3IK9A

Human gst a1-1-gimf with gsdhn
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
219
structure length
219
Chain Sequence
b'AEKPKLHYFNGRGRMESTRWLLAAAGVEFEEKFIKSAEDLDKLRNDGYLMFQQVPMVEIDGMKLVQTRAILNYIASKYNLYGKDIKERALIDMYIEGIADLGEMIIMLPFCPPEEKDAKLALIKEKIKNRYFPAFEKVLKSHGQDYLVGNKLSRADIHLVELLYYVEELDSSLISSFPLLKALKTRISNLPTVKKFLQPGSPRKPPPDEIYVRTVYNIF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glutathione S-transferase A1
publication title Substrate specificity combined with stereopromiscuity in glutathione transferase A4-4-dependent metabolism of 4-hydroxynonenal.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 80
structure length 219
sequence length 219
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2009-08-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00043 GST_C Glutathione S-transferase, C-terminal domain
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 3ik9A02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3ik9A01
1JZWA 1E6BA 1GUMA 4MLYA 2MMZA 4JBBA 2IFQA 2YPMA 1ACVA 4NV2A 2OA7A 2H71A 4TRXA 1MDIA 2DIZA 3DGQA 1F3BA 1QFNA 4N0ZA 1K0NA 14GSA 4XTSA 2RIIA 5IPHA 1XWAA 2VLTA 4MABA 4HZ4A 3FZAA 5ABRA 2HZEA 2VL9A 4WETA 3IK7A 3VPQA 4ZL8A 5AN1A 5D9WA 3EMPA 1O7UA 1TI1A 2NTOA 5ECSA 2K9FA 3CYNA 5D93A 5DCHA 1G6WA 1XBSA 1XZOA 1A23A 5CRWA 1PQNA 4LMWA 1OC3A 1DUGA 2LQQA 3RDWA 2AAWA 1MTCA 1A0RP 3DKSA 2VLVA 4POKA 4XS6A 1TU7A 4GSNA 1PD21 3ZLPA 2AUVA 2H30A 2A4VA 5AIXA 2YP6A 1O8WA 5INYA 4IGJA 3KP9A 4J57E 3TKSC 2GQLA 5HR2A 3FHKA 4V2MA 1GUKA 1N2AA 2XPEA 1GSYA 3KGKA 3IAM2 2HRKB 2PWJA 2MYGA 1NHOA 2H0HA 4AJ7A 2L4CA 3LXZA 4JZQA 1PRXA 2FA4A 1OVNA 5AISA 2VO4A 5F8BA 2CT6A 2DJ1A 2PVQA 1FG4A 2M46A 5FT3A 6GSSA 3G7IA 4G19A 1GTAA 3KH9A 3ZRDA 4OFNA 3DIEA 2O87A 3W6GA 4CHSA 5CAXA 2DSAA 2IWTA 4KA0A 2M80A 1LU4A 2DBCA 3GKMA 1FHEA 2V6OA 3L4NA 1M2BA 3TCOA 3MAKA 1HD2A 1SYRA 4F9ZA 1B9YC 2JZTA 3EU3A 3BJ5A 4YQMA 2H6ZA 2X8GA 3LWAA 1OC9B 1M99A 1FAAA 2LS5A 1J0FA 5G31A 4BWQA 2R2JA 4NMUA 4WKWA 3HA9A 4YQVA 1TK8B 1YF0A 2FHEA 1WRYA 3O3TA 2EIRA 5ENUA 3ERGA 4XHMA 2V32A 4XRDA 3DWVA 3CSHA 2OE3A 3IR4A 2IMFA 3DVXA 3TUEA 1XXUA 4MPGA 1O85A 4G10A 2EIOA 5G5EA 2ON5A 4ACSA 5IPGA 3FRCA 4I97A 5A4UA 4MPFA 5G5FA 1SJZA 2LTKA 4K7NA 3HXSA 3GYKA 1PL2A 2E7PA 4WF5A 2KHPA 3GNJA 1TK0B 2ZNMA 3D21A 1M9BA 4OFTA 4O7HA 6GSXA 2WDUA 1T8EB 2O7KA 2K8VA 4OO5A 4RQRA 1NHYA 1TRWA 1XPVA 1EWXA 1K0DA 3UL3A 2C1YA 5BMUA 2MBTA 2L6DA 5GZZB 3BD2A 4DSQA 2LUSA 3KH7A 4JR4A 5CRHA 1B9XC 3GFKA 3ZL5A 3ERWA 5ECMB 1U3AA 3D22A 2HSMA 2DJ3A 1TI3A 1FVJA 2LRNA 1QK8A 2IN3A 3L0HA 2K18A 1GWCA 1ZL9A 1XW9A 1OC8A 4FYUA 4L8EA 4TR1A 2C8UA 2VCXA 1SL2B 1T4ZA 2V6KA 1HNCA 3FEUA 1XWKA 1TRVA 2P5QA 4ID0A 1ST9A 2GZZA 1BQ7A 3IC4A 2GQMA 1SL0B 2L5OA 2GTUA 2FWFA 4TW5A 1PX6A 2X8CA 1HYUA 4JRRA 3GX0A 1NSWA 3CRUA 3TRXA 2B7KA 3LYPA 1ZOFA 1JLWA 2V2GA 4USSA 2FD3A 2NBSA 1PL1A 3F6FA 5ECOB 4BA7A 1TW9A 3GRXA 3ZIVA 2H01A 4POLA 4FH8A 2JSYA 4L0WA 3DMLA 3FY7A 1ZGNA 5H5SA 4MJCA 4H86A 1R4WA 3W8SA 3PINA 4NAXA 2X99A 5IM9A 3NZNA 4X43A 1K0MA 1K3LA 1KEBA 1USBA 4G2EA 4IJ3A 1Z6NA 2R5GA 3VWVA 1JLVA 2MBSA 3O6TA 5JCWA 3IDVA 2DC5A 5DALA 1DE2A 3WGXA 2DJ2A 4IQAA 3HZ8A 3IV4A 4XCSA 2VM1A 4V2NA 1M2AA 3CSJA 4IS0A 3KJYA 3TJJA 2LV3A 2GSQA 2R6KA 1WP0A 3KTLA 4IQ1A 6GSUA 4HJMA 3U6VA 3R3EA 1R5PA 1V58A 4DSSB 2D2ZA 4XRAA 4F0CA 2VCQA 3PPUA 1R26A 1FB6A 3LJRA 1PX7A 5DCGA 5JCUA 5EPFA 4ZIJA 2VD1A 3KP8A 3E9JB 3TGZA 3M0FA 4ULXA 1TXXA 2F8AA 2QGVA 1Z6MA 2FWGA 3QD9A 1ABAA 1SD8A 1GSSA 5GAPD 4O92A 20GSA 3QOUA 5HFGA 1SK0A 5D73A 9GSSA 5G1KA 3QCPA 4IW9A 3UJ1A 3EC3A 1W4VA 3QDNA 3VK9A 1O6JA 4HU7A 2RUEA 2AV4A 4EUYA 2GSRA 4LMVA 4HZ2A 4XS1A 16GSA 1XWCA 4D73A 1THOA 4HS1A 1J08A 5J3RA 3WYWA 2WULA 4RQXA 3IK9A 4OD7A 3ZZXA 2IJYA 5C04A 5D9TA 5IMCA 3F9UA 2YWNA 1SJ6A 4KSMA 2IPAA 5ECNB 1SU9A 1VF3A 2WB9A 3KCMA 1T3BA 3L9SA 2H72A 3WD6A 3QAGA 5ECQB 5F05A 5IQYA 2H1GA 2H8LA 2IFQB 5HR0A 3VI7A 4ECJA 2GQKA 1U3IA 2CX3A 2MMAA 2YZUA 4TR3A 1U87A 3HZ4A 5B7CA 3M8NA 3GV1A 1QXHA 3M1GA 5IOXA 3K8NA 3GUSA 4PURA 2HZEB 2H76A 4F0BA 3ED3A 2H1BA 2V1MA 1OAZA 3F4TA 2KLXA 2HSNB 2N5FA 1CQGA 2CZ3A 2MMNA 5DAKA 2GSTA 4G0IA 3A2WA 2CVDA 1GULA 3V1WA 2VCTA 2VLUA 3I69A 1SK1A 2K8SA 1TTZA 2JZSA 2I3YA 3ZMKA 1AIUA 3F4RA 4ILFA 3S9FA 5F06A 2H0GA 1GTIA 10GSA 1A2LA 2M72A 4X0XA 2H73A 1I9DA 4ISDA 2CVKA 1EGOA 4IELA 5IMDA 5LCZA 2O85A 5HR1A 4BVXA 2YANA 1WE0A 3I9V2 1EV4A 3I6AA 2CX4A 2OE1A 3RBTA 3VWXA 1BX9A 5ELAA 2XPDA 1UVZA 1VF4A 1UA5A 4PGTA 2WCIA 4YQUA 4KDUA 1SENA 4EKZA 4P3YB 1MDJA 3C71A 3N5OA 1H4OA 8GSSA 1Z7RA 1ZYQB 5D9VA 4PNGA 3J7Yb 1X5EA 2LQOA 3GL5A 5IMAA 4TR0A 3KM6A 3QPMA 2C0GA 4O32A 1IYIA 1GUHA 4HQZA 3EWLA 1TU8A 4KGIA 1AQXA 1ILOA 4TXOA 2PGTA 2C3TA 3IXRA 4MDCA 4IN0A 4MH3A 4NPBA 4JEDA 4MJAA 3H4KA 3TRPA 1T7PB 3N9JA 4WR4A 2XC2A 1X9MB 4QL7A 1JZDA 4PQHA 1S3CA 2P5RA 11GSA 2PVOC 3GKKA 5CYYA 3WGDA 2PU9C 3H1NA 1AW9A 4PQIA 2VL2A 4K8MA 3H8QA 3LEFA 4IKHA 5CRGA 3ZITA 2YV9A 3MSZA 2WZ9A 3P90A 5AGYA 3ZFBA 1SD9A 4MF6A 5FWGA 4EDZA 2JZRA 3U5RE 4HUAA 5DQSA 5J5NA 2R4VA 4MF7A 3KD0A 4XS4A 4OWYA 1F37A 1A0FA 3TJFA 3CBUA 2FGXA 4X1UA 2C3NA 1XWGA 1YF1A 1VF2A 5IO0A 2VCVA 1RK4A 5IO2A 1WPIA 2REMA 5COHA 1G6YA 3ERFA 2F51A 2VAFA 2H1DA 4PUAA 1PSQA 3QAVA 1ZZYA 4Q5FA 5GAND 3WT2A 2QKEA 3FR6A 4EL1A 3F3RA 1B8XA 4I5QA 2YJ7A 1YEXA 4E8EA 4ZILA 3D4TA 2HSHA 5A4WA 3BCIA 5A5KA 4K0NA 3RPNA 4FYBA 2F9SA 3KEBA 2L4QA 3A5WA 4DSRA 4AGSA 4IHUA 2HSMB 5JWQB 5EVOA 3Q19A 1EOGA 3ISOA 1RW1A 3GKXA 5ECPB 1GRXA 1FB0A 3HJPA 4ZBAA 3D5JA 1B48A 3E3EA 3RHBA 1FVKA 4TR1B 3HVVA 3L78A 5J4UA 4FIWA 4IP1A 4KNDA 4OCFA 3TKRA 4K7OA 3DVWA 3GHAA 1XW5A 1MDKA 3FZ9A 6GSYA 5DVBA 1EZKA 5HQPA 1A8YA 2Z9SA 3E0UA 5A4VA 6GSVA 1IYHA 2I9HA 1PA3A 1SK2A 2PUKC 5AIVA 4IP6A 3TRQA 2RUFA 1K3YA 2YNXA 2B5YA 3M9KA 2H6XA 3ZMLA 3GSTA 2PN8A 3C1SA 4NHZA 1DE1A 1TP9A 2N5AA 4PQ1A 2YWIA 4GXZA 5CNWA 2OACA 2JADA 1H75A 1GLPA 4L5LA 2E2GA 3UVHA 2YCDA 4MMMA 2A2RA 1ERWA 2GT5A 4EE0A 2PBJA 3GN3A 5DALB 4TN8A 1OKDA 4QL9A 4YH2A 1V98A 1ZCPA 2HLSA 5KN2A 4WBJA 2MZCA 3QMXA 5ECKB 4KCEA 1KTEA 3L9UA 3TB2A 2E2MA 2L6CA 2CAIA 1GTBA 3GTUA 4ZL9A 3ME8A 5HFKA 3UMAA 1A8LA 3DRNA 1XVQA 2WGRA 1T4YA 2TIRA 4BVYA 3F8UA 1BAYA 1G0TA 1SKWB 2C0FA 1FOVA 2CAQA 2J23A 3ZIJA 3BBYA 3UOMA 2DIYA 1TRSA 1K0AA 1HNAA 5DJMA 1EP8A 1BYEA 3VFIA 1BG5A 2AJQB 5DJLA 1XW6A 1V57A 3VPTA 3QFBC 2HI7A 2X8HA 1ON4A 4FQUA 5KEJA 2N5BA 4V2LA 3KIJA 2JU5A 2H0IA 4O5RA 3OR5A 4K2DA 1YKCA 4MH2A 2B1LA 3VWWA 5F07A 3A2VA 3Q6OA 1XOAA 1E2YA 2QSIA 3KMNA 1S3AA 1HQOA 3P2AA 5IOWA 2IMEA 2F8FA 2GVPA 3GKNA 3ZTLA 4Q5RA 3C8EA 1V40A 3LORA 1LBKA 2DMMA 3UAPA 4GSSA 5HR3A 4D73B 2O8VB 3UARA 3UBLA 5ECIB 1VRSD 2V41A 2FNOA 2R37A 1A2MA 5GSTA 2LJKA 3IAS2 1X5DA 4POMA 1XOBA 2HRNA 4EDYA 2R3XA 4FYCA 3EYTA 4ECCA 1AUCA 5KN1A 13GSA 2BJXA 4GSTA 3DEXA 5F0GA 3CMIA 2B7JA 19GSA 3ZVJA 1SYXA 3DYRA 3F3QA 3TKQA 2BTOT 3L9VA 1TK5B 5J9BA 1GSEA 3RHCA 3FR9A 1MD4A 4RI7A 1PKWA 2RLIA 2ZCTA 1QMVA 2BMXA 2NDOA 5G30A 4LLRA 1ERTA 4ML1A 1QGVA 4MZCA 4ZB9A 5ID2B 2KUCA 2QC7A 1SL1B 1WIKA 3TOTA 3IRAA 2B1KA 1BJXA 4N11A 3LSZA 3F6DA 3KMOA 3QAWA 2H6YA 4OCEA 4KF9A 3PH9A 3CTGA 12GSA 3F4SA 3EMXA 3P7XA 3F63A 4MJEA 1EOHA 2JL4A 3WGEA 4K9ZA 2WFCA 2J9HA 3VI5A 4N10A 3Q74A 2FUG2 2DMLA 1AAZA 5D8IA 2G0FA 2FLSA 1YEPA 4AJ6A 4KX4A 1JFUA 5EL8A 4E8HA 4ML6A 4NWYA 3HVXA 4N30A 5DQYA 2KP2A 4JE1A 4KCAA 4MZBA 5GSSA 4WBRD 2HFDA 3UEMA 5J9CA 1OE7A 3HCZA 5JWRB 1M7TA 2AYTA 3C73A 1R7HA 2I1UA 1PGTA 2VL2C 2VL3A 1O8XA 3GA4A 1PKZA 3EURA 4AF2A 2ALBA 2GSSA 2RM5A 3TJBA 1ML6A 4GWRA 1SKSB 2NVLA 3QR6A 3HJOA 5KN3A 4GQFA 4EXJA 4RI6A 2B5XA 2CVBA 2WJUA 5EY6A 4WF4A 4L0UA 4F82A 2HXKA 3LXTA 2YWMA 3QFAC 2I4AA 4ECIA 2YJHA 6GSTA 3J7Yk 2OBKA 4EC0A 1F6MC 2FWEA 5B8BA 2E0QA 4JU5A 4PTSA 2UZ8A 3D6IA 3KZQA 3GL3A 2LJAA 2FWHA 2VOCA 5D96A 2C3QA 4RUVA 4XIHA 1F9MA 4BL7A 2YOIA 1JHBA 4ECBA 2OADA 4PXOA 2LNTA 3LFLA 3IC8A 4DEJA 1XIYA 1JZRA 3HKRA 3UIWA 4I2TA 1U88A 4Z7XA 2LRTA 2H74A 3HY2A 3DD3A 1M0UA 1EP7A 2EIQA 4MK3A 2KP1A 5ECHB 3APSA 3JCML 3O76A 3TKPA 2C4JA 3KXOA 4IBPA 3RAZA 2XBQA 3Q18A 2G2QA 4XS4B 3US3A 2LSTA 3TJGA 1TKDB 4L5OA 1T00A 1V2AA 1Z3EA 1X0RA 3CTFA 1OE8A 4HOJA 1O81A 2LRCA 4LL4B 1XWBA 4G0KA 1Y6EA 2X64A 1F2EA 5J41A 4K1FA 3VWUA 5B6NA 1YJ6A 4HEA2 3PR8A 2YN1A 3IOSA 4MZWA 5KN0A 1TOFA 2IMIA 3EINA 2HZFA 4KSOA 4GLTA 2YWOA 3A2XA 1MEKA 3ZFLA 4EF0A 3GH9A 1G7EA 2GGTA 2GZPA 4YAVA 3M9JA 4KUNA 3C7MA 1Z7PA 1FW1A 1UC7A 2FA8A 4CDOA 1YDKA 1TRUA 2OJLA 4KAEA 1B4PA 2DJKA 3IPZA 1SKRB 2VCWA 3GX8A 3R2QA 4LL1B 1ZYEA 4TKYA 4PNFA 5CO3A 4TOPA 1S3DA 3F0IA 3MWHA 1N8JA 3PGTA 4MF5A 2HRKA 17GSA 1OYJA 3HD5A 2OKAA 5JCGA 1FO5A 5DDLA 3M3MA 1QUWA 3APOA 5JWOB 4J56E 5L71A 2LEGA 1F3AA 2B5EA 3DXBA 1W89A 1G7OA 1X9WB 5G2ZA 7GSSA 2YZHA 4MA9A 4Q5QA 3G7YA 4MCUA 2ES7A 2KOKA 1XVWA 4BPYA 3G9BA 2IIYA 1GSUA 5DBQA 1DSBA 1GTUA 4N0VA 5LNKe 1B4QA 2FY6A 4NXIA 3NOFA 4KH7A 3IA1A 3D0ZA 5E4WA 18GSA 3VLNA 1VF1A 22GSA 5ECRB 5IMFA 2TRXA 3TKSA 2GZYA 3EVIA 4GQCA 3EE2A 4AJ8A 3IE3A 5B6MA 3IBHA 2TRCP 2JACA 3GTUB 4PX1A 1OC9A 1YKAA 3TKSE 2GLRA 5ELGA 4TR4A 2CV4A 4OMVA 2H1AA 3LYKA 4J2FA 2EC4A 4TVEA 3WT1A 3ZYWA 3GSSA 3FW2A 4TXVA 4BVYB 1MD3A 3FK8A 1JZOA 1K0OA 1YZXA 1XCCA 3CSIA 1J9BA 2PMTA 2DJ0A 4POBA 1QQ2A 1GP1A 2RM6A 2VD0A 4OFMA 1THXA 3LGCA 1EGRA 1K3OA 3GURA 1TJDA 1GNEA 2H70A 3HDCA 4G0LA 2YV7A 5E59A 4EO3A 3UBKA 4HU9A 1AQWA 2C0DA 1SJIA 1X9SB 2DLXA 4I2UA 4GTUA 2HQTA 5FHIA 6GSWA 4WEYA 3H93A 3AY8A 2H19A 1K0BA 4HQSA 3GH6A 3SWLA 2HE3A 1Z5YE 4KE3A 2JSZA 1WOUA 2LJRA 5H5QA 5IMVA 3CRTA 2XHFA 3GIXA 3GMFA 2AHEA 2CQ9A 3ZREA 1NM3A 1YQ1A 2FCHA 1GL8A 2H75A 5H5RA 2HYXA 2GDRA 4HDEA 1WJKA 3HVSA 3MNGA 1XFLA 2MMOA 3RPPA 2I81A 3HJMA 1T1VA 4WR5A 2VCZA 4MP4A 3NIVA 4KDYA 1VGLA 3TDGA 4V1Ag 2HT9A 1GSFA 1K0CA 2B3SA 1WMJA 4V1Ap 5IIZA 4ZBDA 3G7JA 5HFIA 2LNSA 3BCKA 2H66A 2P31A 4OO4A 2CZ2A 5LD0A 1A2JA 2VUPA 4GRFA 2HRAA 1GSQA 5G1LA 1KNGA 1I5GA 4ZXGA 1AC1A 3VURA 1A24A 1DBYA 1Y25A 4GF0A 4EVMA 1YY7A 4HJ2A 2CA8A 2OE0A 2VM2A 3H79A 1PN9A 1V9WA 4JR6A 4NV5A 3C1RA 4FO5A 3FYGA 2L5LA 1KBNA 4K6XA 4CW9A 5IMZA 2IMDA 5CRDA 3IHQA 3TOUA 2L57A 4IVFA 4K0GA 2PERA 4KW6A 3APQA 1U6TA 1URMA 1ERUA 4KDXA 4HI7A 1Z9HA 2C0EA 4GCIA 1AQVA 1ZMAA 3I43A 4WXTA 1O73A 3CXGA 3HYPA 4PUFC 1GLQA 2P0GA 2IL3A 4LA1A 4MJBA 1RQMA 4QQ7A 4ZBBA 1GSDA 1UN2A 1Q4JA 3W8JA 4DSSA 1M9AA 2OBIA 2VIMA 4ZL7A 2HNLA 2F3MA 5DAKB 4NHWA 3LQ7A 2O89A 1HNBA 1GH2A 4BWSA 3FZ5A 5ECLB 2C80A 1TDIA 4I6XA 4F03A 1EEJA 2GS3A 1LJRA 1C72A 4G9HA 2WS2A 3A3TA 5C00A 4ZB6A 3HHVA 2LKUA 3P8WA 2B6MA 4IJIA 2GT6A 5D9XA 1ERVA 5B8AA 1AXDA 2PPTA 4DVCA 2L59A 1PMTA 1Q98A 3TJKA 4BVXB 3KTBA 4K7IA 2A2SA 3MDKA 4I8BA 3FZ4A 3ZVJD 4F2IA 3LG6A 4BL7B 3D4MA 1NW2A 1X5CA 2DJJA 3EU4A 3FR3A 4ZB8A 5ID2A 4YAPA 2ZUPA 1EV9A 1GNWA 2ON7A 4KB3A 1EEMA 1BEDA 2HRFA 2WRTA 3BOAA 5CP1A 1R5AA 3UVTA 1M2DA 2AB6A 1CQHA 4Q5NA 2XBIA 5CREA 3SBCA 1WWJA 3FKFA 2K6VA 1OKTA 3ME7A 2IMKA 4TXOB 2HSYA 2NPBA
