XTS A;  4K7I A;  3E3E A;  3FYG A;  1YY7 A;  2VIM A;  2VM1 A;  2OE3 A;  1K0N A;  3ZTL A;  3VWX A;  4BVY B;  12GS A;  3HJP A;  3F4R A;  5CP1 A;  5ECI B;  1QUW A;  4ZIJ A;  5ID2 B;  2B6M A;  1GSS A;  3FR9 A;  2LJR A;  2PGT A;  3VPT A;  2C0D A;  3UVH A;  3A5W A;  1JZO A;  2GT6 A;  1MDK A;  4PHZ C;  3ZLP A;  2EFH A;  5COH A;  2EFD A;  2MBT A;  2RUF A;  4E8H A;  4ZIL A;  3HZ4 A;  4JR6 A;  2C80 A;  4HEA 2;  1J0F A;  4JU5 A;  3HJM A;  5A5H A;  3ZIV A;  3WGX A;  1SYR A;  1JZD A;  2YWM A;  4GTU A;  4KSO A;  1EOH A;  1HNA A;  3GTU B;  3GKK A;  3UBK A;  2VCT A;  3G7J A;  3HA9 A;  1GUL A;  1OE8 A;  5B8A A;  1FHE A;  2K8S A;  1N2A A;  4ZB8 A;  2H75 A;  3VPQ A;  4N10 A;  1B4Q A;  5A1N B;  5DAL A;  4IJI A;  2GSR A;  3L9V A;  3HVN A;  3FRC A;  1XW6 A;  1GNE A;  1T00 A;  1XOB A;  3L0H A;  3O6T A;  2DIY A;  5JCG A;  2CV4 A;  4TVE A;  5JWO B;  2HNL A;  1PQN A;  3VUR A;  4ID0 A;  3KM6 A;  5EL8 A;  1PRX A;  1ACV A;  2LTK A;  4WR4 A;  5BRT A;  1ILO A;  2CVB A;  3J7Y b;  4NV2 A;  4AKH A;  1Z7P A;  1R26 A;  3E0U A;  1BG5 A;  5EY6 A;  3GMF A;  2WVZ A;  2LJA A;  3K8N A;  2VL9 A;  4YKG A;  1S3C A;  4W66 A;  4LMV A;  1O81 A;  2QKE A;  5FT3 A;  2NVL A;  3D4T A;  5L71 A;  4GWR A;  4AJ6 A;  2E7P A;  4MJA A;  1ZCP A;  5ECS A;  6GSU A;  1THX A;  4PI0 C;  1PKW A;  2DKH A;  2LJK A;  4EDZ A;  4E8E A;  4X4J A;  1O8W A;  3M3M A;  3P90 A;  5DCH A;  3FW2 A;  1MD4 A;  2IMI A;  1SKS B;  1PFO A;  4I6X A;  2MYG A;  4CY8 A;  5ECP B;  3IAM 2;  1HNB A;  3HJO A;  3NZN A;  2PWJ A;  1VF3 A;  2CT6 A;  2VCQ A;  5DDL A;  1BED A;  3R2Q A;  5F0G A;  2X49 A;  4AKX B;  3US3 A;  4PNG A;  4F2I A;  4O92 A;  2C4J A;  2OJL A;  4FIW A;  3GA4 A;  4JR4 A;  3CWG A;  2C3T A;  4TXV A;  2VOC A;  1GWC A;  2IME A;  2YJ7 A;  3HXS A;  3DRN A;  1URM A;  1G6W A;  3GX0 A;  4I97 A;  3RHB A;  1F2E A;  1TU7 A;  1BX9 A;  2N5A A;  1PN9 A;  2DML A;  5AIS A;  4KUN A;  5HR0 A;  3UAP A;  3I6A A;  2B1K A;  2YV7 A;  3F6D A;  2AUV A;  2QC7 A;  5DQS A;  3DIE A;  4IBP A;  4YQU A;  5J47 A;  4PNF A;  3KGK A;  1NM3 A;  1ON4 A;  2REM A;  5G5F A;  4JZQ A;  5ECH B;  1ST9 A;  4HI7 A;  3F9U A;  3GNJ A;  1KBN A;  1QQ2 A;  2L6C A;  2DJ2 A;  4G19 A;  3A3T A;  3QFA C;  2VLU A;  5AGY A;  1M7T A;  2LRT A;  1TJD A;  5D9W A;  1V40 A;  5HR2 A;  4OO4 A;  3GUS A;  6GST A;  2GVP A;  1JZR A;  4WF5 A;  1K0O A;  3PIN A;  2C8U A;  1V58 A;  1AQW A;  5E4W A;  3CHX C;  4V2N A;  3C8E A;  2DC5 A;  4USS A;  4EUY A;  2X8C A;  3IR4 A;  1Y25 A;  4MJC A;  4CHS A;  3DVW A;  3IE3 A;  2QGV A;  3M9K A;  3DYR A;  5J9C A;  3TCO A;  3UOM A;  1G6Y A;  2AAW A;  3MAK A;  4BWQ A;  1LU4 A;  2N5B A;  3HZ8 A;  2JU5 A;  1Z3E A;  4TXO B;  1SK1 A;  2YWN A;  3APS A;  2K18 A;  1LBK A;  4F0C A;  4MPF A;  2XBI A;  2ES7 A;  2XPE A;  2GSQ A;  3ZFL A;  3FMW A;  3APQ A;  3GRX A;  3P7X A;  3D0Z A;  3J7Y k;  4XS6 A;  1OKD A;  2PPT A;  2B1L A;  1TRW A;  2DJ1 A;  4XHM A;  1DBY A;  1YZX A;  4MPG A;  3PR8 A;  2BMX A;  3LYK