3SWLA

Crystal structure analysis of h74a mutant of human clic1
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
232
structure length
232
Chain Sequence
PQVELFVKAGSDGAKIGNCPFSQRLFMVLWLKGVTFNVTTVDTKRRTETVQKLCPGGQLPFLLYGTEVATDTNKIEEFLEAVLCPPRYPKLAALNPESNTAGLDIFAKFSAYIKNSNPALNDNLEKGLLKALKVLDNYLTSPLPEEVDETSAEDEGVSQRKFLDGNELTLADCNLLPKLHIVQVVCKKYRGFTIPEAFRGVHRYLSNAYAREEFASTCPDDEEIELAYEQVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chloride intracellular channel protein 1
publication title Role of individual histidines in the pH-dependent global stability of human chloride intracellular channel 1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 76
structure length 232
sequence length 232
ec nomenclature
pdb deposition date 2011-07-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13409 GST_N_2 Glutathione S-transferase, N-terminal domain
A PF13410 GST_C_2 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 3swlA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3swlA01
5GSSA 2DJ2A 2HZFA 1OC3A 1PN9A 5JCGA 16GSA 2F51A 4TN8A 2VCTA 2VCXA 3D4TA 1BQ7A 5CO3A 2C0DA 3TUEA 2K8SA 17GSA 3ZVJA 2NBSA 2VD0A 4ZB8A 5ECOB 2VUPA 4D73B 1J08A 4ZILA 3LXZA 1SK0A 5D93A 1TU8A 3A2WA 3IPZA 3SBCA 1OVNA 5J3RA 1SYXA 3HJPA 4KCEA 5KN0A 1WRYA 4ZL8A 2P31A 3KD0A 3EU4A 4EXJA 2CVBA 3UIWA 2VCVA 5DALB 3CRTA 1PD21 2GSSA 3I43A 1V58A 2B5YA 2IWTA 1GUMA 4J2FA 2DJ1A 2G0FA 1YZXA 1ML6A 2IJYA 4PUAA 5H5QA 2FWFA 2YWOA 3VURA 4RI6A 2JL4A 4ZB9A 3ME8A 2PUKC 5CRHA 2BJXA 1A8YA 3TKPA 2MMZA 2HRNA 1SL1B 1QUWA 1M2BA 2GDRA 2K6VA 3KGKA 2K18A 1N8JA 2IFQA 2VCWA 4G2EA 4X1UA 4DEJA 1Z7PA 4G0LA 3RAZA 3BCIA 2ALBA 3N5OA 3H1NA 2V1MA 2VL2C 3IAM2 1VRSD 3D21A 4IP1A 4G10A 3C8EA 5D9TA 1JLVA 2LRNA 4NWYA 2HLSA 3GH9A 1XW5A 3VFIA 2ZNMA 4V2MA 2WGRA 2C3QA 3HY2A 1X9WB 2E2GA 1NM3A 2VM1A 4QQ7A 2YV7A 2N5BA 2L5OA 2EC4A 4ACSA 1ST9A 1ZZYA 6GSXA 3TJJA 1JZWA 1THXA 1MD3A 4USSA 4ZB6A 1XFLA 1FOVA 2IPAA 4Q5QA 3F3QA 2OBKA 4XS6A 4I6XA 3HD5A 3ZREA 1HYUA 2PN8A 4DSRA 2C80A 2H30A 4TOPA 3GKXA 1O8WA 5ENUA 5A4VA 3UAPA 5ECQB 1CQHA 3KH9A 3KIJA 1O85A 1EV4A 1GRXA 5BMUA 1TW9A 2H1DA 5E59A 5CAXA 2VLUA 2HE3A 3DKSA 1PSQA 3L0HA 3VLNA 2FA4A 1O7UA 3NOFA 3M1GA 3NZNA 1SJ6A 3VWXA 2GZZA 3C7MA 1GLPA 3BOAA 1TRVA 4GWRA 2M46A 2RLIA 1K0NA 18GSA 4BWQA 4I2UA 2WZ9A 2DJ3A 5C00A 3D0ZA 1THOA 3PPUA 1EP7A 4FYBA 6GSUA 2AYTA 1NSWA 1ZCPA 3DRNA 4CDOA 3ZLPA 4I8BA 2DMMA 5ECSA 1WMJA 4V1Ap 4POKA 5ID2B 2CAQA 1EEJA 3LJRA 1ABAA 3G9BA 2CX3A 2VLVA 5IOXA 1O81A 4HU7A 4TXOB 1I9DA 2L5LA 3KM6A 3QAWA 2HFDA 4MF5A 1VGLA 4P3YB 1PA3A 2FY6A 2FUG2 2OADA 1BX9A 3ZYWA 2YP6A 2OA7A 2B6MA 1B4PA 1WWJA 4JZQA 4MPGA 3TB2A 2ON7A 5ECNB 4RUVA 2FA8A 1X9SB 1AXDA 4HUAA 3LQ7A 4L0WA 4MH3A 3KJYA 5LNKe 2L4QA 3GKKA 3L78A 4EE0A 2I1UA 1Z6MA 2MMNA 4XS4A 4OO4A 1T4ZA 1B9XC 2QGVA 1TDIA 2REMA 1A0FA 3A2XA 2FWEA 3TKQA 1XVWA 3HVXA 19GSA 5KEJA 3U6VA 3GN3A 2YWMA 4JRRA 4HQSA 4G0KA 4ZIJA 1AQVA 6GSYA 4JR4A 1K0DA 4TR4A 3QMXA 5ECMB 3IC4A 3LXTA 2C3TA 1XPVA 5D9VA 2C0FA 2JZRA 2L57A 2O87A 2X64A 1SU9A 2HRKA 3FYGA 2CQ9A 3J7Yb 1JFUA 2H1BA 4OCFA 4CHSA 3KMNA 4AF2A 1UA5A 4IGJA 2VAFA 3HYPA 2VL3A 4G19A 2J23A 1U88A 2IMEA 3QPMA 3Q19A 1YJ6A 1PL1A 2X8HA 1SK1A 1IYIA 4I5QA 2LJRA 4F9ZA 3CMIA 1B9YC 1O73A 2LJAA 2FGXA 3PGTA 2DIZA 4F0CA 5IMVA 2FCHA 2DMLA 2HYXA 5F0GA 3GURA 4PQHA 5F8BA 4G9HA 2GQMA 5HFGA 5ABRA 1YF0A 3PR8A 1K0BA 1W89A 1BAYA 3M9JA 3D4MA 1A2LA 3APQA 3BCKA 1QK8A 1Q4JA 2YWIA 2RIIA 1K3OA 2VL9A 1M2AA 2RUFA 3GKMA 5J5NA 1VF2A 5D9WA 5EVOA 4O7HA 1ZOFA 1DE2A 4WKWA 3HJMA 5E4WA 3L9UA 2KUCA 1GSEA 4KDUA 3UVHA 2QKEA 2E0QA 3GNJA 3FZ4A 4PXOA 3F4SA 3IC8A 3TJBA 1K0MA 3FZ9A 1KEBA 2NVLA 3FZAA 3UL3A 3P8WA 2H72A 3O3TA 3CTGA 3MDKA 4O92A 1JLWA 2K8VA 2OE0A 3EINA 2WJUA 5EY6A 2GLRA 3HKRA 3VI7A 1AW9A 3IHQA 2A4VA 3UVTA 2LRCA 2PERA 5IQYA 3R2QA 1TJDA 1RK4A 3HJOA 2HZEA 4OWYA 3UOMA 4L0UA 2PWJA 2H8LA 4KH7A 5EL8A 5HFIA 2MBTA 4KE3A 1PMTA 1GSUA 5J9BA 2PGTA 3TOUA 2R2JA 5IPGA 4BL7A 1KBNA 2HRAA 2H71A 4LL4B 9GSSA 3VI5A 1W4VA 3HA9A 3LORA 3G7IA 2HRFA 2XHFA 1UVZA 2LS5A 2KP2A 1TXXA 1OC9A 4IELA 2GZPA 2YJ7A 1FO5A 4MZWA 5GZZB 4BPYA 4ECCA 3ZMKA 1EP8A 5DAKB 4Z7XA 4YAPA 1MDJA 1OKTA 1FAAA 1X5DA 3GIXA 2OBIA 3BJ5A 3GRXA 4MMMA 5HR2A 1CQGA 1OE7A 3DWVA 1TP9A 2LUSA 1K3LA 1R4WA 2FLSA 2RM6A 3DIEA 2WS2A 1C72A 4KGIA 4IS0A 5JWQB 1F3AA 11GSA 3GA4A 4DSQA 1X5EA 2OACA 3WT2A 3RHBA 1HD2A 3DEXA 1WOUA 3QOUA 2DLXA 4K0NA 1GUHA 3I69A 3G7YA 4N11A 4HI7A 2TIRA 5L71A 4XHMA 1T3BA 3GX0A 2LKUA 4KSOA 1OE8A 5J41A 2V32A 5CREA 1A0RP 4ECJA 2B1KA 5ECIB 1JZDA 3APOA 1TK8B 1B4QA 2ES7A 3LSZA 2NDOA 2XPEA 2CV4A 1GLQA 3M0FA 1FB0A 4YQVA 2GSTA 4ZBAA 4V2LA 4ZL9A 5FWGA 3L4NA 4N10A 4WETA 4POLA 2VD1A 4KX4A 1TK0B 4F03A 3C73A 3M9KA 2DJ0A 1VF3A 1WP0A 3KTLA 2MYGA 4ILFA 2NTOA 3RBTA 1BYEA 2PVQA 3TGZA 3CYNA 3QAGA 3TDGA 3IAS2 1YF1A 2IL3A 4LL1B 1AQXA 13GSA 1ACVA 1ILOA 5DBQA 4KDYA 4X0XA 2GGTA 4OFTA 2LNTA 2JSZA 1DE1A 3FR3A 2HI7A 4F0BA 4IVFA 20GSA 1KNGA 4EL1A 1BG5A 1G7EA 4YAVA 1U3AA 3KZQA 5G2ZA 4PGTA 2V41A 3DVWA 2YV9A 4GSTA 2AJQB 2YZHA 3TKSC 2L6CA 3LWAA 2CZ3A 1TRSA 5D96A 1FG4A 4HJMA 2O85A 1GTIA 1SD8A 1PGTA 2KHPA 3FK8A 1JZOA 1USBA 2HT9A 4BVXA 1PX7A 1EOGA 2VCZA 1E2YA 2BMXA 2HSMB 3H93A 5C04A 2YN1A 2H6YA 3QFBC 1XXUA 1EZKA 4MJCA 5GSTA 4WXTA 1OC8A 4N30A 4PURA 2WCIA 1SK2A 4ZXGA 1SJZA 2YPMA 1X5CA 2H73A 4GLTA 4HEA2 3S9FA 5KN1A 4MH2A 3EVIA 3CSHA 3CSJA 1A2MA 2C3NA 3DGQA 2IIYA 5IIZA 4D73A 2X8CA 2B5EA 1T7PB 3FRCA 3ISOA 3D5JA 4MP4A 1G7OA 1MEKA 1TTZA 3IA1A 5AN1A 3H8QA 4JEDA 1LJRA 4LA1A 1DUGA 3GTUB 3N9JA 1Z7RA 4OMVA 3P90A 3H4KA 2LSTA 5DALA 3F6FA 1GSDA 2CZ2A 3W6GA 1G0TA 2I4AA 4EUYA 1XW6A 2VL2A 4NXIA 4GTUA 4OCEA 1ERTA 3UBKA 4BVYB 3R3EA 4EDYA 1LU4A 2PVOC 4KUNA 2H0GA 2H76A 1YQ1A 2R5GA 1S3AA 4NAXA 3AY8A 3TKSE 4N0ZA 1B8XA 3RPPA 4WF4A 4K6XA 1S3CA 2I81A 3F0IA 1FHEA 2XPDA 1GULA 3ZVJD 2KP1A 2LQQA 3E3EA 2O7KA 1EGOA 2IN3A 1E6BA 4MDCA 1MDKA 5B6MA 1XIYA 2C4JA 5CNWA 1K3YA 2WRTA 1EOHA 5IMZA 3ZTLA 3QAVA 2V6OA 2YOIA 3GFKA 1PKWA 1XWKA 3L9VA 3VK9A 2AHEA 4E8HA 1UC7A 5H5SA 5D9XA 3US3A 12GSA 3A2VA 3E0UA 3TCOA 4L5LA 1PRXA 3ZL5A 3VPTA 3ZIVA 3PH9A 4POMA 2FWGA 3ZZXA 1M2DA 3GH6A 3VPQA 4DSSB 2AUVA 1OKDA 5COHA 1G6WA 4ZL7A 4LMVA 2EIQA 5LD0A 2IMKA 4TR1B 3KCMA 1HNAA 1J9BA 1ON4A 4RQXA 4BA7A 4IN0A 4IP6A 5CYYA 1XWCA 5INYA 2FNOA 2I9HA 2XC2A 4YQMA 4KCAA 1Z5YE 4MLYA 1XWBA 3LYKA 1TU7A 2CA8A 5D8IA 1A2JA 2PU9C 4GRFA 5AIVA 1WIKA 2Z9SA 1LBKA 1NW2A 1R26A 3GHAA 1TRWA 2LNSA 1FB6A 4FYUA 4FH8A 1GWCA 3KTBA 4YQUA 2M72A 4MK3A 2DJKA 4XS1A 2A2RA 5DCGA 3TOTA 4MF6A 4EC0A 1GTAA 