chains in the Genus database with same CATH superfamily
1JZWA 1E6BA 1GUMA 1S3RA 4MLYA 2MMZA 4JBBA 2IFQA 2YPMA 1ACVA 4NV2A 2OA7A 2H71A 4TRXA 1MDIA 2DIZA 3DGQA 1F3BA 1QFNA 4N0ZA 1K0NA 14GSA 4XTSA 2RIIA 5IPHA 1XWAA 2VLTA 4MABA 2EFHA 4HZ4A 3FZAA 5ABRA 2HZEA 2VL9A 4WETA 3IK7A 3VPQA 4ZL8A 5AN1A 2HSNA 5D9WA 3EMPA 1O7UA 1TI1A 2NTOA 5ECSA 2K9FA 3CYNA 5D93A 5DCHA 1G6WA 1XBSA 1XZOA 1A23A 5CRWA 1PQNA 4LMWA 1OC3A 1DUGA 2LQQA 3RDWA 2AAWA 1MTCA 1A0RP 3DKSA 2VLVA 4POKA 4XS6A 1TU7A 4GSNA 1PD21 5A5HA 3ZLPA 2AUVA 2H30A 2A4VA 4N3ZA 5AIXA 2YP6A 1O8WA 5INYA 4IGJA 3KP9A 4J57E 3TKSC 2GQLA 5HR2A 3FHKA 4V2MA 1GUKA 1N2AA 2XPEA 1GSYA 3KGKA 3IAM2 2HRKB 2PWJA 2MYGA 1NHOA 2H0HA 4AJ7A 2L4CA 3LXZA 4JZQA 1PRXA 2FA4A 4CY6A 1OVNA 4AKGA 5AISA 2VO4A 5F8BA 2CT6A 2DJ1A 2PVQA 1FG4A 2M46A 5FT3A 6GSSA 3G7IA 4G19A 1GTAA 3KH9A 3ZRDA 4OFNA 3DIEA 2O87A 2R0PA 3W6GA 4CHSA 5CAXA 2DSAA 2IWTA 4KA0A 4MNNA 2M80A 1LU4A 2DBCA 3GKMA 1FHEA 2V6OA 5J4YA 3L4NA 1M2BA 3TCOA 3MAKA 1HD2A 1SYRA 4F9ZA 1B9YC 2JZTA 3EU3A 3BJ5A 4YQMA 2H6ZA 2X8GA 3LWAA 1OC9B 1M99A 1FAAA 2LS5A 1J0FA 5G31A 4BWQA 2R2JA 4NMUA 4WKWA 3RFRC 3HA9A 4YQVA 1TK8B 1YF0A 2FHEA 1WRYA 3O3TA 2EIRA 5ENUA 3ERGA 4XHMA 2V32A 4XRDA 3DWVA 3CSHA 2OE3A 3IR4A 2IMFA 3DVXA 3TUEA 1XXUA 1BG1A 4MPGA 1O85A 4G10A 2EIOA 5G5EA 2ON5A 4ACSA 4YKGA 5IPGA 3FRCA 4I97A 5A4UA 4MPFA 5G5FA 1SJZA 2LTKA 4K7NA 2DKHA 3HXSA 3GYKA 4O5UA 1PL2A 2E7PA 4WF5A 2KHPA 3GNJA 1TK0B 2ZNMA 3D21A 3TU3B 1M9BA 4OFTA 4O7HA 6GSXA 2WDUA 1T8EB 2O7KA 2K8VA 4OO5A 4RQRA 1NHYA 1TRWA 1XPVA 1EWXA 1K0DA 3UL3A 2C1YA 5BMUA 2MBTA 2L6DA 5GZZB 3BD2A 4DSQA 2LUSA 3KH7A 4JR4A 5CRHA 1B9XC 3GFKA 3ZL5A 3ERWA 5ECMB 1U3AA 3D22A 2HSMA 2DJ3A 1TI3A 1FVJA 2LRNA 1QK8A 2IN3A 3L0HA 2K18A 1GWCA 1ZL9A 1XW9A 1OC8A 4FYUA 4L8EA 4TR1A 2C8UA 2VCXA 1SL2B 1T4ZA 2V6KA 1HNCA 3FEUA 1XWKA 1TRVA 2P5QA 4ID0A 1ST9A 2GZZA 1BQ7A 3IHGA 3IC4A 2GQMA 1SL0B 2L5OA 2GTUA 2FWFA 4TW5A 1PX6A 2X8CA 1HYUA 4JRRA 3GX0A 1NSWA 3CRUA 3TRXA 2B7KA 3LYPA 1ZOFA 1JLWA 2V2GA 4USSA 2FD3A 3A5IA 2NBSA 1PL1A 3F6FA 5ECOB 4BA7A 1TW9A 3GRXA 3ZIVA 2H01A 4POLA 4E68A 4FH8A 4K2XA 2JSYA 4L0WA 3DMLA 3FY7A 1ZGNA 5H5SA 4MJCA 4H86A 1R4WA 3W8SA 3PINA 4NAXA 2X99A 5IM9A 3NZNA 4X43A 1K0MA 1K3LA 5KOXA 1KEBA 1USBA 1M3JA 4G2EA 4IJ3A 1Z6NA 2R5GA 3VWVA 1JLVA 2MBSA 3O6TA 5JCWA 3IDVA 2DC5A 5DALA 1DE2A 3WGXA 2DJ2A 4IQAA 3HZ8A 3IV4A 4XCSA 2VM1A 4V2NA 1M2AA 3CSJA 4IS0A 3KJYA 3TJJA 2LV3A 2GSQA 2R6KA 1WP0A 3KTLA 4IQ1A 6GSUA 3U6VA 4HJMA 3R3EA 1R5PA 1V58A 4DSSB 2D2ZA 4XRAA 4F0CA 2VCQA 3PPUA 1R26A 1FB6A 3LJRA 1PX7A 5DCGA 5JCUA 5EPFA 4ZIJA 2VD1A 3KP8A 3E9JB 3TGZA 3M0FA 4ULXA 1TXXA 2F8AA 2QGVA 1Z6MA 2FWGA 3QD9A 1ABAA 1SD8A 1GSSA 5GAPD 4O92A 20GSA 3QOUA 5HFGA 1SK0A 5D73A 1SVMA 9GSSA 5G1KA 3QCPA 4IW9A 3UJ1A 1N25A 3EC3A 1W4VA 3QDNA 3VK9A 1O6JA 4HU7A 2RUEA 2AV4A 4EUYA 2GSRA 4LMVA 5J47A 4HZ2A 4XS1A 16GSA 1YEWC 1XWCA 4D73A 1THOA 4HS1A 1J08A 5J3RA 3WYWA 2WULA 4RQXA 3IK9A 4AKIA 4OD7A 3ZZXA 2IJYA 5C04A 5D9TA 5IMCA 3CWGA 3F9UA 2YWNA 1SJ6A 4KSMA 2IPAA 5ECNB 4PI0C 1SU9A 1VF3A 2WB9A 3KCMA 1T3BA 3L9SA 2H72A 3WD6A 3QAGA 5ECQB 5F05A 5IQYA 2H1GA 2H8LA 2IFQB 5BRTA 5HR0A 3VI7A 4ECJA 2GQKA 1U3IA 2CX3A 2MMAA 2YZUA 4TR3A 1U87A 3HZ4A 5B7CA 3M8NA 1PFOA 3GV1A 1QXHA 3M1GA 5IOXA 3K8NA 3GUSA 4PURA 1SVLA 4AI6A 2HZEB 2H76A 4F0BA 3ED3A 2H1BA 2V1MA 1OAZA 3F4TA 2KLXA 2HSNB 2N5FA 5J40A 1CQGA 2CZ3A 2MMNA 5DAKA 2GSTA 4G0IA 3A2WA 2CVDA 1GULA 3V1WA 2VCTA 2VLUA 3I69A 1SK1A 2K8SA 1TTZA 2JZSA 2I3YA 3ZMKA 1AIUA 3F4RA 4ILFA 3S9FA 5F06A 2H0GA 1GTIA 10GSA 1A2LA 2M72A 4X0XA 2H73A 1I9DA 4ISDA 2CVKA 1EGOA 4IELA 5IMDA 5LCZA 2O85A 4G01A 5HR1A 4BVXA 2YANA 1WE0A 3I9V2 4Z2TA 1EV4A 3I6AA 2OE1A 2CX4A 3RBTA 3VWXA 2A4HA 1BX9A 5ELAA 2XPDA 1BF5A 1UVZA 1VF4A 1UA5A 4PGTA 2WCIA 4YQUA 4KDUA 1SENA 4EKZA 4P3YB 1MDJA 3C71A 3N5OA 1H4OA 8GSSA 1Z7RA 1ZYQB 5D9VA 4PNGA 3J7Yb 1X5EA 2LQOA 3GL5A 5IMAA 4TR0A 3KM6A 2EFEA 3QPMA 2C0GA 4O32A 1IYIA 1GUHA 4HQZA 3EWLA 1TU8A 4KGIA 1AQXA 1ILOA 4TXOA 2PGTA 2C3TA 3IXRA 4MDCA 4IN0A 4MH3A 4NPBA 4JEDA 4MJAA 3LW9A 2X49A 3H4KA 3TRPA 1T7PB 3N9JA 4WR4A 2XC2A 1X9MB 4QL7A 1JZDA 4PQHA 1S3CA 2P5RA 11GSA 2PVOC 3GKKA 5CYYA 3WGDA 3CQFA 2PU9C 3H1NA 1AW9A 4PQIA 2VL2A 4K8MA 3H8QA 3LEFA 4IKHA 5CRGA 3ZITA 1SVOA 2YV9A 1YVLA 3MSZA 4AKXB 2WZ9A 3P90A 5AGYA 3ZFBA 1SD9A 4MF6A 5FWGA 4EDZA 2JZRA 3U5RE 4HUAA 5DQSA 5J5NA 2R4VA 4MF7A 2O3EA 3KD0A 4XS4A 4OWYA 1F37A 1A0FA 2WW2A 3CBUA 3TJFA 2FGXA 4X1UA 2C3NA 1XWGA 1YF1A 1VF2A 5IO0A 2VCVA 1RK4A 5IO2A 1WPIA 2REMA 5COHA 1G6YA 3ERFA 2F51A 2VAFA 2H1DA 4PUAA 1PSQA 3QAVA 1ZZYA 4Q5FA 5GAND 3WT2A 2QKEA 3FR6A 4EL1A 3F3RA 1B8XA 4I5QA 2YJ7A 2WVXA 1YEXA 4E8EA 4ZILA 3D4TA 2O5VA 2HSHA 5A4WA 3BCIA 5A5KA 4K0NA 3RPNA 4FYBA 5BMUB 2F9SA 3KEBA 2L4QA 3A5WA 4DSRA 4AGSA 4IHUA 1M3IA 2HSMB 5JWQB 5EVOA 3Q19A 1EOGA 3ISOA 1RW1A 3GKXA 5ECPB 1GRXA 1FB0A 3HJPA 4ZBAA 3D5JA 1B48A 3E3EA 3RHBA 1FVKA 4TR1B 3HVVA 3L78A 2QA2A 5J4UA 4FIWA 4IP1A 4KNDA 4OCFA 3TKRA 4K7OA 3DVWA 3GHAA 1XW5A 1MDKA 3FZ9A 6GSYA 2OT3A 5DVBA 1EZKA 1ZYPA 5HQPA 1A8YA 2Z9SA 3E0UA 5A4VA 6GSVA 1IYHA 2I9HA 4PHZC 1PA3A 1SK2A 2PUKC 5AIVA 4IP6A 3TRQA 2RUFA 1K3YA 2YNXA 3MYDA 2B5YA 3M9KA 2H6XA 3ZMLA 3GSTA 2PN8A 3C1SA 4NHZA 1DE1A 1TP9A 2N5AA 4PQ1A 2YWIA 4GXZA 5CNWA 2OACA 2JADA 1H75A 1GLPA 2E2GA 4L5LA 3UVHA 2YCDA 4MMMA 4CY8A 2A2RA 1ERWA 2GT5A 4EE0A 2PBJA 3GN3A 5DALB 4TN8A 1OKDA 4QL9A 4YH2A 1V98A 1ZCPA 2HLSA 5KN2A 4ICYA 4WBJA 2MZCA 3QMXA 5ECKB 2WZSA 4KCEA 3HMJG 1KTEA 3L9UA 3TB2A 2E2MA 2L6CA 2CAIA 1GTBA 3GTUA 4ZL9A 3ME8A 5HFKA 3UMAA 1A8LA 4QMKA 3DRNA 1XVQA 2WGRA 1T4YA 2TIRA 4BVYA 3F8UA 1BAYA 1G0TA 1SKWB 2C0FA 1FOHA 1FOVA 2CAQA 2J23A 3ZIJA 3BBYA 3UOMA 2DIYA 1TRSA 1K0AA 1HNAA 5DJMA 1EP8A 1BYEA 3VFIA 1BG5A 2AJQB 5DJLA 1XW6A 1V57A 3VPTA 3QFBC 2EFDA 2HI7A 2X8HA 1ON4A 4FQUA 5KEJA 2N5BA 4V2LA 3KIJA 2JU5A 2H0IA 4O5RA 3OR5A 4K2DA 1YKCA 4MH2A 2B1LA 3VWWA 5F07A 3A2VA 3HVNA 3Q6OA 1XOAA 4EIPA 3MIXA 1E2YA 2QSIA 3KMNA 1S3AA 1HQOA 3P2AA 5IOWA 2IMEA 2F8FA 2GVPA 3GKNA 3ZTLA 4Q5RA 3C8EA 1V40A 3LORA 1LBKA 2DMMA 3UAPA 4GSSA 5HR3A 4D73B 2O8VB 3UARA 3UBLA 5ECIB 5A34A 1VRSD 2V41A 2FNOA 2R37A 4K5RA 1A2MA 5GSTA 2LJKA 3IAS2 1X5DA 4POMA 1XOBA 2HRNA 4EDYA 2R3XA 4FYCA 3EYTA 4ECCA 1AUCA 5KN1A 13GSA 2BJXA 4GSTA 3DEXA 5F0GA 3CMIA 2B7JA 19GSA 3ZVJA 1SYXA 3DYRA 2R0CA 3F3QA 3TKQA 2BTOT 3L9VA 1TK5B 5J9BA 1GSEA 3RHCA 3FR9A 1MD4A 4RI7A 1PKWA 2RLIA 2ZCTA 1QMVA 2BMXA 2NDOA 5G30A 4LLRA 1ERTA 4ML1A 1QGVA 4MZCA 4ZB9A 5ID2B 2KUCA 2QC7A 1SL1B 1WIKA 3TOTA 3IRAA 2B1KA 1BJXA 4N11A 3LSZA 3F6DA 3KMOA 3QAWA 2H6YA 4OCEA 4KF9A 3PH9A 3CTGA 12GSA 3F4SA 3EMXA 3P7XA 3F63A 1TXUA 5A1NA 4MJEA 1EOHA 2JL4A 3WGEA 2R0GA 4K9ZA 2WFCA 2J9HA 3VI5A 4N10A 3Q74A 2FUG2 2DMLA 1AAZA 4YKFA 5D8IA 2G0FA 2FLSA 1YEPA 4AJ6A 4KX4A 1JFUA 5EL8A 4E8HA 4ML6A 4NWYA 3HVXA 4N30A 5DQYA 2KP2A 4JE1A 4KCAA 4MZBA 5GSSA 4WBRD 2HFDA 3UEMA 5J9CA 1OE7A 3HCZA 5JWRB 5KOWA 1M7TA 2AYTA 3C73A 1R7HA 2I1UA 1PGTA 2VL2C 2VL3A 1O8XA 3GA4A 1PKZA 3EURA 4AF2A 2ALBA 2GSSA 2RM5A 3TJBA 1ML6A 4GWRA 1SKSB 2NVLA 3QR6A 3HJOA 5KN3A 4GQFA 4EXJA 4RI6A 5A5HB 2B5XA 2CVBA 2WJUA 5EY6A 4WF4A 4L0UA 2VKZG 4F82A 2HXKA 3LXTA 2YWMA 3QFAC 3CHXC 2I4AA 4ECIA 2YJHA 6GSTA 3J7Yk 2OBKA 4EC0A 1F6MC 2FWEA 5B8BA 2E0QA 4JU5A 4PTSA 2UZ8A 3D6IA 3KZQA 3GL3A 2LJAA 2FWHA 2VOCA 5D96A 2C3QA 4RUVA 4XIHA 1F9MA 4BL7A 2YOIA 1JHBA 4ECBA 2OADA 4PXOA 2LNTA 3LFLA 3IC8A 4DEJA 1XIYA 1JZRA 3HKRA 3UIWA 4I2TA 1U88A 4A5PA 4Z7XA 2LRTA 2H74A 3HY2A 3DD3A 1M0UA 1EP7A 2EIQA 4MK3A 2KP1A 5ECHB 3APSA 3JCML 3O76A 3TKPA 4K5SA 2C4JA 3KXOA 1S4BP 4IBPA 3RAZA 2XBQA 3Q18A 2G2QA 4XS4B 3US3A 2LSTA 2UV8G 3TJGA 1TKDB 4L5OA 1T00A 1V2AA 1Z3EA 1X0RA 3CTFA 1OE8A 4HOJA 1O81A 2LRCA 4LL4B 1XWBA 4G0KA 1Y6EA 2X64A 1F2EA 5J41A 4K1FA 3VWUA 5B6NA 1YJ6A 4HEA2 3PR8A 2YN1A 3IOSA 2WVZA 4MZWA 5KN0A 1TOFA 4PI2C 3EINA 2IMIA 2HZFA 4KSOA 4GLTA 2WVXB 2YWOA 3A2XA 1MEKA 3ZFLA 4EF0A 3GH9A 1G7EA 2GGTA 2GZPA 4YAVA 3M9JA 4KUNA 3C7MA 1Z7PA 1FW1A 1UC7A 2FA8A 4CDOA 1YDKA 1TRUA 2OJLA 4KAEA 1B4PA 2DJKA 3IPZA 1SKRB 2VCWA 3GX8A 3R2QA 4LL1B 1ZYEA 4TKYA 4PNFA 5CO3A 4TOPA 1S3DA 3F0IA 4Z2UA 3MWHA 1N8JA 3PGTA 4MF5A 2HRKA 4X4JA 17GSA 1OYJA 3HD5A 2OKAA 5JCGA 4EIQA 1FO5A 5DDLA 4BIKA 3M3MA 1QUWA 3APOA 5JWOB 4J56E 5L71A 2LEGA 1F3AA 2B5EA 3DXBA 1W89A 1G7OA 4GDFA 1X9WB 5G2ZA 7GSSA 2YZHA 4MA9A 4Q5QA 3G7YA 4MCUA 2ES7A 2KOKA 1XVWA 4BPYA 3G9BA 2IIYA 1GSUA 5DBQA 1DSBA 4AKHA 1GTUA 3RGBC 4N0VA 5LNKe 1B4QA 2FY6A 4NXIA 3NOFA 4KH7A 3IA1A 3D0ZA 5E4WA 18GSA 3VLNA 1VF1A 22GSA 5ECRB 5IMFA 2TRXA 3TKSA 2GZYA 3EVIA 4GQCA 3EE2A 4AJ8A 3IE3A 5B6MA 3IBHA 2TRCP 2JACA 3GTUB 4PX1A 1OC9A 1YKAA 3TKSE 2GLRA 5ELGA 4TR4A 2CV4A 4OMVA 2H1AA 3LYKA 2WW0A 4J2FA 2EC4A 4TVEA 3WT1A 3ZYWA 3GSSA 3FW2A 4TXVA 4BVYB 1MD3A 