3IK9A

Human gst a1-1-gimf with gsdhn
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
219
structure length
219
Chain Sequence
AEKPKLHYFNGRGRMESTRWLLAAAGVEFEEKFIKSAEDLDKLRNDGYLMFQQVPMVEIDGMKLVQTRAILNYIASKYNLYGKDIKERALIDMYIEGIADLGEMIIMLPFCPPEEKDAKLALIKEKIKNRYFPAFEKVLKSHGQDYLVGNKLSRADIHLVELLYYVEELDSSLISSFPLLKALKTRISNLPTVKKFLQPGSPRKPPPDEIYVRTVYNIF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Glutathione S-transferase A1
publication title Substrate specificity combined with stereopromiscuity in glutathione transferase A4-4-dependent metabolism of 4-hydroxynonenal.
pubmed doi rcsb
source organism Homo sapiens
total genus 80
structure length 219
sequence length 219
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2009-08-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00043 GST_C Glutathione S-transferase, C-terminal domain
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 3ik9A02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3ik9A01
1WMJA 3GA4A 5EY6A 4Q5QA 3ZYWA 1VF2A 2DJKA 3WT1A 4F0BA 1Z6NA 3GFKA 1Z7PA 1OKTA 3NOFA 3W8JA 3FR6A 2JADA 2GDRA 1B4PA 1PKZA 2H74A 2PUKC 2H01A 2H76A 2TRCP 2X64A 3GL3A 4OCEA 5IMAA 3HVVA 3EINA 3M8NA 1LBKA 2YZUA 2JACA 5B6MA 2HYXA 2H0IA 1X0RA 1ILOA 5ECLB 4XTSA 2H1GA 4HJ2A 4IGJA 3KTLA 2G2QA 3TRQA 1AQXA 2D2ZA 3K8NA 2VCVA 5LD0A 1THOA 4D73A 5FWGA 4HZ4A 3FKFA 4GSSA 2VCWA 4BVYB 2VO4A 4GXZA 5ECOB 4YQMA 4YQVA 3CXGA 4G0KA 4EDZA 1NHOA 4MF7A 2AJQB 1R5PA 4RI6A 2WCIA 4QL9A 5FT3A 1AQWA 3H79A 1WP0A 5ENUA 1YKAA 4HEA2 3CSHA 2H70A 2A2SA 5KEJA 2YV9A 4ZBBA 5HR0A 4F03A 5D9XA 1K0DA 6GSSA 4E8EA 4K6XA 5DJMA 3DWVA 4ZB8A 5B8AA 2VL2A 2VAFA 4IP6A 1K0NA 2WULA 3IDVA 3CTFA 1ZL9A 4OMVA 5IOWA 2LNSA 5JCUA 3Q18A 4FYUA 1XW9A 3VK9A 2H6YA 4KAEA 1PN9A 1FO5A 4FQUA 1HQOA 1DE2A 5AIXA 1TI3A 3RHBA 1LJRA 4V1Ap 1ERUA 3DD3A 2IMEA 3QPMA 3KJYA 3IBHA 2DJ3A 3ISOA 2HSYA 2N5AA 3IRAA 4X43A 6GSYA 3TJFA 3LFLA 2FNOA 3KIJA 5HQPA 2OA7A 2CA8A 3C1RA 5JCGA 5L71A 4ILFA 1B48A 4TXOB 3ME8A 2HQTA 1HD2A 1GTBA 5CRWA 1WE0A 1SKSB 1ML6A 2QC7A 2R5GA 3F0IA 3HZ8A 3HDCA 1G7EA 1XFLA 4NXIA 5B8BA 4J2FA 1K0OA 1SD9A 1NHYA 2YJHA 5LNKe 2ON7A 4ZL7A 1E6BA 4ZBAA 1GSEA 4PURA 6GSTA 1A24A 1FAAA 3KEBA 2LKUA 1UVZA 3UARA 3C73A 4MJBA 3DYRA 5A4UA 2VL2C 4Q5NA 2F3MA 4IJ3A 1EEMA 1KTEA 1V9WA 4KH7A 2NDOA 4BPYA 2C8UA 3EURA 2QSIA 3ZZXA 3IAS2 3IK7A 1M2AA 1O7UA 4HUAA 2YV7A 2HRAA 5G5FA 3BJ5A 3W6GA 4MF6A 2HE3A 2BTOT 4MH2A 5D8IA 3IV4A 1TTZA 1AW9A 1H4OA 5CREA 3C71A 1B9XC 2IPAA 1A8YA 2HNLA 1O85A 2PN8A 3HYPA 4ECCA 1O81A 4ECJA 4KF9A 3TCOA 3TKQA 2B3SA 1FVKA 4MF5A 4IW9A 4O32A 3ZRDA 1X5EA 4HOJA 3ZVJA 3UIWA 4F2IA 2LQQA 20GSA 1E2YA 5G30A 1XWGA 5IMZA 3M9KA 1DUGA 2EIRA 2LRNA 2P5RA 3LGCA 2WDUA 2H72A 2CVDA 2R4VA 2FLSA 2YN1A 1QQ2A 2EIOA 1XW5A 2IMFA 4MPFA 3CBUA 1GP1A 1QGVA 4IVFA 1OE7A 4G9HA 3BCIA 4OCFA 2C80A 5IPGA 1RQMA 4ML6A 5ID2B 4WKWA 5F0GA 1X5DA 3KMNA 4KCEA 1W4VA 1GTAA 1J08A 4JRRA 4PGTA 4HDEA 3RPPA 2N5FA 4K2DA 4G10A 2PGTA 4POMA 2NTOA 1YKCA 3GKNA 3IA1A 1TK8B 3ZREA 3CRTA 4WF4A 3ERGA 4G0LA 2C0FA 4MDCA 1PRXA 5F06A 3KGKA 2JZSA 3H4KA 2V6OA 2YP6A 1DBYA 3U5RE 1TW9A 3VFIA 3UL3A 4HQSA 2DIZA 3D4TA 4DSRA 4LMWA 4ECBA 1USBA 3H8QA 4MJEA 1M9BA 1EEJA 2F8AA 3EVIA 5IPHA 1A0FA 1F3AA 1YEPA 4I5QA 2H71A 1QUWA 4RQXA 2A2RA 1GSYA 5ECKB 1WJKA 1PKWA 4TKYA 1ERVA 3O6TA 1PX6A 4CW9A 3GTUB 3IR4A 2C3NA 3ZMKA 1U87A 3TOTA 4EO3A 4DSSA 1THXA 2VLVA 2R3XA 3G7YA 3TRPA 1BQ7A 2UZ8A 4GF0A 1EZKA 4PUFC 5CP1A 1XWCA 1TP9A 3IAM2 2IWTA 5DVBA 5F8BA 4G0IA 4EVMA 1I9DA 2HXKA 4BVXB 5DCHA 1A23A 3KH9A 3KCMA 4KUNA 2CVBA 4AGSA 1LU4A 1O73A 5AIVA 3R2QA 2YWOA 2VOCA 5HFKA 4K0NA 2VUPA 4WR4A 1SK0A 2E2MA 3N9JA 3HZ4A 2L6DA 2I3YA 3ZLPA 1JZWA 1BG5A 3QR6A 3GSSA 1W89A 3FZ4A 1FW1A 1I5GA 4N0ZA 4PQHA 3FEUA 1QK8A 4NWYA 1G0TA 4ULXA 4EXJA 2RLIA 2GSRA 5KN2A 4H86A 2WFCA 3QCPA 2KHPA 1WIKA 5DJLA 4NHWA 5E4WA 3FK8A 4KCAA 4WR5A 1JLWA 2GSQA 4K0GA 1GUKA 3MNGA 3DVWA 4LL4B 1A2MA 1PSQA 3APQA 4IHUA 3GKKA 2DSAA 2N5BA 3A3TA 3GMFA 2HT9A 1NW2A 3HVSA 2B5EA 4GWRA 1FHEA 1ZOFA 4PXOA 3F6DA 1WPIA 2GQKA 4I97A 4TR3A 5D9VA 1OC9B 3QAVA 5EL8A 2HRKA 7GSSA 2CAIA 3R3EA 3M9JA 4TRXA 5DAKA 4NMUA 1K0CA 2LJKA 14GSA 3F3QA 2B1KA 2VIMA 3RBTA 4JE1A 5ECPB 3HY2A 2L59A 3GN3A 2KP2A 2KP1A 1GL8A 5IMVA 3LQ7A 1K0MA 4JEDA 2VLUA 3TUEA 4DSQA 4IQAA 1SJZA 5EVOA 3NIVA 4FYCA 1HNCA 1GH2A 2OE1A 4KW6A 4O5RA 3TB2A 2MMNA 4GTUA 1XXUA 4L0UA 1QFNA 2HSHA 3EMXA 5J41A 1B9YC 1XWAA 3GUSA 5ECNB 3CRUA 4XCSA 5CRHA 5G2ZA 1PQNA 4QL7A 1UN2A 4HU7A 3HKRA 2PU9C 2RUEA 4MH3A 3UEMA 2L6CA 4ZB9A 2B6MA 2JSZA 4BVYA 2RUFA 2M46A 5CAXA 4E8HA 1M99A 1ZYQB 3EU4A 4IJIA 2EIQA 3LORA 4TR1A 1GULA 4D73B 1GTUA 2E7PA 5IIZA 2HSMB 3HA9A 1OC3A 1M9AA 2VCZA 1BYEA 2WJUA 3VURA 4BL7B 2EC4A 2R37A 2IMDA 2AHEA 1V98A 1BEDA 2LNTA 4EF0A 2YWNA 2JL4A 4AJ8A 1GSFA 3L0HA 2L5LA 2K8SA 4EE0A 3TKSC 16GSA 5CRGA 3QOUA 3A2WA 3BBYA 3LWAA 2VM1A 4XS4A 2C3QA 2BJXA 2REMA 3PINA 2P31A 3GX8A 2NPBA 3IHQA 1TJDA 1G7OA 2FA4A 3Q74A 2ES7A 1EV9A 1PD21 1F6MC 5ECSA 2GT5A 4YAPA 1T3BA 1XPVA 3TRXA 4F82A 2DC5A 2XC2A 2CX4A 2LJAA 1GRXA 3HJPA 4ISDA 4K1FA 4I8BA 1PL2A 1FG4A 3PPUA 1FVJA 3SWLA 2MMZA 1AIUA 5J5NA 2WRTA 5IM9A 4LMVA 1XVWA 1IYHA 1Z3EA 2B7JA 2JSYA 3PGTA 5C04A 5DALA 3O3TA 4PNGA 4EKZA 2LQOA 1HNBA 1TDIA 4IQ1A 2GTUA 1YF0A 2GGTA 5B7CA 3TJGA 1GTIA 3RAZA 3BD2A 9GSSA 1FOVA 2A4VA 5KN3A 4OD7A 1YQ1A 4TVEA 3ZIJA 3GSTA 2YNXA 3TOUA 1F9MA 1URMA 3ME7A 3H1NA 4KE3A 2DIYA 2NBSA 4WXTA 4AJ6A 4L5LA 5DCGA 1X9MB 1JZRA 4MJCA 5A4WA 5DDLA 1M2DA 3MSZA 4PQIA 2LSTA 5ECIB 4MA9A 5IO2A 2L57A 5IO0A 5IMDA 5CO3A 1X5CA 5CNWA 1EWXA 1VRSD 1TU7A 1G6WA 3TDGA 2PBJA 1TRSA 4K7NA 2H19A 1DE1A 2ZCTA 4V2LA 1GSUA 2IL3A 1HYUA 3VI7A 3DIEA 4HQZA 1VGLA 1WOUA 2I81A 2GSSA 5KN0A 2K8VA 3US3A 3E3EA 4OO4A 3G9BA 1MD3A 2V6KA 4MABA 3ZFLA 2VCTA 1Z6MA 3VWUA 2O87A 2FA8A 5AN1A 5D93A 3D21A 3DVXA 1Q98A 2DJ0A 4G2EA 4XHMA 3G7JA 3CTGA 3H93A 3ZVJD 4BWSA 2L5OA 1GLPA 4KSMA 5ELGA 1Y6EA 4ZILA 3Q6OA 2VCXA 3PH9A 4YQUA 3GX0A 1TK0B 5J3RA 2LUSA 4N0VA 5HFIA 2R6KA 2C0EA 2HLSA 2AV4A 2DBCA 2HZEA 3ED3A 5IQYA 2LRCA 3QAWA 3DMLA 5GAND 3VWXA 4GQFA 4IBPA 2P5QA 1ZGNA 3WT2A 2YOIA 1TRUA 4LA1A 3SBCA 4PNFA 1T4YA 2WGRA 1MDKA 4N11A 1XOBA 4MMMA 3J7Yb 2GQLA 3N5OA 4DVCA 1F37A 2C0GA 2VL9A 3IK9A 4KDYA 4I2TA 4PQ1A 4TXVA 5DQSA 1GLQA 4KA0A 2RIIA 3GNJA 3VPQA 3CMIA 2IFQA 2O89A 5HR1A 3KH7A 3A2VA 1RK4A 1OE8A 1XCCA 2CQ9A 2H30A 3D0ZA 1AUCA 3L9VA 2H0HA 4AJ7A 3F3RA 3GURA 3UVHA 1S3DA 1FB6A 2CT6A 3RHCA 3RDWA 5G31A 4TOPA 2C4JA 1M0UA 2KLXA 5A5KA 3F4TA 3LXZA 1VF3A 2YWMA 4MPGA 4NV2A 4MP4A 4PX1A 2CVKA 1Z7RA 2DMLA 2VL3A 3A2XA 4MK3A 4JBBA 3GV1A 1MDJA 1H75A 4X1UA 4K7OA 5H5QA 3P90A 3UJ1A 3V1WA 5C00A 3OR5A 1ERWA 1WWJA 3HJOA 4KSOA 1N8JA 2OADA 4Q5FA 4HJMA 3ZL5A 3UOMA 4POBA 4V2NA 1XWKA 4ZBDA 1PX7A 3KD0A 3HCZA 3WYWA 3EYTA 3F4RA 1NSWA 1A8LA 2H6XA 2PWJA 4O7HA 1TXXA 2OE0A 3ZITA 5D96A 1O6JA 1PMTA 2VM2A 2ON5A 3GH6A 3FR9A 8GSSA 4V1Ag 4CHSA 3EMPA 1RW1A 6GSVA 1XWBA 3F8UA 3VI5A 3F4SA 5AISA 5J4UA 3DXBA 5DBQA 1SU9A 2XPEA 3I6AA 2X8CA 4OFTA 1V58A 4ZIJA 3KP9A 2IJYA 1SENA 1ST9A 4GRFA 2LTKA 4LL1B 3LXTA 4Q5RA 2XPDA 5INYA 1M2BA 4MZBA 1XBSA 1CQHA 4FYBA 4GSNA 4P3YB 2O8VB 1VF4A 1YDKA 2OBKA 4NHZA 1OC8A 5LCZA 3LEFA 2DJ1A 3GYKA 4JR4A 4QQ7A 4OFMA 1SJ6A 1Z5YE 2OACA 1KEBA 1JZOA 2FWEA 2H1AA 3UMAA 4ML1A 4ECIA 5ECRB 1U88A 1XZOA 1AC1A 3LYKA 4JZQA 13GSA 1TI1A 3WGEA 2K6VA 3D6IA 2H75A 5F05A 1GNWA 1Z9HA 3C8EA 2V41A 4ZB6A 1CQGA 2KUCA 1O8XA 2HRNA 2AB6A 17GSA 2YZHA 1JZDA 3CSJA 3TKSE 4NPBA 2GZYA 1PL1A 5H5SA 4FO5A 5JCWA 3ERFA 1U3AA 3GH9A 3M3MA 3F63A 4TN8A 4KGIA 5ECHB 3UVTA 3HVXA 1OC9A 4GCIA 4IP1A 1SKWB 4V2MA 2HFDA 1U6TA 2LV3A 3JCML 3UBKA 3QFBC 3CSIA 5G5EA 3IC4A 4ZL9A 1ZYEA 3E0UA 4RUVA 3TKSA 3D4MA 3LSZA 3LG6A 4KNDA 12GSA 2HRKB 2C0DA 3EE2A 3QDNA 2M72A 2MMAA 5J9CA 2GLRA 5DAKB 3S9FA 2I9HA 4YAVA 1V57A 1WRYA 5JWQB 5IMCA 1V40A 4KX4A 4ACSA 3HHVA 2PVQA 3IXRA 2PERA 3KZQA 2K18A 3L9UA 1SL0B 1B8XA 1JFUA 2TIRA 3L78A 4PUAA 3GKXA 4FH8A 3F9UA 2FWFA 2GQMA 3RPNA 3P2AA 4FIWA 3A5WA 3TKRA 2DLXA 1T1VA 2WS2A 2E2GA 2O85A 3TJKA 2OJLA 3TKPA 2J23A 3DRNA 2FY6A 1YZXA 1UA5A 3QFAC 3MAKA 2HSMA 5AGYA 4BA7A 2OKAA 4JU5A 4TR1B 1R26A 4BL7A 3KMOA 2JZTA 2MYGA 3DEXA 4XRAA 3DKSA 1SJIA 2CX3A 4TR4A 4CDOA 1IYIA 1K0BA 1GWCA 4MJAA 3I69A 1K3OA 3QAGA 2MMOA 1GUMA 1AAZA 2IIYA 2XBQA 1B4QA 2F8FA 1TRVA 2IMKA 2FWGA 1S3AA 2YPMA 1JHBA 1N2AA 5ECQB 5GSSA 4G19A 3L9SA 3WD6A 1ZMAA 3LYPA 2FHEA 3P7XA 4HZ2A 1ZCPA 4K7IA 1SKRB 1F2EA 1A0RP 1A2LA 1QMVA 1F3BA 2F51A 2YJ7A 1J0FA 4XS4B 3IE3A 3U6VA 1ON4A 1Y25A 1K3LA 3DGQA 4POKA 1KBNA 3I43A 1GSDA 3I9V2 1JLVA 4LLRA 1PA3A 4EUYA 1MD4A 10GSA 3GL5A 4I6XA 4HS1A 4KB3A 3TJBA 1QXHA 4BWQA 2H1BA 3UAPA 4GQCA 4XS6A 4X0XA 2ZNMA 4TXOA 2HI7A 1TKDB 1O8WA 2H73A 3M0FA 2K9FA 3EC3A 2G0FA 3FHKA 1K0AA 1G6YA 4ZL8A 5DALB 3W8SA 4TW5A 2RM5A 1T8EB 2OBIA 5A4VA 1HNAA 4IELA 2M80A 2Z9SA 3NZNA 2GS3A 2QKEA 4OO5A 3WGDA 1J9BA 2H8LA 4USSA 5COHA 2F9SA 3VPTA 2VD0A 2XHFA 1XVQA 2WB9A 3GHAA 4I2UA 4DEJA 2B5XA 4WBJA 4WF5A 1XOAA 2CV4A 1AXDA 2O7KA 1S3CA 3FY7A 3EWLA 1R5AA 1YEXA 4HI7A 3IPZA 3ZTLA 3J7Yk 2B7KA 2VCQA 3KP8A 22GSA 4EL1A 2JZRA 2I1UA 4GSTA 3APSA 2J9HA 2HRFA 3O76A 1EGOA 4ID0A 5IMFA 2CZ2A 3L4NA 3P8WA 4XS1A 3KTBA 3GIXA 1OYJA 5EPFA 5GZZB 6GSWA 2YCDA 2QGVA 2H0GA 4K8MA 4MLYA 2AAWA 4EDYA 3BCKA 1T7PB 5ECMB 1A2JA 4Z7XA 2NVLA 1EP8A 2B1LA 1X9WB 4K9ZA 5ELAA 2HZEB 6GSXA 4WETA 4L0WA 2C1YA 2FWHA 4J57E 2GZZA 2BMXA 3VWWA 2OE3A 4AF2A 3FZAA 5FHIA 1AQVA 1OAZA 4XRDA 1TRWA 1TU8A 1ACVA 5IOXA 4IN0A 2XBIA 4YH2A 4RI7A 3ZMLA 2IN3A 2YANA 5DQYA 5BMUA 2I4AA 1T00A 4F9ZA 1ABAA 3MWHA 2MBTA 4N30A 4L8EA 5ID2A 1PGTA 2HSNB 1ZZYA 5ABRA 2IFQB 2TRXA 2ZUPA 1KNGA 2ALBA 4OFNA 2L4QA 2JU5A 1SYRA 3WGXA 5D9WA 5G1KA 3ZIVA 1YF1A 1MEKA 2DMMA 4N10A 4MCUA 3TGZA 2H66A 2CZ3A 5H5RA 3TJJA 2LRTA 3KM6A 1XW6A 2AYTA 6GSUA 1M7TA 1GSSA 5GAPD 19GSA 3PR8A 1YJ6A 3KXOA 5GSTA 3C1SA 1SL2B 4F0CA 5HR3A 4TR0A 5G1LA 1NM3A 1U3IA 2X8GA 3HD5A 4NAXA 3EU3A 5D9TA 2IMIA 1X9SB 3FZ9A 1BX9A 1SK1A 1EOHA 2VLTA 1SYXA 5HFGA 4ZXGA 3D22A 4RQRA 5J9BA 5D73A 1SD8A 1UC7A 2H1DA 2WZ9A 2MZCA 2YWIA 2PPTA 5CYYA 3CYNA 2MBSA 2AUVA 5CRDA 3GTUA 5JWRB 1FB0A 1K3YA 2X99A 3Q19A 1V2AA 2CAQA 3MDKA 3GRXA 2P0GA 1EOGA 1EV4A 4PTSA 3VLNA 3IOSA 5JWOB 2LJRA 1T4ZA 2V2GA 2H6ZA 4HU9A 2R2JA 4WBRD 5B6NA 2GSTA 1MDIA 2LEGA 3D5JA 4DSSB 3ERWA 4BVXA 3APOA 5F07A 1OVNA 4JR6A 1OKDA 1MTCA 2X8HA 4IS0A 2HZFA 3BOAA 4KDXA 3LJRA 2FD3A 2RM6A 2FGXA 3C7MA 1SK2A 4NV5A 1ERTA 3FZ5A 11GSA 4MZCA 3GKMA 2VD1A 3IC8A 1YY7A 1R7HA 4IKHA 4EC0A 2DJ2A 3F6FA 2V1MA 4J56E 3VWVA 3G7IA 4KDUA 2V32A 3FW2A 3AY8A 3M1GA 4XIHA 3HXSA 5HR2A 2C3TA 3FYGA 1BJXA 3QD9A 1XIYA 3QMXA 1SL1B 2PVOC 1GUHA 2B5YA 1EGRA 2E0QA 1TOFA 4GLTA 4O92A 3HJMA 5E59A 1DSBA 4OWYA 2GZPA 4L5OA 3E9JB 18GSA 2GT6A 1GNEA 1TK5B 1VF1A 2KOKA 1Q4JA 1BAYA 3UBLA 3ZFBA 3FR3A 5KN1A 1C72A 2GVPA 2DJJA 4WEYA 2L4CA 2PMTA 4POLA 4MZWA 2FCHA 2LS5A 3FRCA 1R4WA 1EP7A 1GSQA 2FUG2