5B7CA 4WR5A 3DXBA 4K8MA 1YEXA 3LG6A 1R5PA 5HFKA 1EWXA 3GYKA 3IR4A 4OO5A 5ID2A 3GL3A 3EYTA 4IQ1A 1XWAA 4K9ZA 1Q98A 2DJJA 2GS3A 4MCUA 4KA0A 2JU5A 1OYJA 4TXOA 3DMLA 3RHCA 1O8XA 4TXVA 2LRTA 4HOJA 4PQIA 3W8JA 4IKHA 3FZ5A 2YANA 7GSSA 2QC7A 3KH7A 4IHUA 4J56E 5G5EA 3MSZA 1WPIA 2PPTA 3CTFA 1PL2A 4XRAA 2RUEA 4V2NA 3O6TA 2C0GA 2JACA 1K0OA 3TJGA 4NHZA 3FHKA 3HZ4A 1QXHA 4HU9A 3WGXA 1ZYQB 1V9WA 3TRQA 3C71A 3GX8A 2QSIA 4XTSA 2JADA 2V2GA 1GNEA 3ERWA 2B5XA 4MJBA 4I2TA 2WFCA 1T1VA 4FYCA 1PX6A 2L59A 3WGDA 1JZRA 3PINA 2HNLA 2EIRA 2I3YA 4LMWA 5ELGA 1ERUA 3EURA 3FEUA 5ECHB 5A4WA 3A5WA 4KAEA 4ECBA 3SWLA 2X99A 3TJKA 5G1LA 4F2IA 3EE2A 4PQ1A 3RDWA 2CT6A 2LQOA 2B7KA 3KMOA 2F3MA 1PKZA 4NHWA 1B48A 4CW9A 2H70A 2IFQB 3UEMA 3CXGA 2AAWA 5AISA 3EWLA 1XOBA 3ZRDA 2YZUA 2F8FA 4O32A 3ZFLA 2WULA 4IJ3A 2VO4A 3C1SA 2GZYA 4KW6A 2X8GA 3LYPA 4ZBDA 2LJKA 2O89A 1GH2A 5ECPB 3O76A 3WD6A 3KP9A 4F82A 1YY7A 1TK5B 1HNCA 3I6AA 5DJLA 5AGYA 3IXRA 4EDZA 4WBJA 3HVSA 3TRPA 3LFLA 4K1FA 1OAZA 3DVXA 5IMAA 1T8EB 5IO0A 1T4YA 2GTUA 4BVXB 2E7PA 5KN3A 2MBSA 1GSSA 3P2AA 2PMTA 3GKNA 1T00A 2AV4A 3WGEA 3UBLA 1KTEA 2HSYA 1Y6EA 2H01A 1XW9A 1RQMA 2H75A 4IW9A 4EF0A 2DSAA 5DJMA 3FW2A 2XBQA 1QMVA 2K9FA 4Q5RA 5GAND 5D73A 4EVMA 1G6YA 4NV5A 4PX1A 1A24A 2H66A 2GT6A 4GF0A 3TKRA 5JCWA 4RI7A 4KF9A 1XOAA 3QCPA 1R5AA 3Q74A 3A3TA 4MPFA 4WBRD 1XBSA 4X43A 2R4VA 1BEDA 1QGVA 1O6JA 2LV3A 4K7OA 5G30A 3FR9A 4NMUA 4XRDA 1URMA 5H5RA 5DCHA 5G1KA 3GSTA 5FHIA 4NPBA 4YH2A 4HS1A 1SJIA 3D6IA 2C8UA 4HDEA 2VM2A 1GSFA 4WF5A 2JZSA 1A8LA 2H1AA 3C1RA 1GSQA 3F3RA 4MJEA 4H86A 4QL7A 1FVJA 1J0FA 2GSQA 2BTOT 3HVVA 4FO5A 22GSA 1ZL9A 4MABA 4TR0A 1YKCA 4GCIA 2R37A 4WEYA 4TR3A 1FVKA 4ID0A 3HDCA 2V6KA 4JBBA 1BJXA 3HXSA 5DAKA 3WYWA 3DD3A 2VIMA 3ZITA 1EGRA 2PBJA 1N2AA 1FW1A 1XZOA 3G7JA 2HSNB 4XS4B 3GL5A 4V1Ag 2FHEA 3QDNA 4K7IA 3GUSA 2GSRA 1MDIA 1QQ2A 4GQFA 2MZCA 4O5RA 1F2EA 5B6NA 3I9V2 1DSBA 2OE1A 5A4UA 1Y25A 1TKDB 3IRAA 2IMFA 1U3IA 1ZYEA 3KP8A 4MA9A 3F4RA 1GL8A 4TW5A 2JSYA 5A5KA 1TOFA 1GTUA 1ZGNA 2JZTA 3BBYA 3IBHA 2P0GA 4IBPA 3APSA 3F9UA 3FKFA 2GQLA 4MF7A 2HRKB 3ERGA 3UARA 10GSA 2WDUA 1SENA 4ECIA 2B7JA 2AB6A 4FIWA 1F3BA 3HHVA 2C0EA 2LEGA 4HJ2A 4L5OA 1SYRA 3L9SA 3QR6A 5IMFA 4PTSA 2OE3A 2D2ZA 5AIXA 1GP1A 2F8AA 3UJ1A 3QFAC 2P5RA 4MJAA 1MD4A 2N5FA 3KEBA 2H74A 6GSVA 1GNWA 4HZ2A 5ELAA 1H75A 3TKSA 3IDVA 4XIHA 1V98A 2F9SA 4ULXA 3RPNA 3CBUA 1ERWA 1RW1A 4Q5NA 3F8UA 1VF1A 4K0GA 3MAKA 2A2SA 4FQUA 3TRXA 3OR5A 3LGCA 5EPFA 1EEMA 2O8VB 3P7XA 1YDKA 1GTBA 5JWOB 4AJ6A 5DQSA 2H19A 1GUKA 4GSNA 1PQNA 1IYHA 5ECLB 3TJFA 5CP1A 6GSSA 4KDXA 1NHOA 2FWHA 1XWGA 4J57E 5J9CA 2R6KA 2CVDA 14GSA 4GXZA 2G2QA 2OKAA 2L6DA 5J4UA 5GAPD 4JE1A 2MMOA 4K2DA 1R7HA 1YKAA 4HQZA 2KLXA 3EU3A 4DVCA 3V1WA 2H1GA 3HZ8A 3K8NA 2IMIA 4EKZA 3VWVA 1MTCA 4EO3A 2HSMA 4TKYA 1F6MC 4AJ8A 2H0HA 4WR4A 4JU5A 2MMAA 3ZFBA 4MZCA 2CVKA 3ERFA 1XVQA 2ZUPA 3MWHA 1XCCA 2EIOA 4OFNA 2WB9A 3VWWA 1M9BA 4AGSA 3EMXA 3FY7A 3LEFA 1AUCA 6GSWA 2HZEB 1ZMAA 3ME7A 5F07A 1V2AA 1TI3A 3KXOA 4POBA 1TI1A 4LLRA 4IJIA 2E2MA 2TRCP 4OFMA 2NPBA 5B8BA 3GV1A 5HQPA 4NV2A 4RQRA 2ON5A 5G31A 5B8AA 3IK7A 3W8SA 4ZBBA 3GTUA 1HQOA 3IK9A 4PNFA 1Z9HA 4BL7B 2CX4A 4TRXA 4KB3A 3MNGA 1SKSB 3CRUA 3H79A 2HSHA 5IPHA 1HNBA 1OC9B 2FD3A 4BVYA 2R3XA 2GT5A 5F06A 2RM5A 4G0IA 5JWRB 4QL9A 4XCSA 4E8EA 2H0IA 4OD7A 4PUFC 1TRUA 4PNGA 5HR1A 3IE3A 1VF4A 4GSSA 2DBCA 2HXKA 1WE0A 3JCML 5DVBA 5F05A 3IOSA 4BWSA 1EV9A 2VCQA 1AQWA 3BD2A 5DQYA 2CAIA 5ECKB 2OJLA 1U6TA 2XBIA 4I97A 4GQCA 1SL2B 3E9JB 2VLTA 1YEPA 3ZMLA 5IM9A 1K0AA 3GMFA 3EMPA 4ML1A 3VWUA 1V40A 1ERVA 1SD9A 2DIYA 3ZIJA 2IMDA 6GSTA 2L4CA 8GSSA 2YJHA 1S3DA 2H6ZA 2YCDA 4KNDA 1X9MB 3M8NA 2TRXA 5KN2A 1GSYA 3QD9A 5HR3A 3UMAA 4MZBA 1NHYA 3HCZA 4IQAA 3WT1A 1SKWB 3M3MA 1V57A 4DSSA 1WJKA 3F6DA 2HQTA 3IV4A 5CRDA 2VOCA 2N5AA 3NIVA 2LTKA 4TR1A 5IOWA 2C1YA 1X0RA 1Z3EA 5FT3A 2GQKA 1M99A 3DYRA 5IO2A 5DDLA 5JCUA 1AAZA 4AJ7A 4TVEA 1SL0B 2YNXA 1F9MA 1SKRB 1H4OA 1I5GA 5LCZA 4HZ4A 3Q6OA 1JHBA 4ISDA 4KSMA 3F63A 5IMDA 1AC1A 1DBYA 3EC3A 3J7Yk 2B1LA 4K7NA 5CRGA 2UZ8A 1Z6NA 5CRWA 2P5QA 5HR0A 4JR6A 4Q5FA 5G5FA 5ECRB 2H6XA 1M0UA 2J9HA 3FR6A 3F4TA 2YWNA 1M9AA 2B3SA 1M7TA 2M80A 1K0CA 2KOKA 3GSSA 3U5RE 3D22A 4N0VA 5IMCA 1UN2A 2GVPA 1A23A 3Q18A 1QFNA 1F37A 1AIUA 4L8EA 4ML6A 3CSIA 3ED3A 2ZCTA 2DC5A 1U87A
chains in the Genus database with same CATH superfamily
5GSSA 2DJ2A 2HZFA 1OC3A 1PN9A 5JCGA 16GSA 2F51A 4TN8A 2VCTA 2VCXA 3D4TA 1BQ7A 5CO3A 2C0DA 3TUEA 2K8SA 17GSA 3ZVJA 2NBSA 2VD0A 4ZB8A 5ECOB 2VUPA 4D73B 1J08A 4ZILA 3LXZA 1SK0A 5D93A 1TU8A 3A2WA 3IPZA 3SBCA 1OVNA 5J3RA 1SYXA 3HJPA 4KCEA 5KN0A 1WRYA 4ZL8A 2P31A 3KD0A 3EU4A 4EXJA 2CVBA 3UIWA 2VCVA 5DALB 3CRTA 1PD21 2GSSA 3I43A 1V58A 2B5YA 2IWTA 1GUMA 4J2FA 2DJ1A 2G0FA 1YZXA 1ML6A 2IJYA 4PUAA 5H5QA 2EFCA 2FWFA 2YWOA 1BF5A 3VURA 4RI6A 4Z2RA 2JL4A 4ZB9A 3ME8A 2PUKC 5CRHA 2BJXA 1A8YA 3TKPA 2MMZA 2HRNA 1SL1B 1QUWA 4ZB7A 1M2BA 2GDRA 2K6VA 3KGKA 2K18A 1N8JA 2IFQA 2VCWA 4G2EA 4X1UA 4DEJA 1YVLA 1Z7PA 4G0LA 3RAZA 3BCIA 2ALBA 3N5OA 3H1NA 2V1MA 2VL2C 3IAM2 1VRSD 3D21A 4IP1A 4G10A 1ZYPA 3C8EA 5D9TA 1JLVA 2LRNA 4NWYA 2HLSA 3GH9A 1XW5A 3VFIA 2ZNMA 4V2MA 2WGRA 2C3QA 1ZYNA 3HY2A 1X9WB 2E2GA 1NM3A 2VM1A 4QQ7A 2YV7A 2N5BA 2L5OA 2EC4A 4ACSA 1ST9A 3MIXA 1ZZYA 6GSXA 3TJJA 4N3ZA 1JZWA 1THXA 1MD3A 4USSA 4ZB6A 1XFLA 1FOVA 2IPAA 4Q5QA 3F3QA 2OBKA 4XS6A 4I6XA 3HD5A 3ZREA 1HYUA 2PN8A 4DSRA 2C80A 2H30A 1FOHA 4TOPA 3GKXA 1O8WA 5ENUA 5A4VA 3UAPA 5ECQB 1CQHA 3KH9A 3KIJA 1O85A 1EV4A 1GRXA 5BMUA 1TW9A 2H1DA 5E59A 5CAXA 2VLUA 2HE3A 4W66A 3DKSA 1PSQA 3L0HA 3VLNA 2FA4A 1O7UA 3NOFA 3M1GA 3NZNA 1SJ6A 3VWXA 2GZZA 3C7MA 1GLPA 3BOAA 1TRVA 4GWRA 2M46A 2RLIA 1K0NA 18GSA 4BWQA 4I2UA 2WZ9A 2DJ3A 5C00A 3D0ZA 1SVLA 1THOA 3PPUA 3CHXC 1EP7A 4FYBA 6GSUA 2AYTA 4K5RA 1NSWA 1ZCPA 3DRNA 4CDOA 3ZLPA 4I8BA 1SVMA 2DMMA 5ECSA 1WMJA 4V1Ap 4POKA 5ID2B 2CAQA 2DKIA 1EEJA 3LJRA 1ABAA 3G9BA 2CX3A 2VLVA 5IOXA 1O81A 4HU7A 4TXOB 1I9DA 2O3EA 5J4YA 2L5LA 3KM6A 3QAWA 2HFDA 4MF5A 1VGLA 4P3YB 1PA3A 2FY6A 2FUG2 2OADA 1BX9A 3LW9A 3ZYWA 2YP6A 2OA7A 2B6MA 1B4PA 1WWJA 4JZQA 4MPGA 3TB2A 2ON7A 5ECNB 4RUVA 2FA8A 1X9SB 1AXDA 4HUAA 3LQ7A 4L0WA 4MH3A 3KJYA 5LNKe 2L4QA 3GKKA 3L78A 4EE0A 2I1UA 1Z6MA 2MMNA 2HSNA 4XS4A 4OO4A 1T4ZA 1B9XC 2QGVA 1TDIA 3A2XA 1A0FA 2REMA 4Z2TA 2FWEA 3TKQA 1XVWA 3HVXA 19GSA 5KEJA 2X4AA 3U6VA 3GN3A 2YWMA 4JRRA 2QA2A 4HQSA 4G0KA 4ZIJA 1AQVA 6GSYA 4JR4A 1K0DA 4TR4A 3QMXA 2R0PA 5ECMB 3IC4A 3LXTA 2C3TA 1XPVA 5D9VA 2C0FA 2JZRA 2L57A 2O87A 2X64A 1SU9A 