A;  1TKD B;  4JED A;  3KZQ A;  2VLT A;  1M99 A;  4RUV A;  2YCD A;  1R7H A;  2D2Z A;  5A4W A;  5J40 A;  4K7N A;  5CAX A;  4ULX A;  3L9S A;  1WIK A;  1ERW A;  5J4V A;  1PX6 A;  1YVL A;  2FY6 A;  4WF4 A;  4MF6 A;  2GDR A;  1MTC A;  2O7K A;  2CAQ A;  4ZB9 A;  1FOH A;  3CRU A;  2OAD A;  2EFE A;  4ECJ A;  2E2G A;  1XWK A;  1GLQ A;  1MD3 A;  4D73 B;  1F37 A;  5ID2 A;  2VD0 A;  2AB6 A;  2HRK B;  4EVM A;  1QFN A;  20GS A;  2R5G A;  2XHF A;  2H1A A;  1SJZ A;  1TRV A;  1DE1 A;  1GLP A;  5IIZ A;  1R4W A;  2VL3 A;  1F3A A;  4NV5 A;  1SVO A;  4HUA A;  4K9Z A;  3TU3 B;  1X0R A;  5JCU A;  1NHO A;  2CVK A;  3F4S A;  1XVW A;  3GFK A;  3QAV A;  2HRF A;  5G1K A;  1MDJ A;  3TJJ A;  4GST A;  4MZW A;  3HYP A;  1OAZ A;  2IIY A;  5IQY A;  1RK4 A;  2GQK A;  2BJX A;  2B5E A;  4KW6 A;  2PER A;  2B5Y A;  2WS2 A;  4KDU A;  1Z5Y E;  2WFC A;  1SKW B;  2K6V A;  4FH8 A;  1XWA A;  4OD7 A;  4F82 A;  4XS4 A;  2FNO A;  2V6K A;  2WZ9 A;  5DCG A;  1GTI A;  4L5O A;  4XS1 A;  2G2Q A;  3D22 A;  1A2J A;  5D9T A;  5IO2 A;  2HLS A;  3F8U A;  2O85 A;  4MP4 A;  4Z7X A;  2OT3 A;  5J9B A;  3A5I A;  4JBB A;  2I9H A;  3GHA A;  2IMD A;  1ML6 A;  4Q5Q A;  4XIH A;  2FWH A;  2P5R A;  1TOF A;  3ZML A;  2YAN A;  3CBU A;  1K0D A;  4KCA A;  1KNG A;  4GQF A;  2B5X A;  1RQM A;  4TOP A;  2GTU A;  2H8L A;  1A0R P;  1EP7 A;  1WPI A;  2ZNM A;  1X5C A;  4QL7 A;  2XPD A;  3CXG A;  5D8I A;  1VF1 A;  1RW1 A;  2VKZ G;  2DLX A;  3FZ4 A;  2HSH A;  4RQX A;  4HQZ A;  5HFG A;  2CX3 A;  2EIR A;  2C3N A;  4EDY A;  1DSB A;  2H76 A;  5F8B A;  3MNG A;  18GS A;  1M2D A;  1M9A A;  4TR0 A;  3D6I A;  3CSI A;  1EEJ A;  3TRX A;  2IMK A;  4F03 A;  5J4U A;  4K6X A;  2R2J A;  4LL4 B;  3F6F A;  2TIR A;  2NDO A;  2AV4 A;  3HDC A;  1ZYE A;  3BCI A;  4JE1 A;  1TRS A;  5HFI A;  3V1W A;  3IC4 A;  2MMN A;  4AGS A;  1I5G A;  4IQA A;  2K8V A;  3TKS C;  4K2X A;  2VO4 A;  1YQ1 A;  5IMC A;  1YEP A;  3HD5 A;  3H93 A;  3G7I A;  2H1D A;  4I2T A;  3IA1 A;  4FXY P;  3BBY A;  2YZU A;  3ERW A;  2O3E A;  3M8N A;  3W8J A;  2WVX B;  1GTU A;  3CSH A;  5IMD A;  2R37 A;  3HKR A;  3A2V A;  3GKM A;  5BMU B;  2F3M A;  4YAV A;  1H4O A;  3IDV A;  3ZIJ A;  1THO A;  4Q5F A;  1QMV A;  4ZBB A;  1XPV A;  5HR3 A;  2RII A;  2V1M A;  5G2Z A;  5ECO B;  1N8J A;  3VLN A;  2JZR A;  2IFQ B;  5IOW A;  2HT9 A;  2PU9 C;  2YJH A;  3HMJ G;  2OE1 A;  3GUR A;  4GSS A;  1GSQ A;  2PN8 A;  5G1L A;  3KP8 A;  4ZL7 A;  3GN3 A;  1T4Y A;  1U87 A;  2G0F A;  1UN2 A;  2B3S A;  1PSQ A;  1EWX A;  3IK7 A;  2LNS A;  3GSS A;  2DIZ A;  2A4V A;  5ECR B;  2A4H A;  1R5P A;  3GV1 A;  4K5S A;  3EU3 A;  1B48 A;  5G31 A;  1DE2 A;  1SD8 A;  3EUR A;  4EKZ A;  1AIU A;  3TJK A;  1X9W B;  2WCI A;  2F8A A;  2H0G A;  5GSS A;  3O3T A;  4IJ3 A;  2H1B A;  3ZZX A;  5CO3 A;  1YKC A;  3MDK A;  2FWF A;  3MSZ A;  3N9J A;  5IMV A;  4TRX A;  2RUE A;  2GLR A;  3S9F A;  3ERG A;  3PGT A;  1EGR A;  4PQI A;  5J41 A;  4FQU A;  2QSI A;  5IM9 A;  2EC4 A;  