chains in the Genus database with same CATH superfamily
1WMJA 3GA4A 5EY6A 4Q5QA 3ZYWA 1VF2A 2DJKA 1ZYNA 3WT1A 4F0BA 1Z6NA 3GFKA 1Z7PA 1OKTA 3NOFA 3W8JA 3FR6A 2JADA 2GDRA 1B4PA 1PKZA 2H74A 2PUKC 2H01A 2H76A 2TRCP 2X64A 3GL3A 4OCEA 5IMAA 3HVVA 3EINA 3M8NA 1LBKA 2YZUA 2JACA 5B6MA 4AI6A 2HYXA 2H0IA 1X0RA 1ILOA 4G01A 5ECLB 4XTSA 2H1GA 4HJ2A 4IGJA 1S3RA 3KTLA 2G2QA 3TRQA 1AQXA 2D2ZA 3K8NA 2VCVA 5LD0A 1THOA 4D73A 5FWGA 4HZ4A 3FKFA 4GSSA 2VCWA 4BVYB 2VO4A 3CWGA 4GXZA 5ECOB 4YQMA 4YQVA 3HVNA 3CXGA 4G0KA 4EDZA 1NHOA 4MF7A 2AJQB 1R5PA 4RI6A 2WCIA 4QL9A 4AKIA 5FT3A 1AQWA 3H79A 4K5SA 1WP0A 5ENUA 1YKAA 2EFCA 4HEA2 3CSHA 2H70A 2A2SA 5KEJA 2YV9A 4ZBBA 5HR0A 4F03A 5D9XA 1YEWC 1K0DA 6GSSA 2R0PA 4E8EA 4K6XA 5DJMA 3DWVA 4ZB8A 5B8AA 2VL2A 2VAFA 4IP6A 1K0NA 2WULA 3LW9A 3IDVA 3CTFA 1ZL9A 4OMVA 5IOWA 2LNSA 5JCUA 3Q18A 4FYUA 1XW9A 3VK9A 2H6YA 4KAEA 1PN9A 1FO5A 4FQUA 1HQOA 1DE2A 5AIXA 1TI3A 3RHBA 1LJRA 4V1Ap 1ERUA 3DD3A 2IMEA 3QPMA 3KJYA 3IBHA 2DJ3A 3ISOA 2HSYA 2N5AA 3IRAA 4X43A 6GSYA 3TJFA 3LFLA 2FNOA 2WW2A 3KIJA 5HQPA 2OA7A 2CA8A 3C1RA 2DKHA 5JCGA 5L71A 4ILFA 1B48A 4TXOB 3ME8A 2HQTA 1HD2A 1GTBA 5CRWA 1WE0A 1SKSB 1ML6A 2QC7A 2R5GA 3F0IA 3HZ8A 3HDCA 1G7EA 4BIKA 1XFLA 2WW1A 4NXIA 5B8BA 4J2FA 1K0OA 1SD9A 1NHYA 2YJHA 5LNKe 2ON7A 4ZL7A 1E6BA 4ZBAA 1GSEA 4PURA 6GSTA 1A24A 1FAAA 3KEBA 2LKUA 1UVZA 3UARA 3C73A 4MJBA 3DYRA 5A4UA 1FOHA 2VL2C 4Q5NA 2F3MA 4IJ3A 1EEMA 1KTEA 1V9WA 4KH7A 2NDOA 4BPYA 2C8UA 3EURA 2QSIA 3ZZXA 3IAS2 3IK7A 1M2AA 1O7UA 4HUAA 2YV7A 2HRAA 5G5FA 3BJ5A 3W6GA 4MF6A 2HE3A 4K2XA 2BTOT 4MH2A 5D8IA 3IV4A 1TTZA 1AW9A 1H4OA 5CREA 3C71A 1B9XC 2IPAA 1A8YA 2HNLA 1O85A 2PN8A 3HYPA 2DKIA 4ECCA 1O81A 4ECJA 4FXYP 4KF9A 3TCOA 3TKQA 2B3SA 1FVKA 4MF5A 4IW9A 4O32A 3ZRDA 5A34B 1X5EA 4GDFA 4HOJA 3ZVJA 3UIWA 4F2IA 2LQQA 20GSA 1E2YA 1BG1A 5G30A 1XWGA 5IMZA 3M9KA 1DUGA 2EIRA 2LRNA 2P5RA 3LGCA 2WDUA 2H72A 2CVDA 2R4VA 2FLSA 2YN1A 2EFEA 1QQ2A 2EIOA 2UV8G 1XW5A 2IMFA 4MPFA 3CBUA 1GP1A 1QGVA 4IVFA 1OE7A 4G9HA 3BCIA 4OCFA 5BMUB 2C80A 5IPGA 1RQMA 4ML6A 5ID2B 4WKWA 5F0GA 1X5DA 3KMNA 4KCEA 1W4VA 1GTAA 1J08A 4JRRA 4PGTA 4HDEA 3RPPA 4EIPA 2N5FA 4K2DA 4G10A 2PGTA 4POMA 4ICYA 2NTOA 1YKCA 3GKNA 3IA1A 1TK8B 3ZREA 3CRTA 4WF4A 3ERGA 4G0LA 2C0FA 4MDCA 1PRXA 2WVXB 5F06A 3KGKA 2JZSA 3CQFA 3H4KA 2V6OA 2YP6A 1DBYA 3U5RE 1TW9A 3VFIA 3UL3A 4HQSA 2DIZA 3D4TA 4K5RA 4DSRA 4LMWA 4ECBA 1USBA 3H8QA 4MJEA 1M9BA 1EEJA 2F8AA 1XG8A 3EVIA 5IPHA 1A0FA 1F3AA 1YEPA 4I5QA 2H71A 1QUWA 4RQXA 2A2RA 1GSYA 5ECKB 1WJKA 1PKWA 4TKYA 1ERVA 3O6TA 1PX6A 4CW9A 3GTUB 3IR4A 2C3NA 3ZMKA 1U87A 3TOTA 4EO3A 4DSSA 1THXA 2VLVA 2R3XA 3G7YA 3TRPA 1BQ7A 2UZ8A 4GF0A 1EZKA 4PUFC 5CP1A 1XWCA 1TP9A 2X49A 3IAM2 2IWTA 5DVBA 5F8BA 2EFDA 4G0IA 4EVMA 1I9DA 2HXKA 4BVXB 5DCHA 1A23A 3KH9A 2R0CA 3KCMA 1M3IA 4KUNA 2CVBA 4AGSA 1LU4A 1O73A 5AIVA 4MNNA 3R2QA 2YWOA 2VOCA 5HFKA 4K0NA 2VUPA 4WR4A 1SK0A 2E2MA 3N9JA 3HZ4A 2L6DA 2I3YA 3ZLPA 1JZWA 5KOXA 1BG5A 3QR6A 3GSSA 1W89A 3FZ4A 1FW1A 1I5GA 4N0ZA 4PQHA 3FEUA 1QK8A 4NWYA 1G0TA 4ULXA 4EXJA 2RLIA 2GSRA 5KN2A 4H86A 2WFCA 3QCPA 2KHPA 1WIKA 3CHXC 5DJLA 4NHWA 5E4WA 3FK8A 4KCAA 4WR5A 1JLWA 2GSQA 4K0GA 1GUKA 3MNGA 3DVWA 4LL4B 1A2MA 1PSQA 3APQA 4IHUA 3GKKA 2DSAA 2WZSA 2N5BA 3A3TA 4YKFA 3GMFA 2HT9A 1NW2A 3HVSA 2B5EA 4GWRA 1FHEA 1ZOFA 4PXOA 3F6DA 1WPIA 2GQKA 4I97A 4TR3A 5D9VA 1OC9B 3QAVA 5EL8A 2HRKA 7GSSA 2CAIA 3R3EA 3M9JA 4TRXA 5DAKA 1I1IP 4NMUA 1K0CA 2LJKA 14GSA 2WW3A 3F3QA 2B1KA 2VIMA 3RBTA 4JE1A 5ECPB 3HY2A 2L59A 3GN3A 2KP2A 2KP1A 1GL8A 5IMVA 5J4YA 3LQ7A 1K0MA 4JEDA 2VLUA 3TUEA 4DSQA 4IQAA 1SJZA 5EVOA 3NIVA 4FYCA 1HNCA 1GH2A 2OE1A 4KW6A 4O5RA 3TB2A 2MMNA 4GTUA 1XXUA 4L0UA 1QFNA 2HSHA 3EMXA 5J41A 1B9YC 1XWAA 3GUSA 5ECNB 3CRUA 4XCSA 5CRHA 5G2ZA 1PQNA 4QL7A 1UN2A 4HU7A 3HKRA 2PU9C 2RUEA 4MH3A 3UEMA 2L6CA 4ZB9A 2B6MA 2JSZA 4BVYA 2RUFA 2M46A 4A5PA 5CAXA 4E8HA 1M99A 1ZYQB 3EU4A 4IJIA 2EIQA 3LORA 4TR1A 1GULA 4D73B 1GTUA 4O5QA 4AKGA 2E7PA 5IIZA 2HSMB 3HA9A 1OC3A 1M9AA 2VCZA 1BYEA 2WJUA 3VURA 4BL7B 2EC4A 2R37A 2IMDA 2AHEA 1V98A 1BEDA 2LNTA 4EF0A 2YWNA 2JL4A 4AJ8A 1GSFA 5BRTA 3L0HA 2L5LA 2K8SA 4EE0A 3TKSC 16GSA 5CRGA 3QOUA 3A2WA 3BBYA 3LWAA 4Z2UA 2VM1A 4XS4A 2C3QA 2BJXA 2REMA 3PINA 2P31A 2A4HA 3GX8A 2NPBA 3IHQA 5J40A 1TJDA 1G7OA 2FA4A 3Q74A 2ES7A 1EV9A 1PD21 1F6MC 5ECSA 2GT5A 4YAPA 1T3BA 1XPVA 3TRXA 4F82A 4W66A 2DC5A 2XC2A 2CX4A 2LJAA 1GRXA 3HJPA 4ISDA 4K1FA 3FMWA 4I8BA 1PL2A 1FG4A 3PPUA 1FVJA 3SWLA 2MMZA 1AIUA 5J5NA 2WRTA 5IM9A 4LMVA 1XVWA 1IYHA 1Z3EA 2B7JA 2JSYA 3PGTA 5C04A 5DALA 3O3TA 4PNGA 4EKZA 2LQOA 1HNBA 2R0GA 1TDIA 4IQ1A 2GTUA 1YF0A 2GGTA 5B7CA 3TJGA 2EFHA 1GTIA 3RAZA 3BD2A 9GSSA 1FOVA 2A4VA 5KN3A 4OD7A 1YQ1A 3EPTA 5A1NA 4TVEA 3ZIJA 3GSTA 2YNXA 3TOUA 1F9MA 1URMA 3ME7A 3H1NA 4KE3A 2DIYA 2NBSA 4WXTA 1M3JA 4AJ6A 4L5LA 5DCGA 1X9MB 1JZRA 4AKXB 4MJCA 5A4WA 5DDLA 1M2DA 3MSZA 4PQIA 2LSTA 5ECIB 4MA9A 5IO2A 2L57A 5IO0A 5IMDA 5CO3A 1X5CA 5CNWA 1EWXA 1VRSD 1TU7A 1G6WA 3TDGA 2PBJA 1TRSA 4K7NA 2H19A 1DE1A 2ZCTA 4V2LA 1GSUA 2IL3A 1HYUA 3VI7A 3DIEA 4HQZA 1VGLA 1WOUA 2I81A 2GSSA 5KN0A 2K8VA 3US3A 3E3EA 4OO4A 3G9BA 1MD3A 2V6KA 4MABA 3ZFLA 2VCTA 4N3ZA 1Z6MA 3VWUA 2O87A 2FA8A 5AN1A 5D93A 3D21A 3DVXA 1Q98A 2DJ0A 4G2EA 4XHMA 3G7JA 3CTGA 3H93A 3ZVJD 4BWSA 2L5OA 1GLPA 4KSMA 5ELGA 1Y6EA 4ZILA 3Q6OA 2VCXA 3PH9A 4YQUA 3GX0A 1TK0B 5J3RA 1TXUA 2LUSA 4N0VA 5HFIA 2R6KA 2WVZA 2C0EA 2HLSA 2AV4A 2DBCA 2HZEA 3ED3A 5IQYA 2LRCA 3QAWA 3DMLA 5GAND 3VWXA 4GQFA 4IBPA 2P5QA 1ZGNA 3WT2A 2YOIA 1TRUA 4LA1A 3SBCA 4PNFA 1T4YA 2WGRA 1MDKA 4N11A 2H1LA 1XOBA 4MMMA 3J7Yb 2GQLA 3N5OA 4DVCA 1F37A 2C0GA 2VL9A 3IK9A 4KDYA 4I2TA 4PQ1A 4TXVA 5DQSA 1GLQA 4KA0A 2RIIA 2HSNA 3GNJA 3VPQA 3CMIA 2IFQA 2O89A 5HR1A 3KH7A 3A2VA 1RK4A 1OE8A 1XCCA 2CQ9A 2H30A 3D0ZA 1AUCA 3L9VA 2H0HA 4AJ7A 3F3RA 3GURA 5A5HA 3UVHA 1S3DA 1FB6A 2CT6A 3RHCA 3RDWA 5G31A 4TOPA 2C4JA 1M0UA 2KLXA 5A5KA 3F4TA 3LXZA 1VF3A 2YWMA 4MPGA 2X4AA 4NV2A 4MP4A 4PX1A 2CVKA 1Z7RA 2DMLA 2VL3A 3A2XA 4MK3A 4EIQA 4JBBA 3GV1A 1MDJA 1H75A 4X1UA 4PI0C 4K7OA 5H5QA 3P90A 3UJ1A 3V1WA 5C00A 3OR5A 1ERWA 1WWJA 3HJOA 4KSOA 1N8JA 2OADA 4Q5FA 4HJMA 3ZL5A 3UOMA 4POBA 4V2NA 1XWKA 4ZBDA 1PX7A 3KD0A 3HCZA 3WYWA 3EYTA 3F4RA 1NSWA 1A8LA 2O3EA 2A2PA 2H6XA 2PWJA 4O7HA 2QA1A 1TXXA 4PHZC 2OE0A 3ZITA 5D96A 1O6JA 1PMTA 2VM2A 2ON5A 3GH6A 3FR9A 8GSSA 4V1Ag 4CHSA 3EMPA 1RW1A 6GSVA 1XWBA 3F8UA 3VI5A 3F4SA 5AISA 5J4UA 3DXBA 5DBQA 1SU9A 2XPEA 3I6AA 2X8CA 4OFTA 1V58A 4ZIJA 3KP9A 2IJYA 1SENA 1ST9A 4GRFA 2LTKA 4LL1B 3LXTA 4Q5RA 2XPDA 5INYA 1M2BA 4MZBA 1XBSA 1CQHA 4FYBA 4GSNA 4P3YB 2O8VB 1VF4A 1YDKA 2OBKA 4NHZA 1OC8A 5LCZA 3LEFA 2DJ1A 4CY6A 3GYKA 4JR4A 4QQ7A 4OFMA 1SJ6A 3A5IA 1Z5YE 2OACA 1KEBA 1JZOA 2FWEA 3TU3B 2H1AA 3UMAA 4ML1A 4ECIA 5ECRB 1U88A 1XZOA 1AC1A 3LYKA 4JZQA 13GSA 1TI1A 3WGEA 2K6VA 3D6IA 3MIXA 2H75A 5F05A 1GNWA 1Z9HA 3C8EA 2V41A 4ZB6A 1CQGA 2KUCA 1O8XA 2HRNA 2AB6A 17GSA 2YZHA 1JZDA 3CSJA 3TKSE 4NPBA 2GZYA 1PL1A 5H5SA 4FO5A 5JCWA 3ERFA 1PN0A 1U3AA 3GH9A 3M3MA 3F63A 4TN8A 4KGIA 5ECHB 3UVTA 3RFRC 3HVXA 1OC9A 4GCIA 4IP1A 1SKWB 4V2MA 2HFDA 1U6TA 2LV3A 3JCML 3UBKA 3QFBC 3CSIA 5G5EA 3IC4A 4ZL9A 1ZYEA 3E0UA 4RUVA 3TKSA 3D4MA 2QA2A 3LSZA 3LG6A 4KNDA 12GSA 2HRKB 2C0DA 3EE2A 3QDNA 2M72A 2MMAA 5J9CA 2GLRA 5DAKB 3S9FA 2I9HA 4YAVA 4CY8A 1V57A 1WRYA 5JWQB 5IMCA 4Z2RA 1V40A 4KX4A 4ACSA 3HHVA 1S4BP 2PVQA 3IXRA 2PERA 3KZQA 2K18A 3L9UA 1SL0B 1B8XA 1JFUA 2TIRA 3L78A 4PUAA 3GKXA 4FH8A 3F9UA 2FWFA 2GQMA 3RPNA 4E68A 3P2AA 4FIWA 3A5WA 3TKRA 2DLXA 1T1VA 2WS2A 2E2GA 2O85A 3TJKA 2OJLA 3TKPA 2J23A 2WW0A 3DRNA 2FY6A 1YZXA 1UA5A 3QFAC 3MAKA 2HSMA 5AGYA 4BA7A 2OKAA 4JU5A 4TR1B 1R26A 4BL7A 3KMOA 2JZTA 2MYGA 3DEXA 4XRAA 3DKSA 1SJIA 4AKHA 2CX3A 4TR4A 4CDOA 1IYIA 1K0BA 1GWCA 4MJAA 3I69A 1K3OA 3QAGA 2MMOA 1GUMA 1AAZA 2IIYA 2XBQA 1B4QA 2F8FA 1TRVA 2IMKA 2FWGA 1S3AA 2YPMA 1JHBA 1N2AA 5ECQB 5GSSA 4G19A 5J4VA 3WD6A 1ZMAA 3L9SA 3LYPA 2FHEA 3P7XA 4HZ2A 1ZCPA 4K7IA 1SKRB 1F2EA 1A0RP 1A2LA 1QMVA 1F3BA 2F51A 2YJ7A 1J0FA 4XS4B 3IE3A 3U6VA 1ON4A 1Y25A 1K3LA 3DGQA 4POKA 1KBNA 3I43A 1GSDA 3I9V2 1JLVA 4LLRA 1PA3A 4EUYA 1MD4A 4ZB7A 10GSA 3GL5A 4QMKA 4I6XA 4HS1A 4KB3A 3TJBA 1QXHA 4BWQA 2H1BA 3UAPA 4GQCA 4XS6A 4X0XA 2ZNMA 4TXOA 2HI7A 1TKDB 1O8WA 2H73A 3M0FA 2K9FA 3EC3A 2G0FA 3FHKA 1K0AA 1G6YA 4ZL8A 5DALB 3W8SA 4TW5A 2RM5A 1T8EB 2OBIA 5A4VA 5A1NB 1SVOA 1HNAA 4IELA 2M80A 2O36A 2Z9SA 3NZNA 2WVYA 4O5UA 2GS3A 2QKEA 4OO5A 3WGDA 1J9BA 2H8LA 1ZYPA 4USSA 5COHA 2F9SA 3VPTA 2VD0A 2XHFA 1XVQA 4PI2C 2WB9A 3GHAA 4I2UA 4DEJA 2B5XA 4WBJA 4WF5A 1XOAA 2CV4A 1AXDA 2O7KA 1S3CA 3FY7A 3EWLA 1R5AA 1YEXA 4HI7A 3IPZA 3ZTLA 3J7Yk 2B7KA 2VCQA 3KP8A 22GSA 4EL1A 2JZRA 1YVLA 2I1UA 4GSTA 3APSA 