2HRKA 3FYGA 2CQ9A 3J7Yb 1JFUA 4AKHA 2H1BA 4OCFA 4CHSA 3KMNA 4AF2A 1UA5A 5BRTA 4IGJA 2VAFA 3HYPA 2VL3A 4K2XA 4G19A 2H1LA 2J23A 1U88A 2IMEA 3QPMA 3Q19A 1YJ6A 1PL1A 2X8HA 1SK1A 5J4VA 1IYIA 4I5QA 2LJRA 4F9ZA 3CMIA 1B9YC 1O73A 2LJAA 2FGXA 3PGTA 2DIZA 4F0CA 5IMVA 2FCHA 1PN0A 2DMLA 2HYXA 5F0GA 3GURA 4PQHA 5F8BA 4G9HA 2GQMA 5HFGA 5ABRA 1YF0A 3PR8A 1K0BA 1W89A 2WVXA 1BAYA 3M9JA 3D4MA 1A2LA 3APQA 3BCKA 1QK8A 1Q4JA 2YWIA 2RIIA 1K3OA 2VL9A 1M2AA 2RUFA 3GKMA 5J5NA 1VF2A 5D9WA 5EVOA 4O7HA 1ZOFA 1DE2A 4WKWA 3IHGA 3HJMA 5E4WA 3L9UA 1N25A 2KUCA 1GSEA 4KDUA 3UVHA 2QKEA 2E0QA 3GNJA 3FZ4A 4PXOA 3F4SA 3IC8A 3TJBA 1K0MA 3FZ9A 1KEBA 2NVLA 3FZAA 3UL3A 3P8WA 2H72A 3O3TA 2VKZG 3CTGA 3MDKA 4EIQA 4O92A 1JLWA 2K8VA 2OE0A 3EINA 2WJUA 5EY6A 2GLRA 3HKRA 3VI7A 1AW9A 3IHQA 4AI6A 2A4VA 3UVTA 2LRCA 2PERA 5IQYA 3R2QA 1TJDA 1RK4A 3HJOA 2HZEA 4OWYA 3UOMA 4L0UA 2PWJA 2H8LA 4KH7A 2EFDA 5KOWA 5EL8A 5HFIA 2MBTA 4KE3A 1PMTA 1GSUA 5J9BA 2PGTA 3TOUA 2EFHA 2R2JA 5IPGA 4BL7A 1KBNA 2HRAA 2H71A 4BIKA 4LL4B 9GSSA 2OT3A 3VI5A 1W4VA 3HA9A 3LORA 3G7IA 2HRFA 2XHFA 1UVZA 2LS5A 2KP2A 1TXXA 4FXYP 1OC9A 4IELA 2GZPA 2YJ7A 1FO5A 4MZWA 5GZZB 4BPYA 4ECCA 3ZMKA 1EP8A 5DAKB 4Z7XA 4YAPA 1MDJA 1OKTA 1FAAA 1X5DA 3GIXA 5A1NA 2OBIA 3BJ5A 3GRXA 4MMMA 5HR2A 1CQGA 1OE7A 3DWVA 1TP9A 2LUSA 1K3LA 1R4WA 3HVNA 2FLSA 2RM6A 3DIEA 2WS2A 1C72A 4KGIA 4IS0A 5JWQB 1F3AA 4E68A 11GSA 3GA4A 4DSQA 1X5EA 2OACA 3WT2A 3RHBA 1HD2A 3DEXA 1WOUA 3QOUA 2DLXA 4K0NA 1GUHA 3I69A 3G7YA 4N11A 4HI7A 2TIRA 2QA1A 5L71A 4XHMA 1T3BA 4O5UA 3GX0A 2LKUA 4KSOA 1OE8A 5J41A 2V32A 5CREA 1A0RP 4ECJA 2B1KA 3HMJG 5ECIB 1JZDA 3APOA 1TK8B 1B4QA 2ES7A 3LSZA 2NDOA 2XPEA 2CV4A 1GLQA 3M0FA 1FB0A 2WW2A 4YQVA 2GSTA 4ZBAA 4V2LA 4ZL9A 5FWGA 3L4NA 4N10A 4WETA 4POLA 2VD1A 4KX4A 1TK0B 4F03A 3C73A 3M9KA 2DJ0A 1VF3A 1WP0A 3KTLA 2MYGA 4ILFA 3RGBC 2NTOA 3RBTA 1BYEA 2PVQA 3TGZA 3CYNA 3QAGA 3TDGA 3IAS2 1YF1A 2IL3A 4LL1B 1AQXA 13GSA 1ACVA 1ILOA 5DBQA 4KDYA 4X0XA 2GGTA 4OFTA 2LNTA 2X49A 2JSZA 1DE1A 3FR3A 2HI7A 4F0BA 4IVFA 20GSA 1KNGA 4EL1A 1BG5A 1G7EA 4YAVA 1U3AA 3KZQA 5G2ZA 4PGTA 2V41A 3DVWA 2YV9A 4GSTA 2AJQB 2YZHA 3TKSC 4GDFA 2L6CA 3LWAA 2CZ3A 1TRSA 5D96A 1FG4A 4HJMA 2O85A 1GTIA 1SD8A 1PGTA 2KHPA 3FK8A 1JZOA 1USBA 2HT9A 4BVXA 1PX7A 1EOGA 2VCZA 1E2YA 2BMXA 2HSMB 3H93A 5C04A 2YN1A 2H6YA 3QFBC 4AKIA 1XXUA 1EZKA 4MJCA 5GSTA 2A2PA 4WXTA 1OC8A 4N30A 4PURA 2WCIA 5A34B 1SK2A 4ZXGA 1SJZA 2YPMA 1X5CA 2H73A 4GLTA 4HEA2 3S9FA 5KN1A 4MH2A 3EVIA 3CSHA 3CSJA 1A2MA 2C3NA 3DGQA 2IIYA 5IIZA 4D73A 2X8CA 2B5EA 1T7PB 3FRCA 3ISOA 3D5JA 4MP4A 1G7OA 1MEKA 1TTZA 3IA1A 5AN1A 3H8QA 4JEDA 1LJRA 4LA1A 1DUGA 4ICYA 3GTUB 3N9JA 1Z7RA 4OMVA 3P90A 3H4KA 2LSTA 5DALA 3F6FA 1GSDA 2CZ2A 3W6GA 1G0TA 2I4AA 4EUYA 5J40A 1XW6A 2VL2A 4NXIA 2R0CA 4GTUA 4OCEA 1ERTA 3UBKA 2O5VA 4BVYB 3R3EA 4EDYA 1LU4A 4QMKA 2PVOC 4KUNA 2H0GA 4G01A 2H76A 1YQ1A 2R5GA 1S3AA 4NAXA 3AY8A 3TKSE 4N0ZA 1B8XA 3RPPA 4WF4A 4K6XA 1S3CA 2I81A 3F0IA 1FHEA 2XPDA 1GULA 3ZVJD 2KP1A 2LQQA 3E3EA 2O7KA 1EGOA 2IN3A 1E6BA 4MDCA 1MDKA 5A5HB 5B6MA 3MYDA 1XIYA 2C4JA 5CNWA 1K3YA 2WRTA 1EOHA 5IMZA 3ZTLA 3QAVA 2V6OA 2WW0A 2YOIA 3GFKA 1PKWA 2EFEA 1XWKA 3L9VA 3VK9A 2AHEA 4E8HA 1UC7A 5H5SA 5D9XA 3US3A 12GSA 3A2VA 3E0UA 3TCOA 4L5LA 3FMWA 1PRXA 3ZL5A 3VPTA 3ZIVA 3PH9A 4POMA 2FWGA 3ZZXA 1M2DA 1I1IP 3GH6A 3VPQA 4DSSB 2AUVA 1OKDA 5COHA 1G6WA 4ZL7A 4LMVA 2EIQA 5LD0A 2IMKA 4TR1B 3KCMA 4Z2UA 1HNAA 1J9BA 1ON4A 4RQXA 4BA7A 4IN0A 4IP6A 5CYYA 1XWCA 5INYA 2FNOA 2I9HA 2XC2A 4YQMA 4KCAA 1Z5YE 4MLYA 1XWBA 3LYKA 1TU7A 2CA8A 5D8IA 1A2JA 2PU9C 4GRFA 5AIVA 1WIKA 2Z9SA 1LBKA 1NW2A 1R26A 3GHAA 1TRWA 2LNSA 1FB6A 4FYUA 4FH8A 1GWCA 3KTBA 4YQUA 2M72A 4MK3A 2DJKA 1S3RA 4XS1A 1YEWC 2A2RA 5DCGA 3TOTA 4MF6A 4EC0A 1GTAA 5B7CA 4WR5A 3DXBA 4K8MA 1YEXA 3LG6A 1R5PA 5HFKA 1EWXA 1BG1A 3GYKA 3IR4A 4OO5A 5ID2A 3GL3A 3EYTA 4IQ1A 1XWAA 4K9ZA 1Q98A 2DJJA 2GS3A 4MCUA 4KA0A 2JU5A 1OYJA 4TXOA 3DMLA 3RHCA 1O8XA 4TXVA 2LRTA 3TU3B 4HOJA 4PQIA 3W8JA 4IKHA 3FZ5A 2YANA 7GSSA 2QC7A 3KH7A 4IHUA 4J56E 5G5EA 3MSZA 4AKGA 1WPIA 2PPTA 3CTFA 1PL2A 4XRAA 2RUEA 4V2NA 3O6TA 2C0GA 2JACA 1K0OA 3TJGA 4NHZA 3FHKA 3HZ4A 1QXHA 4HU9A 3WGXA 1ZYQB 1V9WA 3TRQA 3C71A 3GX8A 3CWGA 2QSIA 4XTSA 2JADA 2V2GA 1GNEA 3ERWA 2B5XA 4MJBA 4I2TA 2WFCA 1T1VA 4FYCA 1PX6A 1M3IA 2L59A 3WGDA 1JZRA 3PINA 2HNLA 2EIRA 2I3YA 4LMWA 2WW3A 5ELGA 1ERUA 3EURA 3FEUA 5ECHB 4K5SA 5A4WA 3A5WA 4KAEA 4ECBA 3SWLA 2X99A 3TJKA 5G1LA 4X4JA 4F2IA 3EE2A 4PQ1A 3RDWA 2CT6A 2LQOA 2B7KA 3KMOA 2F3MA 1PKZA 4NHWA 1B48A 4CW9A 2H70A 2IFQB 3UEMA 3CXGA 2AAWA 5AISA 3EWLA 1XOBA 3ZRDA 2YZUA 2F8FA 4O32A 3ZFLA 2WULA 4IJ3A 2VO4A 3C1SA 2GZYA 4KW6A 1XG8A 2X8GA 3LYPA 4ZBDA 2LJKA 2O89A 1GH2A 2WVYA 4YKFA 5ECPB 3O76A 3WD6A 3KP9A 4F82A 1YY7A 1TK5B 1HNCA 3I6AA 5DJLA 5AGYA 3IXRA 4EDZA 4WBJA 3HVSA 3TRPA 3LFLA 4K1FA 1OAZA 3DVXA 5IMAA 1T8EB 5IO0A 1T4YA 2GTUA 4BVXB 4YKGA 2E7PA 5KN3A 2MBSA 1GSSA 3P2AA 2PMTA 3GKNA 1T00A 2AV4A 3WGEA 3UBLA 1KTEA 5KOXA 2HSYA 1Y6EA 2H01A 1XW9A 1RQMA 2H75A 4IW9A 4EF0A 2DSAA 5DJMA 3FW2A 2XBQA 1QMVA 2K9FA 4Q5RA 5GAND 5D73A 4EVMA 5BMUB 1G6YA 4NV5A 4PX1A 1A24A 2H66A 2GT6A 1PFOA 4GF0A 4CY8A 3TKRA 5JCWA 4RI7A 4KF9A 1XOAA 3QCPA 1R5AA 3Q74A 3A3TA 4MPFA 4WBRD 1XBSA 4X43A 2R4VA 1BEDA 1QGVA 1O6JA 2LV3A 4K7OA 5G30A 3FR9A 4NMUA 4XRDA 1URMA 5H5RA 5DCHA 5G1KA 3GSTA 5FHIA 4NPBA 4YH2A 4HS1A 1SJIA 3D6IA 2C8UA 4HDEA 2VM2A 1GSFA 4WF5A 2JZSA 1A8LA 2H1AA 3C1RA 1GSQA 3F3RA 1S4BP 4MJEA 4PI0C 4H86A 4QL7A 1FVJA 1J0FA 2GSQA 2BTOT 3HVVA 4FO5A 22GSA 1ZL9A 4MABA 4TR0A 1YKCA 1TXUA 4PHZC 4GCIA 2R37A 4WEYA 4TR3A 1FVKA 4ID0A 3HDCA 2V6KA 4JBBA 1BJXA 3HXSA 5DAKA 3WYWA 3DD3A 2VIMA 3ZITA 1EGRA 2PBJA 4AKXB 1N2AA 2WVZA 1FW1A 1XZOA 3G7JA 2HSNB 4XS4B 3GL5A 4V1Ag 2FHEA 3QDNA 4K7IA 3GUSA 2GSRA 1MDIA 1QQ2A 4GQFA 2MZCA 4O5RA 1F2EA 5B6NA 3I9V2 1DSBA 2OE1A 5A4UA 2DKHA 1Y25A 1TKDB 3IRAA 2IMFA 1U3IA 1ZYEA 3KP8A 4MA9A 2O36A 3F4RA 1GL8A 4TW5A 2JSYA 5A5KA 1TOFA 1GTUA 1ZGNA 2JZTA 3BBYA 3IBHA 2P0GA 4IBPA 3APSA 3F9UA 3FKFA 2GQLA 4MF7A 2HRKB 3ERGA 3UARA 10GSA 2WDUA 1SENA 4ECIA 2B7JA 2AB6A 1Y1UA 4FIWA 1F3BA 3HHVA 2C0EA 2LEGA 4HJ2A 4L5OA 1SYRA 3L9SA 3QR6A 5IMFA 4PTSA 2OE3A 2D2ZA 5AIXA 1GP1A 2F8AA 3UJ1A 3QFAC 2P5RA 4MJAA 1MD4A 2N5FA 3A5IA 3KEBA 2H74A 6GSVA 1GNWA 4HZ2A 5ELAA 1H75A 3TKSA 3IDVA 4XIHA 3RFRC 1V98A 2F9SA 4ULXA 3RPNA 3CBUA 1ERWA 1RW1A 4Q5NA 3F8UA 1VF1A 4K0GA 3MAKA 2A2SA 4FQUA 3TRXA 3OR5A 2WVXB 3LGCA 5EPFA 1EEMA 2O8VB 3P7XA 1YDKA 1GTBA 5JWOB 4AJ6A 5DQSA 2H19A 1GUKA 4GSNA 1PQNA 1IYHA 5ECLB 2WW1A 3TJFA 5CP1A 