3FK8A 1JZOA 4Z2RA 1K0OA 1YZXA 1XCCA 3CSIA 1J9BA 2PMTA 2DJ0A 3FMWA 2EFCA 4POBA 1QQ2A 1GP1A 2RM6A 2VD0A 4OFMA 1THXA 3LGCA 1EGRA 1K3OA 3GURA 1TJDA 1GNEA 4O5QA 2H70A 3HDCA 4G0LA 2YV7A 5E59A 4EO3A 3UBKA 4HU9A 1AQWA 2C0DA 1SJIA 1X9SB 2DLXA 4I2UA 4GTUA 2HQTA 5FHIA 6GSWA 4WEYA 3H93A 3AY8A 2H19A 2H1LA 1K0BA 4HQSA 3GH6A 3SWLA 2HE3A 1PN0A 1Z5YE 4KE3A 2JSZA 1WOUA 2LJRA 5H5QA 5IMVA 3CRTA 2XHFA 3GIXA 3GMFA 2AHEA 2CQ9A 3ZREA 1NM3A 1YQ1A 2FCHA 1GL8A 2H75A 5H5RA 2HYXA 1Y1UA 2GDRA 5A34B 4HDEA 2QA1A 1WJKA 3HVSA 3MNGA 1XFLA 2MMOA 3RPPA 4W66A 2I81A 3HJMA 1T1VA 4WR5A 2VCZA 4MP4A 3NIVA 4KDYA 1VGLA 3TDGA 4V1Ag 2HT9A 1GSFA 1K0CA 2B3SA 1WMJA 4V1Ap 5IIZA 4ZBDA 3G7JA 5HFIA 2LNSA 3BCKA 2WVYA 2H66A 2P31A 4OO4A 2CZ2A 5LD0A 1A2JA 2VUPA 4GRFA 2HRAA 1GSQA 5G1LA 1KNGA 1I5GA 4ZXGA 1AC1A 3VURA 1A24A 1DBYA 1Y25A 4GF0A 4EVMA 1YY7A 4HJ2A 2CA8A 2OE0A 2VM2A 3H79A 1PN9A 1V9WA 4JR6A 4NV5A 3C1RA 4FO5A 3FYGA 2L5LA 1KBNA 4K6XA 4CW9A 5IMZA 2IMDA 5CRDA 3IHQA 3TOUA 2L57A 4IVFA 5A1NB 4K0GA 2PERA 4KW6A 3APQA 1U6TA 2O36A 1URMA 1ERUA 4KDXA 4HI7A 1Z9HA 2WW3A 2C0EA 4GCIA 4ZB7A 1AQVA 1ZMAA 3I43A 3EPTA 4WXTA 1O73A 3CXGA 3HYPA 4PUFC 1GLQA 2P0GA 1ZYNA 2IL3A 2DKIA 4LA1A 4MJBA 1RQMA 4QQ7A 4ZBBA 1GSDA 1UN2A 1Q4JA 3W8JA 4DSSA 1M9AA 2OBIA 2VIMA 4ZL7A 2HNLA 2F3MA 5DAKB 4NHWA 3LQ7A 2O89A 4HSCX 1HNBA 1GH2A 4BWSA 3FZ5A 5ECLB 2C80A 1TDIA 4I6XA 4F03A 4FXYP 1EEJA 2GS3A 1LJRA 1C72A 4G9HA 2X4AA 2WS2A 3A3TA 5C00A 4ZB6A 2WW1A 3HHVA 2LKUA 3P8WA 2B6MA 4IJIA 2GT6A 5D9XA 1ERVA 1XG8A 5B8AA 1AXDA 2PPTA 4DVCA 2L59A 1PMTA 1Q98A 3TJKA 4BVXB 3KTBA 4K7IA 2A2SA 3MDKA 4I8BA 3FZ4A 3ZVJD 4F2IA 3LG6A 4BL7B 3D4MA 1NW2A 1X5CA 2DJJA 3EU4A 3FR3A 4ZB8A 5ID2A 4YAPA 2ZUPA 1EV9A 1GNWA 2ON7A 4KB3A 1EEMA 1BEDA 2HRFA 2WRTA 3BOAA 5J4VA 5CP1A 1I1IP 1R5AA 3UVTA 1M2DA 2AB6A 1CQHA 4Q5NA 2XBIA 5CREA 3SBCA 1WWJA 3FKFA 2K6VA 1OKTA 3ME7A 2IMKA 4TXOB 2HSYA 2A2PA 2NPBA
chains in the Genus database with same CATH topology
1JZWA 1E6BA 1GUMA 4MLYA 2MMZA 4JBBA 2IFQA 2YPMA 1ACVA 4NV2A 2OA7A 2H71A 4TRXA 1MDIA 2DIZA 3DGQA 1F3BA 1QFNA 4N0ZA 1K0NA 14GSA 4XTSA 2RIIA 5IPHA 1XWAA 2VLTA 4MABA 2EFHA 4HZ4A 3FZAA 5ABRA 2HZEA 2VL9A 4WETA 3IK7A 3VPQA 4ZL8A 5AN1A 2HSNA 5D9WA 3EMPA 1O7UA 1TI1A 2NTOA 5ECSA 2K9FA 3CYNA 5D93A 5DCHA 1G6WA 1XBSA 1XZOA 1A23A 5CRWA 1PQNA 4LMWA 1OC3A 1DUGA 2LQQA 3RDWA 2AAWA 1MTCA 1A0RP 3DKSA 2VLVA 4POKA 4XS6A 1TU7A 4GSNA 1PD21 5A5HA 3ZLPA 2AUVA 2H30A 2A4VA 4N3ZA 5AIXA 2YP6A 1O8WA 5INYA 4IGJA 3KP9A 4J57E 3TKSC 2GQLA 5HR2A 3FHKA 4V2MA 1GUKA 1N2AA 2XPEA 1GSYA 3KGKA 3IAM2 2HRKB 2PWJA 2MYGA 1NHOA 2H0HA 4AJ7A 2L4CA 3LXZA 4JZQA 1PRXA 2FA4A 4CY6A 1OVNA 4AKGA 5AISA 2VO4A 5F8BA 2CT6A 2DJ1A 2PVQA 1FG4A 2M46A 5FT3A 6GSSA 3G7IA 4G19A 1GTAA 3KH9A 3ZRDA 4OFNA 3DIEA 2O87A 2R0PA 3W6GA 4CHSA 5CAXA 2DSAA 2IWTA 4KA0A 4MNNA 2M80A 1LU4A 2DBCA 3GKMA 1FHEA 2V6OA 5J4YA 3L4NA 1M2BA 3TCOA 3MAKA 1HD2A 1SYRA 4F9ZA 1B9YC 2JZTA 3EU3A 3BJ5A 4YQMA 2H6ZA 2X8GA 3LWAA 1OC9B 1M99A 1FAAA 2LS5A 1J0FA 5G31A 4BWQA 2R2JA 4NMUA 4WKWA 3HA9A 4YQVA 1TK8B 1YF0A 2FHEA 1WRYA 3O3TA 2EIRA 5ENUA 3ERGA 4XHMA 2V32A 4XRDA 3DWVA 3CSHA 2OE3A 3IR4A 2IMFA 3DVXA 3TUEA 1XXUA 1BG1A 4MPGA 1O85A 4G10A 2EIOA 5G5EA 2ON5A 4ACSA 4YKGA 5IPGA 3FRCA 4I97A 5A4UA 4MPFA 5G5FA 1SJZA 2LTKA 4K7NA 2DKHA 3HXSA 3GYKA 4O5UA 1PL2A 2E7PA 4WF5A 2KHPA 3GNJA 1TK0B 2ZNMA 3D21A 3TU3B 1M9BA 4OFTA 4O7HA 6GSXA 2WDUA 1T8EB 2O7KA 2K8VA 4OO5A 4RQRA 1NHYA 1TRWA 1XPVA 1EWXA 1K0DA 3UL3A 2C1YA 5BMUA 2MBTA 2L6DA 5GZZB 3BD2A 4DSQA 2LUSA 3KH7A 4JR4A 5CRHA 1B9XC 3GFKA 3ZL5A 3ERWA 5ECMB 1U3AA 3D22A 2HSMA 2DJ3A 1TI3A 1FVJA 2LRNA 1QK8A 2IN3A 3L0HA 2K18A 1GWCA 1ZL9A 1XW9A 1OC8A 4FYUA 4L8EA 4TR1A 2C8UA 2VCXA 1SL2B 1T4ZA 2V6KA 1HNCA 3FEUA 1XWKA 1TRVA 2P5QA 4ID0A 1ST9A 2GZZA 1BQ7A 3IHGA 3IC4A 2GQMA 1SL0B 2L5OA 2GTUA 2FWFA 4TW5A 1PX6A 2X8CA 1HYUA 4JRRA 3GX0A 1NSWA 3CRUA 3TRXA 2B7KA 3LYPA 1ZOFA 1JLWA 2V2GA 4USSA 2FD3A 3A5IA 2NBSA 1PL1A 3F6FA 5ECOB 4BA7A 1TW9A 3GRXA 3ZIVA 2H01A 4POLA 4E68A 4FH8A 4K2XA 2JSYA 4L0WA 3DMLA 3FY7A 1ZGNA 5H5SA 4MJCA 4H86A 1R4WA 3W8SA 3PINA 4NAXA 2X99A 5IM9A 3NZNA 4X43A 1K0MA 1K3LA 5KOXA 1KEBA 1USBA 4G2EA 4IJ3A 1Z6NA 2R5GA 3VWVA 1JLVA 2MBSA 3O6TA 5JCWA 3IDVA 2DC5A 5DALA 1DE2A 3WGXA 2DJ2A 4IQAA 3HZ8A 3IV4A 4XCSA 2VM1A 4V2NA 1M2AA 3CSJA 4IS0A 3KJYA 3TJJA 2LV3A 2GSQA 2R6KA 1WP0A 3KTLA 4IQ1A 6GSUA 3U6VA 4HJMA 3R3EA 1R5PA 1V58A 4DSSB 2D2ZA 4XRAA 4F0CA 2VCQA 3PPUA 1R26A 1FB6A 3LJRA 1PX7A 5DCGA 5JCUA 5EPFA 4ZIJA 2VD1A 3KP8A 3E9JB 3TGZA 3M0FA 4ULXA 1TXXA 2F8AA 2QGVA 1Z6MA 2FWGA 3QD9A 1ABAA 1SD8A 1GSSA 5GAPD 4O92A 20GSA 3QOUA 5HFGA 1SK0A 5D73A 1SVMA 9GSSA 5G1KA 3QCPA 4IW9A 3UJ1A 1N25A 3EC3A 1W4VA 3QDNA 3VK9A 1O6JA 4HU7A 2RUEA 2AV4A 4EUYA 2GSRA 4LMVA 5J47A 4HZ2A 4XS1A 16GSA 1XWCA 4D73A 1THOA 4HS1A 1J08A 5J3RA 3WYWA 2WULA 4RQXA 3IK9A 4AKIA 4OD7A 3ZZXA 2IJYA 5C04A 5D9TA 5IMCA 3CWGA 3F9UA 2YWNA 1SJ6A 4KSMA 2IPAA 5ECNB 1SU9A 1VF3A 2WB9A 3KCMA 1T3BA 3L9SA 2H72A 3WD6A 3QAGA 5ECQB 5F05A 5IQYA 2H1GA 2H8LA 2IFQB 5BRTA 5HR0A 3VI7A 4ECJA 2GQKA 1U3IA 2CX3A 2MMAA 2YZUA 4TR3A 1U87A 3HZ4A 5B7CA 3M8NA 3GV1A 1QXHA 3M1GA 5IOXA 3K8NA 3GUSA 4PURA 1SVLA 4AI6A 2HZEB 2H76A 4F0BA 3ED3A 2H1BA 2V1MA 1OAZA 3F4TA 2KLXA 2HSNB 2N5FA 5J40A 1CQGA 2CZ3A 2MMNA 5DAKA 2GSTA 4G0IA 3A2WA 2CVDA 1GULA 3V1WA 2VCTA 2VLUA 3I69A 1SK1A 2K8SA 1TTZA 2JZSA 2I3YA 3ZMKA 1AIUA 3F4RA 4ILFA 3S9FA 5F06A 2H0GA 1GTIA 10GSA 1A2LA 2M72A 4X0XA 2H73A 1I9DA 4ISDA 2CVKA 1EGOA 4IELA 5IMDA 5LCZA 2O85A 4G01A 5HR1A 4BVXA 2YANA 1WE0A 3I9V2 4Z2TA 1EV4A 3I6AA 2OE1A 2CX4A 3RBTA 3VWXA 2A4HA 1BX9A 5ELAA 2XPDA 1BF5A 1UVZA 1VF4A 1UA5A 4PGTA 2WCIA 4YQUA 4KDUA 1SENA 4EKZA 4P3YB 1MDJA 3C71A 3N5OA 1H4OA 8GSSA 1Z7RA 1ZYQB 5D9VA 4PNGA 3J7Yb 1X5EA 2LQOA 3GL5A 5IMAA 4TR0A 2EFEA 3KM6A 3QPMA 2C0GA 4O32A 1IYIA 1GUHA 4HQZA 3EWLA 1TU8A 4KGIA 1AQXA 1ILOA 4TXOA 2PGTA 2C3TA 3IXRA 4MDCA 4IN0A 4MH3A 4NPBA 4JEDA 4MJAA 3LW9A 2X49A 3H4KA 3TRPA 1T7PB 3N9JA 4WR4A 2XC2A 1X9MB 4QL7A 1JZDA 4PQHA 1S3CA 2P5RA 11GSA 2PVOC 3GKKA 5CYYA 3WGDA 2PU9C 3H1NA 1AW9A 4PQIA 2VL2A 4K8MA 3H8QA 3LEFA 4IKHA 5CRGA 3ZITA 1SVOA 2YV9A 1YVLA 3MSZA 4AKXB 2WZ9A 3P90A 5AGYA 3ZFBA 1SD9A 4MF6A 5FWGA 4EDZA 2JZRA 3U5RE 4HUAA 5DQSA 5J5NA 2R4VA 4MF7A 3KD0A 4XS4A 4OWYA 1F37A 1A0FA 3TJFA 3CBUA 2FGXA 4X1UA 2C3NA 1XWGA 1YF1A 1VF2A 5IO0A 2VCVA 1RK4A 5IO2A 1WPIA 2REMA 5COHA 1G6YA 3ERFA 2F51A 2VAFA 2H1DA 4PUAA 1PSQA 3QAVA 1ZZYA 4Q5FA 5GAND 3WT2A 2QKEA 3FR6A 4EL1A 3F3RA 1B8XA 4I5QA 2YJ7A 1YEXA 4E8EA 4ZILA 3D4TA 2O5VA 2HSHA 5A4WA 3BCIA 5A5KA 4K0NA 3RPNA 4FYBA 5BMUB 2F9SA 3KEBA 2L4QA 3A5WA 4DSRA 4AGSA 4IHUA 2HSMB 5JWQB 5EVOA 3Q19A 1EOGA 3ISOA 1RW1A 3GKXA 5ECPB 1GRXA 1FB0A 3HJPA 4ZBAA 3D5JA 1B48A 3E3EA 3RHBA 1FVKA 4TR1B 3HVVA 3L78A 2QA2A 5J4UA 4FIWA 4IP1A 4KNDA 4OCFA 3TKRA 4K7OA 3DVWA 3GHAA 1XW5A 1MDKA 3FZ9A 6GSYA 2OT3A 5DVBA 1EZKA 1ZYPA 5HQPA 1A8YA 2Z9SA 3E0UA 5A4VA 6GSVA 1IYHA 2I9HA 1PA3A 1SK2A 2PUKC 5AIVA 4IP6A 3TRQA 2RUFA 1K3YA 2YNXA 3MYDA 2B5YA 3M9KA 2H6XA 3ZMLA 3GSTA 2PN8A 3C1SA 4NHZA 1DE1A 1TP9A 2N5AA 4PQ1A 2YWIA 4GXZA 5CNWA 2OACA 2JADA 1H75A 1GLPA 2E2GA 4L5LA 3UVHA 2YCDA 4MMMA 4CY8A 2A2RA 1ERWA 2GT5A 4EE0A 2PBJA 3GN3A 5DALB 4TN8A 1OKDA 4QL9A 4YH2A 1V98A 1ZCPA 2HLSA 5KN2A 4ICYA 4WBJA 2MZCA 3QMXA 5ECKB 4KCEA 3HMJG 1KTEA 3L9UA 3TB2A 2E2MA 2L6CA 2CAIA 1GTBA 3GTUA 4ZL9A 3ME8A 5HFKA 3UMAA 1A8LA 4QMKA 3DRNA 1XVQA 2WGRA 1T4YA 2TIRA 4BVYA 3F8UA 1BAYA 1G0TA 1SKWB 2C0FA 1FOHA 1FOVA 2CAQA 2J23A 3ZIJA 3BBYA 3UOMA 2DIYA 1TRSA 1K0AA 1HNAA 5DJMA 1EP8A 1BYEA 3VFIA 1BG5A 2AJQB 5DJLA 1XW6A 1V57A 3VPTA 3QFBC 2EFDA 2HI7A 2X8HA 1ON4A 4FQUA 5KEJA 2N5BA 4V2LA 3KIJA 2JU5A 2H0IA 4O5RA 3OR5A 4K2DA 1YKCA 4MH2A 2B1LA 3VWWA 5F07A 3A2VA 3Q6OA 1XOAA 4EIPA 3MIXA 1E2YA 2QSIA 3KMNA 1S3AA 1HQOA 3P2AA 5IOWA 2IMEA 2F8FA 2GVPA 3GKNA 3ZTLA 4Q5RA 3C8EA 1V40A 3LORA 1LBKA 2DMMA 3UAPA 4GSSA 5HR3A 4D73B 2O8VB 3UARA 3UBLA 5ECIB 5A34A 1VRSD 2V41A 2FNOA 2R37A 4K5RA 1A2MA 5GSTA 2LJKA 3IAS2 1X5DA 4POMA 1XOBA 2HRNA 4EDYA 2R3XA 4FYCA 3EYTA 4ECCA 1AUCA 5KN1A 13GSA 2BJXA 4GSTA 3DEXA 5F0GA 3CMIA 2B7JA 19GSA 3ZVJA 1SYXA 3DYRA 2R0CA 3F3QA 3TKQA 2BTOT 3L9VA 1TK5B 5J9BA 1GSEA 3RHCA 3FR9A 1MD4A 4RI7A 1PKWA 2RLIA 2ZCTA 1QMVA 2BMXA 2NDOA 5G30A 4LLRA 1ERTA 4ML1A 1QGVA 4MZCA 4ZB9A 5ID2B 2KUCA 2QC7A 1SL1B 1WIKA 3TOTA 3IRAA 2B1KA 1BJXA 4N11A 3LSZA 3F6DA 3KMOA 3QAWA 2H6YA 4OCEA 4KF9A 3PH9A 3CTGA 12GSA 3F4SA 3EMXA 3P7XA 3F63A 1TXUA 5A1NA 4MJEA 1EOHA 2JL4A 3WGEA 2R0GA 4K9ZA 2WFCA 2J9HA 3VI5A 4N10A 3Q74A 2FUG2 2DMLA 1AAZA 4YKFA 5D8IA 2G0FA 2FLSA 1YEPA 4AJ6A 4KX4A 1JFUA 5EL8A 4E8HA 4ML6A 4NWYA 3HVXA 4N30A 5DQYA 2KP2A 4JE1A 4KCAA 4MZBA 5GSSA 4WBRD 2HFDA 3UEMA 5J9CA 1OE7A 3HCZA 5JWRB 5KOWA 1M7TA 2AYTA 3C73A 1R7HA 2I1UA 1PGTA 2VL2C 2VL3A 1O8XA 3GA4A 1PKZA 3EURA 4AF2A 2ALBA 2GSSA 2RM5A 3TJBA 1ML6A 4GWRA 1SKSB 2NVLA 3QR6A 3HJOA 5KN3A 4GQFA 4EXJA 4RI6A 5A5HB 2B5XA 2CVBA 2WJUA 5EY6A 4WF4A 4L0UA 2VKZG 4F82A 2HXKA 3LXTA 2YWMA 3QFAC 2I4AA 4ECIA 2YJHA 6GSTA 3J7Yk 2OBKA 4EC0A 1F6MC 2FWEA 5B8BA 2E0QA 4JU5A 4PTSA 2UZ8A 3D6IA 3KZQA 3GL3A 2LJAA 2FWHA 2VOCA 5D96A 2C3QA 4RUVA 4XIHA 1F9MA 4BL7A 2YOIA 1JHBA 4ECBA 2OADA 4PXOA 2LNTA 3LFLA 3IC8A 4DEJA 1XIYA 1JZRA 3HKRA 3UIWA 4I2TA 1U88A 4A5PA 4Z7XA 2LRTA 2H74A 3HY2A 3DD3A 1M0UA 1EP7A 2EIQA 4MK3A 2KP1A 5ECHB 3APSA 3JCML 3O76A 3TKPA 4K5SA 2C4JA 3KXOA 4IBPA 3RAZA 2XBQA 3Q18A 2G2QA 4XS4B 3US3A 2LSTA 2UV8G 3TJGA 1TKDB 4L5OA 1T00A 1V2AA 1Z3EA 1X0RA 3CTFA 1OE8A 4HOJA 1O81A 2LRCA 4LL4B 1XWBA 4G0KA 1Y6EA 2X64A 1F2EA 5J41A 4K1FA 3VWUA 5B6NA 1YJ6A 4HEA2 3PR8A 2YN1A 3IOSA 4MZWA 5KN0A 1TOFA 3EINA 2IMIA 2HZFA 4KSOA 4GLTA 2YWOA 3A2XA 1MEKA 3ZFLA 4EF0A 3GH9A 1G7EA 2GGTA 2GZPA 4YAVA 3M9JA 4KUNA 3C7MA 1Z7PA 1FW1A 1UC7A 2FA8A 4CDOA 1YDKA 1TRUA 2OJLA 4KAEA 1B4PA 2DJKA 3IPZA 