2J9HA 2HRFA 3O76A 1EGOA 4ID0A 5IMFA 2CZ2A 3L4NA 3P8WA 4XS1A 5A34A 3GIXA 3KTBA 1OYJA 5EPFA 5GZZB 6GSWA 2YCDA 2QGVA 2H0GA 4K8MA 4MLYA 2AAWA 4EDYA 3BCKA 1T7PB 5ECMB 1A2JA 4Z7XA 2NVLA 1EP8A 1SVLA 2B1LA 1X9WB 4K9ZA 5ELAA 2HZEB 6GSXA 4WETA 4L0WA 2C1YA 2FWHA 4J57E 2GZZA 2BMXA 3VWWA 2OE3A 4AF2A 3FZAA 5FHIA 1AQVA 1OAZA 4XRDA 1TRWA 1TU8A 1ACVA 5IOXA 4IN0A 2XBIA 3HMJG 4YH2A 4RI7A 3ZMLA 2IN3A 2YANA 5DQYA 5BMUA 2I4AA 1T00A 4F9ZA 1ABAA 3MWHA 2MBTA 4N30A 4L8EA 5ID2A 1PGTA 2HSNB 1ZZYA 5ABRA 2IFQB 2TRXA 2ZUPA 1KNGA 2ALBA 4OFNA 2L4QA 2JU5A 1SYRA 3WGXA 5D9WA 5G1KA 3ZIVA 1YF1A 1MEKA 2DMMA 4N10A 4MCUA 3TGZA 5A5HB 2H66A 2CZ3A 5H5RA 3TJJA 2LRTA 3KM6A 1XW6A 2AYTA 5J47A 2WVXA 6GSUA 1M7TA 1GSSA 5GAPD 19GSA 3PR8A 1YJ6A 3KXOA 5GSTA 3C1SA 1SL2B 4F0CA 5HR3A 4TR0A 5G1LA 1NM3A 1U3IA 2X8GA 3HD5A 4NAXA 3EU3A 5D9TA 2IMIA 1X9SB 3FZ9A 1BX9A 1BF5A 1SK1A 1EOHA 2VLTA 1SYXA 5HFGA 4ZXGA 3D22A 4RQRA 3IHGA 5J9BA 5D73A 1SD8A 1UC7A 2H1DA 2VKZG 2WZ9A 2MZCA 1Y1UA 2YWIA 3MYDA 2PPTA 5CYYA 3CYNA 2MBSA 2AUVA 5CRDA 3GTUA 5KOWA 5JWRB 1FB0A 1K3YA 2X99A 3Q19A 1V2AA 2CAQA 3MDKA 3GRXA 2P0GA 1EOGA 1EV4A 4PTSA 3VLNA 3IOSA 5JWOB 2LJRA 1T4ZA 2V2GA 2H6ZA 4HU9A 2R2JA 2OT3A 4WBRD 5B6NA 2GSTA 1MDIA 2LEGA 3D5JA 4DSSB 3ERWA 4BVXA 3APOA 5F07A 1OVNA 4JR6A 1OKDA 1MTCA 2X8HA 4IS0A 2HZFA 3BOAA 4KDXA 3LJRA 2FD3A 2RM6A 2FGXA 3C7MA 1SK2A 4NV5A 4Z2TA 1ERTA 3FZ5A 11GSA 1SVMA 4MZCA 3GKMA 2VD1A 3IC8A 1YY7A 1R7HA 4IKHA 4EC0A 2DJ2A 3F6FA 2V1MA 4J56E 3VWVA 3G7IA 4KDUA 2V32A 3FW2A 3RGBC 3AY8A 3M1GA 4XIHA 3HXSA 5HR2A 2C3TA 3FYGA 1BJXA 3QD9A 1XIYA 3QMXA 4YKGA 1SL1B 1PFOA 2PVOC 1GUHA 2B5YA 1EGRA 2E0QA 1TOFA 4GLTA 4O92A 2O5VA 3HJMA 4X4JA 5E59A 1DSBA 4HSCX 4OWYA 2GZPA 4L5OA 3E9JB 18GSA 2GT6A 1GNEA 1TK5B 1VF1A 2KOKA 1Q4JA 1N25A 1BAYA 3UBLA 3ZFBA 3FR3A 5KN1A 1C72A 2GVPA 2DJJA 4WEYA 2L4CA 2PMTA 4POLA 4MZWA 2FCHA 2LS5A 3FRCA 1R4WA 1EP7A 1GSQA 2FUG2
chains in the Genus database with same CATH topology
1WMJA 3GA4A 5EY6A 4Q5QA 3ZYWA 1VF2A 2DJKA 1ZYNA 3WT1A 4F0BA 1Z6NA 3GFKA 1Z7PA 1OKTA 3NOFA 3W8JA 3FR6A 2JADA 2GDRA 1B4PA 1PKZA 2H74A 2PUKC 2H01A 2H76A 2TRCP 2X64A 3GL3A 4OCEA 5IMAA 3HVVA 3EINA 3M8NA 1LBKA 2YZUA 2JACA 5B6MA 4AI6A 2HYXA 2H0IA 1X0RA 1ILOA 4G01A 5ECLB 4XTSA 2H1GA 4HJ2A 4IGJA 3KTLA 2G2QA 3TRQA 1AQXA 2D2ZA 3K8NA 2VCVA 5LD0A 1THOA 4D73A 5FWGA 4HZ4A 3FKFA 4GSSA 2VCWA 4BVYB 2VO4A 3CWGA 4GXZA 5ECOB 4YQMA 4YQVA 3CXGA 4G0KA 4EDZA 1NHOA 4MF7A 2AJQB 1R5PA 4RI6A 2WCIA 4QL9A 4AKIA 5FT3A 1AQWA 3H79A 4K5SA 1WP0A 5ENUA 1YKAA 2EFCA 4HEA2 3CSHA 2H70A 2A2SA 5KEJA 2YV9A 4ZBBA 5HR0A 4F03A 5D9XA 1K0DA 6GSSA 2R0PA 4E8EA 4K6XA 5DJMA 3DWVA 4ZB8A 5B8AA 2VL2A 2VAFA 4IP6A 1K0NA 2WULA 3LW9A 3IDVA 3CTFA 1ZL9A 4OMVA 5IOWA 2LNSA 5JCUA 3Q18A 4FYUA 1XW9A 3VK9A 2H6YA 4KAEA 1PN9A 1FO5A 4FQUA 1HQOA 1DE2A 5AIXA 1TI3A 3RHBA 1LJRA 4V1Ap 1ERUA 3DD3A 2IMEA 3QPMA 3KJYA 3IBHA 2DJ3A 3ISOA 2HSYA 2N5AA 3IRAA 4X43A 6GSYA 3TJFA 3LFLA 2FNOA 3KIJA 5HQPA 2OA7A 2CA8A 3C1RA 2DKHA 5JCGA 5L71A 4ILFA 1B48A 4TXOB 3ME8A 2HQTA 1HD2A 1GTBA 5CRWA 1WE0A 1SKSB 1ML6A 2QC7A 2R5GA 3F0IA 3HZ8A 3HDCA 1G7EA 1XFLA 4NXIA 5B8BA 4J2FA 1K0OA 1SD9A 1NHYA 2YJHA 5LNKe 2ON7A 4ZL7A 1E6BA 4ZBAA 1GSEA 4PURA 6GSTA 1A24A 1FAAA 3KEBA 2LKUA 1UVZA 3UARA 3C73A 4MJBA 3DYRA 5A4UA 1FOHA 2VL2C 4Q5NA 2F3MA 4IJ3A 1EEMA 1KTEA 1V9WA 4KH7A 2NDOA 4BPYA 2C8UA 3EURA 2QSIA 3ZZXA 3IAS2 3IK7A 1M2AA 1O7UA 4HUAA 2YV7A 2HRAA 5G5FA 3BJ5A 3W6GA 4MF6A 2HE3A 4K2XA 2BTOT 4MH2A 5D8IA 3IV4A 1TTZA 1AW9A 1H4OA 5CREA 3C71A 1B9XC 2IPAA 1A8YA 2HNLA 1O85A 2PN8A 3HYPA 2DKIA 4ECCA 1O81A 4ECJA 4KF9A 3TCOA 3TKQA 2B3SA 1FVKA 4MF5A 4IW9A 4O32A 3ZRDA 5A34B 1X5EA 4GDFA 4HOJA 3ZVJA 3UIWA 4F2IA 2LQQA 20GSA 1E2YA 1BG1A 5G30A 1XWGA 5IMZA 3M9KA 1DUGA 2EIRA 2LRNA 2P5RA 3LGCA 2WDUA 2H72A 2CVDA 2R4VA 2FLSA 2YN1A 2EFEA 1QQ2A 2EIOA 2UV8G 1XW5A 2IMFA 4MPFA 3CBUA 1GP1A 1QGVA 4IVFA 1OE7A 4G9HA 3BCIA 4OCFA 5BMUB 2C80A 5IPGA 1RQMA 4ML6A 5ID2B 4WKWA 5F0GA 1X5DA 3KMNA 4KCEA 1W4VA 1GTAA 1J08A 4JRRA 4PGTA 4HDEA 3RPPA 4EIPA 2N5FA 4K2DA 4G10A 2PGTA 4POMA 4ICYA 2NTOA 1YKCA 3GKNA 3IA1A 1TK8B 3ZREA 3CRTA 4WF4A 3ERGA 4G0LA 2C0FA 4MDCA 1PRXA 5F06A 3KGKA 2JZSA 3H4KA 2V6OA 2YP6A 1DBYA 3U5RE 1TW9A 3VFIA 3UL3A 4HQSA 2DIZA 3D4TA 4K5RA 4DSRA 4LMWA 4ECBA 1USBA 3H8QA 4MJEA 1M9BA 1EEJA 2F8AA 3EVIA 5IPHA 1A0FA 1F3AA 1YEPA 4I5QA 2H71A 1QUWA 4RQXA 2A2RA 1GSYA 5ECKB 1WJKA 1PKWA 4TKYA 1ERVA 3O6TA 1PX6A 4CW9A 3GTUB 3IR4A 2C3NA 3ZMKA 1U87A 3TOTA 4EO3A 4DSSA 1THXA 2VLVA 2R3XA 3G7YA 3TRPA 1BQ7A 2UZ8A 4GF0A 1EZKA 4PUFC 5CP1A 1XWCA 1TP9A 2X49A 3IAM2 2IWTA 5DVBA 5F8BA 2EFDA 4G0IA 4EVMA 1I9DA 2HXKA 4BVXB 5DCHA 1A23A 3KH9A 2R0CA 3KCMA 4KUNA 2CVBA 4AGSA 1LU4A 1O73A 5AIVA 4MNNA 3R2QA 2YWOA 2VOCA 5HFKA 4K0NA 2VUPA 4WR4A 1SK0A 2E2MA 3N9JA 3HZ4A 2L6DA 2I3YA 3ZLPA 1JZWA 5KOXA 1BG5A 3QR6A 3GSSA 1W89A 3FZ4A 1FW1A 1I5GA 4N0ZA 4PQHA 3FEUA 1QK8A 4NWYA 1G0TA 4ULXA 4EXJA 2RLIA 2GSRA 5KN2A 4H86A 2WFCA 3QCPA 2KHPA 1WIKA 5DJLA 4NHWA 5E4WA 3FK8A 4KCAA 4WR5A 1JLWA 2GSQA 4K0GA 1GUKA 3MNGA 3DVWA 4LL4B 1A2MA 1PSQA 3APQA 4IHUA 3GKKA 2DSAA 2N5BA 3A3TA 4YKFA 3GMFA 2HT9A 1NW2A 3HVSA 2B5EA 4GWRA 1FHEA 1ZOFA 4PXOA 3F6DA 1WPIA 2GQKA 4I97A 4TR3A 5D9VA 1OC9B 3QAVA 5EL8A 2HRKA 7GSSA 2CAIA 3R3EA 3M9JA 4TRXA 5DAKA 4NMUA 1K0CA 2LJKA 14GSA 3F3QA 2B1KA 2VIMA 3RBTA 4JE1A 5ECPB 3HY2A 2L59A 3GN3A 2KP2A 2KP1A 1GL8A 5IMVA 5J4YA 3LQ7A 1K0MA 4JEDA 2VLUA 3TUEA 4DSQA 4IQAA 1SJZA 5EVOA 3NIVA 4FYCA 1HNCA 1GH2A 2OE1A 4KW6A 4O5RA 3TB2A 2MMNA 4GTUA 1XXUA 4L0UA 1QFNA 2HSHA 3EMXA 5J41A 1B9YC 1XWAA 3GUSA 5ECNB 3CRUA 4XCSA 5CRHA 5G2ZA 1PQNA 4QL7A 1UN2A 4HU7A 3HKRA 2PU9C 2RUEA 4MH3A 3UEMA 2L6CA 4ZB9A 2B6MA 2JSZA 4BVYA 2RUFA 2M46A 4A5PA 5CAXA 4E8HA 1M99A 1ZYQB 3EU4A 4IJIA 2EIQA 3LORA 4TR1A 1GULA 4D73B 1GTUA 4O5QA 4AKGA 2E7PA 5IIZA 2HSMB 3HA9A 1OC3A 1M9AA 2VCZA 1BYEA 2WJUA 3VURA 4BL7B 2EC4A 2R37A 2IMDA 2AHEA 1V98A 1BEDA 2LNTA 4EF0A 2YWNA 2JL4A 4AJ8A 1GSFA 5BRTA 3L0HA 2L5LA 2K8SA 4EE0A 3TKSC 16GSA 5CRGA 3QOUA 3A2WA 3BBYA 3LWAA 4Z2UA 2VM1A 4XS4A 2C3QA 2BJXA 2REMA 3PINA 2P31A 2A4HA 3GX8A 2NPBA 3IHQA 5J40A 1TJDA 1G7OA 2FA4A 3Q74A 2ES7A 1EV9A 1PD21 1F6MC 5ECSA 2GT5A 4YAPA 1T3BA 1XPVA 3TRXA 4F82A 4W66A 2DC5A 2XC2A 2CX4A 2LJAA 1GRXA 3HJPA 4ISDA 4K1FA 3FMWA 4I8BA 1PL2A 1FG4A 3PPUA 1FVJA 3SWLA 2MMZA 1AIUA 5J5NA 2WRTA 5IM9A 4LMVA 1XVWA 1IYHA 1Z3EA 2B7JA 2JSYA 3PGTA 5C04A 5DALA 3O3TA 4PNGA 4EKZA 2LQOA 1HNBA 2R0GA 1TDIA 4IQ1A 2GTUA 1YF0A 2GGTA 5B7CA 3TJGA 2EFHA 1GTIA 3RAZA 3BD2A 9GSSA 1FOVA 2A4VA 5KN3A 4OD7A 1YQ1A 3EPTA 5A1NA 4TVEA 3ZIJA 3GSTA 2YNXA 3TOUA 1F9MA 1URMA 3ME7A 3H1NA 4KE3A 2DIYA 2NBSA 4WXTA 4AJ6A 4L5LA 5DCGA 1X9MB 1JZRA 4AKXB 4MJCA 5A4WA 5DDLA 1M2DA 3MSZA 4PQIA 2LSTA 5ECIB 4MA9A 5IO2A 2L57A 5IO0A 5IMDA 5CO3A 1X5CA 5CNWA 1EWXA 1VRSD 1TU7A 1G6WA 3TDGA 2PBJA 1TRSA 4K7NA 2H19A 1DE1A 2ZCTA 4V2LA 1GSUA 2IL3A 1HYUA 3VI7A 3DIEA 4HQZA 1VGLA 1WOUA 2I81A 2GSSA 5KN0A 2K8VA 3US3A 3E3EA 4OO4A 3G9BA 1MD3A 2V6KA 4MABA 3ZFLA 2VCTA 4N3ZA 1Z6MA 3VWUA 2O87A 2FA8A 5AN1A 5D93A 3D21A 3DVXA 1Q98A 2DJ0A 4G2EA 4XHMA 3G7JA 3CTGA 3H93A 3ZVJD 4BWSA 2L5OA 1GLPA 4KSMA 5ELGA 1Y6EA 4ZILA 3Q6OA 2VCXA 3PH9A 4YQUA 3GX0A 1TK0B 5J3RA 1TXUA 2LUSA 4N0VA 5HFIA 2R6KA 2C0EA 2HLSA 2AV4A 2DBCA 2HZEA 3ED3A 5IQYA 2LRCA 3QAWA 3DMLA 5GAND 3VWXA 4GQFA 4IBPA 2P5QA 1ZGNA 3WT2A 2YOIA 1TRUA 4LA1A 3SBCA 4PNFA 1T4YA 2WGRA 1MDKA 4N11A 2H1LA 1XOBA 4MMMA 3J7Yb 2GQLA 3N5OA 4DVCA 1F37A 2C0GA 2VL9A 3IK9A 4KDYA 4I2TA 4PQ1A 4TXVA 5DQSA 1GLQA 4KA0A 2RIIA 2HSNA 3GNJA 3VPQA 3CMIA 2IFQA 2O89A 5HR1A 3KH7A 3A2VA 1RK4A 1OE8A 1XCCA 2CQ9A 2H30A 3D0ZA 1AUCA 3L9VA 2H0HA 4AJ7A 3F3RA 3GURA 5A5HA 3UVHA 1S3DA 1FB6A 2CT6A 3RHCA 3RDWA 5G31A 4TOPA 2C4JA 1M0UA 2KLXA 5A5KA 3F4TA 3LXZA 1VF3A 2YWMA 4MPGA 2X4AA 4NV2A 4MP4A 4PX1A 2CVKA 1Z7RA 2DMLA 2VL3A 3A2XA 4MK3A 4EIQA 4JBBA 3GV1A 1MDJA 1H75A 4X1UA 4K7OA 5H5QA 3P90A 3UJ1A 3V1WA 5C00A 3OR5A 1ERWA 1WWJA 3HJOA 4KSOA 1N8JA 2OADA 4Q5FA 4HJMA 3ZL5A 3UOMA 4POBA 4V2NA 1XWKA 4ZBDA 1PX7A 3KD0A 3HCZA 3WYWA 3EYTA 3F4RA 1NSWA 1A8LA 2A2PA 2H6XA 2PWJA 4O7HA 2QA1A 1TXXA 2OE0A 3ZITA 5D96A 1O6JA 1PMTA 2VM2A 2ON5A 3GH6A 3FR9A 8GSSA 4V1Ag 4CHSA 3EMPA 1RW1A 6GSVA 1XWBA 3F8UA 3VI5A 3F4SA 5AISA 5J4UA 3DXBA 5DBQA 1SU9A 2XPEA 3I6AA 2X8CA 4OFTA 1V58A 4ZIJA 3KP9A 2IJYA 1SENA 1ST9A 4GRFA 2LTKA 4LL1B 3LXTA 4Q5RA 2XPDA 5INYA 1M2BA 4MZBA 1XBSA 1CQHA 4FYBA 4GSNA 4P3YB 2O8VB 1VF4A 1YDKA 2OBKA 4NHZA 1OC8A 5LCZA 3LEFA 2DJ1A 4CY6A 3GYKA 4JR4A 4QQ7A 4OFMA 1SJ6A 3A5IA 1Z5YE 2OACA 1KEBA 1JZOA 2FWEA 3TU3B 2H1AA 3UMAA 4ML1A 4ECIA 5ECRB 1U88A 1XZOA 1AC1A 3LYKA 4JZQA 13GSA 1TI1A 3WGEA 2K6VA 3D6IA 3MIXA 2H75A 5F05A 1GNWA 1Z9HA 3C8EA 2V41A 4ZB6A 1CQGA 2KUCA 1O8XA 2HRNA 2AB6A 17GSA 2YZHA 1JZDA 3CSJA 3TKSE 4NPBA 2GZYA 1PL1A 5H5SA 4FO5A 5JCWA 3ERFA 1PN0A 1U3AA 3GH9A 3M3MA 3F63A 4TN8A 4KGIA 5ECHB 3UVTA 3HVXA 1OC9A 4GCIA 4IP1A 1SKWB 4V2MA 2HFDA 1U6TA 2LV3A 3JCML 3UBKA 3QFBC 3CSIA 5G5EA 3IC4A 4ZL9A 1ZYEA 3E0UA 4RUVA 3TKSA 3D4MA 2QA2A 3LSZA 3LG6A 4KNDA 12GSA 2HRKB 2C0DA 3EE2A 3QDNA 2M72A 2MMAA 5J9CA 2GLRA 5DAKB 3S9FA 2I9HA 4YAVA 4CY8A 1V57A 1WRYA 5JWQB 5IMCA 4Z2RA 1V40A 4KX4A 4ACSA 3HHVA 2PVQA 3IXRA 2PERA 3KZQA 2K18A 3L9UA 1SL0B 1B8XA 1JFUA 2TIRA 3L78A 4PUAA 3GKXA 4FH8A 3F9UA 2FWFA 2GQMA 3RPNA 4E68A 3P2AA 4FIWA 3A5WA 3TKRA 2DLXA 1T1VA 2WS2A 2E2GA 2O85A 3TJKA 2OJLA 3TKPA 2J23A 3DRNA 2FY6A 1YZXA 1UA5A 3QFAC 3MAKA 2HSMA 5AGYA 4BA7A 2OKAA 4JU5A 4TR1B 1R26A 4BL7A 3KMOA 2JZTA 2MYGA 3DEXA 4XRAA 3DKSA 1SJIA 4AKHA 2CX3A 4TR4A 4CDOA 1IYIA 1K0BA 1GWCA 4MJAA 3I69A 1K3OA 3QAGA 2MMOA 1GUMA 1AAZA 2IIYA 2XBQA 1B4QA 2F8FA 1TRVA 2IMKA 2FWGA 1S3AA 2YPMA 1JHBA 1N2AA 5ECQB 5GSSA 4G19A 5J4VA 3WD6A 1ZMAA 3L9SA 3LYPA 2FHEA 3P7XA 4HZ2A 1ZCPA 4K7IA 1SKRB 1F2EA 1A0RP 1A2LA 1QMVA 1F3BA 2F51A 2YJ7A 1J0FA 