17GS A;  5D9X A;  1S3R A;  1G7O A;  4KB3 A;  4JRR A;  2HZE B;  2K9F A;  1AUC A;  4XRD A;  5DBQ A;  1TXU A;  5ECM B;  2LKU A;  2O36 A;  3Q6O A;  2EFC A;  3HY2 A;  4MAB A;  1K0C A;  3D4M A;  22GS A;  2UV8 G;  3QR6 A;  4I5Q A;  4GDF A;  3ERF A;  2VL2 A;  3FY7 A;  4TR1 B;  3O76 A;  1OC8 A;  5DJL A;  2DBC A;  2DKI A;  2HFD A;  4YQV A;  4PGT A;  1A2M A;  1ZYP A;  4EL1 A;  2HYX A;  2GS3 A;  2HSM A;  1SKR B;  1GH2 A;  2VCX A;  1XIY A;  5A4U A;  4BL7 B;  2KP1 A;  2L5L A;  3DVX A;  2QA1 A;  3TRQ A;  1F3B A;  1J9B A;  1BQ7 A;  4HU9 A;  1HYU A;  6GSX A;  4OFT A;  3LSZ A;  2I1U A;  2B7K A;  2IJY A;  4KGI A;  4V1A p;  4KAE A;  3NIV A;  1S3A A;  4NPB A;  3ZVJ D;  1N25 A;  4AJ7 A;  4D73 A;  1O6J A;  2Z9S A;  2LV3 A;  2M46 A;  1XZO A;  1YF1 A;  2H71 A;  3UBL A;  2DJ0 A;  1TI3 A;  5B7C A;  1Y1U A;  3SWL A;  4DVC A;  4EO3 A;  2HRK A;  2L5O A;  5LD0 A;  4N11 A;  3C1S A;  2NTO A;  4KE3 A;  4RI7 A;  3Q74 A;  1V98 A;  1PMT A;  1K3Y A;  1GP1 A;  2LRN A;  1ERT A;  2GZP A;  1AW9 A;  3R3E A;  5GAN D;  5D96 A;  3UMA A;  3RHC A;  4ZB6 A;  2H6X A;  2LQQ A;  3LOR A;  3FK8 A;  4POK A;  5CRH A;  1EP8 A;  1WJK A;  3EU4 A;  1PL2 A;  2B7J A;  1EEM A;  2H72 A;  4GF0 A;  1O7U A;  1BF5 A;  1NHY A;  4LA1 A;  1S3D A;  5A34 B;  4X43 A;  1HD2 A;  3HVS A;  1U3I A;  3UAR A;  5IMZ A;  1A23 A;  5FWG A;  6GSY A;  4MJB A;  1C72 A;  4BVX A;  3F63 A;  3E9J B;  4LLR A;  3TRP A;  4DSS B;  1ZL9 A;  3VWW A;  3M0F A;  4FYC A;  4EIQ A;  1A24 A;  1XCC A;  4IVF A;  5ELA A;  2JAC A;  3CTF A;  4G01 A;  5A5H B;  2F51 A;  1K3O A;  5ECQ B;  3W8S A;  3EMX A;  8GSS A;  2MMZ A;  2YWI A;  1T1V A;  5F06 A;  2ON5 A;  3FEU A;  2JZS A;  1ZMA A;  2WDU A;  2VCW A;  1B9X C;  2VLV A;  1PN0 A;  3DXB A;  1OYJ A;  2C3Q A;  1H75 A;  2KP2 A;  1YEW C;  5DAL B;  4CDO A;  4J56 E;  1TU8 A;  3IK9 A;  4AI6 A;  2HRA A;  4KND A;  4V2L A;  4ZB7 A;  1TP9 A;  19GS A;  1V57 A;  1FB6 A;  2R3X A;  1YEX A;  3EMP A;  2HXK A;  5D9V A;  1BJX A;  2X8H A;  2PMT A;  4Z2U A;  3JCM L;  3EPT A;  5HFK A;  4KH7 A;  3RDW A;  1WOU A;  1SVL A;  5FHI A;  4MF5 A;  3ME7 A;  3IPZ A;  3OR5 A;  5G5E A;  2H74 A;  2VM2 A;  2FA4 A;  4E68 A;  4K0N A;  3IAS 2;  1JHB A;  3RPN A;  1W89 A;  3KTB A;  3EWL A;  4I2U A;  4CY6 A;  1J08 A;  3DML A;  2HE3 A;  3LGC A;  2O8V B;  2H1G A;  3FZA A;  1KTE A;  4GRF A;  4YKF A;  5GAP D;  4V2M A;  2JSZ A;  1PA3 A; 
#chains in the Genus database with same CATH homology
 1X5D A;  1EV4 A;  4P3Y B;  2BTO T;  2R0C A;  4MZC A;  2QA2 A;  1SJI A;  3TGZ A;  3PH9 A;  3C1R A;  4I8B A;  1MDI A;  3HVV A;  4Z2T A;  2OKA A;  2GSS A;  5ECL B;  2R0G A;  3KMO A;  14GS A;  3KIJ A;  4BVY A;  3TJF A;  4ICY A;  1U6T A;  5B6M A;  1X5E A;  5J3R A;  4G0I A;  3TOU A;  2WGR A;  2YOI A;  2IFQ A;  3H4K A;  3KH9 A;  3M1G A;  1ZYN A;  1U3A A;  5D93 A;  4RI6 A;  1FO5 A;  2OA7 A;  1XOA A;  3VFI A;  1K0M A;  3EIN A;  1SU9 A;  3ZL5 A;  2EIQ A;  2RLI A;  4POB A;  3L78 A;  4IHU A;  1FVJ A;  2PVO