6GSSA 4KDXA 1NHOA 2FWHA 4MNNA 1XWGA 4J57E 5J9CA 2R6KA 2CVDA 14GSA 4GXZA 2G2QA 2OKAA 4EIPA 2L6DA 5J4UA 5GAPD 4JE1A 2MMOA 4K2DA 1R7HA 1YKAA 4HQZA 2KLXA 3EU3A 4DVCA 3V1WA 2H1GA 3HZ8A 3K8NA 2IMIA 1SVOA 4EKZA 3VWVA 1MTCA 4PI2C 4EO3A 2HSMA 4TKYA 1F6MC 4AJ8A 2H0HA 4WR4A 4JU5A 2MMAA 3ZFBA 5A34A 4MZCA 2CVKA 3ERFA 1XVQA 2ZUPA 3MWHA 1XCCA 2EIOA 4OFNA 2WB9A 3VWWA 5J47A 1M9BA 4AGSA 3EMXA 2WZSA 3FY7A 3LEFA 1AUCA 6GSWA 2HZEB 1ZMAA 3ME7A 5F07A 1V2AA 1TI3A 3KXOA 4POBA 1TI1A 4LLRA 4IJIA 2E2MA 2TRCP 4OFMA 2NPBA 5B8BA 3GV1A 5HQPA 4NV2A 4RQRA 2ON5A 5G31A 4CY6A 5B8AA 3IK7A 3W8SA 4ZBBA 3GTUA 1HQOA 3IK9A 4PNFA 1Z9HA 4BL7B 2CX4A 4TRXA 4KB3A 3MNGA 1SKSB 3CRUA 3H79A 2HSHA 5IPHA 1HNBA 1OC9B 2FD3A 4BVYA 2R3XA 3EPTA 2GT5A 5F06A 2RM5A 4G0IA 5JWRB 4QL9A 4XCSA 4E8EA 2H0IA 4OD7A 4PUFC 1TRUA 4PNGA 5HR1A 3IE3A 1VF4A 5A1NB 4GSSA 2DBCA 2HXKA 1WE0A 3JCML 5DVBA 5F05A 3IOSA 4BWSA 1EV9A 2VCQA 1AQWA 3BD2A 5DQYA 5A5HA 2CAIA 5ECKB 2OJLA 1U6TA 2XBIA 4I97A 4GQCA 1SL2B 3E9JB 2VLTA 1YEPA 3ZMLA 5IM9A 1K0AA 3GMFA 4O5QA 3EMPA 4ML1A 3VWUA 1V40A 1ERVA 1SD9A 2DIYA 3ZIJA 2IMDA 6GSTA 2L4CA 8GSSA 1M3JA 2YJHA 1S3DA 2H6ZA 2YCDA 4KNDA 1X9MB 3M8NA 2TRXA 5KN2A 1GSYA 2UV8G 3QD9A 5HR3A 3UMAA 4MZBA 1NHYA 3HCZA 4IQAA 3WT1A 1SKWB 3M3MA 1V57A 4DSSA 1WJKA 3F6DA 2HQTA 3IV4A 5CRDA 2VOCA 2N5AA 3NIVA 2LTKA 4TR1A 5IOWA 2C1YA 1X0RA 1Z3EA 5FT3A 2GQKA 1M99A 3DYRA 5IO2A 5DDLA 5JCUA 1AAZA 4AJ7A 4TVEA 1SL0B 2YNXA 1F9MA 1SKRB 2A4HA 1H4OA 1I5GA 5LCZA 4HZ4A 3Q6OA 1JHBA 4ISDA 4KSMA 3F63A 5IMDA 1AC1A 1DBYA 3EC3A 3J7Yk 2B1LA 4K7NA 5CRGA 2UZ8A 1Z6NA 5CRWA 2R0GA 2P5QA 5HR0A 4JR6A 4Q5FA 3CQFA 5G5FA 5ECRB 2H6XA 4A5PA 1M0UA 2J9HA 3FR6A 3F4TA 2YWNA 1M9AA 2B3SA 1M7TA 2M80A 1K0CA 2KOKA 3GSSA 3U5RE 3D22A 4N0VA 5IMCA 1UN2A 2GVPA 1A23A 3Q18A 1QFNA 1F37A 1AIUA 4L8EA 4ML6A 3CSIA 3ED3A 4HSCX 2ZCTA 2DC5A 1U87A
chains in the Genus database with same CATH topology
5GSSA 2DJ2A 2HZFA 1OC3A 1PN9A 5JCGA 16GSA 2F51A 4TN8A 2VCTA 2VCXA 3D4TA 1BQ7A 5CO3A 2C0DA 3TUEA 2K8SA 17GSA 3ZVJA 2NBSA 2VD0A 4ZB8A 5ECOB 2VUPA 4D73B 1J08A 4ZILA 3LXZA 1SK0A 5D93A 1TU8A 3A2WA 3IPZA 3SBCA 1OVNA 5J3RA 1SYXA 3HJPA 4KCEA 5KN0A 1WRYA 4ZL8A 2P31A 3KD0A 3EU4A 4EXJA 2CVBA 3UIWA 2VCVA 5DALB 3CRTA 1PD21 2GSSA 3I43A 1V58A 2B5YA 2IWTA 1GUMA 4J2FA 2DJ1A 2G0FA 1YZXA 1ML6A 2IJYA 4PUAA 5H5QA 2EFCA 2FWFA 2YWOA 1BF5A 3VURA 4RI6A 4Z2RA 2JL4A 4ZB9A 3ME8A 2PUKC 5CRHA 2BJXA 1A8YA 3TKPA 2MMZA 2HRNA 1SL1B 1QUWA 4ZB7A 1M2BA 2GDRA 2K6VA 3KGKA 2K18A 1N8JA 2IFQA 2VCWA 4G2EA 4X1UA 4DEJA 1YVLA 1Z7PA 4G0LA 3RAZA 3BCIA 2ALBA 3N5OA 3H1NA 2V1MA 2VL2C 3IAM2 1VRSD 3D21A 4IP1A 4G10A 1ZYPA 3C8EA 5D9TA 1JLVA 2LRNA 4NWYA 2HLSA 3GH9A 1XW5A 3VFIA 2ZNMA 4V2MA 2WGRA 2C3QA 1ZYNA 3HY2A 1X9WB 2E2GA 1NM3A 2VM1A 4QQ7A 2YV7A 2N5BA 2L5OA 2EC4A 4ACSA 1ST9A 3MIXA 1ZZYA 6GSXA 3TJJA 4N3ZA 1JZWA 1THXA 1MD3A 4USSA 4ZB6A 1XFLA 1FOVA 2IPAA 4Q5QA 3F3QA 2OBKA 4XS6A 4I6XA 3HD5A 3ZREA 1HYUA 2PN8A 4DSRA 2C80A 2H30A 1FOHA 4TOPA 3GKXA 1O8WA 5ENUA 5A4VA 3UAPA 5ECQB 1CQHA 3KH9A 3KIJA 1O85A 1EV4A 1GRXA 5BMUA 1TW9A 2H1DA 5E59A 5CAXA 2VLUA 2HE3A 4W66A 3DKSA 1PSQA 3L0HA 3VLNA 2FA4A 1O7UA 3NOFA 3M1GA 3NZNA 1SJ6A 3VWXA 2GZZA 3C7MA 1GLPA 3BOAA 1TRVA 4GWRA 2M46A 2RLIA 1K0NA 18GSA 4BWQA 4I2UA 2WZ9A 2DJ3A 5C00A 3D0ZA 1SVLA 1THOA 3PPUA 1EP7A 4FYBA 6GSUA 2AYTA 4K5RA 1NSWA 1ZCPA 3DRNA 4CDOA 3ZLPA 4I8BA 1SVMA 2DMMA 5ECSA 1WMJA 4V1Ap 4POKA 5ID2B 2CAQA 2DKIA 1EEJA 3LJRA 1ABAA 3G9BA 2CX3A 2VLVA 5IOXA 1O81A 4HU7A 4TXOB 1I9DA 5J4YA 2L5LA 3KM6A 3QAWA 2HFDA 4MF5A 1VGLA 4P3YB 1PA3A 2FY6A 2FUG2 2OADA 3LW9A 1BX9A 3ZYWA 2YP6A 2OA7A 2B6MA 1B4PA 1WWJA 4JZQA 4MPGA 3TB2A 2ON7A 5ECNB 4RUVA 2FA8A 1X9SB 1AXDA 4HUAA 3LQ7A 4L0WA 4MH3A 3KJYA 5LNKe 2L4QA 3GKKA 3L78A 4EE0A 2I1UA 1Z6MA 2MMNA 2HSNA 4XS4A 4OO4A 1T4ZA 1B9XC 2QGVA 1TDIA 3A2XA 1A0FA 2REMA 4Z2TA 2FWEA 3TKQA 1XVWA 3HVXA 19GSA 5KEJA 2X4AA 3U6VA 3GN3A 2YWMA 4JRRA 2QA2A 4HQSA 4G0KA 4ZIJA 1AQVA 6GSYA 4JR4A 1K0DA 4TR4A 3QMXA 2R0PA 5ECMB 3IC4A 3LXTA 2C3TA 1XPVA 5D9VA 2C0FA 2JZRA 2L57A 2O87A 2X64A 1SU9A 2HRKA 3FYGA 2CQ9A 3J7Yb 1JFUA 4AKHA 2H1BA 4OCFA 4CHSA 3KMNA 4AF2A 1UA5A 5BRTA 4IGJA 2VAFA 3HYPA 2VL3A 4K2XA 4G19A 2H1LA 2J23A 1U88A 2IMEA 3QPMA 3Q19A 1YJ6A 1PL1A 2X8HA 1SK1A 5J4VA 1IYIA 4I5QA 2LJRA 4F9ZA 3CMIA 1B9YC 1O73A 2LJAA 2FGXA 3PGTA 2DIZA 4F0CA 5IMVA 2FCHA 1PN0A 2DMLA 2HYXA 5F0GA 3GURA 4PQHA 5F8BA 4G9HA 2GQMA 5HFGA 5ABRA 1YF0A 3PR8A 1K0BA 1W89A 1BAYA 3M9JA 3D4MA 1A2LA 3APQA 3BCKA 1QK8A 1Q4JA 2YWIA 2RIIA 1K3OA 2VL9A 1M2AA 2RUFA 3GKMA 5J5NA 1VF2A 5D9WA 5EVOA 4O7HA 1ZOFA 1DE2A 4WKWA 3IHGA 3HJMA 5E4WA 3L9UA 1N25A 2KUCA 1GSEA 4KDUA 3UVHA 2QKEA 2E0QA 3GNJA 3FZ4A 4PXOA 3F4SA 3IC8A 3TJBA 1K0MA 3FZ9A 1KEBA 2NVLA 3FZAA 3UL3A 3P8WA 2H72A 3O3TA 2VKZG 3CTGA 3MDKA 4EIQA 4O92A 1JLWA 2K8VA 2OE0A 3EINA 2WJUA 5EY6A 2GLRA 3HKRA 3VI7A 1AW9A 3IHQA 4AI6A 2A4VA 3UVTA 2LRCA 2PERA 5IQYA 3R2QA 1TJDA 1RK4A 3HJOA 2HZEA 4OWYA 3UOMA 4L0UA 2PWJA 2H8LA 4KH7A 2EFDA 5KOWA 5EL8A 5HFIA 2MBTA 4KE3A 1PMTA 1GSUA 5J9BA 2PGTA 3TOUA 2EFHA 2R2JA 5IPGA 4BL7A 1KBNA 2HRAA 2H71A 4LL4B 9GSSA 2OT3A 3VI5A 1W4VA 3HA9A 3LORA 3G7IA 2HRFA 2XHFA 1UVZA 2LS5A 2KP2A 1TXXA 1OC9A 4IELA 2GZPA 2YJ7A 1FO5A 4MZWA 5GZZB 4BPYA 4ECCA 3ZMKA 1EP8A 5DAKB 4Z7XA 4YAPA 1MDJA 1OKTA 1FAAA 1X5DA 3GIXA 5A1NA 2OBIA 3BJ5A 3GRXA 4MMMA 5HR2A 1CQGA 1OE7A 3DWVA 1TP9A 2LUSA 1K3LA 1R4WA 2FLSA 2RM6A 3DIEA 2WS2A 1C72A 4KGIA 4IS0A 5JWQB 1F3AA 4E68A 11GSA 3GA4A 4DSQA 1X5EA 2OACA 3WT2A 3RHBA 1HD2A 3DEXA 1WOUA 3QOUA 2DLXA 4K0NA 1GUHA 3I69A 3G7YA 4N11A 4HI7A 2TIRA 2QA1A 5L71A 4XHMA 1T3BA 4O5UA 3GX0A 2LKUA 4KSOA 1OE8A 5J41A 2V32A 5CREA 1A0RP 4ECJA 2B1KA 3HMJG 5ECIB 1JZDA 3APOA 1TK8B 1B4QA 2ES7A 3LSZA 2NDOA 2XPEA 2CV4A 1GLQA 3M0FA 1FB0A 4YQVA 2GSTA 4ZBAA 4V2LA 4ZL9A 5FWGA 3L4NA 4N10A 4WETA 4POLA 2VD1A 4KX4A 1TK0B 4F03A 3C73A 3M9KA 2DJ0A 1VF3A 1WP0A 3KTLA 2MYGA 4ILFA 2NTOA 3RBTA 1BYEA 2PVQA 3TGZA 3CYNA 3QAGA 3TDGA 3IAS2 1YF1A 2IL3A 4LL1B 1AQXA 13GSA 1ACVA 1ILOA 5DBQA 4KDYA 4X0XA 2GGTA 4OFTA 2LNTA 2X49A 2JSZA 1DE1A 3FR3A 2HI7A 4F0BA 4IVFA 20GSA 1KNGA 4EL1A 1BG5A 1G7EA 4YAVA 1U3AA 3KZQA 5G2ZA 4PGTA 2V41A 3DVWA 2YV9A 4GSTA 2AJQB 2YZHA 3TKSC 4GDFA 2L6CA 3LWAA 2CZ3A 1TRSA 5D96A 1FG4A 4HJMA 2O85A 1GTIA 1SD8A 1PGTA 2KHPA 3FK8A 1JZOA 1USBA 2HT9A 4BVXA 1PX7A 1EOGA 2VCZA 1E2YA 2BMXA 2HSMB 3H93A 5C04A 2YN1A 2H6YA 3QFBC 4AKIA 1XXUA 1EZKA 4MJCA 5GSTA 2A2PA 4WXTA 1OC8A 4N30A 4PURA 2WCIA 5A34B 1SK2A 4ZXGA 1SJZA 2YPMA 1X5CA 2H73A 4GLTA 4HEA2 3S9FA 5KN1A 4MH2A 3EVIA 3CSHA 3CSJA 1A2MA 2C3NA 