4XS4B 3IE3A 3U6VA 1ON4A 1Y25A 1K3LA 3DGQA 4POKA 1KBNA 3I43A 1GSDA 3I9V2 1JLVA 4LLRA 1PA3A 4EUYA 1MD4A 4ZB7A 10GSA 3GL5A 4QMKA 4I6XA 4HS1A 4KB3A 3TJBA 1QXHA 4BWQA 2H1BA 3UAPA 4GQCA 4XS6A 4X0XA 2ZNMA 4TXOA 2HI7A 1TKDB 1O8WA 2H73A 3M0FA 2K9FA 3EC3A 2G0FA 3FHKA 1K0AA 1G6YA 4ZL8A 5DALB 3W8SA 4TW5A 2RM5A 1T8EB 2OBIA 5A4VA 5A1NB 1SVOA 1HNAA 4IELA 2M80A 2Z9SA 3NZNA 4O5UA 2GS3A 2QKEA 4OO5A 3WGDA 1J9BA 2H8LA 1ZYPA 4USSA 5COHA 2F9SA 3VPTA 2VD0A 2XHFA 1XVQA 2WB9A 3GHAA 4I2UA 4DEJA 2B5XA 4WBJA 4WF5A 1XOAA 2CV4A 1AXDA 2O7KA 1S3CA 3FY7A 3EWLA 1R5AA 1YEXA 4HI7A 3IPZA 3ZTLA 3J7Yk 2B7KA 2VCQA 3KP8A 22GSA 4EL1A 2JZRA 1YVLA 2I1UA 4GSTA 3APSA 2J9HA 2HRFA 3O76A 1EGOA 4ID0A 5IMFA 2CZ2A 3L4NA 3P8WA 4XS1A 5A34A 3GIXA 3KTBA 1OYJA 5EPFA 5GZZB 6GSWA 2YCDA 2QGVA 2H0GA 4K8MA 4MLYA 2AAWA 4EDYA 3BCKA 1T7PB 5ECMB 1A2JA 4Z7XA 2NVLA 1EP8A 1SVLA 2B1LA 1X9WB 4K9ZA 5ELAA 2HZEB 6GSXA 4WETA 4L0WA 2C1YA 2FWHA 4J57E 2GZZA 2BMXA 3VWWA 2OE3A 4AF2A 3FZAA 5FHIA 1AQVA 1OAZA 4XRDA 1TRWA 1TU8A 1ACVA 5IOXA 4IN0A 2XBIA 3HMJG 4YH2A 4RI7A 3ZMLA 2IN3A 2YANA 5DQYA 5BMUA 2I4AA 1T00A 4F9ZA 1ABAA 3MWHA 2MBTA 4N30A 4L8EA 5ID2A 1PGTA 2HSNB 1ZZYA 5ABRA 2IFQB 2TRXA 2ZUPA 1KNGA 2ALBA 4OFNA 2L4QA 2JU5A 1SYRA 3WGXA 5D9WA 5G1KA 3ZIVA 1YF1A 1MEKA 2DMMA 4N10A 4MCUA 3TGZA 5A5HB 2H66A 2CZ3A 5H5RA 3TJJA 2LRTA 3KM6A 1XW6A 2AYTA 5J47A 6GSUA 1M7TA 1GSSA 5GAPD 19GSA 3PR8A 1YJ6A 3KXOA 5GSTA 3C1SA 1SL2B 4F0CA 5HR3A 4TR0A 5G1LA 1NM3A 1U3IA 2X8GA 3HD5A 4NAXA 3EU3A 5D9TA 2IMIA 1X9SB 3FZ9A 1BX9A 1BF5A 1SK1A 1EOHA 2VLTA 1SYXA 5HFGA 4ZXGA 3D22A 4RQRA 3IHGA 5J9BA 5D73A 1SD8A 1UC7A 2H1DA 2VKZG 2WZ9A 2MZCA 1Y1UA 2YWIA 3MYDA 2PPTA 5CYYA 3CYNA 2MBSA 2AUVA 5CRDA 3GTUA 5KOWA 5JWRB 1FB0A 1K3YA 2X99A 3Q19A 1V2AA 2CAQA 3MDKA 3GRXA 2P0GA 1EOGA 1EV4A 4PTSA 3VLNA 3IOSA 5JWOB 2LJRA 1T4ZA 2V2GA 2H6ZA 4HU9A 2R2JA 2OT3A 4WBRD 5B6NA 2GSTA 1MDIA 2LEGA 3D5JA 4DSSB 3ERWA 4BVXA 3APOA 5F07A 1OVNA 4JR6A 1OKDA 1MTCA 2X8HA 4IS0A 2HZFA 3BOAA 4KDXA 3LJRA 2FD3A 2RM6A 2FGXA 3C7MA 1SK2A 4NV5A 4Z2TA 1ERTA 3FZ5A 11GSA 1SVMA 4MZCA 3GKMA 2VD1A 3IC8A 1YY7A 1R7HA 4IKHA 4EC0A 2DJ2A 3F6FA 2V1MA 4J56E 3VWVA 3G7IA 4KDUA 2V32A 3FW2A 3AY8A 3M1GA 4XIHA 3HXSA 5HR2A 2C3TA 3FYGA 1BJXA 3QD9A 1XIYA 3QMXA 4YKGA 1SL1B 2PVOC 1GUHA 2B5YA 1EGRA 2E0QA 1TOFA 4GLTA 4O92A 2O5VA 3HJMA 4X4JA 5E59A 1DSBA 4OWYA 2GZPA 4L5OA 3E9JB 18GSA 2GT6A 1GNEA 1TK5B 1VF1A 2KOKA 1Q4JA 1N25A 1BAYA 3UBLA 3ZFBA 3FR3A 5KN1A 1C72A 2GVPA 2DJJA 4WEYA 2L4CA 2PMTA 4POLA 4MZWA 2FCHA 2LS5A 3FRCA 1R4WA 1EP7A 1GSQA 2FUG2
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WMJ A;  3GA4 A;  5EY6 A;  4Q5Q A;  3ZYW A;  1VF2 A;  2DJK A;  3WT1 A;  4F0B A;  1Z6N A;  3GFK A;  1Z7P A;  1OKT A;  3NOF A;  3W8J A;  3FR6 A;  2JAD A;  2GDR A;  1B4P A;  1PKZ A;  2H74 A;  2PUK C;  2H01 A;  2H76 A;  2TRC P;  2X64 A;  3GL3 A;  4OCE A;  5IMA A;  3HVV A;  3EIN A;  3M8N A;  1LBK A;  2YZU A;  2JAC A;  5B6M A;  2HYX A;  2H0I A;  1X0R A;  1ILO A;  5ECL B;  4XTS A;  2H1G A;  4HJ2 A;  4IGJ A;  3KTL A;  2G2Q A;  3TRQ A;  1AQX A;  2D2Z A;  3K8N A;  2VCV A;  5LD0 A;  1THO A;  4D73 A;  5FWG A;  4HZ4 A;  3FKF A;  4GSS A;  2VCW A;  4BVY B;  2VO4 A;  4GXZ A;  5ECO B;  4YQM A;  4YQV A;  3CXG A;  4G0K A;  4EDZ A;  1NHO A;  4MF7 A;  2AJQ B;  1R5P A;  4RI6 A;  2WCI A;  4QL9 A;  5FT3 A;  1AQW A;  3H79 A;  1WP0 A;  5ENU A;  1YKA A;  4HEA 2;  3CSH A;  2H70 A;  2A2S A;  5KEJ A;  2YV9 A;  4ZBB A;  5HR0 A;  4F03 A;  5D9X A;  1K0D A;  6GSS A;  4E8E A;  4K6X A;  5DJM A;  3DWV A;  4ZB8 A;  5B8A A;  2VL2 A;  2VAF A;  4IP6 A;  1K0N A;  2WUL A;  3IDV A;  3CTF A;  1ZL9 A;  4OMV A;  5IOW A;  2LNS A;  5JCU A;  3Q18 A;  4FYU A;  1XW9 A;  3VK9 A;  2H6Y A;  4KAE A;  1PN9 A;  1FO5 A;  4FQU A;  1HQO A;  1DE2 A;  5AIX A;  1TI3 A;  3RHB A;  1LJR A;  4V1A p;  1ERU A;  3DD3 A;  2IME A;  3QPM A;  3KJY A;  3IBH A;  2DJ3 A;  3ISO A;  2HSY A;  2N5A A;  3IRA A;  4X43 A;  6GSY A;  3TJF A;  3LFL A;  2FNO A;  3KIJ A;  5HQP A;  2OA7 A;  2CA8 A;  3C1R A;  5JCG A;  5L71 A;  4ILF A;  1B48 A;  4TXO B;  3ME8 A;  2HQT A;  1HD2 A;  1GTB A;  5CRW A;  1WE0 A;  1SKS B;  1ML6 A;  2QC7 A;  2R5G A;  3F0I A;  3HZ8 A;  3HDC A;  1G7E A;  1XFL A;  4NXI A;  5B8B A;  4J2F A;  1K0O A;  1SD9 A;  1NHY A;  2YJH A;  5LNK e;  2ON7 A;  4ZL7 A;  1E6B A;  4ZBA A;  1GSE A;  4PUR A;  6GST A;  1A24 A;  1FAA A;  3KEB A;  2LKU A;  1UVZ A;  3UAR A;  3C73 A;  4MJB A;  3DYR A;  5A4U A;  2VL2 C;  4Q5N A;  2F3M A;  4IJ3 A;  1EEM A;  1KTE A;  1V9W A;  4KH7 A;  2NDO A;  4BPY A;  2C8U A;  3EUR A;  2QSI A;  3ZZX A;  3IAS 2;  3IK7 A;  1M2A A;  1O7U A;  4HUA A;  2YV7 A;  2HRA A;  5G5F A;  3BJ5 A;  3W6G A;  4MF6 A;  2HE3 A;  2BTO T;  4MH2 A;  5D8I A;  3IV4 A;  1TTZ A;  1AW9 A;  1H4O A;  5CRE A;  3C71 A;  1B9X C;  2IPA A;  1A8Y A;  2HNL A;  1O85 A;  2PN8 A;  3HYP A;  4ECC A;  1O81 A;  4ECJ A;  4KF9 A;  3TCO A;  3TKQ A;  2B3S A;  1FVK A;  4MF5 A;  4IW9 A;  4O32 A;  3ZRD A;  1X5E A;  4HOJ A;  3ZVJ A;  3UIW A;  4F2I A;  2LQQ A;  20GS A;  1E2Y A;  5G30 A;  1XWG A;  5IMZ A;  3M9K A;  1DUG A;  2EIR A;  2LRN A;  2P5R A;  3LGC A;  2WDU A;  2H72 A;  2CVD A;  2R4V A;  2FLS A;  2YN1 A;  1QQ2 A;  2EIO A;  1XW5 A;  2IMF A;  4MPF A;  3CBU A;  1GP1 A;  1QGV A;  4IVF A;  1OE7 A;  4G9H A;  3BCI A;  4OCF A;  2C80 A;  5IPG A;  1RQM A;  4ML6 A;  5ID2 B;  4WKW A;  5F0G A;  1X5D A;  3KMN A;  4KCE A;  1W4V A;  1GTA A;  1J08 A;  4JRR A;  4PGT A;  4HDE A;  3RPP A;  2N5F A;  4K2D A;  4G10 A;  2PGT A;  4POM A;  2NTO A;  1YKC A;  3GKN A;  3IA1 A;  1TK8 B;  3ZRE A;  3CRT A;  4WF4 A;  3ERG A;  4G0L A;  2C0F A;  4MDC A;  1PRX A;  5F06 A;  3KGK A;  2JZS A;  3H4K A;  2V6O A;  2YP6 A;  1DBY A;  3U5R E;  1TW9 A;  3VFI A;  3UL3 A;  4HQS A;  2DIZ A;  3D4T A;  4DSR A;  4LMW A;  4ECB A;  1USB A;  3H8Q A;  4MJE A;  1M9B A;  1EEJ A;  2F8A A;  3EVI A;  5IPH A;  1A0F A;  1F3A A;  1YEP A;  4I5Q A;  2H71 A;  1QUW A;  4RQX A;  2A2R A;  1GSY A;  5ECK B;  1WJK A;  1PKW A;  4TKY A;  1ERV A;  3O6T A;  1PX6 A;  4CW9 A;  3GTU B;  3IR4 A;  2C3N A;  3ZMK A;  1U87 A;  3TOT A;  4EO3 A;  4DSS A;  1THX A;  2VLV A;  2R3X A;  3G7Y A;  3TRP A;  1BQ7 A;  2UZ8 A;  4GF0 A;  1EZK A;  4PUF C;  5CP1 A;  1XWC A;  1TP9 A;  3IAM 2;  2IWT A;  5DVB A;  5F8B A;  4G0I A;  4EVM A;  1I9D A;  2HXK A;  4BVX B;  5DCH A;  1A23 A;  3KH9 A;  3KCM A;  4KUN A;  2CVB A;  4AGS A;  1LU4 A;  1O73 A;  5AIV A;  3R2Q A;  2YWO A;  2VOC A;  5HFK A;  4K0N A;  2VUP A;  4WR4 A;  1SK0 A;  2E2M A;  3N9J A;  3HZ4 A;  2L6D A;  2I3Y A;  3ZLP A;  1JZW A;  1BG5 A;  3QR6 A;  3GSS A;  1W89 A;  3FZ4 A;  1FW1 A;  1I5G A;  4N0Z A;  4PQH A;  3FEU A;  1QK8 A;  4NWY A;  1G0T A;  4ULX A;  4EXJ A;  2RLI A;  2GSR A;  5KN2 A;  4H86 A;  2WFC A;  3QCP A;  2KHP A;  1WIK A;  5DJL A;  4NHW A;  5E4W A;  3FK8 A;  4KCA A;  4WR5 A;  1JLW A;  2GSQ A;  4K0G A;  1GUK A;  3MNG A;  3DVW A;  4LL4 B;  1A2M A;  1PSQ A;  3APQ A;  4IHU A;  3GKK A;  2DSA A;  2N5B A;  3A3T A;  3GMF A;  2HT9 A;  1NW2 A;  3HVS A;  2B5E A;  4GWR A;  1FHE A;  1ZOF A;  4PXO A;  3F6D A;  1WPI A;  2GQK A;  4I97 A;  4TR3 A;  5D9V A;  1OC9 B;  3QAV A;  5EL8 A;  2HRK A;  7GSS A;  2CAI A;  3R3E A;  3M9J A;  4TRX A;  5DAK A;  4NMU A;  1K0C A;  2LJK A;  14GS A;  3F3Q A;  2B1K A;  2VIM A;  3RBT A;  4JE1 A;  5ECP B;  3HY2 A;  2L59 A;  3GN3 A;  2KP2 A;  2KP1 A;  1GL8 A;  5IMV A;  3LQ7 A;  1K0M A;  4JED A;  2VLU A;  3TUE A;  4DSQ A;  4IQA A;  1SJZ A;  5EVO A;  3NIV A;  4FYC A;  1HNC A;  1GH2 A;  2OE1 A;  4KW6 A;  4O5R A;  3TB2 A;  2MMN A;  4GTU A;  1XXU A;  4L0U A;  1QFN A;  2HSH A;  3EMX A;  5J41 A;  1B9Y C;  1XWA A;  3GUS A;  5ECN B;  3CRU A;  4XCS A;  5CRH A;  5G2Z A;  1PQN A;  4QL7 A;  1UN2 A;  4HU7 A;  3HKR A;  2PU9 C;  2RUE A;  4MH3 A;  3UEM A;  2L6C A;  4ZB9 A;  2B6M A;  2JSZ A;  4BVY A;  2RUF A;  2M46 A;  5CAX A;  4E8H A;  1M99 A;  1ZYQ B;  3EU4 A;  4IJI A;  2EIQ A;  3LOR A;  4TR1 A;  1GUL A;  4D73 B;  1GTU A;  2E7P A;  5IIZ A;  2HSM B;  3HA9 A;  1OC3 A;  1M9A A;  2VCZ A;  1BYE A;  2WJU A;  3VUR A;  4BL7 B;  2EC4 A;  2R37 A;  2IMD A;  2AHE A;  1V98 A;  1BED A;  2LNT A;  4EF0 A;  2YWN A;  2JL4 A;  4AJ8 A;  1GSF A;  3L0H A;  2L5L A;  2K8S A;  4EE0 A;  3TKS C;  16GS A;  5CRG A;  3QOU A;  3A2W A;  3BBY A;  3LWA A;  2VM1 A;  4XS4 A;  2C3Q A;  2BJX A;  2REM A;  3PIN A;  2P31 A;  3GX8 A;  2NPB A;  3IHQ A;  1TJD A;  1G7O A;  2FA4 A;  3Q74 A;  2ES7 A;  1EV9 A;  1PD2 1;  1F6M C;  5ECS A;  2GT5 A;  4YAP A;  1T3B A;  1XPV A;  3TRX A;  4F82 A;  2DC5 A;  2XC2 A;  2CX4 A;  2LJA A;  1GRX A;  3HJP A;  4ISD A;  4K1F A;  4I8B A;  1PL2 A;  1FG4 A;  3PPU A;  1FVJ A;  3SWL A;  2MMZ A;  1AIU A;  5J5N A;  2WRT A;  5IM9 A;  4LMV A;  1XVW A;  1IYH A;  1Z3E A;  2B7J A;  2JSY A;  3PGT A;  5C04 A;  5DAL A;  3O3T A;  4PNG A;  4EKZ A;  2LQO A;  1HNB A;  1TDI A;  4IQ1 A;  2GTU A;  1YF0 A;  2GGT A;  5B7C A;  3TJG A;  1GTI A;  3RAZ A;  3BD2 A;  9GSS A;  1FOV A;  2A4V A;  5KN3 A;  4OD7 A;  1YQ1 A;  4TVE A;  3ZIJ A;  3GST A;  2YNX A;  3TOU A;  1F9M A;  1URM A;  3ME7 A;  3H1N A;  4KE3 A;  2DIY A;  2NBS A;  4WXT A;  4AJ6 A;  4L5L A;  5DCG A;  1X9M B;  1JZR A;  4MJC A;  5A4W A;  5DDL A;  1M2D A;  3MSZ A;  4PQI A;  2LST A;  5ECI B;  4MA9 A;  5IO2 A;  2L57 A;  5IO0 A;  5IMD A;  5CO3 A;  1X5C A;  5CNW A;  1EWX A;  1VRS D;  1TU7 A;  1G6W A;  3TDG A;  2PBJ A;  1TRS A;  4K7N A;  2H19 A;  1DE1 A;  2ZCT A;  4V2L A;  1GSU A;  2IL3 A;  1HYU A;  3VI7 A;  3DIE A;  4HQZ A;  1VGL A;  1WOU A;  2I81 A;  2GSS A;  5KN0 A;  2K8V A;  3US3 A;  3E3E A;  4OO4 A;  3G9B A;  1MD3 A;  2V6K A;  4MAB A;  3ZFL A;  2VCT A;  1Z6M A;  3VWU A;  2O87 A;  2FA8 A;  5AN1 A;  5D93 A;  3D21 A;  3DVX