C;  4N0Z A;  3LXT A;  3WT1 A;  3GTU A;  3EYT A;  2ON7 A;  2H1L A;  3A2W A;  1ERV A;  5ECK B;  5D73 A;  4HZ2 A;  1ZGN A;  3RAZ A;  2HQT A;  3H1N A;  2ALB A;  3EVI A;  5C04 A;  1SVM A;  5A1N A;  3IBH A;  5DVB A;  1QXH A;  3GYK A;  4GCI A;  4BA7 A;  2LST A;  3QD9 A;  3RPP A;  3GST A;  5CRG A;  1AQX A;  4ML6 A;  4MK3 A;  5EPF A;  4K7O A;  5DAK B;  3CTG A;  4OFN A;  2XC2 A;  4KA0 A;  3WYW A;  4PUR A;  5KEJ A;  3DWV A;  1AQV A;  3VWV A;  4Q5N A;  2J9H A;  4MH2 A;  5JWQ B;  5A5K A;  2AJQ B;  3WGE A;  4IP6 A;  2H01 A;  2TRX A;  2HZF A;  2KUC A;  4PUF C;  1OE7 A;  3I69 A;  2NPB A;  3VI7 A;  3UVT A;  3U6V A;  4NAX A;  2FUG 2;  3FKF A;  3I9V 2;  1W4V A;  2AHE A;  2HSY A;  3HHV A;  4EF0 A;  4POL A;  5LCZ A;  2A2P A;  5H5Q A;  1VF2 A;  3FR3 A;  3L4N A;  2YP6 A;  1WWJ A;  3LG6 A;  2H30 A;  2HSN B;  2YV9 A;  5B6N A;  3ZIT A;  1XXU A;  2LEG A;  3MIX A;  2IPA A;  2FLS A;  2GZY A;  4HS1 A;  4BL7 A;  3QCP A;  3LXZ A;  3ZMK A;  1XFL A;  2VL2 C;  1PKZ A;  3AY8 A;  3PPU A;  2A2R A;  3Q19 A;  4DEJ A;  2V2G A;  4IP1 A;  5GZZ B;  3GL3 A;  1TXX A;  1FAA A;  1SJ6 A;  4IEL A;  1ERU A;  1TI1 A;  1GTA A;  1SK2 A;  2IWT A;  3CYN A;  1FB0 A;  1TW9 A;  1O8X A;  3C7M A;  3KEB A;  3QOU A;  4PUA A;  16GS A;  4POM A;  4ACS A;  3ZRD A;  1XVQ A;  2JSY A;  2MMO A;  4LMW A;  3KMN A;  4QMK A;  4IQ1 A;  3I43 A;  1PD2 1;  2LS5 A;  1GL8 A;  2UZ8 A;  4OMV A;  3G7Y A;  4EC0 A;  5ABR A;  4L5L A;  1XW5 A;  3FZ5 A;  3KJY A;  4X1U A;  3D21 A;  1WRY A;  1SL0 B;  3TKS E;  1CQH A;  2H73 A;  2YPM A;  4WBJ A;  4AF2 A;  2JZT A;  2HI7 A;  1SD9 A;  2RM5 A;  3LYP A;  4ZXG A;  2TRC P;  3M9J A;  2YZH A;  1O85 A;  1V9W A;  1Q98 A;  3C73 A;  2VCZ A;  4MF7 A;  1NW2 A;  2H19 A;  1FG4 A;  5A34 A;  1SL1 B;  3H79 A;  5IO0 A;  3QMX A;  5IMF A;  1WP0 A;  3SBC A;  1M9B A;  2H70 A;  2WRT A;  4GQC A;  3TUE A;  4DSS A;  2NBS A;  4H86 A;  4HQS A;  5DQY A;  3VK9 A;  1GNW A;  3D5J A;  3VWU A;  4HJ2 A;  1A8L A;  2LNT A;  1GTB A;  2H66 A;  1Z6M A;  5CRD A;  1TRU A;  5CRE A;  3TJG A;  4MLY A;  1GUM A;  5IPH A;  4MH3 A;  3ZYW A;  3KH7 A;  2PBJ A;  1T3B A;  4IKH A;  2OE0 A;  4XS4 B;  4L8E A;  5G30 A;  5H5R A;  5DJM A;  3LW9 A;  5KN1 A;  2DJ3 A;  1A8Y A;  2FWG A;  4ML1 A;  4MA9 A;  4YAP A;  2FGX A;  4RQR A;  3IRA A;  4OCF A;  1AXD A;  4J57 E;  3ZRE A;  5A4V A;  4TXO A;  5GST A;  1OKT A;  1TTZ A;  1F9M A;  1GSU A;  1Z6N A;  2CQ9 A;  2PUK C;  4K1F A;  4CW9 A;  5B8B A;  2R4V A;  4KX4 A;  5CNW A;  2IMF A;  1A0F A;  4PX1 A;  4G9H A;  3HCZ A;  1K0B A;  4WXT A;  1T4Z A;  2F9S A;  4EXJ A;  4HDE A;  1IYH A;  3L9U A;  2E2M A;  5KN0 A;  5JCW A;  1F6M C;  1Z9H A;  2KHP A;  1YKA A;  4NMU A;  1SYX A;  3GX8 A;  3QPM A;  2IN3 A;  2I3Y A;  4ILF A;  4OO5 A;  4F0B A;  2ZUP A;  1HNC A;  3N5O A;  3GKN A;  4DSR A;  2XBQ A;  4KSM A;  2CX4 A;  4IN0 A;  2J23 A;  4O7H A;  1LJR A;  3TKS A;  1GRX A;  4HOJ A;  1UVZ A;  4ZL8 A;  3Q18 A;  1FOV A;  5KOX A;  2GQM A;  1SK0 A;  4IW9 A;  4IS0 