3DGQA 2IIYA 5IIZA 4D73A 2X8CA 2B5EA 1T7PB 3FRCA 3ISOA 3D5JA 4MP4A 1G7OA 1MEKA 1TTZA 3IA1A 5AN1A 3H8QA 4JEDA 1LJRA 4LA1A 1DUGA 4ICYA 3GTUB 3N9JA 1Z7RA 4OMVA 3P90A 3H4KA 2LSTA 5DALA 3F6FA 1GSDA 2CZ2A 3W6GA 1G0TA 2I4AA 4EUYA 5J40A 1XW6A 2VL2A 4NXIA 2R0CA 4GTUA 4OCEA 1ERTA 3UBKA 2O5VA 4BVYB 3R3EA 4EDYA 1LU4A 4QMKA 2PVOC 4KUNA 2H0GA 4G01A 2H76A 1YQ1A 2R5GA 1S3AA 4NAXA 3AY8A 3TKSE 4N0ZA 1B8XA 3RPPA 4WF4A 4K6XA 1S3CA 2I81A 3F0IA 1FHEA 2XPDA 1GULA 3ZVJD 2KP1A 2LQQA 3E3EA 2O7KA 1EGOA 2IN3A 1E6BA 4MDCA 1MDKA 5A5HB 5B6MA 3MYDA 1XIYA 2C4JA 5CNWA 1K3YA 2WRTA 1EOHA 5IMZA 3ZTLA 3QAVA 2V6OA 2YOIA 3GFKA 1PKWA 2EFEA 1XWKA 3L9VA 3VK9A 2AHEA 4E8HA 1UC7A 5H5SA 5D9XA 3US3A 12GSA 3A2VA 3E0UA 3TCOA 4L5LA 3FMWA 1PRXA 3ZL5A 3VPTA 3ZIVA 3PH9A 4POMA 2FWGA 3ZZXA 1M2DA 3GH6A 3VPQA 4DSSB 2AUVA 1OKDA 5COHA 1G6WA 4ZL7A 4LMVA 2EIQA 5LD0A 2IMKA 4TR1B 3KCMA 4Z2UA 1HNAA 1J9BA 1ON4A 4RQXA 4BA7A 4IN0A 4IP6A 5CYYA 1XWCA 5INYA 2FNOA 2I9HA 2XC2A 4YQMA 4KCAA 1Z5YE 4MLYA 1XWBA 3LYKA 1TU7A 2CA8A 5D8IA 1A2JA 2PU9C 4GRFA 5AIVA 1WIKA 2Z9SA 1LBKA 1NW2A 1R26A 3GHAA 1TRWA 2LNSA 1FB6A 4FYUA 4FH8A 1GWCA 3KTBA 4YQUA 2M72A 4MK3A 2DJKA 4XS1A 2A2RA 5DCGA 3TOTA 4MF6A 4EC0A 1GTAA 5B7CA 4WR5A 3DXBA 4K8MA 1YEXA 3LG6A 1R5PA 5HFKA 1EWXA 1BG1A 3GYKA 3IR4A 4OO5A 5ID2A 3GL3A 3EYTA 4IQ1A 1XWAA 4K9ZA 1Q98A 2DJJA 2GS3A 4MCUA 4KA0A 2JU5A 1OYJA 4TXOA 3DMLA 3RHCA 1O8XA 4TXVA 2LRTA 3TU3B 4HOJA 4PQIA 3W8JA 4IKHA 3FZ5A 2YANA 7GSSA 2QC7A 3KH7A 4IHUA 4J56E 5G5EA 3MSZA 4AKGA 1WPIA 2PPTA 3CTFA 1PL2A 4XRAA 2RUEA 4V2NA 3O6TA 2C0GA 2JACA 1K0OA 3TJGA 4NHZA 3FHKA 3HZ4A 1QXHA 4HU9A 3WGXA 1ZYQB 1V9WA 3TRQA 3C71A 3GX8A 3CWGA 2QSIA 4XTSA 2JADA 2V2GA 1GNEA 3ERWA 2B5XA 4MJBA 4I2TA 2WFCA 1T1VA 4FYCA 1PX6A 2L59A 3WGDA 1JZRA 3PINA 2HNLA 2EIRA 2I3YA 4LMWA 5ELGA 1ERUA 3EURA 3FEUA 5ECHB 4K5SA 5A4WA 3A5WA 4KAEA 4ECBA 3SWLA 2X99A 3TJKA 5G1LA 4X4JA 4F2IA 3EE2A 4PQ1A 3RDWA 2CT6A 2LQOA 2B7KA 3KMOA 2F3MA 1PKZA 4NHWA 1B48A 4CW9A 2H70A 2IFQB 3UEMA 3CXGA 2AAWA 5AISA 3EWLA 1XOBA 3ZRDA 2YZUA 2F8FA 4O32A 3ZFLA 2WULA 4IJ3A 2VO4A 3C1SA 2GZYA 4KW6A 2X8GA 3LYPA 4ZBDA 2LJKA 2O89A 1GH2A 4YKFA 5ECPB 3O76A 3WD6A 3KP9A 4F82A 1YY7A 1TK5B 1HNCA 3I6AA 5DJLA 5AGYA 3IXRA 4EDZA 4WBJA 3HVSA 3TRPA 3LFLA 4K1FA 1OAZA 3DVXA 5IMAA 1T8EB 5IO0A 1T4YA 2GTUA 4BVXB 4YKGA 2E7PA 5KN3A 2MBSA 1GSSA 3P2AA 2PMTA 3GKNA 1T00A 2AV4A 3WGEA 3UBLA 1KTEA 5KOXA 2HSYA 1Y6EA 2H01A 1XW9A 1RQMA 2H75A 4IW9A 4EF0A 2DSAA 5DJMA 3FW2A 2XBQA 1QMVA 2K9FA 4Q5RA 5GAND 5D73A 4EVMA 5BMUB 1G6YA 4NV5A 4PX1A 1A24A 2H66A 2GT6A 4GF0A 4CY8A 3TKRA 5JCWA 4RI7A 4KF9A 1XOAA 3QCPA 1R5AA 3Q74A 3A3TA 4MPFA 4WBRD 1XBSA 4X43A 2R4VA 1BEDA 1QGVA 1O6JA 2LV3A 4K7OA 5G30A 3FR9A 4NMUA 4XRDA 1URMA 5H5RA 5DCHA 5G1KA 3GSTA 5FHIA 4NPBA 4YH2A 4HS1A 1SJIA 3D6IA 2C8UA 4HDEA 2VM2A 1GSFA 4WF5A 2JZSA 1A8LA 2H1AA 3C1RA 1GSQA 3F3RA 4MJEA 4H86A 4QL7A 1FVJA 1J0FA 2GSQA 2BTOT 3HVVA 4FO5A 22GSA 1ZL9A 4MABA 4TR0A 1YKCA 1TXUA 4GCIA 2R37A 4WEYA 4TR3A 1FVKA 4ID0A 3HDCA 2V6KA 4JBBA 1BJXA 3HXSA 5DAKA 3WYWA 3DD3A 2VIMA 3ZITA 1EGRA 2PBJA 4AKXB 1N2AA 1FW1A 1XZOA 3G7JA 2HSNB 4XS4B 3GL5A 4V1Ag 2FHEA 3QDNA 4K7IA 3GUSA 2GSRA 1MDIA 1QQ2A 4GQFA 2MZCA 4O5RA 1F2EA 5B6NA 3I9V2 1DSBA 2OE1A 5A4UA 2DKHA 1Y25A 1TKDB 3IRAA 2IMFA 1U3IA 1ZYEA 3KP8A 4MA9A 3F4RA 1GL8A 4TW5A 2JSYA 5A5KA 1TOFA 1GTUA 1ZGNA 2JZTA 3BBYA 3IBHA 2P0GA 4IBPA 3APSA 3F9UA 3FKFA 2GQLA 4MF7A 2HRKB 3ERGA 3UARA 10GSA 2WDUA 1SENA 4ECIA 2B7JA 2AB6A 1Y1UA 4FIWA 1F3BA 3HHVA 2C0EA 2LEGA 4HJ2A 4L5OA 1SYRA 3L9SA 3QR6A 5IMFA 4PTSA 2OE3A 2D2ZA 5AIXA 1GP1A 2F8AA 3UJ1A 3QFAC 2P5RA 4MJAA 1MD4A 2N5FA 3A5IA 3KEBA 2H74A 6GSVA 1GNWA 4HZ2A 5ELAA 1H75A 3TKSA 3IDVA 4XIHA 1V98A 2F9SA 4ULXA 3RPNA 3CBUA 1ERWA 1RW1A 4Q5NA 3F8UA 1VF1A 4K0GA 3MAKA 2A2SA 4FQUA 3TRXA 3OR5A 3LGCA 5EPFA 1EEMA 2O8VB 3P7XA 1YDKA 1GTBA 5JWOB 4AJ6A 5DQSA 2H19A 1GUKA 4GSNA 1PQNA 1IYHA 5ECLB 3TJFA 5CP1A 6GSSA 4KDXA 1NHOA 2FWHA 4MNNA 1XWGA 4J57E 5J9CA 2R6KA 2CVDA 14GSA 4GXZA 2G2QA 2OKAA 4EIPA 2L6DA 5J4UA 5GAPD 4JE1A 2MMOA 4K2DA 1R7HA 1YKAA 4HQZA 2KLXA 3EU3A 4DVCA 3V1WA 2H1GA 3HZ8A 3K8NA 2IMIA 1SVOA 4EKZA 3VWVA 1MTCA 4EO3A 2HSMA 4TKYA 1F6MC 4AJ8A 2H0HA 4WR4A 4JU5A 2MMAA 3ZFBA 5A34A 4MZCA 2CVKA 3ERFA 1XVQA 2ZUPA 3MWHA 1XCCA 2EIOA 4OFNA 2WB9A 3VWWA 5J47A 1M9BA 4AGSA 3EMXA 3FY7A 3LEFA 1AUCA 6GSWA 2HZEB 1ZMAA 3ME7A 5F07A 1V2AA 1TI3A 3KXOA 4POBA 1TI1A 4LLRA 4IJIA 2E2MA 2TRCP 4OFMA 2NPBA 5B8BA 3GV1A 5HQPA 4NV2A 4RQRA 2ON5A 5G31A 4CY6A 5B8AA 3IK7A 3W8SA 4ZBBA 3GTUA 1HQOA 3IK9A 4PNFA 1Z9HA 4BL7B 2CX4A 4TRXA 4KB3A 3MNGA 1SKSB 3CRUA 3H79A 2HSHA 5IPHA 1HNBA 1OC9B 2FD3A 4BVYA 2R3XA 3EPTA 2GT5A 5F06A 2RM5A 4G0IA 5JWRB 4QL9A 4XCSA 4E8EA 2H0IA 4OD7A 4PUFC 1TRUA 4PNGA 5HR1A 3IE3A 1VF4A 5A1NB 4GSSA 2DBCA 2HXKA 1WE0A 3JCML 5DVBA 5F05A 3IOSA 4BWSA 1EV9A 2VCQA 1AQWA 3BD2A 5DQYA 5A5HA 2CAIA 5ECKB 2OJLA 1U6TA 2XBIA 4I97A 4GQCA 1SL2B 3E9JB 2VLTA 1YEPA 3ZMLA 5IM9A 1K0AA 3GMFA 4O5QA 3EMPA 4ML1A 3VWUA 1V40A 1ERVA 1SD9A 2DIYA 3ZIJA 2IMDA 6GSTA 2L4CA 8GSSA 2YJHA 1S3DA 2H6ZA 2YCDA 4KNDA 1X9MB 3M8NA 2TRXA 5KN2A 1GSYA 2UV8G 3QD9A 5HR3A 3UMAA 4MZBA 1NHYA 3HCZA 4IQAA 3WT1A 1SKWB 3M3MA 1V57A 4DSSA 1WJKA 3F6DA 2HQTA 3IV4A 5CRDA 2VOCA 2N5AA 3NIVA 2LTKA 4TR1A 5IOWA 2C1YA 1X0RA 1Z3EA 5FT3A 2GQKA 1M99A 3DYRA 5IO2A 5DDLA 5JCUA 1AAZA 4AJ7A 4TVEA 1SL0B 2YNXA 1F9MA 1SKRB 2A4HA 1H4OA 1I5GA 5LCZA 4HZ4A 3Q6OA 1JHBA 4ISDA 4KSMA 3F63A 5IMDA 1AC1A 1DBYA 3EC3A 3J7Yk 2B1LA 4K7NA 5CRGA 2UZ8A 1Z6NA 5CRWA 2R0GA 2P5QA 5HR0A 4JR6A 4Q5FA 5G5FA 5ECRB 2H6XA 4A5PA 1M0UA 2J9HA 3FR6A 3F4TA 2YWNA 1M9AA 2B3SA 1M7TA 2M80A 1K0CA 2KOKA 3GSSA 3U5RE 3D22A 4N0VA 5IMCA 1UN2A 2GVPA 1A23A 3Q18A 1QFNA 1F37A 1AIUA 4L8EA 4ML6A 3CSIA 3ED3A 2ZCTA 2DC5A 1U87A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5GSS A;  2DJ2 A;  2HZF A;  1OC3 A;  1PN9 A;  5JCG A;  16GS A;  2F51 A;  4TN8 A;  2VCT A;  2VCX A;  3D4T A;  1BQ7 A;  5CO3 A;  2C0D A;  3TUE A;  2K8S A;  17GS A;  3ZVJ A;  2NBS A;  2VD0 A;  4ZB8 A;  5ECO B;  2VUP A;  4D73 B;  1J08 A;  4ZIL A;  3LXZ A;  1SK0 A;  5D93 A;  1TU8 A;  3A2W A;  3IPZ A;  3SBC A;  1OVN A;  5J3R A;  1SYX A;  3HJP A;  4KCE A;  5KN0 A;  1WRY A;  4ZL8 A;  2P31 A;  3KD0 A;  3EU4 A;  4EXJ A;  2CVB A;  3UIW A;  2VCV A;  5DAL B;  3CRT A;  1PD2 1;  2GSS A;  3I43 A;  1V58 A;  2B5Y A;  2IWT A;  1GUM A;  4J2F A;  2DJ1 A;  2G0F A;  1YZX A;  1ML6 A;  2IJY A;  4PUA A;  5H5Q A;  2FWF A;  2YWO A;  3VUR A;  4RI6 A;  2JL4 A;  4ZB9 A;  3ME8 A;  2PUK C;  5CRH A;  2BJX A;  1A8Y A;  3TKP