A;  1Q98 A;  2DJ0 A;  4G2E A;  4XHM A;  3G7J A;  3CTG A;  3H93 A;  3ZVJ D;  4BWS A;  2L5O A;  1GLP A;  4KSM A;  5ELG A;  1Y6E A;  4ZIL A;  3Q6O A;  2VCX A;  3PH9 A;  4YQU A;  3GX0 A;  1TK0 B;  5J3R A;  2LUS A;  4N0V A;  5HFI A;  2R6K A;  2C0E A;  2HLS A;  2AV4 A;  2DBC A;  2HZE A;  3ED3 A;  5IQY A;  2LRC A;  3QAW A;  3DML A;  5GAN D;  3VWX A;  4GQF A;  4IBP A;  2P5Q A;  1ZGN A;  3WT2 A;  2YOI A;  1TRU A;  4LA1 A;  3SBC A;  4PNF A;  1T4Y A;  2WGR A;  1MDK A;  4N11 A;  1XOB A;  4MMM A;  3J7Y b;  2GQL A;  3N5O A;  4DVC A;  1F37 A;  2C0G A;  2VL9 A;  3IK9 A;  4KDY A;  4I2T A;  4PQ1 A;  4TXV A;  5DQS A;  1GLQ A;  4KA0 A;  2RII A;  3GNJ A;  3VPQ A;  3CMI A;  2IFQ A;  2O89 A;  5HR1 A;  3KH7 A;  3A2V A;  1RK4 A;  1OE8 A;  1XCC A;  2CQ9 A;  2H30 A;  3D0Z A;  1AUC A;  3L9V A;  2H0H A;  4AJ7 A;  3F3R A;  3GUR A;  3UVH A;  1S3D A;  1FB6 A;  2CT6 A;  3RHC A;  3RDW A;  5G31 A;  4TOP A;  2C4J A;  1M0U A;  2KLX A;  5A5K A;  3F4T A;  3LXZ A;  1VF3 A;  2YWM A;  4MPG A;  4NV2 A;  4MP4 A;  4PX1 A;  2CVK A;  1Z7R A;  2DML A;  2VL3 A;  3A2X A;  4MK3 A;  4JBB A;  3GV1 A;  1MDJ A;  1H75 A;  4X1U A;  4K7O A;  5H5Q A;  3P90 A;  3UJ1 A;  3V1W A;  5C00 A;  3OR5 A;  1ERW A;  1WWJ A;  3HJO A;  4KSO A;  1N8J A;  2OAD A;  4Q5F A;  4HJM A;  3ZL5 A;  3UOM A;  4POB A;  4V2N A;  1XWK A;  4ZBD A;  1PX7 A;  3KD0 A;  3HCZ A;  3WYW A;  3EYT A;  3F4R A;  1NSW A;  1A8L A;  2H6X A;  2PWJ A;  4O7H A;  1TXX A;  2OE0 A;  3ZIT A;  5D96 A;  1O6J A;  1PMT A;  2VM2 A;  2ON5 A;  3GH6 A;  3FR9 A;  8GSS A;  4V1A g;  4CHS A;  3EMP A;  1RW1 A;  6GSV A;  1XWB A;  3F8U A;  3VI5 A;  3F4S A;  5AIS A;  5J4U A;  3DXB A;  5DBQ A;  1SU9 A;  2XPE A;  3I6A A;  2X8C A;  4OFT A;  1V58 A;  4ZIJ A;  3KP9 A;  2IJY A;  1SEN A;  1ST9 A;  4GRF A;  2LTK A;  4LL1 B;  3LXT A;  4Q5R A;  2XPD A;  5INY A;  1M2B A;  4MZB A;  1XBS A;  1CQH A;  4FYB A;  4GSN A;  4P3Y B;  2O8V B;  1VF4 A;  1YDK A;  2OBK A;  4NHZ A;  1OC8 A;  5LCZ A;  3LEF A;  2DJ1 A;  3GYK A;  4JR4 A;  4QQ7 A;  4OFM A;  1SJ6 A;  1Z5Y E;  2OAC A;  1KEB A;  1JZO A;  2FWE A;  2H1A A;  3UMA A;  4ML1 A;  4ECI A;  5ECR B;  1U88 A;  1XZO A;  1AC1 A;  3LYK A;  4JZQ A;  13GS A;  1TI1 A;  3WGE A;  2K6V A;  3D6I A;  2H75 A;  5F05 A;  1GNW A;  1Z9H A;  3C8E A;  2V41 A;  4ZB6 A;  1CQG A;  2KUC A;  1O8X A;  2HRN A;  2AB6 A;  17GS A;  2YZH A;  1JZD A;  3CSJ A;  3TKS E;  4NPB A;  2GZY A;  1PL1 A;  5H5S A;  4FO5 A;  5JCW A;  3ERF A;  1U3A A;  3GH9 A;  3M3M A;  3F63 A;  4TN8 A;  4KGI A;  5ECH B;  3UVT A;  3HVX A;  1OC9 A;  4GCI A;  4IP1 A;  1SKW B;  4V2M A;  2HFD A;  1U6T A;  2LV3 A;  3JCM L;  3UBK A;  3QFB C;  3CSI A;  5G5E A;  3IC4 A;  4ZL9 A;  1ZYE A;  3E0U A;  4RUV A;  3TKS A;  3D4M A;  3LSZ A;  3LG6 A;  4KND A;  12GS A;  2HRK B;  2C0D A;  3EE2 A;  3QDN A;  2M72 A;  2MMA A;  5J9C A;  2GLR A;  5DAK B;  3S9F A;  2I9H A;  4YAV A;  1V57 A;  1WRY A;  5JWQ B;  5IMC A;  1V40 A;  4KX4 A;  4ACS A;  3HHV A;  2PVQ A;  3IXR A;  2PER A;  3KZQ A;  2K18 A;  3L9U A;  1SL0 B;  1B8X A;  1JFU A;  2TIR A;  3L78 A;  4PUA A;  3GKX A;  4FH8 A;  3F9U A;  2FWF A;  2GQM A;  3RPN A;  3P2A A;  4FIW A;  3A5W A;  3TKR A;  2DLX A;  1T1V A;  2WS2 A;  2E2G A;  2O85 A;  3TJK A;  2OJL A;  3TKP A;  2J23 A;  3DRN A;  2FY6 A;  1YZX A;  1UA5 A;  3QFA C;  3MAK A;  2HSM A;  5AGY A;  4BA7 A;  2OKA A;  4JU5 A;  4TR1 B;  1R26 A;  4BL7 A;  3KMO A;  2JZT A;  2MYG A;  3DEX A;  4XRA A;  3DKS A;  1SJI A;  2CX3 A;  4TR4 A;  4CDO A;  1IYI A;  1K0B A;  1GWC A;  4MJA A;  3I69 A;  1K3O A;  3QAG A;  2MMO A;  1GUM A;  1AAZ A;  2IIY A;  2XBQ A;  1B4Q A;  2F8F A;  1TRV A;  2IMK A;  2FWG A;  1S3A A;  2YPM A;  1JHB A;  1N2A A;  5ECQ B;  5GSS A;  4G19 A;  3L9S A;  3WD6 A;  1ZMA A;  3LYP A;  2FHE A;  3P7X A;  4HZ2 A;  1ZCP A;  4K7I A;  1SKR B;  1F2E A;  1A0R P;  1A2L A;  1QMV A;  1F3B A;  2F51 A;  2YJ7 A;  1J0F A;  4XS4 B;  3IE3 A;  3U6V A;  1ON4 A;  1Y25 A;  1K3L A;  3DGQ A;  4POK A;  1KBN A;  3I43 A;  1GSD A;  3I9V 2;  1JLV A;  4LLR A;  1PA3 A;  4EUY A;  1MD4 A;  10GS A;  3GL5 A;  4I6X A;  4HS1 A;  4KB3 A;  3TJB A;  1QXH A;  4BWQ A;  2H1B A;  3UAP A;  4GQC A;  4XS6 A;  4X0X A;  2ZNM A;  4TXO A;  2HI7 A;  1TKD B;  1O8W A;  2H73 A;  3M0F A;  2K9F A;  3EC3 A;  2G0F A;  3FHK A;  1K0A A;  1G6Y A;  4ZL8 A;  5DAL B;  3W8S A;  4TW5 A;  2RM5 A;  1T8E B;  2OBI A;  5A4V A;  1HNA A;  4IEL A;  2M80 A;  2Z9S A;  3NZN A;  2GS3 A;  2QKE A;  4OO5 A;  3WGD A;  1J9B A;  2H8L A;  4USS A;  5COH A;  2F9S A;  3VPT A;  2VD0 A;  2XHF A;  1XVQ A;  2WB9 A;  3GHA A;  4I2U A;  4DEJ A;  2B5X A;  4WBJ A;  4WF5 A;  1XOA A;  2CV4 A;  1AXD A;  2O7K A;  1S3C A;  3FY7 A;  3EWL A;  1R5A A;  1YEX A;  4HI7 A;  3IPZ A;  3ZTL A;  3J7Y k;  2B7K A;  2VCQ A;  3KP8 A;  22GS A;  4EL1 A;  2JZR A;  2I1U A;  4GST A;  3APS A;  2J9H A;  2HRF A;  3O76 A;  1EGO A;  4ID0 A;  5IMF A;  2CZ2 A;  3L4N A;  3P8W A;  4XS1 A;  3KTB A;  3GIX A;  1OYJ A;  5EPF A;  5GZZ B;  6GSW A;  2YCD A;  2QGV A;  2H0G A;  4K8M A;  4MLY A;  2AAW A;  4EDY A;  3BCK A;  1T7P B;  5ECM B;  1A2J A;  4Z7X A;  2NVL A;  1EP8 A;  2B1L A;  1X9W B;  4K9Z A;  5ELA A;  2HZE B;  6GSX A;  4WET A;  4L0W A;  2C1Y A;  2FWH A;  4J57 E;  2GZZ A;  2BMX A;  3VWW A;  2OE3 A;  4AF2 A;  3FZA A;  5FHI A;  1AQV A;  1OAZ A;  4XRD A;  1TRW A;  1TU8 A;  1ACV A;  5IOX A;  4IN0 A;  2XBI A;  4YH2 A;  4RI7 A;  3ZML A;  2IN3 A;  2YAN A;  5DQY A;  5BMU A;  2I4A A;  1T00 A;  4F9Z A;  1ABA A;  3MWH A;  2MBT A;  4N30 A;  4L8E A;  5ID2 A;  1PGT A;  2HSN B;  1ZZY A;  5ABR A;  2IFQ B;  2TRX A;  2ZUP A;  1KNG A;  2ALB A;  4OFN A;  2L4Q A;  2JU5 A;  1SYR A;  3WGX A;  5D9W A;  5G1K A;  3ZIV A;  1YF1 A;  1MEK A;  2DMM A;  4N10 A;  4MCU A;  3TGZ A;  2H66 A;  2CZ3 A;  5H5R A;  3TJJ A;  2LRT A;  3KM6 A;  1XW6 A;  2AYT A;  6GSU A;  1M7T A;  1GSS A;  5GAP D;  19GS A;  3PR8 A;  1YJ6 A;  3KXO A;  5GST A;  3C1S A;  1SL2 B;  4F0C A;  5HR3 A;  4TR0 A;  5G1L A;  1NM3 A;  1U3I A;  2X8G A;  3HD5 A;  4NAX A;  3EU3 A;  5D9T A;  2IMI A;  1X9S B;  3FZ9 A;  1BX9 A;  1SK1 A;  1EOH A;  2VLT A;  1SYX A;  5HFG A;  4ZXG A;  3D22 A;  4RQR A;  5J9B A;  5D73 A;  1SD8 A;  1UC7 A;  2H1D A;  2WZ9 A;  2MZC A;  2YWI A;  2PPT A;  5CYY A;  3CYN A;  2MBS A;  2AUV A;  5CRD A;  3GTU A;  5JWR B;  1FB0 A;  1K3Y A;  2X99 A;  3Q19 A;  1V2A A;  2CAQ A;  3MDK A;  3GRX A;  2P0G A;  1EOG A;  1EV4 A;  4PTS A;  3VLN A;  3IOS A;  5JWO B;  2LJR A;  1T4Z A;  2V2G A;  2H6Z A;  4HU9 A;  2R2J A;  4WBR D;  5B6N A;  2GST A;  1MDI A;  2LEG A;  3D5J A;  4DSS B;  3ERW A;  4BVX A;  3APO A;  5F07 A;  1OVN A;  4JR6 A;  1OKD A;  1MTC A;  2X8H A;  4IS0 A;  2HZF A;  3BOA A;  4KDX A;  3LJR A;  2FD3 A;  2RM6 A;  2FGX A;  3C7M A;  1SK2 A;  4NV5 A;  1ERT A;  3FZ5 A;  11GS A;  4MZC A;  3GKM A;  2VD1 A;  3IC8 A;  1YY7 A;  1R7H A;  4IKH A;  4EC0 A;  2DJ2 A;  3F6F A;  2V1M A;  4J56 E;  3VWV A;  3G7I A;  4KDU A;  2V32 A;  3FW2 A;  3AY8 A;  3M1G A;  4XIH A;  3HXS A;  5HR2 A;  2C3T A;  3FYG A;  1BJX A;  3QD9 A;  1XIY A;  3QMX A;  1SL1 B;  2PVO C;  1GUH A;  2B5Y A;  1EGR A;  2E0Q A;  1TOF A;  4GLT A;  4O92 A;  3HJM A;  5E59 A;  1DSB A;  4OWY A;  2GZP A;  4L5O A;  3E9J B;  18GS A;  2GT6 A;  1GNE A;  1TK5 B;  1VF1 A;  2KOK A;  1Q4J A;  1BAY A;  3UBL A;  3ZFB A;  3FR3 A;  5KN1 A;  1C72 A;  2GVP A;  2DJJ A;  4WEY A;  2L4C A;  2PMT A;  4POL A;  4MZW A;  2FCH A;  2LS5 A;  3FRC A;  1R4W A;  1EP7 A;  1GSQ A;  2FUG 2; 
#chains in the Genus database with same CATH topology
 1WMJ A;  3GA4 A;  5EY6 A;  4Q5Q A;  3ZYW A;  1VF2 A;  2DJK A;  1ZYN A;  3WT1 A;  4F0B A;  1Z6N A;  3GFK A;  1Z7P A;  1OKT A;  3NOF A;  3W8J A;  3FR6 A;  2JAD A;  2GDR A;  1B4P A;  1PKZ A;  2H74 A;  2PUK C;  2H01 A;  2H76 A;  2TRC P;  2X64 A;  3GL3 A;  4OCE A;  5IMA A;  3HVV A;  3EIN A;  3M8N A;  1LBK A;  2YZU A;  2JAC A;  5B6M A;  4AI6 A;  2HYX A;  2H0I A;  1X0R A;  1ILO A;  4G01 A;  5ECL B;  4XTS A;  2H1G A;  4HJ2 A;  4IGJ A;  1S3R A;  3KTL A;  2G2Q A;  3TRQ A;  1AQX A;  2D2Z A;  3K8N A;  2VCV A;  5LD0 A;  1THO A;  4D73 A;  5FWG A;  4HZ4 A;  3FKF A;  4GSS A;  2VCW A;  4BVY B;  2VO4 A;  3CWG A;  4GXZ A;  5ECO B;  4YQM A;  4YQV A;  3HVN A;  3CXG A;  4G0K A;  4EDZ A;  1NHO A;  4MF7 A;  2AJQ B;  1R5P A;  4RI6 A;  2WCI A;  4QL9 A;  4AKI A;  5FT3 A;  1AQW A;  3H79 A;  4K5S A;  1WP0 A;  5ENU A;  1YKA A;  2EFC A;  4HEA 2;  3CSH A;  2H70 A;  2A2S A;  5KEJ A;  2YV9 A;  4ZBB A;  5HR0 A;  4F03 A;  5D9X A;  1YEW C;  1K0D A;  6GSS A;  2R0P A;  4E8E A;  4K6X A;  5DJM A;  3DWV A;  4ZB8 A;  5B8A A;  2VL2 A;  2VAF A;  4IP6 A;  1K0N A;  2WUL A;  3LW9 A;  3IDV A;  3CTF A;  1ZL9 A;  4OMV A;  5IOW A;  2LNS A;  5JCU A;  3Q18 A;  4FYU A;  1XW9 A;  3VK9 A;  2H6Y A;  4KAE A;  1PN9 A;  1FO5 A;  4FQU A;  1HQO A;  1DE2 A;  5AIX A;  1TI3 A;  3RHB A;  1LJR A;  4V1A p;  1ERU A;  3DD3 A;  2IME A;  3QPM A;  3KJY A;  3IBH A;  2DJ3 A;  3ISO A;  2HSY A;  2N5A A;  3IRA A;  4X43 A;  6GSY A;  3TJF A;  3LFL A;  2FNO A;  2WW2 A;  3KIJ A;  5HQP A;  2OA7 A;  2CA8 A;  3C1R A;  2DKH A;  5JCG A;  5L71 A;  4ILF A;  1B48 A;  4TXO B;  3ME8 A;  2HQT A;  1HD2 A;  1GTB A;  5CRW A;  1WE0 A;  1SKS B;  1ML6 A;  2QC7 A;  2R5G A;  3F0I A;  3HZ8 A;  3HDC A;  1G7E A;  4BIK A;  1XFL A;  2WW1 A;  4NXI A;  5B8B A;  4J2F A;  1K0O A;  1SD9 A;  1NHY A;  2YJH A;  5LNK e;  2ON7 A;  4ZL7 A;  1E6B A;  4ZBA A;  1GSE A;  4PUR A;  6GST A;  1A24 A;  1FAA A;  3KEB A;  2LKU A;  1UVZ A;  3UAR A;  3C73 A;  4MJB A;  3DYR A;  5A4U A;  1FOH A;  2VL2 C;  4Q5N A;  2F3M A;  4IJ3 A;  1EEM A;  1KTE A;  1V9W A;  4KH7 A;  2NDO A;  4BPY A;  2C8U A;  3EUR A;  2QSI A;  3ZZX A;  3IAS 2;  3IK7 