A;  1Q4J A;  3EE2 A;  2H6Z A;  4O5Q A;  5AIV A;  1E2Y A;  2P31 A;  3MWH A;  2V32 A;  4ZBA A;  2GQL A;  2GGT A;  2JL4 A;  1OC9 B;  5C00 A;  2P0G A;  4TKY A;  4WBR D;  3UJ1 A;  1CQG A;  5AN1 A;  3BOA A;  1YF0 A;  3GH6 A;  3KP9 A;  4NXI A;  3TDG A;  4XCS A;  4NHZ A;  1WE0 A;  4LL1 B;  4N3Z A;  2O5V A;  4PXO A;  1PGT A;  3GL5 A;  1M0U A;  4EE0 A;  2H0I A;  3CRT A;  5HQP A;  2M72 A;  1FW1 A;  2H6Y A;  5HR1 A;  4OFM A;  1FVK A;  4OCE A;  4PQH A;  2F8F A;  5KOW A;  3KD0 A;  3GIX A;  9GSS A;  4HJM A;  1R5A A;  1WMJ A;  5LNK e;  3LJR A;  2YNX A;  3CSJ A;  4FYB A;  4WKW A;  2R6K A;  2C1Y A;  3IV4 A;  3MYD A;  2E0Q A;  5J4Y A;  13GS A;  3G9B A;  1VRS D;  2CVD A;  3IHG A;  3TKR A;  2FD3 A;  4AKG A;  5EVO A;  2H0H A;  4DSQ A;  5CRW A;  1TDI A;  1T8E B;  1OVN A;  4MJE A;  5AIX A;  4WEY A;  3GH9 A;  4BWS A;  3IOS A;  11GS A;  1EZK A;  5DAK A;  4AJ8 A;  3QAW A;  3APO A;  4YQM A;  2ZCT A;  1OC3 A;  2KOK A;  2HRN A;  2C0G A;  1XWC A;  1GSD A;  3KXO A;  1G7E A;  1E6B A;  1B4P A;  1VF4 A;  4FO5 A;  6GSV A;  3P8W A;  2FWE A;  2OBK A;  3F3R A;  2C0F A;  7GSS A;  3P2A A;  5KN3 A;  1X9M B;  4MNN A;  3LEF A;  1AAZ A;  4A5P A;  2HSN A;  2FHE A;  1B9Y C;  1SL2 B;  3DEX A;  3GKX A;  4ECI A;  1TK5 B;  1GUH A;  2X99 A;  2R0P A;  2LQO A;  2YWO A;  4N30 A;  3ISO A;  10GS A;  1PL1 A;  2CAI A;  5J5N A;  4GSN A;  1V2A A;  3LQ7 A;  1YDK A;  2EIO A;  1GSE A;  4MDC A;  1GSY A;  3TB2 A;  3FR6 A;  3H8Q A;  1Y6E A;  4MCU A;  1DUG A;  2L4Q A;  2V6O A;  2O87 A;  4WR5 A;  1GUK A;  4V1A g;  1M2B A;  2O89 A;  2VUP A;  3U5R E;  2MMA A;  2M80 A;  4TR4 A;  3IC8 A;  2HSM B;  5CYY A;  4TW5 A;  3QFB C;  3DD3 A;  4KDX A;  4G0K A;  5F05 A;  1EV9 A;  1XWG A;  2YN1 A;  1GSF A;  1JZW A;  3UIW A;  2IL3 A;  2CZ3 A;  4AKI A;  2WJU A;  2CZ2 A;  5BMU A;  2L57 A;  2L4C A;  3FHK A;  4KDY A;  1X9S B;  4TN8 A;  1JLW A;  5ENU A;  3TJB A;  3WT2 A;  4NWY A;  4KF9 A;  1SEN A;  1QGV A;  4ZL9 A;  3VI5 A;  4L0W A;  3RBT A;  1EOG A;  3TKQ A;  1U88 A;  1ZZY A;  4K0G A;  4F9Z A;  2MZC A;  1K0A A;  2WUL A;  3LFL A;  4MZB A;  3DKS A;  4G2E A;  2AYT A;  2X64 A;  1VGL A;  3BD2 A;  4O32 A;  3CMI A;  3QDN A;  3BJ5 A;  3UEM A;  3W6G A;  6GSS A;  3F4T A;  4Q5R A;  2I4A A;  1PX7 A;  3F0I A;  3EC3 A;  5ECN B;  2X8G A;  1K3L A;  3UL3 A;  4N0V A;  4HZ4 A;  1BYE A;  4G0L A;  5JWR B;  2LUS A;  4O5R A;  5ELG A;  1NSW A;  2VD1 A;  4BVX B;  3KCM A;  1XBS A;  3HVX A;  4GXZ A;  4G10 A;  3NOF A;  1KEB A;  1I9D A;  2DJJ A;  3TKP A;  5KN2 A;  3ED3 A;  2HZE A;  3BCK A;  5INY A;  4X0X A;  4ECC A;  2C0E A;  4FYU A;  1BG1 A;  4QL9 A;  5E59 A;  4OWY A;  2GZZ A;  3DGQ A;  3WGD A;  3FZ9 A;  2CA8 A;  1BAY A;  4QQ7 A;  2MBS A;  1IYI A;  2KLX A;  3C71 A;  2WB9 A;  3WD6 A;  4GLT A;  4WET A;  4IGJ A;  2L59 A;  4TR1 A;  1JFU A;  3ME8 A;  2P5Q A;  1EGO A;  3F3Q A;  2DJK A;  2L6D A;  4ISD A;  2VCV A;  1XW9 A;  1O73 A;  2V41 A;  3QAG A;  1B8X A;  3IHQ A;  1ZOF A;  5IOX A;  2OBI A;  