A;  2MMZ A;  2HRN A;  1SL1 B;  1QUW A;  1M2B A;  2GDR A;  2K6V A;  3KGK A;  2K18 A;  1N8J A;  2IFQ A;  2VCW A;  4G2E A;  4X1U A;  4DEJ A;  1Z7P A;  4G0L A;  3RAZ A;  3BCI A;  2ALB A;  3N5O A;  3H1N A;  2V1M A;  2VL2 C;  3IAM 2;  1VRS D;  3D21 A;  4IP1 A;  4G10 A;  3C8E A;  5D9T A;  1JLV A;  2LRN A;  4NWY A;  2HLS A;  3GH9 A;  1XW5 A;  3VFI A;  2ZNM A;  4V2M A;  2WGR A;  2C3Q A;  3HY2 A;  1X9W B;  2E2G A;  1NM3 A;  2VM1 A;  4QQ7 A;  2YV7 A;  2N5B A;  2L5O A;  2EC4 A;  4ACS A;  1ST9 A;  1ZZY A;  6GSX A;  3TJJ A;  1JZW A;  1THX A;  1MD3 A;  4USS A;  4ZB6 A;  1XFL A;  1FOV A;  2IPA A;  4Q5Q A;  3F3Q A;  2OBK A;  4XS6 A;  4I6X A;  3HD5 A;  3ZRE A;  1HYU A;  2PN8 A;  4DSR A;  2C80 A;  2H30 A;  4TOP A;  3GKX A;  1O8W A;  5ENU A;  5A4V A;  3UAP A;  5ECQ B;  1CQH A;  3KH9 A;  3KIJ A;  1O85 A;  1EV4 A;  1GRX A;  5BMU A;  1TW9 A;  2H1D A;  5E59 A;  5CAX A;  2VLU A;  2HE3 A;  3DKS A;  1PSQ A;  3L0H A;  3VLN A;  2FA4 A;  1O7U A;  3NOF A;  3M1G A;  3NZN A;  1SJ6 A;  3VWX A;  2GZZ A;  3C7M A;  1GLP A;  3BOA A;  1TRV A;  4GWR A;  2M46 A;  2RLI A;  1K0N A;  18GS A;  4BWQ A;  4I2U A;  2WZ9 A;  2DJ3 A;  5C00 A;  3D0Z A;  1THO A;  3PPU A;  1EP7 A;  4FYB A;  6GSU A;  2AYT A;  1NSW A;  1ZCP A;  3DRN A;  4CDO A;  3ZLP A;  4I8B A;  2DMM A;  5ECS A;  1WMJ A;  4V1A p;  4POK A;  5ID2 B;  2CAQ A;  1EEJ A;  3LJR A;  1ABA A;  3G9B A;  2CX3 A;  2VLV A;  5IOX A;  1O81 A;  4HU7 A;  4TXO B;  1I9D A;  2L5L A;  3KM6 A;  3QAW A;  2HFD A;  4MF5 A;  1VGL A;  4P3Y B;  1PA3 A;  2FY6 A;  2FUG 2;  2OAD A;  1BX9 A;  3ZYW A;  2YP6 A;  2OA7 A;  2B6M A;  1B4P A;  1WWJ A;  4JZQ A;  4MPG A;  3TB2 A;  2ON7 A;  5ECN B;  4RUV A;  2FA8 A;  1X9S B;  1AXD A;  4HUA A;  3LQ7 A;  4L0W A;  4MH3 A;  3KJY A;  5LNK e;  2L4Q A;  3GKK A;  3L78 A;  4EE0 A;  2I1U A;  1Z6M A;  2MMN A;  4XS4 A;  4OO4 A;  1T4Z A;  1B9X C;  2QGV A;  1TDI A;  2REM A;  1A0F A;  3A2X A;  2FWE A;  3TKQ A;  1XVW A;  3HVX A;  19GS A;  5KEJ A;  3U6V A;  3GN3 A;  2YWM A;  4JRR A;  4HQS A;  4G0K A;  4ZIJ A;  1AQV A;  6GSY A;  4JR4 A;  1K0D A;  4TR4 A;  3QMX A;  5ECM B;  3IC4 A;  3LXT A;  2C3T A;  1XPV A;  5D9V A;  2C0F A;  2JZR A;  2L57 A;  2O87 A;  2X64 A;  1SU9 A;  2HRK A;  3FYG A;  2CQ9 A;  3J7Y b;  1JFU A;  2H1B A;  4OCF A;  4CHS A;  3KMN A;  4AF2 A;  1UA5 A;  4IGJ A;  2VAF A;  3HYP A;  2VL3 A;  4G19 A;  2J23 A;  1U88 A;  2IME A;  3QPM A;  3Q19 A;  1YJ6 A;  1PL1 A;  2X8H A;  1SK1 A;  1IYI A;  4I5Q A;  2LJR A;  4F9Z A;  3CMI A;  1B9Y C;  1O73 A;  2LJA A;  2FGX A;  3PGT A;  2DIZ A;  4F0C A;  5IMV A;  2FCH A;  2DML A;  2HYX A;  5F0G A;  3GUR A;  4PQH A;  5F8B A;  4G9H A;  2GQM A;  5HFG A;  5ABR A;  1YF0 A;  3PR8 A;  1K0B A;  1W89 A;  1BAY A;  3M9J A;  3D4M A;  1A2L A;  3APQ A;  3BCK A;  1QK8 A;  1Q4J A;  2YWI A;  2RII A;  1K3O A;  2VL9 A;  1M2A A;  2RUF A;  3GKM A;  5J5N A;  1VF2 A;  5D9W A;  5EVO A;  4O7H A;  1ZOF A;  1DE2 A;  4WKW A;  3HJM A;  5E4W A;  3L9U A;  2KUC A;  1GSE A;  4KDU A;  3UVH A;  2QKE A;  2E0Q A;  3GNJ A;  3FZ4 A;  4PXO A;  3F4S A;  3IC8 A;  3TJB A;  1K0M A;  3FZ9 A;  1KEB A;  2NVL A;  3FZA A;  3UL3 A;  3P8W A;  2H72 A;  3O3T A;  3CTG A;  3MDK A;  4O92 A;  1JLW A;  2K8V A;  2OE0 A;  3EIN A;  2WJU A;  5EY6 A;  2GLR A;  3HKR A;  3VI7 A;  1AW9 A;  3IHQ A;  2A4V A;  3UVT A;  2LRC A;  2PER A;  5IQY A;  3R2Q A;  1TJD A;  1RK4 A;  3HJO A;  2HZE A;  4OWY A;  3UOM A;  4L0U A;  2PWJ A;  2H8L A;  4KH7 A;  5EL8 A;  5HFI A;  2MBT A;  4KE3 A;  1PMT A;  1GSU A;  5J9B A;  2PGT A;  3TOU A;  2R2J A;  5IPG A;  4BL7 A;  1KBN A;  2HRA A;  2H71 A;  4LL4 B;  9GSS A;  3VI5 A;  1W4V A;  3HA9 A;  3LOR A;  3G7I A;  2HRF A;  2XHF A;  1UVZ A;  2LS5 A;  2KP2 A;  1TXX A;  1OC9 A;  4IEL A;  2GZP A;  2YJ7 A;  1FO5 A;  4MZW A;  5GZZ B;  4BPY A;  4ECC A;  3ZMK A;  1EP8 A;  5DAK B;  4Z7X A;  4YAP A;  1MDJ A;  1OKT A;  1FAA A;  1X5D A;  3GIX A;  2OBI A;  3BJ5 A;  3GRX A;  4MMM A;  5HR2 A;  1CQG A;  1OE7 A;  3DWV A;  1TP9 A;  2LUS A;  1K3L A;  1R4W A;  2FLS A;  2RM6 A;  3DIE A;  2WS2 A;  1C72 A;  4KGI A;  4IS0 A;  5JWQ B;  1F3A A;  11GS A;  3GA4 A;  4DSQ A;  1X5E A;  2OAC A;  3WT2 A;  3RHB A;  1HD2 A;  3DEX A;  1WOU A;  3QOU A;  2DLX A;  4K0N A;  1GUH A;  3I69 A;  3G7Y A;  4N11 A;  4HI7 A;  2TIR A;  5L71 A;  4XHM A;  1T3B A;  3GX0 A;  2LKU A;  4KSO A;  1OE8 A;  5J41 A;  2V32 A;  5CRE A;  1A0R P;  4ECJ A;  2B1K A;  5ECI B;  1JZD A;  3APO A;  1TK8 B;  1B4Q A;  2ES7 A;  3LSZ A;  2NDO A;  2XPE A;  2CV4 A;  1GLQ A;  3M0F A;  1FB0 A;  4YQV A;  2GST A;  4ZBA A;  4V2L A;  4ZL9 A;  5FWG A;  3L4N A;  4N10 A;  4WET A;  4POL A;  2VD1 A;  4KX4 A;  1TK0 B;  4F03 A;  3C73 A;  3M9K A;  2DJ0 A;  1VF3 A;  1WP0 A;  3KTL A;  2MYG A;  4ILF A;  2NTO A;  3RBT A;  1BYE A;  2PVQ A;  3TGZ A;  3CYN A;  3QAG A;  3TDG A;  3IAS 2;  1YF1 A;  2IL3 A;  4LL1 B;  1AQX A;  13GS A;  1ACV A;  1ILO A;  5DBQ A;  4KDY A;  4X0X A;  2GGT A;  4OFT A;  2LNT A;  2JSZ A;  1DE1 A;  3FR3 A;  2HI7 A;  4F0B A;  4IVF A;  20GS A;  1KNG A;  4EL1 A;  1BG5 A;  1G7E A;  4YAV A;  1U3A A;  3KZQ A;  5G2Z A;  4PGT A;  2V41 A;  3DVW A;  2YV9 A;  4GST A;  2AJQ B;  2YZH A;  3TKS C;  2L6C A;  3LWA A;  2CZ3 A;  1TRS A;  5D96 A;  1FG4 A;  4HJM A;  2O85 A;  1GTI A;  1SD8 A;  1PGT A;  2KHP A;  3FK8 A;  1JZO A;  1USB A;  2HT9 A;  4BVX A;  1PX7 A;  1EOG A;  2VCZ A;  1E2Y A;  2BMX A;  2HSM B;  3H93 A;  5C04 A;  2YN1 A;  2H6Y A;  3QFB C;  1XXU A;  1EZK A;  4MJC A;  5GST A;  4WXT A;  1OC8 A;  4N30 A;  4PUR A;  2WCI A;  1SK2 A;  4ZXG A;  1SJZ A;  2YPM A;  1X5C A;  2H73 A;  4GLT A;  4HEA 2;  3S9F A;  5KN1 A;  4MH2 A;  3EVI A;  3CSH A;  3CSJ A;  1A2M A;  2C3N A;  3DGQ A;  2IIY A;  5IIZ A;  4D73 A;  2X8C A;  2B5E A;  1T7P B;  3FRC A;  3ISO A;  3D5J A;  4MP4 A;  1G7O A;  1MEK A;  1TTZ A;  3IA1 A;  5AN1 A;  3H8Q A;  4JED A;  1LJR A;  4LA1 A;  1DUG A;  3GTU B;  3N9J A;  1Z7R A;  4OMV A;  3P90 A;  3H4K A;  2LST A;  5DAL A;  3F6F A;  1GSD A;  2CZ2 A;  3W6G A;  1G0T A;  2I4A A;  4EUY A;  1XW6 A;  2VL2 A;  4NXI A;  4GTU A;  4OCE A;  1ERT A;  3UBK A;  4BVY B;  3R3E A;  4EDY A;  1LU4 A;  2PVO C;  4KUN A;  2H0G A;  2H76 A;  1YQ1 A;  2R5G A;  1S3A A;  4NAX A;  3AY8 A;  3TKS E;  4N0Z A;  1B8X A;  3RPP A;  4WF4 A;  4K6X A;  1S3C A;  2I81 A;  3F0I A;  1FHE A;  2XPD A;  1GUL A;  3ZVJ D;  2KP1 A;  2LQQ A;  3E3E A;  2O7K A;  1EGO A;  2IN3 A;  1E6B A;  4MDC A;  1MDK A;  5B6M A;  1XIY A;  2C4J A;  5CNW A;  1K3Y A;  2WRT