A;  1M2A A;  1O7U A;  4HUA A;  2YV7 A;  2HRA A;  5G5F A;  3BJ5 A;  3W6G A;  4MF6 A;  2HE3 A;  4K2X A;  2BTO T;  4MH2 A;  5D8I A;  3IV4 A;  1TTZ A;  1AW9 A;  1H4O A;  5CRE A;  3C71 A;  1B9X C;  2IPA A;  1A8Y A;  2HNL A;  1O85 A;  2PN8 A;  3HYP A;  2DKI A;  4ECC A;  1O81 A;  4ECJ A;  4FXY P;  4KF9 A;  3TCO A;  3TKQ A;  2B3S A;  1FVK A;  4MF5 A;  4IW9 A;  4O32 A;  3ZRD A;  5A34 B;  1X5E A;  4GDF A;  4HOJ A;  3ZVJ A;  3UIW A;  4F2I A;  2LQQ A;  20GS A;  1E2Y A;  1BG1 A;  5G30 A;  1XWG A;  5IMZ A;  3M9K A;  1DUG A;  2EIR A;  2LRN A;  2P5R A;  3LGC A;  2WDU A;  2H72 A;  2CVD A;  2R4V A;  2FLS A;  2YN1 A;  2EFE A;  1QQ2 A;  2EIO A;  2UV8 G;  1XW5 A;  2IMF A;  4MPF A;  3CBU A;  1GP1 A;  1QGV A;  4IVF A;  1OE7 A;  4G9H A;  3BCI A;  4OCF A;  5BMU B;  2C80 A;  5IPG A;  1RQM A;  4ML6 A;  5ID2 B;  4WKW A;  5F0G A;  1X5D A;  3KMN A;  4KCE A;  1W4V A;  1GTA A;  1J08 A;  4JRR A;  4PGT A;  4HDE A;  3RPP A;  4EIP A;  2N5F A;  4K2D A;  4G10 A;  2PGT A;  4POM A;  4ICY A;  2NTO A;  1YKC A;  3GKN A;  3IA1 A;  1TK8 B;  3ZRE A;  3CRT A;  4WF4 A;  3ERG A;  4G0L A;  2C0F A;  4MDC A;  1PRX A;  2WVX B;  5F06 A;  3KGK A;  2JZS A;  3CQF A;  3H4K A;  2V6O A;  2YP6 A;  1DBY A;  3U5R E;  1TW9 A;  3VFI A;  3UL3 A;  4HQS A;  2DIZ A;  3D4T A;  4K5R A;  4DSR A;  4LMW A;  4ECB A;  1USB A;  3H8Q A;  4MJE A;  1M9B A;  1EEJ A;  2F8A A;  1XG8 A;  3EVI A;  5IPH A;  1A0F A;  1F3A A;  1YEP A;  4I5Q A;  2H71 A;  1QUW A;  4RQX A;  2A2R A;  1GSY A;  5ECK B;  1WJK A;  1PKW A;  4TKY A;  1ERV A;  3O6T A;  1PX6 A;  4CW9 A;  3GTU B;  3IR4 A;  2C3N A;  3ZMK A;  1U87 A;  3TOT A;  4EO3 A;  4DSS A;  1THX A;  2VLV A;  2R3X A;  3G7Y A;  3TRP A;  1BQ7 A;  2UZ8 A;  4GF0 A;  1EZK A;  4PUF C;  5CP1 A;  1XWC A;  1TP9 A;  2X49 A;  3IAM 2;  2IWT A;  5DVB A;  5F8B A;  2EFD A;  4G0I A;  4EVM A;  1I9D A;  2HXK A;  4BVX B;  5DCH A;  1A23 A;  3KH9 A;  2R0C A;  3KCM A;  1M3I A;  4KUN A;  2CVB A;  4AGS A;  1LU4 A;  1O73 A;  5AIV A;  4MNN A;  3R2Q A;  2YWO A;  2VOC A;  5HFK A;  4K0N A;  2VUP A;  4WR4 A;  1SK0 A;  2E2M A;  3N9J A;  3HZ4 A;  2L6D A;  2I3Y A;  3ZLP A;  1JZW A;  5KOX A;  1BG5 A;  3QR6 A;  3GSS A;  1W89 A;  3FZ4 A;  1FW1 A;  1I5G A;  4N0Z A;  4PQH A;  3FEU A;  1QK8 A;  4NWY A;  1G0T A;  4ULX A;  4EXJ A;  2RLI A;  2GSR A;  5KN2 A;  4H86 A;  2WFC A;  3QCP A;  2KHP A;  1WIK A;  3CHX C;  5DJL A;  4NHW A;  5E4W A;  3FK8 A;  4KCA A;  4WR5 A;  1JLW A;  2GSQ A;  4K0G A;  1GUK A;  3MNG A;  3DVW A;  4LL4 B;  1A2M A;  1PSQ A;  3APQ A;  4IHU A;  3GKK A;  2DSA A;  2WZS A;  2N5B A;  3A3T A;  4YKF A;  3GMF A;  2HT9 A;  1NW2 A;  3HVS A;  2B5E A;  4GWR A;  1FHE A;  1ZOF A;  4PXO A;  3F6D A;  1WPI A;  2GQK A;  4I97 A;  4TR3 A;  5D9V A;  1OC9 B;  3QAV A;  5EL8 A;  2HRK A;  7GSS A;  2CAI A;  3R3E A;  3M9J A;  4TRX A;  5DAK A;  1I1I P;  4NMU A;  1K0C A;  2LJK A;  14GS A;  2WW3 A;  3F3Q A;  2B1K A;  2VIM A;  3RBT A;  4JE1 A;  5ECP B;  3HY2 A;  2L59 A;  3GN3 A;  2KP2 A;  2KP1 A;  1GL8 A;  5IMV A;  5J4Y A;  3LQ7 A;  1K0M A;  4JED A;  2VLU A;  3TUE A;  4DSQ A;  4IQA A;  1SJZ A;  5EVO A;  3NIV A;  4FYC A;  1HNC A;  1GH2 A;  2OE1 A;  4KW6 A;  4O5R A;  3TB2 A;  2MMN A;  4GTU A;  1XXU A;  4L0U A;  1QFN A;  2HSH A;  3EMX A;  5J41 A;  1B9Y C;  1XWA A;  3GUS A;  5ECN B;  3CRU A;  4XCS A;  5CRH A;  5G2Z A;  1PQN A;  4QL7 A;  1UN2 A;  4HU7 A;  3HKR A;  2PU9 C;  2RUE A;  4MH3 A;  3UEM A;  2L6C A;  4ZB9 A;  2B6M A;  2JSZ A;  4BVY A;  2RUF A;  2M46 A;  4A5P A;  5CAX A;  4E8H A;  1M99 A;  1ZYQ B;  3EU4 A;  4IJI A;  2EIQ A;  3LOR A;  4TR1 A;  1GUL A;  4D73 B;  1GTU A;  4O5Q A;  4AKG A;  2E7P A;  5IIZ A;  2HSM B;  3HA9 A;  1OC3 A;  1M9A A;  2VCZ A;  1BYE A;  2WJU A;  3VUR A;  4BL7 B;  2EC4 A;  2R37 A;  2IMD A;  2AHE A;  1V98 A;  1BED A;  2LNT A;  4EF0 A;  2YWN A;  2JL4 A;  4AJ8 A;  1GSF A;  5BRT A;  3L0H A;  2L5L A;  2K8S A;  4EE0 A;  3TKS C;  16GS A;  5CRG A;  3QOU A;  3A2W A;  3BBY A;  3LWA A;  4Z2U A;  2VM1 A;  4XS4 A;  2C3Q A;  2BJX A;  2REM A;  3PIN A;  2P31 A;  2A4H A;  3GX8 A;  2NPB A;  3IHQ A;  5J40 A;  1TJD A;  1G7O A;  2FA4 A;  3Q74 A;  2ES7 A;  1EV9 A;  1PD2 1;  1F6M C;  5ECS A;  2GT5 A;  4YAP A;  1T3B A;  1XPV A;  3TRX A;  4F82 A;  4W66 A;  2DC5 A;  2XC2 A;  2CX4 A;  2LJA A;  1GRX A;  3HJP A;  4ISD A;  4K1F A;  3FMW A;  4I8B A;  1PL2 A;  1FG4 A;  3PPU A;  1FVJ A;  3SWL A;  2MMZ A;  1AIU A;  5J5N A;  2WRT A;  5IM9 A;  4LMV A;  1XVW A;  1IYH A;  1Z3E A;  2B7J A;  2JSY A;  3PGT A;  5C04 A;  5DAL A;  3O3T A;  4PNG A;  4EKZ A;  2LQO A;  1HNB A;  2R0G A;  1TDI A;  4IQ1 A;  2GTU A;  1YF0 A;  2GGT A;  5B7C A;  3TJG A;  2EFH A;  1GTI A;  3RAZ A;  3BD2 A;  9GSS A;  1FOV A;  2A4V A;  5KN3 A;  4OD7 A;  1YQ1 A;  3EPT A;  5A1N A;  4TVE A;  3ZIJ A;  3GST A;  2YNX A;  3TOU A;  1F9M A;  1URM A;  3ME7 A;  3H1N A;  4KE3 A;  2DIY A;  2NBS A;  4WXT A;  1M3J A;  4AJ6 A;  4L5L A;  5DCG A;  1X9M B;  1JZR A;  4AKX B;  4MJC A;  5A4W A;  5DDL A;  1M2D A;  3MSZ A;  4PQI A;  2LST A;  5ECI B;  4MA9 A;  5IO2 A;  2L57 A;  5IO0 A;  5IMD A;  5CO3 A;  1X5C A;  5CNW A;  1EWX A;  1VRS D;  1TU7 A;  1G6W A;  3TDG A;  2PBJ A;  1TRS A;  4K7N A;  2H19 A;  1DE1 A;  2ZCT A;  4V2L A;  1GSU A;  2IL3 A;  1HYU A;  3VI7 A;  3DIE A;  4HQZ A;  1VGL A;  1WOU A;  2I81 A;  2GSS A;  5KN0 A;  2K8V A;  3US3 A;  3E3E A;  4OO4 A;  3G9B A;  1MD3 A;  2V6K A;  4MAB A;  3ZFL A;  2VCT A;  4N3Z A;  1Z6M A;  3VWU A;  2O87 A;  2FA8 A;  5AN1 A;  5D93 A;  3D21 A;  3DVX A;  1Q98 A;  2DJ0 A;  4G2E A;  4XHM A;  3G7J A;  3CTG A;  3H93 A;  3ZVJ D;  4BWS A;  2L5O A;  1GLP A;  4KSM A;  5ELG A;  1Y6E A;  4ZIL A;  3Q6O A;  2VCX A;  3PH9 A;  4YQU A;  3GX0 A;  1TK0 B;  5J3R A;  1TXU A;  2LUS A;  4N0V A;  5HFI A;  2R6K A;  2WVZ A;  2C0E A;  2HLS A;  2AV4 A;  2DBC A;  2HZE A;  3ED3 A;  5IQY A;  2LRC A;  3QAW A;  3DML A;  5GAN D;  3VWX A;  4GQF A;  4IBP A;  2P5Q A;  1ZGN A;  3WT2 A;  2YOI A;  1TRU A;  4LA1 A;  3SBC A;  4PNF A;  1T4Y A;  2WGR A;  1MDK A;  4N11 A;  2H1L A;  1XOB A;  4MMM A;  3J7Y b;  2GQL A;  3N5O A;  4DVC A;  1F37 A;  2C0G A;  2VL9 A;  3IK9 A;  4KDY A;  4I2T A;  4PQ1 A;  4TXV A;  5DQS A;  1GLQ A;  4KA0 A;  2RII A;  2HSN A;  3GNJ A;  3VPQ A;  3CMI A;  2IFQ A;  2O89 A;  5HR1 A;  3KH7 A;  3A2V A;  1RK4 A;  1OE8 A;  1XCC A;  2CQ9 A;  2H30 A;  3D0Z A;  1AUC A;  3L9V A;  2H0H A;  4AJ7 A;  3F3R A;  3GUR A;  5A5H A;  3UVH A;  1S3D A;  1FB6 A;  2CT6 A;  3RHC A;  3RDW A;  5G31 A;  4TOP A;  2C4J A;  1M0U A;  2KLX A;  5A5K A;  3F4T A;  3LXZ A;  1VF3 A;  2YWM A;  4MPG A;  2X4A A;  4NV2 A;  4MP4 A;  4PX1 A;  2CVK A;  1Z7R A;  2DML A;  2VL3 A;  3A2X A;  4MK3 A;  4EIQ A;  4JBB A;  3GV1 A;  1MDJ A;  1H75 A;  4X1U A;  4PI0 C;  4K7O A;  5H5Q A;  3P90 A;  3UJ1 A;  3V1W A;  5C00 A;  3OR5 A;  1ERW A;  1WWJ A;  3HJO A;  4KSO A;  1N8J A;  2OAD A;  4Q5F A;  4HJM A;  3ZL5 A;  3UOM A;  4POB A;  4V2N A;  1XWK A;  4ZBD A;  1PX7 A;  3KD0 A;  3HCZ A;  3WYW A;  3EYT A;  3F4R A;  1NSW A;  1A8L A;  2O3E A;  2A2P A;  2H6X A;  2PWJ A;  4O7H A;  2QA1 A;  1TXX A;  4PHZ C;  2OE0 A;  3ZIT A;  5D96 A;  1O6J A;  1PMT A;  2VM2 A;  2ON5 A;  3GH6 A;  3FR9 A;  8GSS A;  4V1A g;  4CHS A;  3EMP A;  1RW1 A;  6GSV A;  1XWB A;  3F8U A;  3VI5 A;  3F4S A;  5AIS A;  5J4U A;  3DXB A;  5DBQ A;  1SU9 A;  2XPE A;  3I6A A;  2X8C A;  4OFT A;  1V58 A;  4ZIJ A;  3KP9 A;  2IJY A;  1SEN A;  1ST9 A;  4GRF A;  2LTK A;  4LL1 B;  3LXT A;  4Q5R A;  2XPD A;  5INY A;  1M2B A;  4MZB A;  1XBS A;  1CQH A;  4FYB A;  4GSN A;  4P3Y B;  2O8V B;  1VF4 A;  1YDK A;  2OBK A;  4NHZ A;  1OC8 A;  5LCZ A;  3LEF A;  2DJ1 A;  4CY6 A;  3GYK A;  4JR4 A;  4QQ7 A;  4OFM A;  1SJ6 A;  3A5I A;  1Z5Y E;  2OAC A;  1KEB A;  1JZO A;  2FWE A;  3TU3 B;  2H1A A;  3UMA A;  4ML1 A;  4ECI A;  5ECR B;  1U88 A;  1XZO A;  1AC1 A;  3LYK A;  4JZQ A;  13GS A;  1TI1 A;  3WGE A;  2K6V A;  3D6I A;  3MIX A;  2H75 A;  5F05 A;  1GNW A;  1Z9H A;  3C8E A;  2V41 A;  4ZB6 A;  1CQG A;  2KUC A;  1O8X A;  2HRN A;  2AB6 A;  17GS A;  2YZH A;  1JZD A;  3CSJ A;  3TKS E;  4NPB A;  2GZY A;  1PL1 A;  5H5S A;  4FO5 A;  5JCW A;  3ERF A;  1PN0 A;  1U3A A;  3GH9 A;  3M3M A;  3F63 A;  4TN8 A;  4KGI A;  5ECH B;  3UVT A;  3RFR C;  3HVX A;  1OC9 A;  4GCI A;  4IP1 A;  1SKW B;  4V2M A;  2HFD A;  1U6T A;  2LV3 A;  3JCM L;  3UBK A;  3QFB C;  3CSI A;  5G5E A;  3IC4 A;  4ZL9 A;  1ZYE A;  3E0U A;  4RUV A;  3TKS A;  3D4M A;  2QA2 A;  3LSZ A;  3LG6 A;  4KND A;  12GS A;  2HRK B;  2C0D A;  3EE2 A;  3QDN A;  2M72 A;  2MMA A;  5J9C A;  2GLR A;  5DAK B;  3S9F A;  2I9H A;  4YAV A;  4CY8 A;  1V57 A;  1WRY A;  5JWQ B;  5IMC A;  4Z2R A;  1V40 A;  4KX4 A;  4ACS A;  3HHV A;  1S4B P;  2PVQ A;  3IXR A;  2PER A;  3KZQ A;  2K18 A;  3L9U A;  1SL0 B;  1B8X A;  1JFU A;  2TIR A;  3L78 A;  4PUA A;  3GKX A;  4FH8 A;  3F9U A;  2FWF A;  2GQM A;  3RPN A;  4E68 A;  3P2A A;  4FIW A;  3A5W A;  3TKR A;  2DLX A;  1T1V A;  2WS2 A;  2E2G A;  2O85 A;  3TJK A;  2OJL A;  3TKP A;  2J23 A;  2WW0 A;  3DRN A;  2FY6 A;  1YZX A;  1UA5 A;  3QFA C;  3MAK A;  2HSM A;  5AGY A;  4BA7 A;  2OKA A;  4JU5 A;  4TR1 B;  1R26 A;  4BL7 A;  3KMO A;  2JZT A;  2MYG A;  3DEX A;  4XRA A;  3DKS A;  1SJI A;  4AKH A;  2CX3 A;  4TR4 A;  4CDO A;  1IYI A;  1K0B A;  1GWC A;  4MJA A;  3I69 A;  1K3O A;  3QAG A;  2MMO A;  1GUM A;  1AAZ A;  2IIY A;  2XBQ A;  1B4Q A;  2F8F A;  1TRV A;  2IMK A;  2FWG A;  1S3A A;  2YPM A;  1JHB A;  1N2A A;  5ECQ B;  5GSS A;  4G19 A;  5J4V A;  3WD6 A;  1ZMA A;  3L9S A;  3LYP A;  2FHE A;  3P7X A;  4HZ2 A;  1ZCP A;  4K7I A;  1SKR B;  1F2E A;  1A0R P;  1A2L A;  1QMV A;  1F3B A;  2F51 A;  2YJ7 A;  1J0F A;  4XS4 B;  3IE3 