4Z2R A;  4PTS A;  1T7P B;  2PVQ A;  4MMM A;  4J2F A;  1UC7 A;  1USB A;  2DSA A;  2LRC A;  4KCE A;  4ECB A;  1MEK A;  4YH2 A;  4PQ1 A;  1Z7R A;  2N5F A;  2VAF A;  4O5U A;  3TOT A;  2DMM A;  5F07 A;  4K8M A;  3KTL A;  4TR3 A;  1TK8 B;  2OAC A;  4EIP A;  2GT5 A;  2FA8 A;  2I81 A;  1AC1 A;  1TK0 B;  1ABA A;  2X4A A;  1OC9 A;  4ZBD A;  1M2A A;  1QK8 A;  2JAD A;  2RM6 A;  3ZVJ A;  2GST A;  5IPG A;  1G0T A;  3A2X A;  3IXR A;  3ZFB A;  4K2D A;  1A2L A;  6GSW A;  5IMA A;  4L0U A;  4XRA A;  3LWA A;  1YJ6 A;  4NHW A;  4BPY A;  2FCH A;  5H5S A;  1UA5 A;  1JLV A;  2A2S A;  1HQO A;  4K5R A;  1XWB A;  4HU7 A;  1ZYQ B;  4XTS A;  4K7I A;  3E3E A;  3FYG A;  1YY7 A;  2VIM A;  2VM1 A;  2OE3 A;  1K0N A;  3ZTL A;  3VWX A;  4BVY B;  12GS A;  3HJP A;  3F4R A;  5CP1 A;  5ECI B;  1QUW A;  4ZIJ A;  5ID2 B;  2B6M A;  1GSS A;  3FR9 A;  2LJR A;  2PGT A;  3VPT A;  2C0D A;  3UVH A;  3A5W A;  1JZO A;  2GT6 A;  1MDK A;  3ZLP A;  2EFH A;  5COH A;  2EFD A;  2MBT A;  2RUF A;  4E8H A;  4ZIL A;  3HZ4 A;  4JR6 A;  2C80 A;  4HEA 2;  1J0F A;  4JU5 A;  3HJM A;  5A5H A;  3ZIV A;  3WGX A;  1SYR A;  1JZD A;  2YWM A;  4GTU A;  4KSO A;  1EOH A;  1HNA A;  3GTU B;  3GKK A;  3UBK A;  2VCT A;  3G7J A;  3HA9 A;  1GUL A;  1OE8 A;  5B8A A;  1FHE A;  2K8S A;  1N2A A;  4ZB8 A;  2H75 A;  3VPQ A;  4N10 A;  1B4Q A;  5A1N B;  5DAL A;  4IJI A;  2GSR A;  3L9V A;  3FRC A;  1XW6 A;  1GNE A;  1T00 A;  1XOB A;  3L0H A;  3O6T A;  2DIY A;  5JCG A;  2CV4 A;  4TVE A;  5JWO B;  2HNL A;  1PQN A;  3VUR A;  4ID0 A;  3KM6 A;  5EL8 A;  1PRX A;  1ACV A;  2LTK A;  4WR4 A;  5BRT A;  1ILO A;  2CVB A;  3J7Y b;  4NV2 A;  4AKH A;  1Z7P A;  1R26 A;  3E0U A;  1BG5 A;  5EY6 A;  3GMF A;  2LJA A;  3K8N A;  2VL9 A;  4YKG A;  1S3C A;  4W66 A;  4LMV A;  1O81 A;  2QKE A;  5FT3 A;  2NVL A;  3D4T A;  5L71 A;  4GWR A;  4AJ6 A;  2E7P A;  4MJA A;  1ZCP A;  5ECS A;  6GSU A;  1THX A;  1PKW A;  2DKH A;  2LJK A;  4EDZ A;  4E8E A;  4X4J A;  1O8W A;  3M3M A;  3P90 A;  5DCH A;  3FW2 A;  1MD4 A;  2IMI A;  1SKS B;  4I6X A;  2MYG A;  4CY8 A;  5ECP B;  3IAM 2;  1HNB A;  3HJO A;  3NZN A;  2PWJ A;  1VF3 A;  2CT6 A;  2VCQ A;  5DDL A;  1BED A;  3R2Q A;  5F0G A;  2X49 A;  4AKX B;  3US3 A;  4PNG A;  4F2I A;  4O92 A;  2C4J A;  2OJL A;  4FIW A;  3GA4 A;  4JR4 A;  3CWG A;  2C3T A;  4TXV A;  2VOC A;  1GWC A;  2IME A;  2YJ7 A;  3HXS A;  3DRN A;  1URM A;  1G6W A;  3GX0 A;  4I97 A;  3RHB A;  1F2E A;  1TU7 A;  1BX9 A;  2N5A A;  1PN9 A;  2DML A;  5AIS A;  4KUN A;  5HR0 A;  3UAP A;  3I6A A;  2B1K A;  2YV7 A;  3F6D A;  2AUV A;  2QC7 A;  5DQS A;  3DIE A;  4IBP A;  4YQU A;  5J47 A;  4PNF A;  3KGK A;  1NM3 A;  1ON4 A;  2REM A;  5G5F A;  4JZQ A;  5ECH B;  1ST9 A;  4HI7 A;  3F9U A;  3GNJ A;  1KBN A;  1QQ2 A;  2L6C A;  2DJ2 A;  4G19 A;  3A3T A;  3QFA C;  2VLU A;  5AGY A;  1M7T A;  2LRT A;  1TJD A;  5D9W A;  1V40 A;  5HR2 A;  4OO4 A;  3GUS A;  6GST A;  2GVP A;  1JZR A;  4WF5 A;  1K0O A;  3PIN A;  2C8U