A;  1EOH A;  5IMZ A;  3ZTL A;  3QAV A;  2V6O A;  2YOI A;  3GFK A;  1PKW A;  1XWK A;  3L9V A;  3VK9 A;  2AHE A;  4E8H A;  1UC7 A;  5H5S A;  5D9X A;  3US3 A;  12GS A;  3A2V A;  3E0U A;  3TCO A;  4L5L A;  1PRX A;  3ZL5 A;  3VPT A;  3ZIV A;  3PH9 A;  4POM A;  2FWG A;  3ZZX A;  1M2D A;  3GH6 A;  3VPQ A;  4DSS B;  2AUV A;  1OKD A;  5COH A;  1G6W A;  4ZL7 A;  4LMV A;  2EIQ A;  5LD0 A;  2IMK A;  4TR1 B;  3KCM A;  1HNA A;  1J9B A;  1ON4 A;  4RQX A;  4BA7 A;  4IN0 A;  4IP6 A;  5CYY A;  1XWC A;  5INY A;  2FNO A;  2I9H A;  2XC2 A;  4YQM A;  4KCA A;  1Z5Y E;  4MLY A;  1XWB A;  3LYK A;  1TU7 A;  2CA8 A;  5D8I A;  1A2J A;  2PU9 C;  4GRF A;  5AIV A;  1WIK A;  2Z9S A;  1LBK A;  1NW2 A;  1R26 A;  3GHA A;  1TRW A;  2LNS A;  1FB6 A;  4FYU A;  4FH8 A;  1GWC A;  3KTB A;  4YQU A;  2M72 A;  4MK3 A;  2DJK A;  4XS1 A;  2A2R A;  5DCG A;  3TOT A;  4MF6 A;  4EC0 A;  1GTA A;  5B7C A;  4WR5 A;  3DXB A;  4K8M A;  1YEX A;  3LG6 A;  1R5P A;  5HFK A;  1EWX A;  3GYK A;  3IR4 A;  4OO5 A;  5ID2 A;  3GL3 A;  3EYT A;  4IQ1 A;  1XWA A;  4K9Z A;  1Q98 A;  2DJJ A;  2GS3 A;  4MCU A;  4KA0 A;  2JU5 A;  1OYJ A;  4TXO A;  3DML A;  3RHC A;  1O8X A;  4TXV A;  2LRT A;  4HOJ A;  4PQI A;  3W8J A;  4IKH A;  3FZ5 A;  2YAN A;  7GSS A;  2QC7 A;  3KH7 A;  4IHU A;  4J56 E;  5G5E A;  3MSZ A;  1WPI A;  2PPT A;  3CTF A;  1PL2 A;  4XRA A;  2RUE A;  4V2N A;  3O6T A;  2C0G A;  2JAC A;  1K0O A;  3TJG A;  4NHZ A;  3FHK A;  3HZ4 A;  1QXH A;  4HU9 A;  3WGX A;  1ZYQ B;  1V9W A;  3TRQ A;  3C71 A;  3GX8 A;  2QSI A;  4XTS A;  2JAD A;  2V2G A;  1GNE A;  3ERW A;  2B5X A;  4MJB A;  4I2T A;  2WFC A;  1T1V A;  4FYC A;  1PX6 A;  2L59 A;  3WGD A;  1JZR A;  3PIN A;  2HNL A;  2EIR A;  2I3Y A;  4LMW A;  5ELG A;  1ERU A;  3EUR A;  3FEU A;  5ECH B;  5A4W A;  3A5W A;  4KAE A;  4ECB A;  3SWL A;  2X99 A;  3TJK A;  5G1L A;  4F2I A;  3EE2 A;  4PQ1 A;  3RDW A;  2CT6 A;  2LQO A;  2B7K A;  3KMO A;  2F3M A;  1PKZ A;  4NHW A;  1B48 A;  4CW9 A;  2H70 A;  2IFQ B;  3UEM A;  3CXG A;  2AAW A;  5AIS A;  3EWL A;  1XOB A;  3ZRD A;  2YZU A;  2F8F A;  4O32 A;  3ZFL A;  2WUL A;  4IJ3 A;  2VO4 A;  3C1S A;  2GZY A;  4KW6 A;  2X8G A;  3LYP A;  4ZBD A;  2LJK A;  2O89 A;  1GH2 A;  5ECP B;  3O76 A;  3WD6 A;  3KP9 A;  4F82 A;  1YY7 A;  1TK5 B;  1HNC A;  3I6A A;  5DJL A;  5AGY A;  3IXR A;  4EDZ A;  4WBJ A;  3HVS A;  3TRP A;  3LFL A;  4K1F A;  1OAZ A;  3DVX A;  5IMA A;  1T8E B;  5IO0 A;  1T4Y A;  2GTU A;  4BVX B;  2E7P A;  5KN3 A;  2MBS A;  1GSS A;  3P2A A;  2PMT A;  3GKN A;  1T00 A;  2AV4 A;  3WGE A;  3UBL A;  1KTE A;  2HSY A;  1Y6E A;  2H01 A;  1XW9 A;  1RQM A;  2H75 A;  4IW9 A;  4EF0 A;  2DSA A;  5DJM A;  3FW2 A;  2XBQ A;  1QMV A;  2K9F A;  4Q5R A;  5GAN D;  5D73 A;  4EVM A;  1G6Y A;  4NV5 A;  4PX1 A;  1A24 A;  2H66 A;  2GT6 A;  4GF0 A;  3TKR A;  5JCW A;  4RI7 A;  4KF9 A;  1XOA A;  3QCP A;  1R5A A;  3Q74 A;  3A3T A;  4MPF A;  4WBR D;  1XBS A;  4X43 A;  2R4V A;  1BED A;  1QGV A;  1O6J A;  2LV3 A;  4K7O A;  5G30 A;  3FR9 A;  4NMU A;  4XRD A;  1URM A;  5H5R A;  5DCH A;  5G1K A;  3GST A;  5FHI A;  4NPB A;  4YH2 A;  4HS1 A;  1SJI A;  3D6I A;  2C8U A;  4HDE A;  2VM2 A;  1GSF A;  4WF5 A;  2JZS A;  1A8L A;  2H1A A;  3C1R A;  1GSQ A;  3F3R A;  4MJE A;  4H86 A;  4QL7 A;  1FVJ A;  1J0F A;  2GSQ A;  2BTO T;  3HVV A;  4FO5 A;  22GS A;  1ZL9 A;  4MAB A;  4TR0 A;  1YKC A;  4GCI A;  2R37 A;  4WEY A;  4TR3 A;  1FVK A;  4ID0 A;  3HDC A;  2V6K A;  4JBB A;  1BJX A;  3HXS A;  5DAK A;  3WYW A;  3DD3 A;  2VIM A;  3ZIT A;  1EGR A;  2PBJ A;  1N2A A;  1FW1 A;  1XZO A;  3G7J A;  2HSN B;  4XS4 B;  3GL5 A;  4V1A g;  2FHE A;  3QDN A;  4K7I A;  3GUS A;  2GSR A;  1MDI A;  1QQ2 A;  4GQF A;  2MZC A;  4O5R A;  1F2E A;  5B6N A;  3I9V 2;  1DSB A;  2OE1 A;  5A4U A;  1Y25 A;  1TKD B;  3IRA A;  2IMF A;  1U3I A;  1ZYE A;  3KP8 A;  4MA9 A;  3F4R A;  1GL8 A;  4TW5 A;  2JSY A;  5A5K A;  1TOF A;  1GTU A;  1ZGN A;  2JZT A;  3BBY A;  3IBH A;  2P0G A;  4IBP A;  3APS A;  3F9U A;  3FKF A;  2GQL A;  4MF7 A;  2HRK B;  3ERG A;  3UAR A;  10GS A;  2WDU A;  1SEN A;  4ECI A;  2B7J A;  2AB6 A;  4FIW A;  1F3B A;  3HHV A;  2C0E A;  2LEG A;  4HJ2 A;  4L5O A;  1SYR A;  3L9S A;  3QR6 A;  5IMF A;  4PTS A;  2OE3 A;  2D2Z A;  5AIX A;  1GP1 A;  2F8A A;  3UJ1 A;  3QFA C;  2P5R A;  4MJA A;  1MD4 A;  2N5F A;  3KEB A;  2H74 A;  6GSV A;  1GNW A;  4HZ2 A;  5ELA A;  1H75 A;  3TKS A;  3IDV A;  4XIH A;  1V98 A;  2F9S A;  4ULX A;  3RPN A;  3CBU A;  1ERW A;  1RW1 A;  4Q5N A;  3F8U A;  1VF1 A;  4K0G A;  3MAK A;  2A2S A;  4FQU A;  3TRX A;  3OR5 A;  3LGC A;  5EPF A;  1EEM A;  2O8V B;  3P7X A;  1YDK A;  1GTB A;  5JWO B;  4AJ6 A;  5DQS A;  2H19 A;  1GUK A;  4GSN A;  1PQN A;  1IYH A;  5ECL B;  3TJF A;  5CP1 A;  6GSS A;  4KDX A;  1NHO A;  2FWH A;  1XWG A;  4J57 E;  5J9C A;  2R6K A;  2CVD A;  14GS A;  4GXZ A;  2G2Q A;  2OKA A;  2L6D A;  5J4U A;  5GAP D;  4JE1 A;  2MMO A;  4K2D A;  1R7H A;  1YKA A;  4HQZ A;  2KLX A;  3EU3 A;  4DVC A;  3V1W A;  2H1G A;  3HZ8 A;  3K8N A;  2IMI A;  4EKZ A;  3VWV A;  1MTC A;  4EO3 A;  2HSM A;  4TKY A;  1F6M C;  4AJ8 A;  2H0H A;  4WR4 A;  4JU5 A;  2MMA A;  3ZFB A;  4MZC A;  2CVK A;  3ERF A;  1XVQ A;  2ZUP A;  3MWH A;  1XCC A;  2EIO A;  4OFN A;  2WB9 A;  3VWW A;  1M9B A;  4AGS A;  3EMX A;  3FY7 A;  3LEF A;  1AUC A;  6GSW A;  2HZE B;  1ZMA A;  3ME7 A;  5F07 A;  1V2A A;  1TI3 A;  3KXO A;  4POB A;  1TI1 A;  4LLR A;  4IJI A;  2E2M A;  2TRC P;  4OFM A;  2NPB A;  5B8B A;  3GV1 A;  5HQP A;  4NV2 A;  4RQR A;  2ON5 A;  5G31 A;  5B8A A;  3IK7 A;  3W8S A;  4ZBB A;  3GTU A;  1HQO A;  3IK9 A;  4PNF A;  1Z9H A;  4BL7 B;  2CX4 A;  4TRX A;  4KB3 A;  3MNG A;  1SKS B;  3CRU A;  3H79 A;  2HSH A;  5IPH A;  1HNB A;  1OC9 B;  2FD3 A;  4BVY A;  2R3X A;  2GT5 A;  5F06 A;  2RM5 A;  4G0I A;  5JWR B;  4QL9 A;  4XCS A;  4E8E A;  2H0I A;  4OD7 A;  4PUF C;  1TRU A;  4PNG A;  5HR1 A;  3IE3 A;  1VF4 A;  4GSS A;  2DBC A;  2HXK A;  1WE0 A;  3JCM L;  5DVB A;  5F05 A;  3IOS A;  4BWS A;  1EV9 A;  2VCQ A;  1AQW A;  3BD2 A;  5DQY A;  2CAI A;  5ECK B;  2OJL A;  1U6T A;  2XBI A;  4I97 A;  4GQC A;  1SL2 B;  3E9J B;  2VLT A;  1YEP A;  3ZML A;  5IM9 A;  1K0A A;  3GMF A;  3EMP A;  4ML1 A;  3VWU A;  1V40 A;  1ERV A;  1SD9 A;  2DIY A;  3ZIJ A;  2IMD A;  6GST A;  2L4C A;  8GSS A;  2YJH A;  1S3D A;  2H6Z A;  2YCD A;  4KND A;  1X9M B;  3M8N A;  2TRX A;  5KN2 A;  1GSY A;  3QD9 A;  5HR3 A;  3UMA A;  4MZB A;  1NHY A;  3HCZ A;  4IQA A;  3WT1 A;  1SKW B;  3M3M A;  1V57 A;  4DSS A;  1WJK A;  3F6D A;  2HQT A;  3IV4 A;  5CRD A;  2VOC A;  2N5A A;  3NIV A;  2LTK A;  4TR1 A;  5IOW A;  2C1Y A;  1X0R A;  1Z3E A;  5FT3 A;  2GQK A;  1M99 A;  3DYR A;  5IO2 A;  5DDL A;  5JCU A;  1AAZ A;  4AJ7 A;  4TVE A;  1SL0 B;  2YNX A;  1F9M A;  1SKR B;  1H4O A;  1I5G A;  5LCZ A;  4HZ4 A;  3Q6O A;  1JHB A;  4ISD A;  4KSM A;  3F63 A;  5IMD A;  1AC1 A;  1DBY A;  3EC3 A;  3J7Y k;  2B1L A;  4K7N A;  5CRG A;  2UZ8 A;  1Z6N A;  5CRW A;  2P5Q A;  5HR0 A;  4JR6 A;  4Q5F A;  5G5F A;  5ECR B;  2H6X A;  1M0U A;  2J9H A;  3FR6 A;  3F4T A;  2YWN A;  1M9A A;  2B3S A;  1M7T A;  2M80 A;  1K0C A;  2KOK A;  3GSS A;  3U5R E;  3D22 A;  4N0V A;  5IMC A;  1UN2 A;  2GVP A;  1A23 A;  3Q18 A;  1QFN A;  1F37 A;  1AIU A;  4L8E A;  4ML6 A;  3CSI A;  3ED3 A;  2ZCT A;  2DC5 A;  1U87 A; 