1SKRB 2VCWA 3GX8A 3R2QA 4LL1B 1ZYEA 4TKYA 4PNFA 5CO3A 4TOPA 1S3DA 3F0IA 4Z2UA 3MWHA 1N8JA 3PGTA 4MF5A 2HRKA 4X4JA 17GSA 1OYJA 3HD5A 2OKAA 5JCGA 4EIQA 1FO5A 5DDLA 3M3MA 1QUWA 3APOA 5JWOB 4J56E 5L71A 2LEGA 1F3AA 2B5EA 3DXBA 1W89A 1G7OA 4GDFA 1X9WB 5G2ZA 7GSSA 2YZHA 4MA9A 4Q5QA 3G7YA 4MCUA 2ES7A 2KOKA 1XVWA 4BPYA 3G9BA 2IIYA 1GSUA 5DBQA 1DSBA 4AKHA 1GTUA 4N0VA 5LNKe 1B4QA 2FY6A 4NXIA 3NOFA 4KH7A 3IA1A 3D0ZA 5E4WA 18GSA 3VLNA 1VF1A 22GSA 5ECRB 5IMFA 2TRXA 3TKSA 2GZYA 3EVIA 4GQCA 3EE2A 4AJ8A 3IE3A 5B6MA 3IBHA 2TRCP 2JACA 3GTUB 4PX1A 1OC9A 1YKAA 3TKSE 2GLRA 5ELGA 4TR4A 2CV4A 4OMVA 2H1AA 3LYKA 4J2FA 2EC4A 4TVEA 3WT1A 3ZYWA 3GSSA 3FW2A 4TXVA 4BVYB 1MD3A 3FK8A 1JZOA 4Z2RA 1K0OA 1YZXA 1XCCA 3CSIA 1J9BA 2PMTA 2DJ0A 3FMWA 2EFCA 4POBA 1QQ2A 1GP1A 2RM6A 2VD0A 4OFMA 1THXA 3LGCA 1EGRA 1K3OA 3GURA 1TJDA 1GNEA 4O5QA 2H70A 3HDCA 4G0LA 2YV7A 5E59A 4EO3A 3UBKA 4HU9A 1AQWA 2C0DA 1SJIA 1X9SB 2DLXA 4I2UA 4GTUA 2HQTA 5FHIA 6GSWA 4WEYA 3H93A 3AY8A 2H19A 2H1LA 1K0BA 4HQSA 3GH6A 3SWLA 2HE3A 1PN0A 1Z5YE 4KE3A 2JSZA 1WOUA 2LJRA 5H5QA 5IMVA 3CRTA 2XHFA 3GIXA 3GMFA 2AHEA 2CQ9A 3ZREA 1NM3A 1YQ1A 2FCHA 1GL8A 2H75A 5H5RA 2HYXA 1Y1UA 2GDRA 5A34B 4HDEA 2QA1A 1WJKA 3HVSA 3MNGA 1XFLA 2MMOA 3RPPA 4W66A 2I81A 3HJMA 1T1VA 4WR5A 2VCZA 4MP4A 3NIVA 4KDYA 1VGLA 3TDGA 4V1Ag 2HT9A 1GSFA 1K0CA 2B3SA 1WMJA 4V1Ap 5IIZA 4ZBDA 3G7JA 5HFIA 2LNSA 3BCKA 2H66A 2P31A 4OO4A 2CZ2A 5LD0A 1A2JA 2VUPA 4GRFA 2HRAA 1GSQA 5G1LA 1KNGA 1I5GA 4ZXGA 1AC1A 3VURA 1A24A 1DBYA 1Y25A 4GF0A 4EVMA 1YY7A 4HJ2A 2CA8A 2OE0A 2VM2A 3H79A 1PN9A 1V9WA 4JR6A 4NV5A 3C1RA 4FO5A 3FYGA 2L5LA 1KBNA 4K6XA 4CW9A 5IMZA 2IMDA 5CRDA 3IHQA 3TOUA 2L57A 4IVFA 5A1NB 4K0GA 2PERA 4KW6A 3APQA 1U6TA 1URMA 1ERUA 4KDXA 4HI7A 1Z9HA 2C0EA 4GCIA 4ZB7A 1AQVA 1ZMAA 3I43A 3EPTA 4WXTA 1O73A 3CXGA 3HYPA 4PUFC 1GLQA 2P0GA 1ZYNA 2IL3A 2DKIA 4LA1A 4MJBA 1RQMA 4QQ7A 4ZBBA 1GSDA 1UN2A 1Q4JA 3W8JA 4DSSA 1M9AA 2OBIA 2VIMA 4ZL7A 2HNLA 2F3MA 5DAKB 4NHWA 3LQ7A 2O89A 1HNBA 1GH2A 4BWSA 3FZ5A 5ECLB 2C80A 1TDIA 4I6XA 4F03A 1EEJA 2GS3A 1LJRA 1C72A 4G9HA 2X4AA 2WS2A 3A3TA 5C00A 4ZB6A 3HHVA 2LKUA 3P8WA 2B6MA 4IJIA 2GT6A 5D9XA 1ERVA 5B8AA 1AXDA 2PPTA 4DVCA 2L59A 1PMTA 1Q98A 3TJKA 4BVXB 3KTBA 4K7IA 2A2SA 3MDKA 4I8BA 3FZ4A 3ZVJD 4F2IA 3LG6A 4BL7B 3D4MA 1NW2A 1X5CA 2DJJA 3EU4A 3FR3A 4ZB8A 5ID2A 4YAPA 2ZUPA 1EV9A 1GNWA 2ON7A 4KB3A 1EEMA 1BEDA 2HRFA 2WRTA 3BOAA 5J4VA 5CP1A 1R5AA 3UVTA 1M2DA 2AB6A 1CQHA 4Q5NA 2XBIA 5CREA 3SBCA 1WWJA 3FKFA 2K6VA 1OKTA 3ME7A 2IMKA 4TXOB 2HSYA 2A2PA 2NPBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JZW A;  1E6B A;  1GUM A;  4MLY A;  2MMZ A;  4JBB A;  2IFQ A;  2YPM A;  1ACV A;  4NV2 A;  2OA7 A;  2H71 A;  4TRX A;  1MDI A;  2DIZ A;  3DGQ A;  1F3B A;  1QFN A;  4N0Z A;  1K0N A;  14GS A;  4XTS A;  2RII A;  5IPH A;  1XWA A;  2VLT A;  4MAB A;  4HZ4 A;  3FZA A;  5ABR A;  2HZE A;  2VL9 A;  4WET A;  3IK7 A;  3VPQ A;  4ZL8 A;  5AN1 A;  5D9W A;  3EMP A;  1O7U A;  1TI1 A;  2NTO A;  5ECS A;  2K9F A;  3CYN A;  5D93 A;  5DCH A;  1G6W A;  1XBS A;  1XZO A;  1A23 A;  5CRW A;  1PQN A;  4LMW A;  1OC3 A;  1DUG A;  2LQQ A;  3RDW A;  2AAW A;  1MTC A;  1A0R P;  3DKS A;  2VLV A;  4POK A;  4XS6 A;  1TU7 A;  4GSN A;  1PD2 1;  3ZLP A;  2AUV A;  2H30 A;  2A4V A;  5AIX A;  2YP6 A;  1O8W A;  5INY A;  4IGJ A;  3KP9 A;  4J57 E;  3TKS C;  2GQL A;  5HR2 A;  3FHK A;  4V2M A;  1GUK A;  1N2A A;  2XPE A;  1GSY A;  3KGK A;  3IAM 2;  2HRK B;  2PWJ A;  2MYG A;  1NHO A;  2H0H A;  4AJ7 A;  2L4C A;  3LXZ A;  4JZQ A;  1PRX A;  2FA4 A;  1OVN A;  5AIS A;  2VO4 A;  5F8B A;  2CT6 A;  2DJ1 A;  2PVQ A;  1FG4 A;  2M46 A;  5FT3 A;  6GSS A;  3G7I A;  4G19 A;  1GTA A;  3KH9 A;  3ZRD A;  4OFN A;  3DIE A;  2O87 A;  3W6G A;  4CHS A;  5CAX A;  2DSA A;  2IWT A;  4KA0 A;  2M80 A;  1LU4 A;  2DBC A;  3GKM A;  1FHE A;  2V6O A;  3L4N A;  1M2B A;  3TCO A;  3MAK A;  1HD2 A;  1SYR A;  4F9Z A;  1B9Y C;  2JZT A;  3EU3 A;  3BJ5 A;  4YQM A;  2H6Z A;  2X8G A;  3LWA A;  1OC9 B;  1M99 A;  1FAA A;  2LS5 A;  1J0F A;  5G31 A;  4BWQ A;  2R2J A;  4NMU A;  4WKW A;  3HA9 A;  4YQV A;  1TK8 B;  1YF0 A;  2FHE A;  1WRY A;  3O3T A;  2EIR A;  5ENU A;  3ERG A;  4XHM A;  2V32 A;  4XRD A;  3DWV A;  3CSH A;  2OE3 A;  3IR4 A;  2IMF A;  3DVX A;  3TUE A;  1XXU A;  4MPG A;  1O85 A;  4G10 A;  2EIO A;  5G5E A;  2ON5 A;  4ACS A;  5IPG A;  3FRC A;  4I97 A;  5A4U A;  4MPF A;  5G5F A;  1SJZ A;  2LTK A;  4K7N A;  3HXS A;  3GYK A;  1PL2 A;  2E7P A;  4WF5 A;  2KHP A;  3GNJ A;  1TK0 B;  2ZNM A;  3D21 A;  1M9B A;  4OFT A;  4O7H A;  6GSX A;  2WDU A;  1T8E B;  2O7K A;  2K8V A;  4OO5 A;  4RQR A;  1NHY A;  1TRW A;  1XPV A;  1EWX A;  1K0D A;  3UL3 A;  2C1Y A;  5BMU A;  2MBT A;  2L6D A;  5GZZ B;  3BD2 A;  4DSQ A;  2LUS A;  3KH7 A;  4JR4 A;  5CRH A;  1B9X C;  3GFK A;  3ZL5 A;  3ERW A;  5ECM B;  1U3A A;  3D22 A;  2HSM A;  2DJ3 A;  1TI3 A;  1FVJ A;  2LRN A;  1QK8 A;  2IN3 A;  3L0H A;  2K18 A;  1GWC A;  1ZL9 A;  1XW9 A;  1OC8 A;  4FYU A;  4L8E A;  4TR1 A;  2C8U A;  2VCX A;  1SL2 B;  1T4Z A;  2V6K A;  1HNC A;  3FEU A;  1XWK A;  1TRV A;  2P5Q A;  4ID0 A;  1ST9 A;  2GZZ A;  1BQ7 A;  3IC4 A;  2GQM A;  1SL0 B;  2L5O A;  2GTU A;  2FWF A;  4TW5 A;  1PX6 A;  2X8C A;  1HYU A;  4JRR A;  3GX0 A;  1NSW A;  3CRU A;  3TRX A;  2B7K A;  3LYP A;  1ZOF A;  1JLW A;  2V2G A;  4USS A;  2FD3 A;  2NBS A;  1PL1 A;  3F6F A;  5ECO B;  4BA7 A;  1TW9 A;  3GRX A;  3ZIV A;  2H01 A;  4POL A;  4FH8 A;  2JSY A;  4L0W A;  3DML A;  3FY7 A;  1ZGN A;  5H5S A;  4MJC A;  4H86 A;  1R4W A;  3W8S A;  3PIN A;  4NAX A;  2X99 A;  5IM9 A;  3NZN A;  4X43 A;  1K0M A;  1K3L A;  1KEB A;  1USB A;  4G2E A;  4IJ3 A;  1Z6N A;  2R5G A;  3VWV A;  1JLV A;  2MBS A;  3O6T A;  5JCW A;  3IDV A;  2DC5 A;  5DAL A;  1DE2 A;  3WGX A;  2DJ2 A;  4IQA A;  3HZ8 A;  3IV4 A;  4XCS A;  2VM1 A;  4V2N A;  1M2A A;  3CSJ A;  4IS0 A;  3KJY A;  3TJJ A;  2LV3 A;  2GSQ A;  2R6K A;  1WP0 A;  3KTL A;  4IQ1 A;  6GSU A;  4HJM A;  3U6V A;  3R3E A;  1R5P A;  1V58 A;  4DSS B;  2D2Z A;  4XRA A;  4F0C A;  2VCQ A;  3PPU A;  1R26 A;  1FB6 A;  3LJR A;  1PX7 A;  5DCG A;  5JCU A;  5EPF A;  4ZIJ A;  2VD1 A;  3KP8 A;  3E9J B;  3TGZ A;  3M0F A;  4ULX A;  1TXX A;  2F8A A;  2QGV A;  1Z6M A;  2FWG A;  3QD9 A;  1ABA A;  1SD8 A;  1GSS A;  5GAP D;  4O92 A;  20GS A;  3QOU A;  5HFG A;  1SK0 A;  5D73 A;  9GSS A;  5G1K A;  3QCP A;  4IW9 A;  3UJ1 A;  3EC3 A;  1W4V A;  3QDN A;  3VK9 A;  1O6J A;  4HU7 A;  2RUE A;  2AV4 A;  4EUY A;  2GSR A;  4LMV A;  4HZ2 A;  4XS1 A;  16GS A;  1XWC A;  4D73 A;  1THO A;  4HS1 A;  1J08 A;  5J3R A;  3WYW A;  2WUL A;  4RQX A;  3IK9 A;  4OD7 A;  3ZZX A;  2IJY A;  5C04 A;  5D9T A;  5IMC A;  3F9U A;  2YWN A;  1SJ6 A;  4KSM A;  2IPA A;  5ECN B;  1SU9 A;  1VF3 A;  2WB9 A;  3KCM A;  1T3B A;  3L9S A;  2H72 A;  3WD6 A;  3QAG A;  5ECQ B;  5F05 A;  5IQY A;  2H1G A;  2H8L A;  2IFQ B;  5HR0 A;  3VI7 A;  4ECJ A;  2GQK A;  1U3I A;  2CX3 A;  2MMA A;  2YZU A;  4TR3 A;  1U87 A;  3HZ4 A;  5B7C A;  3M8N A;  3GV1 A;  1QXH A;  3M1G A;  5IOX A;  3K8N A;  3GUS A;  4PUR A;  2HZE B;  2H76 A;  4F0B A;  3ED3 A;  2H1B A;  2V1M A;  1OAZ A;  3F4T A;  2KLX A;  2HSN B;  2N5F A;  1CQG A;  2CZ3 A;  2MMN A;  5DAK A;  2GST A;  4G0I A;  3A2W A;  2CVD A;  1GUL A;  3V1W A;  2VCT A;  2VLU A;  3I69 A;  1SK1 A;  2K8S A;  1TTZ A;  2JZS A;  2I3Y A;  3ZMK A;  1AIU A;  3F4R A;  4ILF A;  3S9F A;  5F06 A;  2H0G A;  1GTI A;  10GS A;  1A2L A;  2M72 A;  4X0X A;  2H73 A;  1I9D A;  4ISD A;  2CVK A;  1EGO A;  4IEL A;  5IMD A;  5LCZ A;  2O85 A;  5HR1 A;  4BVX A;  2YAN A;  1WE0 A;  3I9V 2;  1EV4 A;  3I6A A;  2CX4 A;  2OE1 A;  3RBT A;  3VWX A;  1BX9 A;  5ELA A;  2XPD A;  1UVZ A;  1VF4 A;  1UA5 A;  4PGT A;  2WCI A;  4YQU A;  4KDU A;  1SEN A;  4EKZ A;  4P3Y B;  1MDJ A;  3C71 A;  3N5O A;  1H4O A;  8GSS A;  1Z7R A;  1ZYQ B;  5D9V A;  4PNG A;  3J7Y b;  1X5E A;  2LQO A;  3GL5 A;  5IMA A;  4TR0 A;  3KM6 A;  3QPM A;  2C0G A;  4O32 A;  1IYI A;  1GUH A;  4HQZ A;  3EWL A;  1TU8 A;  4KGI A;  1AQX A;  1ILO A;  4TXO A;  2PGT A;  2C3T A;  3IXR A;  4MDC A;  4IN0 A;  4MH3 A;  4NPB A;  4JED A;  4MJA A;  3H4K A;  3TRP A;  1T7P B;  3N9J A;  4WR4 A;  2XC2 A;  1X9M B;  4QL7 A;  1JZD A;  4PQH A;  1S3C A;  2P5R A;  11GS A;  2PVO C;  3GKK A;  5CYY A;  3WGD A;  2PU9 C;  3H1N A;  1AW9 A;  4PQI A;  2VL2 A;  4K8M A;  3H8Q A;  3LEF A;  4IKH A;  5CRG A;  3ZIT A;  2YV9 A;  3MSZ A;  2WZ9 A;  3P90 A;  5AGY A;  3ZFB A;  1SD9 A;  4MF6 A;  5FWG A;  4EDZ A;  2JZR A;  3U5R E;  4HUA A;  5DQS A;  5J5N A;  2R4V A;  4MF7 A;  3KD0 A;  4XS4 A;  4OWY A;  1F37 A;  1A0F A;  3TJF A;  3CBU A;  2FGX A;  4X1U A;  2C3N A;  1XWG A;  1YF1 A;  1VF2 A;  5IO0 A;  2VCV A;  1RK4 A;  5IO2 A;  1WPI A;  2REM A;  5COH A;  1G6Y A;  3ERF A;  2F51 A;  2VAF A;  2H1D A;  4PUA A;  1PSQ A;  3QAV A;  1ZZY A;  4Q5F A;  5GAN D;  3WT2 A;  2QKE A;  3FR6 A;  4EL1 A;  3F3R A;  1B8X A;  4I5Q A;  2YJ7 A;  1YEX A;  4E8E A;  4ZIL A;  3D4T A;  2HSH A;  5A4W A;  3BCI A;  5A5K A;  4K0N A;  3RPN A;  4FYB A;  2F9S A;  3KEB A;  2L4Q A;  3A5W A;  4DSR A;  4AGS A;  4IHU A;  2HSM B;  5JWQ B;  5EVO A;  3Q19 A;  1EOG A;  3ISO A;  1RW1 A;  3GKX A;  5ECP B;  1GRX A;  1FB0 A;  3HJP A;  4ZBA A;  3D5J A;  1B48 A;  3E3E A;  3RHB A;  1FVK A;  4TR1 B;  3HVV A;  3L78 A;  5J4U A;  4FIW A;  4IP1 A;  4KND A;  4OCF A;  3TKR A;  4K7O A;  3DVW A;  3GHA A;  1XW5 A;  1MDK A;  3FZ9 A;  6GSY A;  5DVB A;  1EZK A;  5HQP A;  1A8Y A;  2Z9S A;  3E0U A;  5A4V A;  6GSV A;  1IYH A;  2I9H A;  1PA3 A;  1SK2 A;  2PUK C;  5AIV A;  4IP6 A;  3TRQ A;  2RUF A;  1K3Y A;  2YNX A;  2B5Y A;  3M9K A;  2H6X A;  3ZML A;  3GST A;  2PN8 A;  3C1S A;  4NHZ A;  1DE1 