A;  1V58 A;  1AQW A;  5E4W A;  4V2N A;  3C8E A;  2DC5 A;  4USS A;  4EUY A;  2X8C A;  3IR4 A;  1Y25 A;  4MJC A;  4CHS A;  3DVW A;  3IE3 A;  2QGV A;  3M9K A;  3DYR A;  5J9C A;  3TCO A;  3UOM A;  1G6Y A;  2AAW A;  3MAK A;  4BWQ A;  1LU4 A;  2N5B A;  3HZ8 A;  2JU5 A;  1Z3E A;  4TXO B;  1SK1 A;  2YWN A;  3APS A;  2K18 A;  1LBK A;  4F0C A;  4MPF A;  2XBI A;  2ES7 A;  2XPE A;  2GSQ A;  3ZFL A;  3FMW A;  3APQ A;  3GRX A;  3P7X A;  3D0Z A;  3J7Y k;  4XS6 A;  1OKD A;  2PPT A;  2B1L A;  1TRW A;  2DJ1 A;  4XHM A;  1DBY A;  1YZX A;  4MPG A;  3PR8 A;  2BMX A;  3LYK A;  1TKD B;  4JED A;  3KZQ A;  2VLT A;  1M99 A;  4RUV A;  2YCD A;  1R7H A;  2D2Z A;  5A4W A;  5J40 A;  4K7N A;  5CAX A;  4ULX A;  3L9S A;  1WIK A;  1ERW A;  5J4V A;  1PX6 A;  1YVL A;  2FY6 A;  4WF4 A;  4MF6 A;  2GDR A;  1MTC A;  2O7K A;  2CAQ A;  4ZB9 A;  1FOH A;  3CRU A;  2OAD A;  2EFE A;  4ECJ A;  2E2G A;  1XWK A;  1GLQ A;  1MD3 A;  4D73 B;  1F37 A;  5ID2 A;  2VD0 A;  2AB6 A;  2HRK B;  4EVM A;  1QFN A;  20GS A;  2R5G A;  2XHF A;  2H1A A;  1SJZ A;  1TRV A;  1DE1 A;  1GLP A;  5IIZ A;  1R4W A;  2VL3 A;  1F3A A;  4NV5 A;  1SVO A;  4HUA A;  4K9Z A;  3TU3 B;  1X0R A;  5JCU A;  1NHO A;  2CVK A;  3F4S A;  1XVW A;  3GFK A;  3QAV A;  2HRF A;  5G1K A;  1MDJ A;  3TJJ A;  4GST A;  4MZW A;  3HYP A;  1OAZ A;  2IIY A;  5IQY A;  1RK4 A;  2GQK A;  2BJX A;  2B5E A;  4KW6 A;  2PER A;  2B5Y A;  2WS2 A;  4KDU A;  1Z5Y E;  2WFC A;  1SKW B;  2K6V A;  4FH8 A;  1XWA A;  4OD7 A;  4F82 A;  4XS4 A;  2FNO A;  2V6K A;  2WZ9 A;  5DCG A;  1GTI A;  4L5O A;  4XS1 A;  2G2Q A;  3D22 A;  1A2J A;  5D9T A;  5IO2 A;  2HLS A;  3F8U A;  2O85 A;  4MP4 A;  4Z7X A;  2OT3 A;  5J9B A;  3A5I A;  4JBB A;  2I9H A;  3GHA A;  2IMD A;  1ML6 A;  4Q5Q A;  4XIH A;  2FWH A;  2P5R A;  1TOF A;  3ZML A;  2YAN A;  3CBU A;  1K0D A;  4KCA A;  1KNG A;  4GQF A;  2B5X A;  1RQM A;  4TOP A;  2GTU A;  2H8L A;  1A0R P;  1EP7 A;  1WPI A;  2ZNM A;  1X5C A;  4QL7 A;  2XPD A;  3CXG A;  5D8I A;  1VF1 A;  1RW1 A;  2VKZ G;  2DLX A;  3FZ4 A;  2HSH A;  4RQX A;  4HQZ A;  5HFG A;  2CX3 A;  2EIR A;  2C3N A;  4EDY A;  1DSB A;  2H76 A;  5F8B A;  3MNG A;  18GS A;  1M2D A;  1M9A A;  4TR0 A;  3D6I A;  3CSI A;  1EEJ A;  3TRX A;  2IMK A;  4F03 A;  5J4U A;  4K6X A;  2R2J A;  4LL4 B;  3F6F A;  2TIR A;  2NDO A;  2AV4 A;  3HDC A;  1ZYE A;  3BCI A;  4JE1 A;  1TRS A;  5HFI A;  3V1W A;  3IC4 A;  2MMN A;  4AGS A;  1I5G A;  4IQA A;  2K8V A;  3TKS C;  4K2X A;  2VO4 A;  1YQ1 A;  5IMC A;  1YEP A;  3HD5 A;  3H93 A;  3G7I A;  2H1D A;  4I2T A;  3IA1 A;  3BBY A;  2YZU A;  3ERW A;  3M8N A;  3W8J A;  1GTU A;  3CSH A;  5IMD A;  2R37 A;  3HKR A;  3A2V A;  3GKM A;  5BMU B;  2F3M A;  4YAV A;  1H4O A;  3IDV A;  3ZIJ A;  1THO A;  4Q5F A;  1QMV A;  4ZBB A;  1XPV A;  5HR3 A;  2RII A;  2V1M A;  5G2Z A;  5ECO B;  1N8J A;  3VLN A;  2JZR A;  2IFQ B;  5IOW A;  2HT9 A;  2PU9 C;  2YJH A;  3HMJ G;  2OE1 A;  3GUR A;  4GSS A;  1GSQ A;  2PN8 A;  