A;  3U6V A;  1ON4 A;  1Y25 A;  1K3L A;  3DGQ A;  4POK A;  1KBN A;  3I43 A;  1GSD A;  3I9V 2;  1JLV A;  4LLR A;  1PA3 A;  4EUY A;  1MD4 A;  4ZB7 A;  10GS A;  3GL5 A;  4QMK A;  4I6X A;  4HS1 A;  4KB3 A;  3TJB A;  1QXH A;  4BWQ A;  2H1B A;  3UAP A;  4GQC A;  4XS6 A;  4X0X A;  2ZNM A;  4TXO A;  2HI7 A;  1TKD B;  1O8W A;  2H73 A;  3M0F A;  2K9F A;  3EC3 A;  2G0F A;  3FHK A;  1K0A A;  1G6Y A;  4ZL8 A;  5DAL B;  3W8S A;  4TW5 A;  2RM5 A;  1T8E B;  2OBI A;  5A4V A;  5A1N B;  1SVO A;  1HNA A;  4IEL A;  2M80 A;  2O36 A;  2Z9S A;  3NZN A;  2WVY A;  4O5U A;  2GS3 A;  2QKE A;  4OO5 A;  3WGD A;  1J9B A;  2H8L A;  1ZYP A;  4USS A;  5COH A;  2F9S A;  3VPT A;  2VD0 A;  2XHF A;  1XVQ A;  4PI2 C;  2WB9 A;  3GHA A;  4I2U A;  4DEJ A;  2B5X A;  4WBJ A;  4WF5 A;  1XOA A;  2CV4 A;  1AXD A;  2O7K A;  1S3C A;  3FY7 A;  3EWL A;  1R5A A;  1YEX A;  4HI7 A;  3IPZ A;  3ZTL A;  3J7Y k;  2B7K A;  2VCQ A;  3KP8 A;  22GS A;  4EL1 A;  2JZR A;  1YVL A;  2I1U A;  4GST A;  3APS A;  2J9H A;  2HRF A;  3O76 A;  1EGO A;  4ID0 A;  5IMF A;  2CZ2 A;  3L4N A;  3P8W A;  4XS1 A;  5A34 A;  3GIX A;  3KTB A;  1OYJ A;  5EPF A;  5GZZ B;  6GSW A;  2YCD A;  2QGV A;  2H0G A;  4K8M A;  4MLY A;  2AAW A;  4EDY A;  3BCK A;  1T7P B;  5ECM B;  1A2J A;  4Z7X A;  2NVL A;  1EP8 A;  1SVL A;  2B1L A;  1X9W B;  4K9Z A;  5ELA A;  2HZE B;  6GSX A;  4WET A;  4L0W A;  2C1Y A;  2FWH A;  4J57 E;  2GZZ A;  2BMX A;  3VWW A;  2OE3 A;  4AF2 A;  3FZA A;  5FHI A;  1AQV A;  1OAZ A;  4XRD A;  1TRW A;  1TU8 A;  1ACV A;  5IOX A;  4IN0 A;  2XBI A;  3HMJ G;  4YH2 A;  4RI7 A;  3ZML A;  2IN3 A;  2YAN A;  5DQY A;  5BMU A;  2I4A A;  1T00 A;  4F9Z A;  1ABA A;  3MWH A;  2MBT A;  4N30 A;  4L8E A;  5ID2 A;  1PGT A;  2HSN B;  1ZZY A;  5ABR A;  2IFQ B;  2TRX A;  2ZUP A;  1KNG A;  2ALB A;  4OFN A;  2L4Q A;  2JU5 A;  1SYR A;  3WGX A;  5D9W A;  5G1K A;  3ZIV A;  1YF1 A;  1MEK A;  2DMM A;  4N10 A;  4MCU A;  3TGZ A;  5A5H B;  2H66 A;  2CZ3 A;  5H5R A;  3TJJ A;  2LRT A;  3KM6 A;  1XW6 A;  2AYT A;  5J47 A;  2WVX A;  6GSU A;  1M7T A;  1GSS A;  5GAP D;  19GS A;  3PR8 A;  1YJ6 A;  3KXO A;  5GST A;  3C1S A;  1SL2 B;  4F0C A;  5HR3 A;  4TR0 A;  5G1L A;  1NM3 A;  1U3I A;  2X8G A;  3HD5 A;  4NAX A;  3EU3 A;  5D9T A;  2IMI A;  1X9S B;  3FZ9 A;  1BX9 A;  1BF5 A;  1SK1 A;  1EOH A;  2VLT A;  1SYX A;  5HFG A;  4ZXG A;  3D22 A;  4RQR A;  3IHG A;  5J9B A;  5D73 A;  1SD8 A;  1UC7 A;  2H1D A;  2VKZ G;  2WZ9 A;  2MZC A;  1Y1U A;  2YWI A;  3MYD A;  2PPT A;  5CYY A;  3CYN A;  2MBS A;  2AUV A;  5CRD A;  3GTU A;  5KOW A;  5JWR B;  1FB0 A;  1K3Y A;  2X99 A;  3Q19 A;  1V2A A;  2CAQ A;  3MDK A;  3GRX A;  2P0G A;  1EOG A;  1EV4 A;  4PTS A;  3VLN A;  3IOS A;  5JWO B;  2LJR A;  1T4Z A;  2V2G A;  2H6Z A;  4HU9 A;  2R2J A;  2OT3 A;  4WBR D;  5B6N A;  2GST A;  1MDI A;  2LEG A;  3D5J A;  4DSS B;  3ERW A;  4BVX A;  3APO A;  5F07 A;  1OVN A;  4JR6 A;  1OKD A;  1MTC A;  2X8H A;  4IS0 A;  2HZF A;  3BOA A;  4KDX A;  3LJR A;  2FD3 A;  2RM6 A;  2FGX A;  3C7M A;  1SK2 A;  4NV5 A;  4Z2T A;  1ERT A;  3FZ5 A;  11GS A;  1SVM A;  4MZC A;  3GKM A;  2VD1 A;  3IC8 A;  1YY7 A;  1R7H A;  4IKH A;  4EC0 A;  2DJ2 A;  3F6F A;  2V1M A;  4J56 E;  3VWV A;  3G7I A;  4KDU A;  2V32 A;  3FW2 A;  3RGB C;  3AY8 A;  3M1G A;  4XIH A;  3HXS A;  5HR2 A;  2C3T A;  3FYG A;  1BJX A;  3QD9 A;  1XIY A;  3QMX A;  4YKG A;  1SL1 B;  1PFO A;  2PVO C;  1GUH A;  2B5Y A;  1EGR A;  2E0Q A;  1TOF A;  4GLT A;  4O92 A;  2O5V A;  3HJM A;  4X4J A;  5E59 A;  1DSB A;  4HSC X;  4OWY A;  2GZP A;  4L5O A;  3E9J B;  18GS A;  2GT6 A;  1GNE A;  1TK5 B;  1VF1 A;  2KOK A;  1Q4J A;  1N25 A;  1BAY A;  3UBL A;  3ZFB A;  3FR3 A;  5KN1 A;  1C72 A;  2GVP A;  2DJJ A;  4WEY A;  2L4C A;  2PMT A;  4POL A;  4MZW A;  2FCH A;  2LS5 A;  3FRC A;  1R4W A;  1EP7 A;  1GSQ A;  2FUG 2; 
#chains in the Genus database with same CATH homology
 1WMJ A;  3GA4 A;  5EY6 A;  4Q5Q A;  3ZYW A;  1VF2 A;  2DJK A;  1ZYN A;  3WT1 A;  4F0B A;  1Z6N A;  3GFK A;  1Z7P A;  1OKT A;  3NOF A;  3W8J A;  3FR6 A;  2JAD A;  2GDR A;  1B4P A;  1PKZ A;  2H74 A;  2PUK C;  2H01 A;  2H76 A;  2TRC P;  2X64 A;  3GL3 A;  4OCE A;  5IMA A;  3HVV A;  3EIN A;  3M8N A;  1LBK A;  2YZU A;  2JAC A;  5B6M A;  4AI6 A;  2HYX A;  2H0I A;  1X0R A;  1ILO A;  4G01 A;  5ECL B;  4XTS A;  2H1G A;  4HJ2 A;  4IGJ A;  3KTL A;  2G2Q A;  3TRQ A;  1AQX A;  2D2Z A;  3K8N A;  2VCV A;  5LD0 A;  1THO A;  4D73 A;  5FWG A;  4HZ4 A;  3FKF A;  4GSS A;  2VCW A;  4BVY B;  2VO4 A;  3CWG A;  4GXZ A;  5ECO B;  4YQM A;  4YQV A;  3CXG A;  4G0K A;  4EDZ A;  1NHO A;  4MF7 A;  2AJQ B;  1R5P A;  4RI6 A;  2WCI A;  4QL9 A;  4AKI A;  5FT3 A;  1AQW A;  3H79 A;  4K5S A;  1WP0 A;  5ENU A;  1YKA A;  2EFC A;  4HEA 2;  3CSH A;  2H70 A;  2A2S A;  5KEJ A;  2YV9 A;  4ZBB A;  5HR0 A;  4F03 A;  5D9X A;  1K0D A;  6GSS A;  2R0P A;  4E8E A;  4K6X A;  5DJM A;  3DWV A;  4ZB8 A;  5B8A A;  2VL2 A;  2VAF A;  4IP6 A;  1K0N A;  2WUL A;  3LW9 A;  3IDV A;  3CTF A;  1ZL9 A;  4OMV A;  5IOW A;  2LNS A;  5JCU A;  3Q18 A;  4FYU A;  1XW9 A;  3VK9 A;  2H6Y A;  4KAE A;  1PN9 A;  1FO5 A;  4FQU A;  1HQO A;  1DE2 A;  5AIX A;  1TI3 A;  3RHB A;  1LJR A;  4V1A p;  1ERU A;  3DD3 A;  2IME A;  3QPM A;  3KJY A;  3IBH A;  2DJ3 A;  3ISO A;  2HSY A;  2N5A A;  3IRA A;  4X43 A;  6GSY A;  3TJF A;  3LFL A;  2FNO A;  3KIJ A;  5HQP A;  2OA7 A;  2CA8 A;  3C1R A;  2DKH A;  5JCG A;  5L71 A;  4ILF A;  1B48 A;  4TXO B;  3ME8 A;  2HQT A;  1HD2 A;  1GTB A;  5CRW A;  1WE0 A;  1SKS B;  1ML6 A;  2QC7 A;  2R5G A;  3F0I A;  3HZ8 A;  3HDC A;  1G7E A;  1XFL A;  4NXI A;  5B8B A;  4J2F A;  1K0O A;  1SD9 A;  1NHY A;  2YJH A;  5LNK e;  2ON7 A;  4ZL7 A;  1E6B A;  4ZBA A;  1GSE A;  4PUR A;  6GST A;  1A24 A;  1FAA A;  3KEB A;  2LKU A;  1UVZ A;  3UAR A;  3C73 A;  4MJB A;  3DYR A;  5A4U A;  1FOH A;  2VL2 C;  4Q5N A;  2F3M A;  4IJ3 A;  1EEM A;  1KTE A;  1V9W A;  4KH7 A;  2NDO A;  4BPY A;  2C8U A;  3EUR A;  2QSI A;  3ZZX A;  3IAS 2;  3IK7 A;  1M2A A;  1O7U A;  4HUA A;  2YV7 A;  2HRA A;  5G5F A;  3BJ5 A;  3W6G A;  4MF6 A;  2HE3 A;  4K2X A;  2BTO T;  4MH2 A;  5D8I A;  3IV4 A;  1TTZ A;  1AW9 A;  1H4O A;  5CRE A;  3C71 A;  1B9X C;  2IPA A;  1A8Y A;  2HNL A;  1O85 A;  2PN8 A;  3HYP A;  2DKI A;  4ECC A;  1O81 A;  4ECJ A;  4KF9 A;  3TCO A;  3TKQ A;  2B3S A;  1FVK A;  4MF5 A;  4IW9 A;  4O32 A;  3ZRD A;  5A34 B;  1X5E A;  4GDF A;  4HOJ A;  3ZVJ A;  3UIW A;  4F2I A;  2LQQ A;  20GS A;  1E2Y A;  1BG1 A;  5G30 A;  1XWG A;  5IMZ A;  3M9K A;  1DUG A;  2EIR A;  2LRN A;  2P5R A;  3LGC A;  2WDU A;  2H72 A;  2CVD A;  2R4V A;  2FLS A;  2YN1 A;  2EFE A;  1QQ2 A;  2EIO A;  2UV8 G;  1XW5 A;  2IMF A;  4MPF A;  3CBU A;  1GP1 A;  1QGV A;  4IVF A;  1OE7 A;  4G9H A;  3BCI A;  4OCF A;  5BMU B;  2C80 A;  5IPG A;  1RQM A;  4ML6 A;  5ID2 B;  4WKW A;  5F0G A;  1X5D A;  3KMN A;  4KCE A;  1W4V A;  1GTA A;  1J08 A;  4JRR A;  4PGT A;  4HDE A;  3RPP A;  4EIP A;  2N5F A;  4K2D A;  4G10 A;  2PGT A;  4POM A;  4ICY A;  2NTO A;  1YKC A;  3GKN A;  3IA1 A;  1TK8 B;  3ZRE A;  3CRT A;  4WF4 A;  3ERG A;  4G0L A;  2C0F A;  4MDC A;  1PRX A;  5F06 A;  3KGK A;  2JZS A;  3H4K A;  2V6O A;  2YP6 A;  1DBY A;  3U5R E;  1TW9 A;  3VFI A;  3UL3 A;  4HQS A;  2DIZ A;  3D4T A;  4K5R A;  4DSR A;  4LMW A;  4ECB A;  1USB A;  3H8Q A;  4MJE A;  1M9B A;  1EEJ A;  2F8A A;  3EVI A;  5IPH A;  1A0F A;  1F3A A;  1YEP A;  4I5Q A;  2H71 A;  1QUW A;  4RQX A;  2A2R A;  1GSY A;  5ECK B;  1WJK A;  1PKW A;  4TKY A;  1ERV A;  3O6T A;  1PX6 A;  4CW9 A;  3GTU B;  3IR4 A;  2C3N A;  3ZMK A;  1U87 A;  3TOT A;  4EO3 A;  4DSS A;  1THX A;  2VLV A;  2R3X A;  3G7Y A;  3TRP A;  1BQ7 A;  2UZ8 A;  4GF0 A;  1EZK A;  4PUF C;  5CP1 A;  1XWC A;  1TP9 A;  2X49 A;  3IAM 2;  2IWT A;  5DVB A;  5F8B A;  2EFD A;  4G0I A;  4EVM A;  1I9D A;  2HXK A;  4BVX B;  5DCH A;  1A23 A;  3KH9 A;  2R0C A;  3KCM A;  4KUN A;  2CVB A;  4AGS A;  1LU4 A;  1O73 A;  5AIV A;  4MNN A;  3R2Q A;  2YWO A;  2VOC A;  5HFK A;  4K0N A;  2VUP A;  4WR4 A;  1SK0 A;  2E2M A;  3N9J A;  3HZ4 A;  2L6D A;  2I3Y A;  3ZLP A;  1JZW A;  5KOX A;  1BG5 A;  3QR6 A;  3GSS A;  1W89 A;  3FZ4 A;  1FW1 A;  1I5G A;  4N0Z A;  4PQH A;  3FEU A;  1QK8 A;  4NWY A;  1G0T A;  4ULX A;  4EXJ A;  2RLI A;  2GSR A;  5KN2 A;  4H86 A;  2WFC A;  3QCP A;  2KHP A;  1WIK A;  5DJL A;  4NHW A;  5E4W A;  3FK8 A;  4KCA A;  4WR5 A;  1JLW A;  2GSQ A;  4K0G A;  1GUK A;  3MNG A;  3DVW A;  4LL4 B;  1A2M A;  1PSQ A;  3APQ A;  4IHU A;  3GKK A;  2DSA A;  2N5B A;  3A3T A;  4YKF A;  3GMF A;  2HT9 A;  1NW2 A;  3HVS A;  2B5E A;  4GWR A;  1FHE A;  1ZOF A;  4PXO A;  3F6D A;  1WPI A;  2GQK A;  4I97 A;  4TR3 A;  5D9V A;  1OC9 B;  3QAV A;  5EL8 A;  2HRK A;  7GSS A;  2CAI A;  3R3E A;  3M9J A;  4TRX A;  5DAK A;  4NMU A;  1K0C A;  2LJK A;  14GS A;  3F3Q A;  2B1K A;  2VIM A;  3RBT A;  4JE1 A;  5ECP B;  3HY2 A;  2L59 A;  3GN3 A;  2KP2 A;  2KP1 A;  1GL8 A;  5IMV A;  5J4Y A;  3LQ7 A;  1K0M A;  4JED A;  2VLU A;  3TUE A;  4DSQ A;  4IQA A;  1SJZ A;  5EVO A;  3NIV A;  4FYC A;  1HNC A;  1GH2 A;  2OE1 A;  4KW6 A;  4O5R A;  3TB2 A;  2MMN A;  4GTU A;  1XXU A;  4L0U A;  1QFN A;  2HSH A;  3EMX A;  5J41 A;  1B9Y C;  1XWA A;  3GUS A;  5ECN B;  3CRU A;  4XCS A;  5CRH A;  5G2Z A;  1PQN A;  4QL7 A;  1UN2 A;  4HU7 A;  3HKR A;  2PU9 C;  2RUE A;  4MH3 A;  3UEM A;  2L6C A;  4ZB9 A;  2B6M A;  2JSZ A;  4BVY A;  2RUF A;  2M46 A;  4A5P A;  5CAX A;  4E8H A;  1M99 A;  1ZYQ B;  3EU4 A;  4IJI A;  2EIQ A;  3LOR A;  4TR1 A;  1GUL A;  4D73 B;  1GTU A;  4O5Q A;  4AKG A;  2E7P A;  5IIZ A;  2HSM B;  3HA9 A;  1OC3 A;  1M9A A;  2VCZ A;  1BYE A;  2WJU A;  3VUR A;  4BL7 B;  2EC4 A;  