A;  1TP9 A;  2N5A A;  4PQ1 A;  2YWI A;  4GXZ A;  5CNW A;  2OAC A;  2JAD A;  1H75 A;  1GLP A;  4L5L A;  2E2G A;  3UVH A;  2YCD A;  4MMM A;  2A2R A;  1ERW A;  2GT5 A;  4EE0 A;  2PBJ A;  3GN3 A;  5DAL B;  4TN8 A;  1OKD A;  4QL9 A;  4YH2 A;  1V98 A;  1ZCP A;  2HLS A;  5KN2 A;  4WBJ A;  2MZC A;  3QMX A;  5ECK B;  4KCE A;  1KTE A;  3L9U A;  3TB2 A;  2E2M A;  2L6C A;  2CAI A;  1GTB A;  3GTU A;  4ZL9 A;  3ME8 A;  5HFK A;  3UMA A;  1A8L A;  3DRN A;  1XVQ A;  2WGR A;  1T4Y A;  2TIR A;  4BVY A;  3F8U A;  1BAY A;  1G0T A;  1SKW B;  2C0F A;  1FOV A;  2CAQ A;  2J23 A;  3ZIJ A;  3BBY A;  3UOM A;  2DIY A;  1TRS A;  1K0A A;  1HNA A;  5DJM A;  1EP8 A;  1BYE A;  3VFI A;  1BG5 A;  2AJQ B;  5DJL A;  1XW6 A;  1V57 A;  3VPT A;  3QFB C;  2HI7 A;  2X8H A;  1ON4 A;  4FQU A;  5KEJ A;  2N5B A;  4V2L A;  3KIJ A;  2JU5 A;  2H0I A;  4O5R A;  3OR5 A;  4K2D A;  1YKC A;  4MH2 A;  2B1L A;  3VWW A;  5F07 A;  3A2V A;  3Q6O A;  1XOA A;  1E2Y A;  2QSI A;  3KMN A;  1S3A A;  1HQO A;  3P2A A;  5IOW A;  2IME A;  2F8F A;  2GVP A;  3GKN A;  3ZTL A;  4Q5R A;  3C8E A;  1V40 A;  3LOR A;  1LBK A;  2DMM A;  3UAP A;  4GSS A;  5HR3 A;  4D73 B;  2O8V B;  3UAR A;  3UBL A;  5ECI B;  1VRS D;  2V41 A;  2FNO A;  2R37 A;  1A2M A;  5GST A;  2LJK A;  3IAS 2;  1X5D A;  4POM A;  1XOB A;  2HRN A;  4EDY A;  2R3X A;  4FYC A;  3EYT A;  4ECC A;  1AUC A;  5KN1 A;  13GS A;  2BJX A;  4GST A;  3DEX A;  5F0G A;  3CMI A;  2B7J A;  19GS A;  3ZVJ A;  1SYX A;  3DYR A;  3F3Q A;  3TKQ A;  2BTO T;  3L9V A;  1TK5 B;  5J9B A;  1GSE A;  3RHC A;  3FR9 A;  1MD4 A;  4RI7 A;  1PKW A;  2RLI A;  2ZCT A;  1QMV A;  2BMX A;  2NDO A;  5G30 A;  4LLR A;  1ERT A;  4ML1 A;  1QGV A;  4MZC A;  4ZB9 A;  5ID2 B;  2KUC A;  2QC7 A;  1SL1 B;  1WIK A;  3TOT A;  3IRA A;  2B1K A;  1BJX A;  4N11 A;  3LSZ A;  3F6D A;  3KMO A;  3QAW A;  2H6Y A;  4OCE A;  4KF9 A;  3PH9 A;  3CTG A;  12GS A;  3F4S A;  3EMX A;  3P7X A;  3F63 A;  4MJE A;  1EOH A;  2JL4 A;  3WGE A;  4K9Z A;  2WFC A;  2J9H A;  3VI5 A;  4N10 A;  3Q74 A;  2FUG 2;  2DML A;  1AAZ A;  5D8I A;  2G0F A;  2FLS A;  1YEP A;  4AJ6 A;  4KX4 A;  1JFU A;  5EL8 A;  4E8H A;  4ML6 A;  4NWY A;  3HVX A;  4N30 A;  5DQY A;  2KP2 A;  4JE1 A;  4KCA A;  4MZB A;  5GSS A;  4WBR D;  2HFD A;  3UEM A;  5J9C A;  1OE7 A;  3HCZ A;  5JWR B;  1M7T A;  2AYT A;  3C73 A;  1R7H A;  2I1U A;  1PGT A;  2VL2 C;  2VL3 A;  1O8X A;  3GA4 A;  1PKZ A;  3EUR A;  4AF2 A;  2ALB A;  2GSS A;  2RM5 A;  3TJB A;  1ML6 A;  4GWR A;  1SKS B;  2NVL A;  3QR6 A;  3HJO A;  5KN3 A;  4GQF A;  4EXJ A;  4RI6 A;  2B5X A;  2CVB A;  2WJU A;  5EY6 A;  4WF4 A;  4L0U A;  4F82 A;  2HXK A;  3LXT A;  2YWM A;  3QFA C;  2I4A A;  4ECI A;  2YJH A;  6GST A;  3J7Y k;  2OBK A;  4EC0 A;  1F6M C;  2FWE A;  5B8B A;  2E0Q A;  4JU5 A;  4PTS A;  2UZ8 A;  3D6I A;  3KZQ A;  3GL3 A;  2LJA A;  2FWH A;  2VOC A;  5D96 A;  2C3Q A;  4RUV A;  4XIH A;  1F9M A;  4BL7 A;  2YOI A;  1JHB A;  4ECB A;  2OAD A;  4PXO A;  2LNT A;  3LFL A;  3IC8 A;  4DEJ A;  1XIY A;  1JZR A;  3HKR A;  3UIW A;  4I2T A;  1U88 A;  4Z7X A;  2LRT A;  2H74 A;  3HY2 A;  3DD3 A;  1M0U A;  1EP7 A;  2EIQ A;  4MK3 A;  2KP1 A;  5ECH B;  3APS A;  3JCM L;  3O76 A;  3TKP A;  2C4J A;  3KXO A;  4IBP A;  3RAZ A;  2XBQ A;  3Q18 A;  2G2Q A;  4XS4 B;  3US3 A;  2LST A;  3TJG A;  1TKD B;  4L5O A;  1T00 A;  1V2A A;  1Z3E A;  1X0R A;  3CTF A;  1OE8 A;  4HOJ A;  1O81 A;  2LRC A;  4LL4 B;  1XWB A;  4G0K A;  1Y6E A;  2X64 A;  1F2E A;  5J41 A;  4K1F A;  3VWU A;  5B6N A;  1YJ6 A;  4HEA 2;  3PR8 A;  2YN1 A;  3IOS A;  4MZW A;  5KN0 A;  1TOF A;  2IMI A;  3EIN A;  2HZF A;  4KSO A;  4GLT A;  2YWO A;  3A2X A;  1MEK A;  3ZFL A;  4EF0 A;  3GH9 A;  1G7E A;  2GGT A;  2GZP A;  4YAV A;  3M9J A;  4KUN A;  3C7M A;  1Z7P A;  1FW1 A;  1UC7 A;  2FA8 A;  4CDO A;  1YDK A;  1TRU A;  2OJL A;  4KAE A;  1B4P A;  2DJK A;  3IPZ A;  1SKR B;  2VCW A;  3GX8 A;  3R2Q A;  4LL1 B;  1ZYE A;  4TKY A;  4PNF A;  5CO3 A;  4TOP A;  1S3D A;  3F0I A;  3MWH A;  1N8J A;  3PGT A;  4MF5 A;  2HRK A;  17GS A;  1OYJ A;  3HD5 A;  2OKA A;  5JCG A;  1FO5 A;  5DDL A;  3M3M A;  1QUW A;  3APO A;  5JWO B;  4J56 E;  5L71 A;  2LEG A;  1F3A A;  2B5E A;  3DXB A;  1W89 A;  1G7O A;  1X9W B;  5G2Z A;  7GSS A;  2YZH A;  4MA9 A;  4Q5Q A;  3G7Y A;  4MCU A;  2ES7 A;  2KOK A;  1XVW A;  4BPY A;  3G9B A;  2IIY A;  1GSU A;  5DBQ A;  1DSB A;  1GTU A;  4N0V A;  5LNK e;  1B4Q A;  2FY6 A;  4NXI A;  3NOF A;  4KH7 A;  3IA1 A;  3D0Z A;  5E4W A;  18GS A;  3VLN A;  1VF1 A;  22GS A;  5ECR B;  5IMF A;  2TRX A;  3TKS A;  2GZY A;  3EVI A;  4GQC A;  3EE2 A;  4AJ8 A;  3IE3 A;  5B6M A;  3IBH A;  2TRC P;  2JAC A;  3GTU B;  4PX1 A;  1OC9 A;  1YKA A;  3TKS E;  2GLR A;  5ELG A;  4TR4 A;  2CV4 A;  4OMV A;  2H1A A;  3LYK A;  4J2F A;  2EC4 A;  4TVE A;  3WT1 A;  3ZYW A;  3GSS A;  3FW2 A;  4TXV A;  4BVY B;  1MD3 A;  3FK8 A;  1JZO A;  1K0O A;  1YZX A;  1XCC A;  3CSI A;  1J9B A;  2PMT A;  2DJ0 A;  4POB A;  1QQ2 A;  1GP1 A;  2RM6 A;  2VD0 A;  4OFM A;  1THX A;  3LGC A;  1EGR A;  1K3O A;  3GUR A;  1TJD A;  1GNE A;  2H70 A;  3HDC A;  4G0L A;  2YV7 A;  5E59 A;  4EO3 A;  3UBK A;  4HU9 A;  1AQW A;  2C0D A;  1SJI A;  1X9S B;  2DLX A;  4I2U A;  4GTU A;  2HQT A;  5FHI A;  6GSW A;  4WEY A;  3H93 A;  3AY8 A;  2H19 A;  1K0B A;  4HQS A;  3GH6 A;  3SWL A;  2HE3 A;  1Z5Y E;  4KE3 A;  2JSZ A;  1WOU A;  2LJR A;  5H5Q A;  5IMV A;  3CRT A;  2XHF A;  3GIX A;  3GMF A;  2AHE A;  2CQ9 A;  3ZRE A;  1NM3 A;  1YQ1 A;  2FCH A;  1GL8 A;  2H75 A;  5H5R A;  2HYX A;  2GDR A;  4HDE A;  1WJK A;  3HVS A;  3MNG A;  1XFL A;  2MMO A;  3RPP A;  2I81 A;  3HJM A;  1T1V A;  4WR5 A;  2VCZ A;  4MP4 A;  3NIV A;  4KDY A;  1VGL A;  3TDG A;  4V1A g;  2HT9 A;  1GSF A;  1K0C A;  2B3S A;  1WMJ A;  4V1A p;  5IIZ A;  4ZBD A;  3G7J A;  5HFI A;  2LNS A;  3BCK A;  2H66 A;  2P31 A;  4OO4 A;  2CZ2 A;  5LD0 A;  1A2J A;  2VUP A;  4GRF A;  2HRA A;  1GSQ A;  5G1L A;  1KNG A;  1I5G A;  4ZXG A;  1AC1 A;  3VUR A;  1A24 A;  1DBY A;  1Y25 A;  4GF0 A;  4EVM A;  1YY7 A;  4HJ2 A;  2CA8 A;  2OE0 A;  2VM2 A;  3H79 A;  1PN9 A;  1V9W A;  4JR6 A;  4NV5 A;  3C1R A;  4FO5 A;  3FYG A;  2L5L A;  1KBN A;  4K6X A;  4CW9 A;  5IMZ A;  2IMD A;  5CRD A;  3IHQ A;  3TOU A;  2L57 A;  4IVF A;  4K0G A;  2PER A;  4KW6 A;  3APQ A;  1U6T A;  1URM A;  1ERU A;  4KDX A;  4HI7 A;  1Z9H A;  2C0E A;  4GCI A;  1AQV A;  1ZMA A;  3I43 A;  4WXT A;  1O73 A;  3CXG A;  3HYP A;  4PUF C;  1GLQ A;  2P0G A;  2IL3 A;  4LA1 A;  4MJB A;  1RQM A;  4QQ7 A;  4ZBB A;  1GSD A;  1UN2 A;  1Q4J A;  3W8J A;  4DSS A;  1M9A A;  2OBI A;  2VIM A;  4ZL7 A;  2HNL A;  2F3M A;  5DAK B;  4NHW A;  3LQ7 A;  2O89 A;  1HNB A;  1GH2 A;  4BWS A;  3FZ5 A;  5ECL B;  2C80 A;  1TDI A;  4I6X A;  4F03 A;  1EEJ A;  2GS3 A;  1LJR A;  1C72 A;  4G9H A;  2WS2 A;  3A3T A;  5C00 A;  4ZB6 A;  3HHV A;  2LKU A;  3P8W A;  2B6M A;  4IJI A;  2GT6 A;  5D9X A;  1ERV A;  5B8A A;  1AXD A;  2PPT A;  4DVC A;  2L59 A;  1PMT A;  1Q98 A;  3TJK A;  4BVX B;  3KTB A;  4K7I A;  2A2S A;  3MDK A;  4I8B A;  3FZ4 A;  3ZVJ D;  4F2I A;  3LG6 A;  4BL7 B;  3D4M A;  1NW2 A;  1X5C A;  2DJJ A;  3EU4 A;  3FR3 A;  4ZB8 A;  5ID2 A;  4YAP A;  2ZUP A;  1EV9 A;  1GNW A;  2ON7 A;  4KB3 A;  1EEM A;  1BED A;  2HRF A;  2WRT A;  3BOA A;  5CP1 A;  1R5A A;  3UVT A;  1M2D A;  2AB6 A;  1CQH A;  4Q5N A;  2XBI A;  5CRE A;  3SBC A;  1WWJ A;  3FKF A;  2K6V A;  1OKT A;  3ME7 A;  2IMK A;  4TXO B;  2HSY A;  2NPB A; 
#chains in the Genus database with same CATH topology
 1JZW A;  1E6B A;  1GUM A;  1S3R A;  4MLY A;  2MMZ A;  4JBB A;  2IFQ A;  2YPM A;  1ACV A;  4NV2 A;  2OA7 A;  2H71 A;  4TRX A;  1MDI A;  2DIZ A;  3DGQ A;  1F3B A;  1QFN A;  4N0Z A;  1K0N A;  14GS A;  4XTS A;  2RII A;  5IPH A;  1XWA A;  2VLT A;  4MAB A;  2EFH A;  4HZ4 A;  3FZA A;  5ABR A;  2HZE A;  2VL9 A;  4WET A;  3IK7 A;  3VPQ A;  4ZL8 A;  5AN1 A;  2HSN A;  5D9W A;  3EMP A;  1O7U A;  1TI1 A;  2NTO A;  5ECS A;  2K9F A;  3CYN A;  5D93 A;  5DCH A;  1G6W A;  1XBS A;  1XZO A;  1A23 A;  5CRW A;  1PQN A;  4LMW A;  1OC3 A;  1DUG A;  2LQQ A;  3RDW A;  2AAW A;  1MTC A;  1A0R P;  3DKS A;  2VLV A;  4POK A;  4XS6 A;  1TU7 A;  4GSN A;  1PD2 1;  5A5H A;  3ZLP A;  2AUV A;  2H30 A;  2A4V A;  4N3Z A;  5AIX A;  2YP6 A;  1O8W A;  5INY A;  4IGJ A;  3KP9 A;  4J57 E;  3TKS C;  2GQL A;  5HR2 A;  3FHK A;  4V2M A;  1GUK A;  1N2A A;  2XPE A;  1GSY A;  3KGK A;  3IAM 2;  2HRK B;  2PWJ A;  2MYG A;  1NHO A;  2H0H A;  4AJ7 A;  2L4C A;  3LXZ A;  4JZQ A;  1PRX A;  2FA4 A;  4CY6 A;  1OVN A;  4AKG A;  5AIS A;  2VO4 A;  5F8B A;  2CT6 A;  2DJ1 A;  2PVQ A;  1FG4 A;  2M46 A;  5FT3 A;  6GSS A;  3G7I A;  4G19 A;  1GTA A;  3KH9 A;  3ZRD A;  4OFN A;  3DIE A;  2O87 A;  2R0P A;  3W6G A;  4CHS A;  5CAX A;  2DSA A;  2IWT A;  4KA0 A;  4MNN A;  2M80 A;  1LU4 A;  2DBC A;  3GKM A;  1FHE A;  2V6O A;  5J4Y A;  3L4N A;  1M2B A;  3TCO A;  3MAK A;  1HD2 A;  1SYR A;  4F9Z A;  1B9Y C;  2JZT A;  3EU3 A;  3BJ5 A;  4YQM A;  2H6Z A;  2X8G A;  3LWA A;  1OC9 B;  1M99 A;  1FAA A;  2LS5 A;  1J0F A;  5G31 A;  4BWQ A;  2R2J A;  4NMU A;  4WKW A;  3RFR C;  3HA9 A;  4YQV A;  1TK8 B;  1YF0 A;  2FHE A;  1WRY A;  3O3T A;  2EIR A;  5ENU A;  3ERG A;  4XHM A;  2V32 A;  4XRD A;  3DWV A;  3CSH A;  2OE3 A;  3IR4 A;  2IMF A;  3DVX A;  3TUE A;  1XXU A;  1BG1 A;  4MPG A;  1O85 A;  4G10 A;  2EIO A;  5G5E A;  2ON5 A;  4ACS A;  4YKG A;  5IPG A;  3FRC A;  4I97 A;  5A4U A;  4MPF A;  5G5F A;  1SJZ A;  2LTK A;  4K7N A;  2DKH A;  3HXS A;  3GYK A;  4O5U A;  1PL2 A;  2E7P A;  4WF5 A;  2KHP A;  3GNJ A;  1TK0 B;  2ZNM A;  3D21 A;  3TU3 B;  1M9B A;  4OFT A;  4O7H A;  6GSX A;  2WDU A;  1T8E B;  2O7K