5G1L A;  3KP8 A;  4ZL7 A;  3GN3 A;  1T4Y A;  1U87 A;  2G0F A;  1UN2 A;  2B3S A;  1PSQ A;  1EWX A;  3IK7 A;  2LNS A;  3GSS A;  2DIZ A;  2A4V A;  5ECR B;  2A4H A;  1R5P A;  3GV1 A;  4K5S A;  3EU3 A;  1B48 A;  5G31 A;  1DE2 A;  1SD8 A;  3EUR A;  4EKZ A;  1AIU A;  3TJK A;  1X9W B;  2WCI A;  2F8A A;  2H0G A;  5GSS A;  3O3T A;  4IJ3 A;  2H1B A;  3ZZX A;  5CO3 A;  1YKC A;  3MSZ A;  3MDK A;  2FWF A;  3N9J A;  5IMV A;  4TRX A;  2RUE A;  2GLR A;  3S9F A;  3ERG A;  3PGT A;  1EGR A;  4PQI A;  5J41 A;  4FQU A;  2QSI A;  5IM9 A;  2EC4 A;  17GS A;  5D9X A;  1G7O A;  4KB3 A;  4JRR A;  2HZE B;  2K9F A;  1AUC A;  4XRD A;  5DBQ A;  1TXU A;  5ECM B;  2LKU A;  3Q6O A;  2EFC A;  3HY2 A;  4MAB A;  1K0C A;  3D4M A;  22GS A;  2UV8 G;  3QR6 A;  4I5Q A;  4GDF A;  3ERF A;  2VL2 A;  3FY7 A;  4TR1 B;  3O76 A;  1OC8 A;  5DJL A;  2DBC A;  2DKI A;  2HFD A;  4YQV A;  4PGT A;  1A2M A;  1ZYP A;  4EL1 A;  2HYX A;  2GS3 A;  2HSM A;  1SKR B;  1GH2 A;  2VCX A;  1XIY A;  5A4U A;  4BL7 B;  2KP1 A;  2L5L A;  3DVX A;  2QA1 A;  3TRQ A;  1F3B A;  1J9B A;  1BQ7 A;  4HU9 A;  1HYU A;  6GSX A;  4OFT A;  3LSZ A;  2I1U A;  2B7K A;  2IJY A;  4KGI A;  4V1A p;  4KAE A;  3NIV A;  1S3A A;  4NPB A;  3ZVJ D;  1N25 A;  4AJ7 A;  4D73 A;  1O6J A;  2Z9S A;  2LV3 A;  2M46 A;  1XZO A;  1YF1 A;  2H71 A;  3UBL A;  2DJ0 A;  1TI3 A;  5B7C A;  1Y1U A;  3SWL A;  4DVC A;  4EO3 A;  2HRK A;  2L5O A;  5LD0 A;  4N11 A;  3C1S A;  2NTO A;  4KE3 A;  4RI7 A;  3Q74 A;  1V98 A;  1PMT A;  1K3Y A;  1GP1 A;  2LRN A;  1ERT A;  2GZP A;  1AW9 A;  3R3E A;  5GAN D;  5D96 A;  3UMA A;  3RHC A;  4ZB6 A;  2H6X A;  2LQQ A;  3LOR A;  3FK8 A;  4POK A;  5CRH A;  1EP8 A;  1WJK A;  3EU4 A;  1PL2 A;  2B7J A;  1EEM A;  2H72 A;  4GF0 A;  1O7U A;  1BF5 A;  1NHY A;  4LA1 A;  1S3D A;  5A34 B;  4X43 A;  1HD2 A;  3HVS A;  1U3I A;  3UAR A;  5IMZ A;  1A23 A;  5FWG A;  6GSY A;  4MJB A;  1C72 A;  4BVX A;  3F63 A;  3E9J B;  4LLR A;  3TRP A;  4DSS B;  1ZL9 A;  3VWW A;  3M0F A;  4FYC A;  4EIQ A;  1A24 A;  1XCC A;  4IVF A;  5ELA A;  2JAC A;  3CTF A;  4G01 A;  5A5H B;  2F51 A;  1K3O A;  5ECQ B;  3W8S A;  3EMX A;  8GSS A;  2MMZ A;  2YWI A;  1T1V A;  5F06 A;  2ON5 A;  3FEU A;  2JZS A;  1ZMA A;  2WDU A;  2VCW A;  1B9X C;  2VLV A;  1PN0 A;  3DXB A;  1OYJ A;  2C3Q A;  1H75 A;  2KP2 A;  5DAL B;  4CDO A;  4J56 E;  1TU8 A;  3IK9 A;  4AI6 A;  2HRA A;  4KND A;  4V2L A;  4ZB7 A;  1TP9 A;  19GS A;  1V57 A;  1FB6 A;  2R3X A;  1YEX A;  3EMP A;  2HXK A;  5D9V A;  1BJX A;  2X8H A;  2PMT A;  4Z2U A;  3JCM L;  3EPT A;  5HFK A;  4KH7 A;  3RDW A;  1WOU A;  1SVL A;  5FHI A;  4MF5 A;  3ME7 A;  3IPZ A;  3OR5 A;  5G5E A;  2H74 A;  2VM2 A;  2FA4 A;  4E68 A;  4K0N A;  3IAS 2;  1JHB A;  3RPN A;  1W89 A;  3KTB A;  3EWL A;  4I2U A;  4CY6 A;  1J08 A;  3DML A;  2HE3 A;  3LGC A;  2O8V B;  2H1G A;  3FZA A;  1KTE A;  4GRF A;  4YKF A;  5GAP D;  4V2M A;  2JSZ A;  1PA3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...