2R37 A;  2IMD A;  2AHE A;  1V98 A;  1BED A;  2LNT A;  4EF0 A;  2YWN A;  2JL4 A;  4AJ8 A;  1GSF A;  5BRT A;  3L0H A;  2L5L A;  2K8S A;  4EE0 A;  3TKS C;  16GS A;  5CRG A;  3QOU A;  3A2W A;  3BBY A;  3LWA A;  4Z2U A;  2VM1 A;  4XS4 A;  2C3Q A;  2BJX A;  2REM A;  3PIN A;  2P31 A;  2A4H A;  3GX8 A;  2NPB A;  3IHQ A;  5J40 A;  1TJD A;  1G7O A;  2FA4 A;  3Q74 A;  2ES7 A;  1EV9 A;  1PD2 1;  1F6M C;  5ECS A;  2GT5 A;  4YAP A;  1T3B A;  1XPV A;  3TRX A;  4F82 A;  4W66 A;  2DC5 A;  2XC2 A;  2CX4 A;  2LJA A;  1GRX A;  3HJP A;  4ISD A;  4K1F A;  3FMW A;  4I8B A;  1PL2 A;  1FG4 A;  3PPU A;  1FVJ A;  3SWL A;  2MMZ A;  1AIU A;  5J5N A;  2WRT A;  5IM9 A;  4LMV A;  1XVW A;  1IYH A;  1Z3E A;  2B7J A;  2JSY A;  3PGT A;  5C04 A;  5DAL A;  3O3T A;  4PNG A;  4EKZ A;  2LQO A;  1HNB A;  2R0G A;  1TDI A;  4IQ1 A;  2GTU A;  1YF0 A;  2GGT A;  5B7C A;  3TJG A;  2EFH A;  1GTI A;  3RAZ A;  3BD2 A;  9GSS A;  1FOV A;  2A4V A;  5KN3 A;  4OD7 A;  1YQ1 A;  3EPT A;  5A1N A;  4TVE A;  3ZIJ A;  3GST A;  2YNX A;  3TOU A;  1F9M A;  1URM A;  3ME7 A;  3H1N A;  4KE3 A;  2DIY A;  2NBS A;  4WXT A;  4AJ6 A;  4L5L A;  5DCG A;  1X9M B;  1JZR A;  4AKX B;  4MJC A;  5A4W A;  5DDL A;  1M2D A;  3MSZ A;  4PQI A;  2LST A;  5ECI B;  4MA9 A;  5IO2 A;  2L57 A;  5IO0 A;  5IMD A;  5CO3 A;  1X5C A;  5CNW A;  1EWX A;  1VRS D;  1TU7 A;  1G6W A;  3TDG A;  2PBJ A;  1TRS A;  4K7N A;  2H19 A;  1DE1 A;  2ZCT A;  4V2L A;  1GSU A;  2IL3 A;  1HYU A;  3VI7 A;  3DIE A;  4HQZ A;  1VGL A;  1WOU A;  2I81 A;  2GSS A;  5KN0 A;  2K8V A;  3US3 A;  3E3E A;  4OO4 A;  3G9B A;  1MD3 A;  2V6K A;  4MAB A;  3ZFL A;  2VCT A;  4N3Z A;  1Z6M A;  3VWU A;  2O87 A;  2FA8 A;  5AN1 A;  5D93 A;  3D21 A;  3DVX A;  1Q98 A;  2DJ0 A;  4G2E A;  4XHM A;  3G7J A;  3CTG A;  3H93 A;  3ZVJ D;  4BWS A;  2L5O A;  1GLP A;  4KSM A;  5ELG A;  1Y6E A;  4ZIL A;  3Q6O A;  2VCX A;  3PH9 A;  4YQU A;  3GX0 A;  1TK0 B;  5J3R A;  1TXU A;  2LUS A;  4N0V A;  5HFI A;  2R6K A;  2C0E A;  2HLS A;  2AV4 A;  2DBC A;  2HZE A;  3ED3 A;  5IQY A;  2LRC A;  3QAW A;  3DML A;  5GAN D;  3VWX A;  4GQF A;  4IBP A;  2P5Q A;  1ZGN A;  3WT2 A;  2YOI A;  1TRU A;  4LA1 A;  3SBC A;  4PNF A;  1T4Y A;  2WGR A;  1MDK A;  4N11 A;  2H1L A;  1XOB A;  4MMM A;  3J7Y b;  2GQL A;  3N5O A;  4DVC A;  1F37 A;  2C0G A;  2VL9 A;  3IK9 A;  4KDY A;  4I2T A;  4PQ1 A;  4TXV A;  5DQS A;  1GLQ A;  4KA0 A;  2RII A;  2HSN A;  3GNJ A;  3VPQ A;  3CMI A;  2IFQ A;  2O89 A;  5HR1 A;  3KH7 A;  3A2V A;  1RK4 A;  1OE8 A;  1XCC A;  2CQ9 A;  2H30 A;  3D0Z A;  1AUC A;  3L9V A;  2H0H A;  4AJ7 A;  3F3R A;  3GUR A;  5A5H A;  3UVH A;  1S3D A;  1FB6 A;  2CT6 A;  3RHC A;  3RDW A;  5G31 A;  4TOP A;  2C4J A;  1M0U A;  2KLX A;  5A5K A;  3F4T A;  3LXZ A;  1VF3 A;  2YWM A;  4MPG A;  2X4A A;  4NV2 A;  4MP4 A;  4PX1 A;  2CVK A;  1Z7R A;  2DML A;  2VL3 A;  3A2X A;  4MK3 A;  4EIQ A;  4JBB A;  3GV1 A;  1MDJ A;  1H75 A;  4X1U A;  4K7O A;  5H5Q A;  3P90 A;  3UJ1 A;  3V1W A;  5C00 A;  3OR5 A;  1ERW A;  1WWJ A;  3HJO A;  4KSO A;  1N8J A;  2OAD A;  4Q5F A;  4HJM A;  3ZL5 A;  3UOM A;  4POB A;  4V2N A;  1XWK A;  4ZBD A;  1PX7 A;  3KD0 A;  3HCZ A;  3WYW A;  3EYT A;  3F4R A;  1NSW A;  1A8L A;  2A2P A;  2H6X A;  2PWJ A;  4O7H A;  2QA1 A;  1TXX A;  2OE0 A;  3ZIT A;  5D96 A;  1O6J A;  1PMT A;  2VM2 A;  2ON5 A;  3GH6 A;  3FR9 A;  8GSS A;  4V1A g;  4CHS A;  3EMP A;  1RW1 A;  6GSV A;  1XWB A;  3F8U A;  3VI5 A;  3F4S A;  5AIS A;  5J4U A;  3DXB A;  5DBQ A;  1SU9 A;  2XPE A;  3I6A A;  2X8C A;  4OFT A;  1V58 A;  4ZIJ A;  3KP9 A;  2IJY A;  1SEN A;  1ST9 A;  4GRF A;  2LTK A;  4LL1 B;  3LXT A;  4Q5R A;  2XPD A;  5INY A;  1M2B A;  4MZB A;  1XBS A;  1CQH A;  4FYB A;  4GSN A;  4P3Y B;  2O8V B;  1VF4 A;  1YDK A;  2OBK A;  4NHZ A;  1OC8 A;  5LCZ A;  3LEF A;  2DJ1 A;  4CY6 A;  3GYK A;  4JR4 A;  4QQ7 A;  4OFM A;  1SJ6 A;  3A5I A;  1Z5Y E;  2OAC A;  1KEB A;  1JZO A;  2FWE A;  3TU3 B;  2H1A A;  3UMA A;  4ML1 A;  4ECI A;  5ECR B;  1U88 A;  1XZO A;  1AC1 A;  3LYK A;  4JZQ A;  13GS A;  1TI1 A;  3WGE A;  2K6V A;  3D6I A;  3MIX A;  2H75 A;  5F05 A;  1GNW A;  1Z9H A;  3C8E A;  2V41 A;  4ZB6 A;  1CQG A;  2KUC A;  1O8X A;  2HRN A;  2AB6 A;  17GS A;  2YZH A;  1JZD A;  3CSJ A;  3TKS E;  4NPB A;  2GZY A;  1PL1 A;  5H5S A;  4FO5 A;  5JCW A;  3ERF A;  1PN0 A;  1U3A A;  3GH9 A;  3M3M A;  3F63 A;  4TN8 A;  4KGI A;  5ECH B;  3UVT A;  3HVX A;  1OC9 A;  4GCI A;  4IP1 A;  1SKW B;  4V2M A;  2HFD A;  1U6T A;  2LV3 A;  3JCM L;  3UBK A;  3QFB C;  3CSI A;  5G5E A;  3IC4 A;  4ZL9 A;  1ZYE A;  3E0U A;  4RUV A;  3TKS A;  3D4M A;  2QA2 A;  3LSZ A;  3LG6 A;  4KND A;  12GS A;  2HRK B;  2C0D A;  3EE2 A;  3QDN A;  2M72 A;  2MMA A;  5J9C A;  2GLR A;  5DAK B;  3S9F A;  2I9H A;  4YAV A;  4CY8 A;  1V57 A;  1WRY A;  5JWQ B;  5IMC A;  4Z2R A;  1V40 A;  4KX4 A;  4ACS A;  3HHV A;  2PVQ A;  3IXR A;  2PER A;  3KZQ A;  2K18 A;  3L9U A;  1SL0 B;  1B8X A;  1JFU A;  2TIR A;  3L78 A;  4PUA A;  3GKX A;  4FH8 A;  3F9U A;  2FWF A;  2GQM A;  3RPN A;  4E68 A;  3P2A A;  4FIW A;  3A5W A;  3TKR A;  2DLX A;  1T1V A;  2WS2 A;  2E2G A;  2O85 A;  3TJK A;  2OJL A;  3TKP A;  2J23 A;  3DRN A;  2FY6 A;  1YZX A;  1UA5 A;  3QFA C;  3MAK A;  2HSM A;  5AGY A;  4BA7 A;  2OKA A;  4JU5 A;  4TR1 B;  1R26 A;  4BL7 A;  3KMO A;  2JZT A;  2MYG A;  3DEX A;  4XRA A;  3DKS A;  1SJI A;  4AKH A;  2CX3 A;  4TR4 A;  4CDO A;  1IYI A;  1K0B A;  1GWC A;  4MJA A;  3I69 A;  1K3O A;  3QAG A;  2MMO A;  1GUM A;  1AAZ A;  2IIY A;  2XBQ A;  1B4Q A;  2F8F A;  1TRV A;  2IMK A;  2FWG A;  1S3A A;  2YPM A;  1JHB A;  1N2A A;  5ECQ B;  5GSS A;  4G19 A;  5J4V A;  3WD6 A;  1ZMA A;  3L9S A;  3LYP A;  2FHE A;  3P7X A;  4HZ2 A;  1ZCP A;  4K7I A;  1SKR B;  1F2E A;  1A0R P;  1A2L A;  1QMV A;  1F3B A;  2F51 A;  2YJ7 A;  1J0F A;  4XS4 B;  3IE3 A;  3U6V A;  1ON4 A;  1Y25 A;  1K3L A;  3DGQ A;  4POK A;  1KBN A;  3I43 A;  1GSD A;  3I9V 2;  1JLV A;  4LLR A;  1PA3 A;  4EUY A;  1MD4 A;  4ZB7 A;  10GS A;  3GL5 A;  4QMK A;  4I6X A;  4HS1 A;  4KB3 A;  3TJB A;  1QXH A;  4BWQ A;  2H1B A;  3UAP A;  4GQC A;  4XS6 A;  4X0X A;  2ZNM A;  4TXO A;  2HI7 A;  1TKD B;  1O8W A;  2H73 A;  3M0F A;  2K9F A;  3EC3 A;  2G0F A;  3FHK A;  1K0A A;  1G6Y A;  4ZL8 A;  5DAL B;  3W8S A;  4TW5 A;  2RM5 A;  1T8E B;  2OBI A;  5A4V A;  5A1N B;  1SVO A;  1HNA A;  4IEL A;  2M80 A;  2Z9S A;  3NZN A;  4O5U A;  2GS3 A;  2QKE A;  4OO5 A;  3WGD A;  1J9B A;  2H8L A;  1ZYP A;  4USS A;  5COH A;  2F9S A;  3VPT A;  2VD0 A;  2XHF A;  1XVQ A;  2WB9 A;  3GHA A;  4I2U A;  4DEJ A;  2B5X A;  4WBJ A;  4WF5 A;  1XOA A;  2CV4 A;  1AXD A;  2O7K A;  1S3C A;  3FY7 A;  3EWL A;  1R5A A;  1YEX A;  4HI7 A;  3IPZ A;  3ZTL A;  3J7Y k;  2B7K A;  2VCQ A;  3KP8 A;  22GS A;  4EL1 A;  2JZR A;  1YVL A;  2I1U A;  4GST A;  3APS A;  2J9H A;  2HRF A;  3O76 A;  1EGO A;  4ID0 A;  5IMF A;  2CZ2 A;  3L4N A;  3P8W A;  4XS1 A;  5A34 A;  3GIX A;  3KTB A;  1OYJ A;  5EPF A;  5GZZ B;  6GSW A;  2YCD A;  2QGV A;  2H0G A;  4K8M A;  4MLY A;  2AAW A;  4EDY A;  3BCK A;  1T7P B;  5ECM B;  1A2J A;  4Z7X A;  2NVL A;  1EP8 A;  1SVL A;  2B1L A;  1X9W B;  4K9Z A;  5ELA A;  2HZE B;  6GSX A;  4WET A;  4L0W A;  2C1Y A;  2FWH A;  4J57 E;  2GZZ A;  2BMX A;  3VWW A;  2OE3 A;  4AF2 A;  3FZA A;  5FHI A;  1AQV A;  1OAZ A;  4XRD A;  1TRW A;  1TU8 A;  1ACV A;  5IOX A;  4IN0 A;  2XBI A;  3HMJ G;  4YH2 A;  4RI7 A;  3ZML A;  2IN3 A;  2YAN A;  5DQY A;  5BMU A;  2I4A A;  1T00 A;  4F9Z A;  1ABA A;  3MWH A;  2MBT A;  4N30 A;  4L8E A;  5ID2 A;  1PGT A;  2HSN B;  1ZZY A;  5ABR A;  2IFQ B;  2TRX A;  2ZUP A;  1KNG A;  2ALB A;  4OFN A;  2L4Q A;  2JU5 A;  1SYR A;  3WGX A;  5D9W A;  5G1K A;  3ZIV A;  1YF1 A;  1MEK A;  2DMM A;  4N10 A;  4MCU A;  3TGZ A;  5A5H B;  2H66 A;  2CZ3 A;  5H5R A;  3TJJ A;  2LRT A;  3KM6 A;  1XW6 A;  2AYT A;  5J47 A;  6GSU A;  1M7T A;  1GSS A;  5GAP D;  19GS A;  3PR8 A;  1YJ6 A;  3KXO A;  5GST A;  3C1S A;  1SL2 B;  4F0C A;  5HR3 A;  4TR0 A;  5G1L A;  1NM3 A;  1U3I A;  2X8G A;  3HD5 A;  4NAX A;  3EU3 A;  5D9T A;  2IMI A;  1X9S B;  3FZ9 A;  1BX9 A;  1BF5 A;  1SK1 A;  1EOH A;  2VLT A;  1SYX A;  5HFG A;  4ZXG A;  3D22 A;  4RQR A;  3IHG A;  5J9B A;  5D73 A;  1SD8 A;  1UC7 A;  2H1D A;  2VKZ G;  2WZ9 A;  2MZC A;  1Y1U A;  2YWI A;  3MYD A;  2PPT A;  5CYY A;  3CYN A;  2MBS A;  2AUV A;  5CRD A;  3GTU A;  5KOW A;  5JWR B;  1FB0 A;  1K3Y A;  2X99 A;  3Q19 A;  1V2A A;  2CAQ A;  3MDK A;  3GRX A;  2P0G A;  1EOG A;  1EV4 A;  4PTS A;  3VLN A;  3IOS A;  5JWO B;  2LJR A;  1T4Z A;  2V2G A;  2H6Z A;  4HU9 A;  2R2J A;  2OT3 A;  4WBR D;  5B6N A;  2GST A;  1MDI A;  2LEG A;  3D5J A;  4DSS B;  3ERW A;  4BVX A;  3APO A;  5F07 A;  1OVN A;  4JR6 A;  1OKD A;  1MTC A;  2X8H A;  4IS0 A;  2HZF A;  3BOA A;  4KDX A;  3LJR A;  2FD3 A;  2RM6 A;  2FGX A;  3C7M A;  1SK2 A;  4NV5 A;  4Z2T A;  1ERT A;  3FZ5 A;  11GS A;  1SVM A;  4MZC A;  3GKM A;  2VD1 A;  3IC8 A;  1YY7 A;  1R7H A;  4IKH A;  4EC0 A;  2DJ2 A;  3F6F A;  2V1M A;  4J56 E;  3VWV A;  3G7I A;  4KDU A;  2V32 A;  3FW2 A;  3AY8 A;  3M1G A;  4XIH A;  3HXS A;  5HR2 A;  2C3T A;  3FYG A;  1BJX A;  3QD9 A;  1XIY A;  3QMX A;  4YKG A;  1SL1 B;  2PVO C;  1GUH A;  2B5Y A;  1EGR A;  2E0Q A;  1TOF A;  4GLT A;  4O92 A;  2O5V A;  3HJM A;  4X4J A;  5E59 A;  1DSB A;  4OWY A;  2GZP A;  4L5O A;  3E9J B;  18GS A;  2GT6 A;  1GNE A;  1TK5 B;  1VF1 A;  2KOK A;  1Q4J A;  1N25 A;  1BAY A;  3UBL A;  3ZFB A;  3FR3 A;  5KN1 A;  1C72 A;  2GVP A;  2DJJ A;  4WEY A;  2L4C A;  2PMT A;  4POL A;  4MZW A;  2FCH A;  2LS5 A;  3FRC A;  1R4W A;  1EP7 A;  1GSQ A;  2FUG 2; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...