A;  2K8V A;  4OO5 A;  4RQR A;  1NHY A;  1TRW A;  1XPV A;  1EWX A;  1K0D A;  3UL3 A;  2C1Y A;  5BMU A;  2MBT A;  2L6D A;  5GZZ B;  3BD2 A;  4DSQ A;  2LUS A;  3KH7 A;  4JR4 A;  5CRH A;  1B9X C;  3GFK A;  3ZL5 A;  3ERW A;  5ECM B;  1U3A A;  3D22 A;  2HSM A;  2DJ3 A;  1TI3 A;  1FVJ A;  2LRN A;  1QK8 A;  2IN3 A;  3L0H A;  2K18 A;  1GWC A;  1ZL9 A;  1XW9 A;  1OC8 A;  4FYU A;  4L8E A;  4TR1 A;  2C8U A;  2VCX A;  1SL2 B;  1T4Z A;  2V6K A;  1HNC A;  3FEU A;  1XWK A;  1TRV A;  2P5Q A;  4ID0 A;  1ST9 A;  2GZZ A;  1BQ7 A;  3IHG A;  3IC4 A;  2GQM A;  1SL0 B;  2L5O A;  2GTU A;  2FWF A;  4TW5 A;  1PX6 A;  2X8C A;  1HYU A;  4JRR A;  3GX0 A;  1NSW A;  3CRU A;  3TRX A;  2B7K A;  3LYP A;  1ZOF A;  1JLW A;  2V2G A;  4USS A;  2FD3 A;  3A5I A;  2NBS A;  1PL1 A;  3F6F A;  5ECO B;  4BA7 A;  1TW9 A;  3GRX A;  3ZIV A;  2H01 A;  4POL A;  4E68 A;  4FH8 A;  4K2X A;  2JSY A;  4L0W A;  3DML A;  3FY7 A;  1ZGN A;  5H5S A;  4MJC A;  4H86 A;  1R4W A;  3W8S A;  3PIN A;  4NAX A;  2X99 A;  5IM9 A;  3NZN A;  4X43 A;  1K0M A;  1K3L A;  5KOX A;  1KEB A;  1USB A;  1M3J A;  4G2E A;  4IJ3 A;  1Z6N A;  2R5G A;  3VWV A;  1JLV A;  2MBS A;  3O6T A;  5JCW A;  3IDV A;  2DC5 A;  5DAL A;  1DE2 A;  3WGX A;  2DJ2 A;  4IQA A;  3HZ8 A;  3IV4 A;  4XCS A;  2VM1 A;  4V2N A;  1M2A A;  3CSJ A;  4IS0 A;  3KJY A;  3TJJ A;  2LV3 A;  2GSQ A;  2R6K A;  1WP0 A;  3KTL A;  4IQ1 A;  6GSU A;  3U6V A;  4HJM A;  3R3E A;  1R5P A;  1V58 A;  4DSS B;  2D2Z A;  4XRA A;  4F0C A;  2VCQ A;  3PPU A;  1R26 A;  1FB6 A;  3LJR A;  1PX7 A;  5DCG A;  5JCU A;  5EPF A;  4ZIJ A;  2VD1 A;  3KP8 A;  3E9J B;  3TGZ A;  3M0F A;  4ULX A;  1TXX A;  2F8A A;  2QGV A;  1Z6M A;  2FWG A;  3QD9 A;  1ABA A;  1SD8 A;  1GSS A;  5GAP D;  4O92 A;  20GS A;  3QOU A;  5HFG A;  1SK0 A;  5D73 A;  1SVM A;  9GSS A;  5G1K A;  3QCP A;  4IW9 A;  3UJ1 A;  1N25 A;  3EC3 A;  1W4V A;  3QDN A;  3VK9 A;  1O6J A;  4HU7 A;  2RUE A;  2AV4 A;  4EUY A;  2GSR A;  4LMV A;  5J47 A;  4HZ2 A;  4XS1 A;  16GS A;  1YEW C;  1XWC A;  4D73 A;  1THO A;  4HS1 A;  1J08 A;  5J3R A;  3WYW A;  2WUL A;  4RQX A;  3IK9 A;  4AKI A;  4OD7 A;  3ZZX A;  2IJY A;  5C04 A;  5D9T A;  5IMC A;  3CWG A;  3F9U A;  2YWN A;  1SJ6 A;  4KSM A;  2IPA A;  5ECN B;  4PI0 C;  1SU9 A;  1VF3 A;  2WB9 A;  3KCM A;  1T3B A;  3L9S A;  2H72 A;  3WD6 A;  3QAG A;  5ECQ B;  5F05 A;  5IQY A;  2H1G A;  2H8L A;  2IFQ B;  5BRT A;  5HR0 A;  3VI7 A;  4ECJ A;  2GQK A;  1U3I A;  2CX3 A;  2MMA A;  2YZU A;  4TR3 A;  1U87 A;  3HZ4 A;  5B7C A;  3M8N A;  1PFO A;  3GV1 A;  1QXH A;  3M1G A;  5IOX A;  3K8N A;  3GUS A;  4PUR A;  1SVL A;  4AI6 A;  2HZE B;  2H76 A;  4F0B A;  3ED3 A;  2H1B A;  2V1M A;  1OAZ A;  3F4T A;  2KLX A;  2HSN B;  2N5F A;  5J40 A;  1CQG A;  2CZ3 A;  2MMN A;  5DAK A;  2GST A;  4G0I A;  3A2W A;  2CVD A;  1GUL A;  3V1W A;  2VCT A;  2VLU A;  3I69 A;  1SK1 A;  2K8S A;  1TTZ A;  2JZS A;  2I3Y A;  3ZMK A;  1AIU A;  3F4R A;  4ILF A;  3S9F A;  5F06 A;  2H0G A;  1GTI A;  10GS A;  1A2L A;  2M72 A;  4X0X A;  2H73 A;  1I9D A;  4ISD A;  2CVK A;  1EGO A;  4IEL A;  5IMD A;  5LCZ A;  2O85 A;  4G01 A;  5HR1 A;  4BVX A;  2YAN A;  1WE0 A;  3I9V 2;  4Z2T A;  1EV4 A;  3I6A A;  2OE1 A;  2CX4 A;  3RBT A;  3VWX A;  2A4H A;  1BX9 A;  5ELA A;  2XPD A;  1BF5 A;  1UVZ A;  1VF4 A;  1UA5 A;  4PGT A;  2WCI A;  4YQU A;  4KDU A;  1SEN A;  4EKZ A;  4P3Y B;  1MDJ A;  3C71 A;  3N5O A;  1H4O A;  8GSS A;  1Z7R A;  1ZYQ B;  5D9V A;  4PNG A;  3J7Y b;  1X5E A;  2LQO A;  3GL5 A;  5IMA A;  4TR0 A;  3KM6 A;  2EFE A;  3QPM A;  2C0G A;  4O32 A;  1IYI A;  1GUH A;  4HQZ A;  3EWL A;  1TU8 A;  4KGI A;  1AQX A;  1ILO A;  4TXO A;  2PGT A;  2C3T A;  3IXR A;  4MDC A;  4IN0 A;  4MH3 A;  4NPB A;  4JED A;  4MJA A;  3LW9 A;  2X49 A;  3H4K A;  3TRP A;  1T7P B;  3N9J A;  4WR4 A;  2XC2 A;  1X9M B;  4QL7 A;  1JZD A;  4PQH A;  1S3C A;  2P5R A;  11GS A;  2PVO C;  3GKK A;  5CYY A;  3WGD A;  3CQF A;  2PU9 C;  3H1N A;  1AW9 A;  4PQI A;  2VL2 A;  4K8M A;  3H8Q A;  3LEF A;  4IKH A;  5CRG A;  3ZIT A;  1SVO A;  2YV9 A;  1YVL A;  3MSZ A;  4AKX B;  2WZ9 A;  3P90 A;  5AGY A;  3ZFB A;  1SD9 A;  4MF6 A;  5FWG A;  4EDZ A;  2JZR A;  3U5R E;  4HUA A;  5DQS A;  5J5N A;  2R4V A;  4MF7 A;  2O3E A;  3KD0 A;  4XS4 A;  4OWY A;  1F37 A;  1A0F A;  2WW2 A;  3CBU A;  3TJF A;  2FGX A;  4X1U A;  2C3N A;  1XWG A;  1YF1 A;  1VF2 A;  5IO0 A;  2VCV A;  1RK4 A;  5IO2 A;  1WPI A;  2REM A;  5COH A;  1G6Y A;  3ERF A;  2F51 A;  2VAF A;  2H1D A;  4PUA A;  1PSQ A;  3QAV A;  1ZZY A;  4Q5F A;  5GAN D;  3WT2 A;  2QKE A;  3FR6 A;  4EL1 A;  3F3R A;  1B8X A;  4I5Q A;  2YJ7 A;  2WVX A;  1YEX A;  4E8E A;  4ZIL A;  3D4T A;  2O5V A;  2HSH A;  5A4W A;  3BCI A;  5A5K A;  4K0N A;  3RPN A;  4FYB A;  5BMU B;  2F9S A;  3KEB A;  2L4Q A;  3A5W A;  4DSR A;  4AGS A;  4IHU A;  1M3I A;  2HSM B;  5JWQ B;  5EVO A;  3Q19 A;  1EOG A;  3ISO A;  1RW1 A;  3GKX A;  5ECP B;  1GRX A;  1FB0 A;  3HJP A;  4ZBA A;  3D5J A;  1B48 A;  3E3E A;  3RHB A;  1FVK A;  4TR1 B;  3HVV A;  3L78 A;  2QA2 A;  5J4U A;  4FIW A;  4IP1 A;  4KND A;  4OCF A;  3TKR A;  4K7O A;  3DVW A;  3GHA A;  1XW5 A;  1MDK A;  3FZ9 A;  6GSY A;  2OT3 A;  5DVB A;  1EZK A;  1ZYP A;  5HQP A;  1A8Y A;  2Z9S A;  3E0U A;  5A4V A;  6GSV A;  1IYH A;  2I9H A;  4PHZ C;  1PA3 A;  1SK2 A;  2PUK C;  5AIV A;  4IP6 A;  3TRQ A;  2RUF A;  1K3Y A;  2YNX A;  3MYD A;  2B5Y A;  3M9K A;  2H6X A;  3ZML A;  3GST A;  2PN8 A;  3C1S A;  4NHZ A;  1DE1 A;  1TP9 A;  2N5A A;  4PQ1 A;  2YWI A;  4GXZ A;  5CNW A;  2OAC A;  2JAD A;  1H75 A;  1GLP A;  2E2G A;  4L5L A;  3UVH A;  2YCD A;  4MMM A;  4CY8 A;  2A2R A;  1ERW A;  2GT5 A;  4EE0 A;  2PBJ A;  3GN3 A;  5DAL B;  4TN8 A;  1OKD A;  4QL9 A;  4YH2 A;  1V98 A;  1ZCP A;  2HLS A;  5KN2 A;  4ICY A;  4WBJ A;  2MZC A;  3QMX A;  5ECK B;  2WZS A;  4KCE A;  3HMJ G;  1KTE A;  3L9U A;  3TB2 A;  2E2M A;  2L6C A;  2CAI A;  1GTB A;  3GTU A;  4ZL9 A;  3ME8 A;  5HFK A;  3UMA A;  1A8L A;  4QMK A;  3DRN A;  1XVQ A;  2WGR A;  1T4Y A;  2TIR A;  4BVY A;  3F8U A;  1BAY A;  1G0T A;  1SKW B;  2C0F A;  1FOH A;  1FOV A;  2CAQ A;  2J23 A;  3ZIJ A;  3BBY A;  3UOM A;  2DIY A;  1TRS A;  1K0A A;  1HNA A;  5DJM A;  1EP8 A;  1BYE A;  3VFI A;  1BG5 A;  2AJQ B;  5DJL A;  1XW6 A;  1V57 A;  3VPT A;  3QFB C;  2EFD A;  2HI7 A;  2X8H A;  1ON4 A;  4FQU A;  5KEJ A;  2N5B A;  4V2L A;  3KIJ A;  2JU5 A;  2H0I A;  4O5R A;  3OR5 A;  4K2D A;  1YKC A;  4MH2 A;  2B1L A;  3VWW A;  5F07 A;  3A2V A;  3HVN A;  3Q6O A;  1XOA A;  4EIP A;  3MIX A;  1E2Y A;  2QSI A;  3KMN A;  1S3A A;  1HQO A;  3P2A A;  5IOW A;  2IME A;  2F8F A;  2GVP A;  3GKN A;  3ZTL A;  4Q5R A;  3C8E A;  1V40 A;  3LOR A;  1LBK A;  2DMM A;  3UAP A;  4GSS A;  5HR3 A;  4D73 B;  2O8V B;  3UAR A;  3UBL A;  5ECI B;  5A34 A;  1VRS D;  2V41 A;  2FNO A;  2R37 A;  4K5R A;  1A2M A;  5GST A;  2LJK A;  3IAS 2;  1X5D A;  4POM A;  1XOB A;  2HRN A;  4EDY A;  2R3X A;  4FYC A;  3EYT A;  4ECC A;  1AUC A;  5KN1 A;  13GS A;  2BJX A;  4GST A;  3DEX A;  5F0G A;  3CMI A;  2B7J A;  19GS A;  3ZVJ A;  1SYX A;  3DYR A;  2R0C A;  3F3Q A;  3TKQ A;  2BTO T;  3L9V A;  1TK5 B;  5J9B A;  1GSE A;  3RHC A;  3FR9 A;  1MD4 A;  4RI7 A;  1PKW A;  2RLI A;  2ZCT A;  1QMV A;  2BMX A;  2NDO A;  5G30 A;  4LLR A;  1ERT A;  4ML1 A;  1QGV A;  4MZC A;  4ZB9 A;  5ID2 B;  2KUC A;  2QC7 A;  1SL1 B;  1WIK A;  3TOT A;  3IRA A;  2B1K A;  1BJX A;  4N11 A;  3LSZ A;  3F6D A;  3KMO A;  3QAW A;  2H6Y A;  4OCE A;  4KF9 A;  3PH9 A;  3CTG A;  12GS A;  3F4S A;  3EMX A;  3P7X A;  3F63 A;  1TXU A;  5A1N A;  4MJE A;  1EOH A;  2JL4 A;  3WGE A;  2R0G A;  4K9Z A;  2WFC A;  2J9H A;  3VI5 A;  4N10 A;  3Q74 A;  2FUG 2;  2DML A;  1AAZ A;  4YKF A;  5D8I A;  2G0F A;  2FLS A;  1YEP A;  4AJ6 A;  4KX4 A;  1JFU A;  5EL8 A;  4E8H A;  4ML6 A;  4NWY A;  3HVX A;  4N30 A;  5DQY A;  2KP2 A;  4JE1 A;  4KCA A;  4MZB A;  5GSS A;  4WBR D;  2HFD A;  3UEM A;  5J9C A;  1OE7 A;  3HCZ A;  5JWR B;  5KOW A;  1M7T A;  2AYT A;  3C73 A;  1R7H A;  2I1U A;  1PGT A;  2VL2 C;  2VL3 A;  1O8X A;  3GA4 A;  1PKZ A;  3EUR A;  4AF2 A;  2ALB A;  2GSS A;  2RM5 A;  3TJB A;  1ML6 A;  4GWR A;  1SKS B;  2NVL A;  3QR6 A;  3HJO A;  5KN3 A;  4GQF A;  4EXJ A;  4RI6 A;  5A5H B;  2B5X A;  2CVB A;  2WJU A;  5EY6 A;  4WF4 A;  4L0U A;  2VKZ G;  4F82 A;  2HXK A;  3LXT A;  2YWM A;  3QFA C;  3CHX C;  2I4A A;  4ECI A;  2YJH A;  6GST A;  3J7Y k;  2OBK A;  4EC0 A;  1F6M C;  2FWE A;  5B8B A;  2E0Q A;  4JU5 A;  4PTS A;  2UZ8 A;  3D6I A;  3KZQ A;  3GL3 A;  2LJA A;  2FWH A;  2VOC A;  5D96 A;  2C3Q A;  4RUV A;  4XIH A;  1F9M A;  4BL7 A;  2YOI A;  1JHB A;  4ECB A;  2OAD A;  4PXO A;  2LNT A;  3LFL A;  3IC8 A;  4DEJ A;  1XIY A;  1JZR A;  3HKR A;  3UIW A;  4I2T A;  1U88 A;  4A5P A;  4Z7X A;  2LRT A;  2H74 A;  3HY2 A;  3DD3 A;  1M0U A;  1EP7 A;  2EIQ A;  4MK3 A;  2KP1 A;  5ECH B;  3APS A;  3JCM L;  3O76 A;  3TKP A;  4K5S A;  2C4J A;  3KXO A;  1S4B P;  4IBP A;  3RAZ A;  2XBQ A;  3Q18 A;  2G2Q A;  4XS4 B;  3US3 A;  2LST A;  2UV8 G;  3TJG A;  1TKD B;  4L5O A;  1T00 A;  1V2A A;  1Z3E A;  1X0R A;  3CTF A;  1OE8 A;  4HOJ A;  1O81 A;  2LRC A;  4LL4 B;  1XWB A;  4G0K A;  1Y6E A;  2X64 A;  1F2E A;  5J41 A;  4K1F A;  3VWU A;  5B6N A;  1YJ6 A;  4HEA 2;  3PR8 A;  2YN1 A;  3IOS A;  2WVZ A;  4MZW A;  5KN0 A;  1TOF A;  4PI2 C;  3EIN A;  2IMI A;  2HZF A;  4KSO A;  4GLT A;  2WVX B;  2YWO A;  3A2X A;  1MEK A;  3ZFL A;  4EF0 A;  3GH9 A;  1G7E A;  2GGT A;  2GZP A;  4YAV A;  3M9J A;  4KUN A;  3C7M A;  1Z7P A;  1FW1 A;  1UC7 A;  2FA8 A;  4CDO A;  1YDK A;  1TRU A;  2OJL A;  4KAE A;  1B4P A;  2DJK A;  3IPZ A;  1SKR B;  2VCW A;  3GX8 A;  3R2Q A;  4LL1 B;  1ZYE A;  4TKY A;  4PNF A;  5CO3 A;  4TOP A;  1S3D A;  3F0I A;  4Z2U A;  3MWH A;  1N8J A;  3PGT A;  4MF5 A;  2HRK A;  4X4J A;  17GS A;  1OYJ A;  3HD5 A;  2OKA A;  5JCG A;  4EIQ A;  1FO5 A;  5DDL A;  4BIK A;  3M3M A;  1QUW A;  3APO A;  5JWO B;  4J56 E;  5L71 A;  2LEG A;  1F3A A;  2B5E A;  3DXB A;  1W89 A;  1G7O A;  4GDF A;  1X9W B;  5G2Z A;  7GSS A;  2YZH A;  4MA9 A;  4Q5Q A;  3G7Y A;  4MCU A;  2ES7 A;  2KOK A;  1XVW A;  4BPY A;  3G9B A;  2IIY A;  1GSU A;  5DBQ A;  1DSB A;  4AKH A;  1GTU A;  3RGB C;  4N0V A;  5LNK e;  1B4Q A;  2FY6 A;  4NXI A;  3NOF A;  4KH7 A;  3IA1 A;  3D0Z A;  5E4W A;  18GS A;  3VLN A;  1VF1 A;  22GS A;  5ECR B;  5IMF A;  2TRX A;  3TKS A;  2GZY A;  3EVI A;  4GQC A;  3EE2 A;  4AJ8 A;  3IE3 A;  5B6M A;  3IBH A;  2TRC P;  2JAC A;  3GTU B;  4PX1 A;  1OC9 A;  1YKA A;  3TKS E;  2GLR A;  5ELG A;  4TR4 A;  2CV4 A;  4OMV A;  2H1A A;  3LYK A;  2WW0 A;  4J2F A;  2EC4 A;  4TVE A;  3WT1 A;  3ZYW A;  3GSS A;  3FW2 A;  4TXV A;  4BVY B;  1MD3 A;  3FK8 A;  1JZO A;  4Z2R A;  1K0O A;  1YZX A;  1XCC A;  3CSI A;  1J9B A;  2PMT A;  2DJ0 A;  3FMW A;  2EFC A;  4POB A;  1QQ2 A;  1GP1 A;  2RM6 A;  2VD0 A;  4OFM A;  1THX A;  3LGC A;  1EGR A;  1K3O A;  3GUR A;  1TJD A;  1GNE A;  4O5Q A;  2H70 A;  3HDC A;  4G0L A;  2YV7 A;  5E59 A;  4EO3 A;  3UBK A;  4HU9 A;  1AQW A;  2C0D A;  1SJI A;  1X9S B;  2DLX A;  4I2U A;  4GTU A;  2HQT A;  5FHI A;  6GSW A;  4WEY A;  3H93 A;  3AY8 A;  2H19 A;  2H1L A;  1K0B A;  4HQS A;  3GH6 A;  3SWL A;  2HE3 A;  1PN0 A;  1Z5Y E;  4KE3 A;  2JSZ A;  1WOU A;  2LJR A;  5H5Q A;  5IMV A;  3CRT A;  2XHF A;  3GIX A;  3GMF A;  2AHE A;  2CQ9 A;  3ZRE A;  1NM3 A;  1YQ1 A;  2FCH A;  1GL8 A;  2H75 A;  5H5R A;  2HYX A;  1Y1U A;  2GDR A;  5A34 B;  4HDE A;  2QA1 A;  1WJK A;  3HVS A;  3MNG A;  1XFL A;  2MMO A;  3RPP A;  4W66 A;  2I81 A;  3HJM A;  1T1V A;  4WR5 A;  2VCZ A;  4MP4 A;  3NIV A;  4KDY A;  1VGL A;  3TDG A;  4V1A g;  2HT9 A;  1GSF A;  1K0C A;  2B3S A;  1WMJ A;  4V1A p;  5IIZ A;  4ZBD A;  3G7J A;  5HFI A;  2LNS A;  3BCK A;  2WVY A;  2H66 A;  2P31 A;  4OO4 A;  2CZ2 A;  5LD0 A;  1A2J A;  2VUP A;  4GRF A;  2HRA A;  1GSQ A;  5G1L A;  1KNG A;  1I5G A;  4ZXG A;  1AC1 A;  3VUR A;  1A24 A;  1DBY A;  1Y25 A;  4GF0 A;  4EVM A;  1YY7 A;  4HJ2 A;  2CA8 A;  2OE0 A;  2VM2 A;  3H79 A;  1PN9 A;  1V9W A;  4JR6 A;  4NV5 A;  3C1R A;  4FO5 A;  3FYG A;  2L5L A;  1KBN A;  4K6X A;  4CW9 A;  5IMZ A;  2IMD A;  5CRD A;  3IHQ A;  3TOU A;  2L57 A;  4IVF A;  5A1N B;  4K0G A;  2PER A;  4KW6 A;  3APQ A;  1U6T A;  2O36 A;  1URM A;  1ERU A;  4KDX A;  4HI7 A;  1Z9H A;  2WW3 A;  2C0E A;  4GCI A;  4ZB7 A;  1AQV A;  1ZMA A;  3I43 A;  3EPT A;  4WXT A;  1O73 A;  3CXG A;  3HYP A;  4PUF C;  1GLQ A;  2P0G A;  1ZYN A;  2IL3 A;  2DKI A;  4LA1 A;  4MJB A;  1RQM A;  4QQ7 A;  4ZBB A;  1GSD A;  1UN2 A;  1Q4J A;  3W8J A;  4DSS A;  1M9A A;  2OBI A;  2VIM A;  4ZL7 A;  2HNL A;  2F3M A;  5DAK B;  4NHW A;  3LQ7 A;  2O89 A;  4HSC X;  1HNB A;  1GH2 A;  4BWS A;  3FZ5 A;  5ECL B;  2C80 A;  1TDI A;  4I6X A;  4F03 A;  4FXY P;  1EEJ A;  2GS3 A;  1LJR A;  1C72 A;  4G9H A;  2X4A A;  2WS2 A;  3A3T A;  5C00 A;  4ZB6 A;  2WW1 A;  3HHV A;  2LKU A;  3P8W A;  2B6M A;  4IJI A;  2GT6 A;  5D9X A;  1ERV A;  1XG8 A;  5B8A A;  1AXD A;  2PPT A;  4DVC A;  2L59 A;  1PMT A;  1Q98 A;  3TJK A;  4BVX B;  3KTB A;  4K7I A;  2A2S A;  3MDK A;  4I8B A;  3FZ4 A;  3ZVJ D;  4F2I A;  3LG6 A;  4BL7 B;  3D4M A;  1NW2 A;  1X5C A;  2DJJ A;  3EU4 A;  3FR3 A;  4ZB8 A;  5ID2 A;  4YAP A;  2ZUP A;  1EV9 A;  1GNW A;  2ON7 A;  4KB3 A;  1EEM A;  1BED A;  2HRF A;  2WRT A;  3BOA A;  5J4V A;  5CP1 A;  1I1I P;  1R5A A;  3UVT A;  1M2D A;  2AB6 A;  1CQH A;  4Q5N A;  2XBI A;  5CRE A;  3SBC A;  1WWJ A;  3FKF A;  2K6V A;  1OKT A;  3ME7 A;  2IMK A;  4TXO B;  2HSY A;  2A2P A;  2NPB A; 
#chains in the Genus database with same CATH homology
 1JZW A;  1E6B A;  1GUM A;  4MLY A;  2MMZ A;  4JBB A;  2IFQ A;  2YPM A;  1ACV A;  4NV2 A;  2OA7 A;  2H71 A;  4TRX A;  1MDI A;  2DIZ A;  3DGQ A;  1F3B A;  1QFN A;  4N0Z A;  1K0N A;  14GS A;  4XTS A;  2RII A;  5IPH A;  1XWA A;  2VLT A;  4MAB A;  2EFH A;  4HZ4 A;  3FZA A;  5ABR A;  2HZE A;  2VL9 A;  4WET A;  3IK7 A;  3VPQ A;  4ZL8 A;  5AN1 A;  2HSN A;  5D9W A;  3EMP A;  1O7U A;  1TI1 A;  2NTO A;  5ECS A;  2K9F A;  3CYN A;  5D93 A;  5DCH A;  1G6W A;  1XBS A;  1XZO A;  1A23 A;  5CRW A;  1PQN A;  4LMW A;  1OC3 A;  1DUG A;  2LQQ A;  3RDW A;  2AAW A;  1MTC A;  1A0R P;  3DKS A;  2VLV A;  4POK A;  4XS6 A;  1TU7 A;  4GSN A;  1PD2 1;  5A5H A;  3ZLP A;  2AUV A;  2H30 A;  2A4V A;  4N3Z A;  5AIX A;  2YP6 A;  1O8W A;  5INY A;  4IGJ A;  3KP9 A;  4J57 E;  3TKS C;  2GQL A;  5HR2 A;  3FHK A;  4V2M A;  1GUK A;  1N2A A;  2XPE A;  1GSY A;  3KGK A;  3IAM 2;  2HRK B;  2PWJ A;  2MYG A;  1NHO A;  2H0H A;  4AJ7 A;  2L4C A;  3LXZ A;  4JZQ A;  1PRX A;  2FA4 A;  4CY6 A;  1OVN A;  4AKG A;  5AIS A;  2VO4 A;  5F8B A;  2CT6 A;  2DJ1 A;  2PVQ A;  1FG4 A;  2M46 A;  5FT3 A;  6GSS A;  3G7I A;  4G19 A;  1GTA A;  3KH9 A;  3ZRD A;  4OFN A;  3DIE A;  2O87 A;  2R0P A;  3W6G A;  4CHS A;  5CAX A;  2DSA A;  2IWT A;  4KA0 A;  4MNN A;  2M80 A;  1LU4 A;  2DBC A;  3GKM A;  1FHE A;  2V6O A;  5J4Y A;  3L4N A;  1M2B A;  3TCO A;  3MAK A;  1HD2 A;  1SYR A;  4F9Z A;  1B9Y C;  2JZT A;  3EU3 A;  3BJ5 A;  4YQM A;  2H6Z A;  2X8G A;  3LWA A;  1OC9 B;  1M99 A;  1FAA A;  2LS5 A;  1J0F A;  5G31 A;  4BWQ A;  2R2J A;  4NMU A;  4WKW A;  3HA9 A;  4YQV A;  1TK8 B;  1YF0 A;  2FHE A;  1WRY A;  3O3T A;  2EIR A;  5ENU A;  3ERG A;  4XHM A;  2V32 A;  4XRD A;  3DWV A;  3CSH A;  2OE3 A;  3IR4 A;  2IMF A;  3DVX A;  3TUE A;  1XXU A;  1BG1 A;  4MPG A;  1O85 A;  4G10 A;  2EIO A;  5G5E A;  2ON5 A;  4ACS A;  4YKG A;  5IPG A;  3FRC A;  4I97 A;  5A4U A;  4MPF A;  5G5F A;  1SJZ A;  2LTK A;  4K7N A;  2DKH A;  3HXS A;  3GYK A;  4O5U A;  1PL2 A;  2E7P A;  4WF5 A;  2KHP A;  3GNJ A;  1TK0 B;  2ZNM A;  3D21 A;  3TU3 B;  1M9B A;  4OFT A;  4O7H A;  6GSX A;  2WDU A;  1T8E B;  2O7K A;  2K8V A;  4OO5 A;  4RQR A;  1NHY A;  1TRW A;  1XPV A;  1EWX A;  1K0D A;  3UL3 A;  2C1Y A;  5BMU A;  2MBT A;  2L6D A;  5GZZ B;  3BD2 A;  4DSQ A;  2LUS A;  3KH7 A;  4JR4 A;  5CRH A;  1B9X C;  3GFK A;  3ZL5 A;  3ERW A;  5ECM B;  1U3A A;  3D22 A;  2HSM A;  2DJ3 A;  1TI3 A;  1FVJ A;  2LRN A;  1QK8 A;  2IN3 A;  3L0H A;  2K18 A;  1GWC A;  1ZL9 A;  1XW9 A;  1OC8 A;  4FYU A;  4L8E A;  4TR1 A;  2C8U A;  2VCX A;  1SL2 B;  1T4Z A;  2V6K A;  1HNC A;  3FEU A;  1XWK A;  1TRV A;  2P5Q A;  4ID0 A;  1ST9 A;  2GZZ A;  1BQ7 A;  3IHG A;  3IC4 A;  2GQM A;  1SL0 B;  2L5O A;  2GTU A;  2FWF A;  4TW5 A;  1PX6 A;  2X8C A;  1HYU A;  4JRR A;  3GX0 A;  1NSW A;  3CRU A;  3TRX A;  2B7K A;  3LYP A;  1ZOF A;  1JLW A;  2V2G A;  4USS A;  2FD3 A;  3A5I A;  2NBS A;  1PL1 A;  3F6F A;  5ECO B;  4BA7 A;  1TW9 A;  3GRX A;  3ZIV A;  2H01 A;  4POL A;  4E68 A;  4FH8 A;  4K2X A;  2JSY A;  4L0W A;  3DML A;  3FY7 A;  1ZGN A;  5H5S A;  4MJC A;  4H86 A;  1R4W A;  3W8S A;  3PIN A;  4NAX A;  2X99 A;  5IM9 A;  3NZN A;  4X43 A;  1K0M A;  1K3L A;  5KOX A;  1KEB A;  1USB A;  4G2E A;  4IJ3 A;  1Z6N A;  2R5G A;  3VWV A;  1JLV A;  2MBS A;  3O6T A;  5JCW A;  3IDV A;  2DC5 A;  5DAL A;  1DE2 A;  3WGX A;  2DJ2 A;  4IQA A;  3HZ8 A;  3IV4 A;  4XCS A;  2VM1 A;  4V2N A;  1M2A A;  3CSJ A;  4IS0 A;  3KJY A;  3TJJ A;  2LV3 A;  2GSQ A;  2R6K A;  1WP0 A;  3KTL A;  4IQ1 A;  6GSU A;  3U6V A;  4HJM A;  3R3E A;  1R5P A;  1V58 A;  4DSS B;  2D2Z A;  4XRA A;  4F0C A;  2VCQ A;  3PPU A;  1R26 A;  1FB6 A;  3LJR A;  1PX7 A;  5DCG A;  5JCU A;  5EPF A;  4ZIJ A;  2VD1 A;  3KP8 A;  3E9J B;  3TGZ A;  3M0F A;  4ULX A;  1TXX A;  2F8A A;  2QGV A;  1Z6M A;  2FWG A;  3QD9 A;  1ABA A;  1SD8 A;  1GSS A;  5GAP D;  4O92 A;  20GS A;  3QOU A;  5HFG A;  1SK0 A;  5D73 A;  1SVM A;  9GSS A;  5G1K A;  3QCP A;  4IW9 A;  3UJ1 A;  1N25 A;  3EC3 A;  1W4V A;  3QDN A;  3VK9 A;  1O6J A;  4HU7 A;  2RUE A;  2AV4 A;  4EUY A;  2GSR A;  4LMV A;  5J47 A;  4HZ2 A;  4XS1 A;  16GS A;  1XWC A;  4D73 A;  1THO A;  4HS1 A;  1J08 A;  5J3R A;  3WYW A;  2WUL A;  4RQX A;  3IK9 A;  4AKI A;  4OD7 A;  3ZZX A;  2IJY A;  5C04 A;  5D9T A;  5IMC A;  3CWG A;  3F9U A;  2YWN A;  1SJ6 A;  4KSM A;  2IPA A;  5ECN B;  1SU9 A;  1VF3 A;  2WB9 A;  3KCM A;  1T3B A;  3L9S A;  2H72 A;  3WD6 A;  3QAG A;  5ECQ B;  5F05 A;  5IQY A;  2H1G A;  2H8L A;  2IFQ B;  5BRT A;  5HR0 A;  3VI7 A;  4ECJ A;  2GQK A;  1U3I A;  2CX3 A;  2MMA A;  2YZU A;  4TR3 A;  1U87 A;  3HZ4 A;  5B7C A;  3M8N A;  3GV1 A;  1QXH A;  3M1G A;  5IOX A;  3K8N A;  3GUS A;  4PUR A;  1SVL A;  4AI6 A;  2HZE B;  2H76 A;  4F0B A;  3ED3 A;  2H1B A;  2V1M A;  1OAZ A;  3F4T A;  2KLX A;  2HSN B;  2N5F A;  5J40 A;  1CQG A;  2CZ3 A;  2MMN A;  5DAK A;  2GST A;  4G0I A;  3A2W A;  2CVD A;  1GUL A;  3V1W A;  2VCT A;  2VLU A;  3I69 A;  1SK1 A;  2K8S A;  1TTZ A;  2JZS A;  2I3Y A;  3ZMK A;  1AIU A;  3F4R A;  4ILF A;  3S9F A;  5F06 A;  2H0G A;  1GTI A;  10GS A;  1A2L A;  2M72 A;  4X0X A;  2H73 A;  1I9D A;  4ISD A;  2CVK A;  1EGO A;  4IEL A;  5IMD A;  5LCZ A;  2O85 A;  4G01 A;  5HR1 A;  4BVX A;  2YAN A;  1WE0 A;  3I9V 2;  4Z2T A;  1EV4 A;  3I6A A;  2OE1 A;  2CX4 A;  3RBT A;  3VWX A;  2A4H A;  1BX9 A;  5ELA A;  2XPD A;  1BF5 A;  1UVZ A;  1VF4 A;  1UA5 A;  4PGT A;  2WCI A;  4YQU A;  4KDU A;  1SEN A;  4EKZ A;  4P3Y B;  1MDJ A;  3C71 A;  3N5O A;  1H4O A;  8GSS A;  1Z7R A;  1ZYQ B;  5D9V A;  4PNG A;  3J7Y b;  1X5E A;  2LQO A;  3GL5 A;  5IMA A;  4TR0 A;  2EFE A;  3KM6 A;  3QPM A;  2C0G A;  4O32 A;  1IYI A;  1GUH A;  4HQZ A;  3EWL A;  1TU8 A;  4KGI A;  1AQX A;  1ILO A;  4TXO A;  2PGT A;  2C3T A;  3IXR A;  4MDC A;  4IN0 A;  4MH3 A;  4NPB A;  4JED A;  4MJA A;  3LW9 A;  2X49 A;  3H4K A;  3TRP A;  1T7P B;  3N9J A;  4WR4 A;  2XC2 A;  1X9M B;  4QL7 A;  1JZD A;  4PQH A;  1S3C A;  2P5R A;  11GS A;  2PVO C;  3GKK A;  5CYY A;  3WGD A;  2PU9 C;  3H1N A;  1AW9 A;  4PQI A;  2VL2 A;  4K8M A;  3H8Q A;  3LEF A;  4IKH A;  5CRG A;  3ZIT A;  1SVO A;  2YV9 A;  1YVL A;  3MSZ A;  4AKX B;  2WZ9 A;  3P90 A;  5AGY A;  3ZFB A;  1SD9 A;  4MF6 A;  5FWG A;  4EDZ A;  2JZR A;  3U5R E;  4HUA A;  5DQS A;  5J5N A;  2R4V A;  4MF7 A;  3KD0 A;  4XS4 A;  4OWY A;  1F37 A;  1A0F A;  3TJF A;  3CBU A;  2FGX A;  4X1U A;  2C3N A;  1XWG A;  1YF1 A;  1VF2 A;  5IO0 A;  2VCV A;  1RK4 A;  5IO2 A;  1WPI A;  2REM A;  5COH A;  1G6Y A;  3ERF A;  2F51 A;  2VAF A;  2H1D A;  4PUA A;  1PSQ A;  3QAV A;  1ZZY A;  4Q5F A;  5GAN D;  3WT2 A;  2QKE A;  3FR6 A;  4EL1 A;  3F3R A;  1B8X A;  4I5Q A;  2YJ7 A;  1YEX A;  4E8E A;  4ZIL A;  3D4T A;  2O5V A;  2HSH A;  5A4W A;  3BCI A;  5A5K A;  4K0N A;  3RPN A;  4FYB A;  5BMU B;  2F9S A;  3KEB A;  2L4Q A;  3A5W A;  4DSR A;  4AGS A;  4IHU A;  2HSM B;  5JWQ B;  5EVO A;  3Q19 A;  1EOG A;  3ISO A;  1RW1 A;  3GKX A;  5ECP B;  1GRX A;  1FB0 A;  3HJP A;  4ZBA A;  3D5J A;  1B48 A;  3E3E A;  3RHB A;  1FVK A;  4TR1 B;  3HVV A;  3L78 A;  2QA2 A;  5J4U A;  4FIW A;  4IP1 A;  4KND A;  4OCF A;  3TKR A;  4K7O A;  3DVW A;  3GHA A;  1XW5 A;  1MDK A;  3FZ9 A;  6GSY A;  2OT3 A;  5DVB A;  1EZK A;  1ZYP A;  5HQP A;  1A8Y A;  2Z9S A;  3E0U A;  5A4V A;  6GSV A;  1IYH A;  2I9H A;  1PA3 A;  1SK2 A;  2PUK C;  5AIV A;  4IP6 A;  3TRQ A;  2RUF A;  1K3Y A;  2YNX A;  3MYD A;  2B5Y A;  3M9K A;  2H6X A;  3ZML A;  3GST A;  2PN8 A;  3C1S A;  4NHZ A;  1DE1 A;  1TP9 A;  2N5A A;  4PQ1 A;  2YWI A;  4GXZ A;  5CNW A;  2OAC A;  2JAD A;  1H75 A;  1GLP A;  2E2G A;  4L5L A;  3UVH A;  2YCD A;  4MMM A;  4CY8 A;  2A2R A;  1ERW A;  2GT5 A;  4EE0 A;  2PBJ A;  3GN3 A;  5DAL B;  4TN8 A;  1OKD A;  4QL9 A;  4YH2 A;  1V98 A;  1ZCP A;  2HLS A;  5KN2 A;  4ICY A;  4WBJ A;  2MZC A;  3QMX A;  5ECK B;  4KCE A;  3HMJ G;  1KTE A;  3L9U A;  3TB2 A;  2E2M A;  2L6C A;  2CAI A;  1GTB A;  3GTU A;  4ZL9 A;  3ME8 A;  5HFK A;  3UMA A;  1A8L A;  4QMK A;  3DRN A;  1XVQ A;  2WGR A;  1T4Y A;  2TIR A;  4BVY A;  3F8U A;  1BAY A;  1G0T A;  1SKW B;  2C0F A;  1FOH A;  1FOV A;  2CAQ A;  2J23 A;  3ZIJ A;  3BBY A;  3UOM A;  2DIY A;  1TRS A;  1K0A A;  1HNA A;  5DJM A;  1EP8 A;  1BYE A;  3VFI A;  1BG5 A;  2AJQ B;  5DJL A;  1XW6 A;  1V57 A;  3VPT A;  3QFB C;  2EFD A;  2HI7 A;  2X8H A;  1ON4 A;  4FQU A;  5KEJ A;  2N5B A;  4V2L A;  3KIJ A;  2JU5 A;  2H0I A;  4O5R A;  3OR5 A;  4K2D A;  1YKC A;  4MH2 A;  2B1L A;  3VWW A;  5F07 A;  3A2V A;  3Q6O A;  1XOA A;  4EIP A;  3MIX A;  1E2Y A;  2QSI A;  3KMN A;  1S3A A;  1HQO A;  3P2A A;  5IOW A;  2IME A;  2F8F A;  2GVP A;  3GKN A;  3ZTL A;  4Q5R A;  3C8E A;  1V40 A;  3LOR A;  1LBK A;  2DMM A;  3UAP A;  4GSS A;  5HR3 A;  4D73 B;  2O8V B;  3UAR A;  3UBL A;  5ECI B;  5A34 A;  1VRS D;  2V41 A;  2FNO A;  2R37 A;  4K5R A;  1A2M A;  5GST A;  2LJK A;  3IAS 2;  1X5D A;  4POM A;  1XOB A;  2HRN A;  4EDY A;  2R3X A;  4FYC A;  3EYT A;  4ECC A;  1AUC A;  5KN1 A;  13GS A;  2BJX A;  4GST A;  3DEX A;  5F0G A;  3CMI A;  2B7J A;  19GS A;  3ZVJ A;  1SYX A;  3DYR A;  2R0C A;  3F3Q A;  3TKQ A;  2BTO T;  3L9V A;  1TK5 B;  5J9B A;  1GSE A;  3RHC A;  3FR9 A;  1MD4 A;  4RI7 A;  1PKW A;  2RLI A;  2ZCT A;  1QMV A;  2BMX A;  2NDO A;  5G30 A;  4LLR A;  1ERT A;  4ML1 A;  1QGV A;  4MZC A;  4ZB9 A;  5ID2 B;  2KUC A;  2QC7 A;  1SL1 B;  1WIK A;  3TOT A;  3IRA A;  2B1K A;  1BJX A;  4N11 A;  3LSZ A;  3F6D A;  3KMO A;  3QAW A;  2H6Y A;  4OCE A;  4KF9 A;  3PH9 A;  3CTG A;  12GS A;  3F4S A;  3EMX A;  3P7X A;  3F63 A;  1TXU A;  5A1N A;  4MJE A;  1EOH A;  2JL4 A;  3WGE A;  2R0G A;  4K9Z A;  2WFC A;  2J9H A;  3VI5 A;  4N10 A;  3Q74 A;  2FUG 2;  2DML A;  1AAZ A;  4YKF A;  5D8I A;  2G0F A;  2FLS A;  1YEP A;  4AJ6 A;  4KX4 A;  1JFU A;  5EL8 A;  4E8H A;  4ML6 A;  4NWY A;  3HVX A;  4N30 A;  5DQY A;  2KP2 A;  4JE1 A;  4KCA A;  4MZB A;  5GSS A;  4WBR D;  2HFD A;  3UEM A;  5J9C A;  1OE7 A;  3HCZ A;  5JWR B;  5KOW A;  1M7T A;  2AYT A;  3C73 A;  1R7H A;  2I1U A;  1PGT A;  2VL2 C;  2VL3 A;  1O8X A;  3GA4 A;  1PKZ A;  3EUR A;  4AF2 A;  2ALB A;  2GSS A;  2RM5 A;  3TJB A;  1ML6 A;  4GWR A;  1SKS B;  2NVL A;  3QR6 A;  3HJO A;  5KN3 A;  4GQF A;  4EXJ A;  4RI6 A;  5A5H B;  2B5X A;  2CVB A;  2WJU A;  5EY6 A;  4WF4 A;  4L0U A;  2VKZ G;  4F82 A;  2HXK A;  3LXT A;  2YWM A;  3QFA C;  2I4A A;  4ECI A;  2YJH A;  6GST A;  3J7Y k;  2OBK A;  4EC0 A;  1F6M C;  2FWE A;  5B8B A;  2E0Q A;  4JU5 A;  4PTS A;  2UZ8 A;  3D6I A;  3KZQ A;  3GL3 A;  2LJA A;  2FWH A;  2VOC A;  5D96 A;  2C3Q A;  4RUV A;  4XIH A;  1F9M A;  4BL7 A;  2YOI A;  1JHB A;  4ECB A;  2OAD A;  4PXO A;  2LNT A;  3LFL A;  3IC8 A;  4DEJ A;  1XIY A;  1JZR A;  3HKR A;  3UIW A;  4I2T A;  1U88 A;  4A5P A;  4Z7X A;  2LRT A;  2H74 A;  3HY2 A;  3DD3 A;  1M0U A;  1EP7 A;  2EIQ A;  4MK3 A;  2KP1 A;  5ECH B;  3APS A;  3JCM L;  3O76 A;  3TKP A;  4K5S A;  2C4J A;  3KXO A;  4IBP A;  3RAZ A;  2XBQ A;  3Q18 A;  2G2Q A;  4XS4 B;  3US3 A;  2LST A;  2UV8 G;  3TJG A;  1TKD B;  4L5O A;  1T00 A;  1V2A A;  1Z3E A;  1X0R A;  3CTF A;  1OE8 A;  4HOJ A;  1O81 A;  2LRC A;  4LL4 B;  1XWB A;  4G0K A;  1Y6E A;  2X64 A;  1F2E A;  5J41 A;  4K1F A;  3VWU A;  5B6N A;  1YJ6 A;  4HEA 2;  3PR8 A;  2YN1 A;  3IOS A;  4MZW A;  5KN0 A;  1TOF A;  3EIN A;  2IMI A;  2HZF A;  4KSO A;  4GLT A;  2YWO A;  3A2X A;  1MEK A;  3ZFL A;  4EF0 A;  3GH9 A;  1G7E A;  2GGT A;  2GZP A;  4YAV A;  3M9J A;  4KUN A;  3C7M A;  1Z7P A;  1FW1 A;  1UC7 A;  2FA8 A;  4CDO A;  1YDK A;  1TRU A;  2OJL A;  4KAE A;  1B4P A;  2DJK A;  3IPZ A;  1SKR B;  2VCW A;  3GX8 A;  3R2Q A;  4LL1 B;  1ZYE A;  4TKY A;  4PNF A;  5CO3 A;  4TOP A;  1S3D A;  3F0I A;  4Z2U A;  3MWH A;  1N8J A;  3PGT A;  4MF5 A;  2HRK A;  4X4J A;  17GS A;  1OYJ A;  3HD5 A;  2OKA A;  5JCG A;  4EIQ A;  1FO5 A;  5DDL A;  3M3M A;  1QUW A;  3APO A;  5JWO B;  4J56 E;  5L71 A;  2LEG A;  1F3A A;  2B5E A;  3DXB A;  1W89 A;  1G7O A;  4GDF A;  1X9W B;  5G2Z A;  7GSS A;  2YZH A;  4MA9 A;  4Q5Q A;  3G7Y A;  4MCU A;  2ES7 A;  2KOK A;  1XVW A;  4BPY A;  3G9B A;  2IIY A;  1GSU A;  5DBQ A;  1DSB A;  4AKH A;  1GTU A;  4N0V A;  5LNK e;  1B4Q A;  2FY6 A;  4NXI A;  3NOF A;  4KH7 A;  3IA1 A;  3D0Z A;  5E4W A;  18GS A;  3VLN A;  1VF1 A;  22GS A;  5ECR B;  5IMF A;  2TRX A;  3TKS A;  2GZY A;  3EVI A;  4GQC A;  3EE2 A;  4AJ8 A;  3IE3 A;  5B6M A;  3IBH A;  2TRC P;  2JAC A;  3GTU B;  4PX1 A;  1OC9 A;  1YKA A;  3TKS E;  2GLR A;  5ELG A;  4TR4 A;  2CV4 A;  4OMV A;  2H1A A;  3LYK A;  4J2F A;  2EC4 A;  4TVE A;  3WT1 A;  3ZYW A;  3GSS A;  3FW2 A;  4TXV A;  4BVY B;  1MD3 A;  3FK8 A;  1JZO A;  4Z2R A;  1K0O A;  1YZX A;  1XCC A;  3CSI A;  1J9B A;  2PMT A;  2DJ0 A;  3FMW A;  2EFC A;  4POB A;  1QQ2 A;  1GP1 A;  2RM6 A;  2VD0 A;  4OFM A;  1THX A;  3LGC A;  1EGR A;  1K3O A;  3GUR A;  1TJD A;  1GNE A;  4O5Q A;  2H70 A;  3HDC A;  4G0L A;  2YV7 A;  5E59 A;  4EO3 A;  3UBK A;  4HU9 A;  1AQW A;  2C0D A;  1SJI A;  1X9S B;  2DLX A;  4I2U A;  4GTU A;  2HQT A;  5FHI A;  6GSW A;  4WEY A;  3H93 A;  3AY8 A;  2H19 A;  2H1L A;  1K0B A;  4HQS A;  3GH6 A;  3SWL A;  2HE3 A;  1PN0 A;  1Z5Y E;  4KE3 A;  2JSZ A;  1WOU A;  2LJR A;  5H5Q A;  5IMV A;  3CRT A;  2XHF A;  3GIX A;  3GMF A;  2AHE A;  2CQ9 A;  3ZRE A;  1NM3 A;  1YQ1 A;  2FCH A;  1GL8 A;  2H75 A;  5H5R A;  2HYX A;  1Y1U A;  2GDR A;  5A34 B;  4HDE A;  2QA1 A;  1WJK A;  3HVS A;  3MNG A;  1XFL A;  2MMO A;  3RPP A;  4W66 A;  2I81 A;  3HJM A;  1T1V A;  4WR5 A;  2VCZ A;  4MP4 A;  3NIV A;  4KDY A;  1VGL A;  3TDG A;  4V1A g;  2HT9 A;  1GSF A;  1K0C A;  2B3S A;  1WMJ A;  4V1A p;  5IIZ A;  4ZBD A;  3G7J A;  5HFI A;  2LNS A;  3BCK A;  2H66 A;  2P31 A;  4OO4 A;  2CZ2 A;  5LD0 A;  1A2J A;  2VUP A;  4GRF A;  2HRA A;  1GSQ A;  5G1L A;  1KNG A;  1I5G A;  4ZXG A;  1AC1 A;  3VUR A;  1A24 A;  1DBY A;  1Y25 A;  4GF0 A;  4EVM A;  1YY7 A;  4HJ2 A;  2CA8 A;  2OE0 A;  2VM2 A;  3H79 A;  1PN9 A;  1V9W A;  4JR6 A;  4NV5 A;  3C1R A;  4FO5 A;  3FYG A;  2L5L A;  1KBN A;  4K6X A;  4CW9 A;  5IMZ A;  2IMD A;  5CRD A;  3IHQ A;  3TOU A;  2L57 A;  4IVF A;  5A1N B;  4K0G A;  2PER A;  4KW6 A;  3APQ A;  1U6T A;  1URM A;  1ERU A;  4KDX A;  4HI7 A;  1Z9H A;  2C0E A;  4GCI A;  4ZB7 A;  1AQV A;  1ZMA A;  3I43 A;  3EPT A;  4WXT A;  1O73 A;  3CXG A;  3HYP A;  4PUF C;  1GLQ A;  2P0G A;  1ZYN A;  2IL3 A;  2DKI A;  4LA1 A;  4MJB A;  1RQM A;  4QQ7 A;  4ZBB A;  1GSD A;  1UN2 A;  1Q4J A;  3W8J A;  4DSS A;  1M9A A;  2OBI A;  2VIM A;  4ZL7 A;  2HNL A;  2F3M A;  5DAK B;  4NHW A;  3LQ7 A;  2O89 A;  1HNB A;  1GH2 A;  4BWS A;  3FZ5 A;  5ECL B;  2C80 A;  1TDI A;  4I6X A;  4F03 A;  1EEJ A;  2GS3 A;  1LJR A;  1C72 A;  4G9H A;  2X4A A;  2WS2 A;  3A3T A;  5C00 A;  4ZB6 A;  3HHV A;  2LKU A;  3P8W A;  2B6M A;  4IJI A;  2GT6 A;  5D9X A;  1ERV A;  5B8A A;  1AXD A;  2PPT A;  4DVC A;  2L59 A;  1PMT A;  1Q98 A;  3TJK A;  4BVX B;  3KTB A;  4K7I A;  2A2S A;  3MDK A;  4I8B A;  3FZ4 A;  3ZVJ D;  4F2I A;  3LG6 A;  4BL7 B;  3D4M A;  1NW2 A;  1X5C A;  2DJJ A;  3EU4 A;  3FR3 A;  4ZB8 A;  5ID2 A;  4YAP A;  2ZUP A;  1EV9 A;  1GNW A;  2ON7 A;  4KB3 A;  1EEM A;  1BED A;  2HRF A;  2WRT A;  3BOA A;  5J4V A;  5CP1 A;  1R5A A;  3UVT A;  1M2D A;  2AB6 A;  1CQH A;  4Q5N A;  2XBI A;  5CRE A;  3SBC A;  1WWJ A;  3FKF A;  2K6V A;  1OKT A;  3ME7 A;  2IMK A;  4TXO B;  2HSY A;  2A2P A;  2NPB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...