#chains in the Genus database with same CATH topology
 5GSS A;  2DJ2 A;  2HZF A;  1OC3 A;  1PN9 A;  5JCG A;  16GS A;  2F51 A;  4TN8 A;  2VCT A;  2VCX A;  3D4T A;  1BQ7 A;  5CO3 A;  2C0D A;  3TUE A;  2K8S A;  17GS A;  3ZVJ A;  2NBS A;  2VD0 A;  4ZB8 A;  5ECO B;  2VUP A;  4D73 B;  1J08 A;  4ZIL A;  3LXZ A;  1SK0 A;  5D93 A;  1TU8 A;  3A2W A;  3IPZ A;  3SBC A;  1OVN A;  5J3R A;  1SYX A;  3HJP A;  4KCE A;  5KN0 A;  1WRY A;  4ZL8 A;  2P31 A;  3KD0 A;  3EU4 A;  4EXJ A;  2CVB A;  3UIW A;  2VCV A;  5DAL B;  3CRT A;  1PD2 1;  2GSS A;  3I43 A;  1V58 A;  2B5Y A;  2IWT A;  1GUM A;  4J2F A;  2DJ1 A;  2G0F A;  1YZX A;  1ML6 A;  2IJY A;  4PUA A;  5H5Q A;  2EFC A;  2FWF A;  2YWO A;  1BF5 A;  3VUR A;  4RI6 A;  4Z2R A;  2JL4 A;  4ZB9 A;  3ME8 A;  2PUK C;  5CRH A;  2BJX A;  1A8Y A;  3TKP A;  2MMZ A;  2HRN A;  1SL1 B;  1QUW A;  4ZB7 A;  1M2B A;  2GDR A;  2K6V A;  3KGK A;  2K18 A;  1N8J A;  2IFQ A;  2VCW A;  4G2E A;  4X1U A;  4DEJ A;  1YVL A;  1Z7P A;  4G0L A;  3RAZ A;  3BCI A;  2ALB A;  3N5O A;  3H1N A;  2V1M A;  2VL2 C;  3IAM 2;  1VRS D;  3D21 A;  4IP1 A;  4G10 A;  1ZYP A;  3C8E A;  5D9T A;  1JLV A;  2LRN A;  4NWY A;  2HLS A;  3GH9 A;  1XW5 A;  3VFI A;  2ZNM A;  4V2M A;  2WGR A;  2C3Q A;  1ZYN A;  3HY2 A;  1X9W B;  2E2G A;  1NM3 A;  2VM1 A;  4QQ7 A;  2YV7 A;  2N5B A;  2L5O A;  2EC4 A;  4ACS A;  1ST9 A;  3MIX A;  1ZZY A;  6GSX A;  3TJJ A;  4N3Z A;  1JZW A;  1THX A;  1MD3 A;  4USS A;  4ZB6 A;  1XFL A;  1FOV A;  2IPA A;  4Q5Q A;  3F3Q A;  2OBK A;  4XS6 A;  4I6X A;  3HD5 A;  3ZRE A;  1HYU A;  2PN8 A;  4DSR A;  2C80 A;  2H30 A;  1FOH A;  4TOP A;  3GKX A;  1O8W A;  5ENU A;  5A4V A;  3UAP A;  5ECQ B;  1CQH A;  3KH9 A;  3KIJ A;  1O85 A;  1EV4 A;  1GRX A;  5BMU A;  1TW9 A;  2H1D A;  5E59 A;  5CAX A;  2VLU A;  2HE3 A;  4W66 A;  3DKS A;  1PSQ A;  3L0H A;  3VLN A;  2FA4 A;  1O7U A;  3NOF A;  3M1G A;  3NZN A;  1SJ6 A;  3VWX A;  2GZZ A;  3C7M A;  1GLP A;  3BOA A;  1TRV A;  4GWR A;  2M46 A;  2RLI A;  1K0N A;  18GS A;  4BWQ A;  4I2U A;  2WZ9 A;  2DJ3 A;  5C00 A;  3D0Z A;  1SVL A;  1THO A;  3PPU A;  3CHX C;  1EP7 A;  4FYB A;  6GSU A;  2AYT A;  4K5R A;  1NSW A;  1ZCP A;  3DRN A;  4CDO A;  3ZLP A;  4I8B A;  1SVM A;  2DMM A;  5ECS A;  1WMJ A;  4V1A p;  4POK A;  5ID2 B;  2CAQ A;  2DKI A;  1EEJ A;  3LJR A;  1ABA A;  3G9B A;  2CX3 A;  2VLV A;  5IOX A;  1O81 A;  4HU7 A;  4TXO B;  1I9D A;  2O3E A;  5J4Y A;  2L5L A;  3KM6 A;  3QAW A;  2HFD A;  4MF5 A;  1VGL A;  4P3Y B;  1PA3 A;  2FY6 A;  2FUG 2;  2OAD A;  1BX9 A;  3LW9 A;  3ZYW A;  2YP6 A;  2OA7 A;  2B6M A;  1B4P A;  1WWJ A;  4JZQ A;  4MPG A;  3TB2 A;  2ON7 A;  5ECN B;  4RUV A;  2FA8 A;  1X9S B;  1AXD A;  4HUA A;  3LQ7 A;  4L0W A;  4MH3 A;  3KJY A;  5LNK e;  2L4Q A;  3GKK A;  3L78 A;  4EE0 A;  2I1U A;  1Z6M A;  2MMN A;  2HSN A;  4XS4 A;  4OO4 A;  1T4Z A;  1B9X C;  2QGV A;  1TDI A;  3A2X A;  1A0F A;  2REM A;  4Z2T A;  2FWE A;  3TKQ A;  1XVW A;  3HVX A;  19GS A;  5KEJ A;  2X4A A;  3U6V A;  3GN3 A;  2YWM A;  4JRR A;  2QA2 A;  4HQS A;  4G0K A;  4ZIJ A;  1AQV A;  6GSY A;  4JR4 A;  1K0D A;  4TR4 A;  3QMX A;  2R0P A;  5ECM B;  3IC4 A;  3LXT A;  2C3T A;  1XPV A;  5D9V A;  2C0F A;  2JZR A;  2L57 A;  2O87 A;  2X64 A;  1SU9 A;  2HRK A;  3FYG A;  2CQ9 A;  3J7Y b;  1JFU A;  4AKH A;  2H1B A;  4OCF A;  4CHS A;  3KMN A;  4AF2 A;  1UA5 A;  5BRT A;  4IGJ A;  2VAF A;  3HYP A;  2VL3 A;  4K2X A;  4G19 A;  2H1L A;  2J23 A;  1U88 A;  2IME A;  3QPM A;  3Q19 A;  1YJ6 A;  1PL1 A;  2X8H A;  1SK1 A;  5J4V A;  1IYI A;  4I5Q A;  2LJR A;  4F9Z A;  3CMI A;  1B9Y C;  1O73 A;  2LJA A;  2FGX A;  3PGT A;  2DIZ A;  4F0C A;  5IMV A;  2FCH A;  1PN0 A;  2DML A;  2HYX A;  5F0G A;  3GUR A;  4PQH A;  5F8B A;  4G9H A;  2GQM A;  5HFG A;  5ABR A;  1YF0 A;  3PR8 A;  1K0B A;  1W89 A;  2WVX A;  1BAY A;  3M9J A;  3D4M A;  1A2L A;  3APQ A;  3BCK A;  1QK8 A;  1Q4J A;  2YWI A;  2RII A;  1K3O A;  2VL9 A;  1M2A A;  2RUF A;  3GKM A;  5J5N A;  1VF2 A;  5D9W A;  5EVO A;  4O7H A;  1ZOF A;  1DE2 A;  4WKW A;  3IHG A;  3HJM A;  5E4W A;  3L9U A;  1N25 A;  2KUC A;  1GSE A;  4KDU A;  3UVH A;  2QKE A;  2E0Q A;  3GNJ A;  3FZ4 A;  4PXO A;  3F4S A;  3IC8 A;  3TJB A;  1K0M A;  3FZ9 A;  1KEB A;  2NVL A;  3FZA A;  3UL3 A;  3P8W A;  2H72 A;  3O3T A;  2VKZ G;  3CTG A;  3MDK A;  4EIQ A;  4O92 A;  1JLW A;  2K8V A;  2OE0 A;  3EIN A;  2WJU A;  5EY6 A;  2GLR A;  3HKR A;  3VI7 A;  1AW9 A;  3IHQ A;  4AI6 A;  2A4V A;  3UVT A;  2LRC A;  2PER A;  5IQY A;  3R2Q A;  1TJD A;  1RK4 A;  3HJO A;  2HZE A;  4OWY A;  3UOM A;  4L0U A;  2PWJ A;  2H8L A;  4KH7 A;  2EFD A;  5KOW A;  5EL8 A;  5HFI A;  2MBT A;  4KE3 A;  1PMT A;  1GSU A;  5J9B A;  2PGT A;  3TOU A;  2EFH A;  2R2J A;  5IPG A;  4BL7 A;  1KBN A;  2HRA A;  2H71 A;  4BIK A;  4LL4 B;  9GSS A;  2OT3 A;  3VI5 A;  1W4V A;  3HA9 A;  3LOR A;  3G7I A;  2HRF A;  2XHF A;  1UVZ A;  2LS5 A;  2KP2 A;  1TXX A;  4FXY P;  1OC9 A;  4IEL A;  2GZP A;  2YJ7 A;  1FO5 A;  4MZW A;  5GZZ B;  4BPY A;  4ECC A;  3ZMK A;  1EP8 A;  5DAK B;  4Z7X A;  4YAP A;  1MDJ A;  1OKT A;  1FAA A;  1X5D A;  3GIX A;  5A1N A;  2OBI A;  3BJ5 A;  3GRX A;  4MMM A;  5HR2 A;  1CQG A;  1OE7 A;  3DWV A;  1TP9 A;  2LUS A;  1K3L A;  1R4W A;  3HVN A;  2FLS A;  2RM6 A;  3DIE A;  2WS2 A;  1C72 A;  4KGI A;  4IS0 A;  5JWQ B;  1F3A A;  4E68 A;  11GS A;  3GA4 A;  4DSQ A;  1X5E A;  2OAC A;  3WT2 A;  3RHB A;  1HD2 A;  3DEX A;  1WOU A;  3QOU A;  2DLX A;  4K0N A;  1GUH A;  3I69 A;  3G7Y A;  4N11 A;  4HI7 A;  2TIR A;  2QA1 A;  5L71 A;  4XHM A;  1T3B A;  4O5U A;  3GX0 A;  2LKU A;  4KSO A;  1OE8 A;  5J41 A;  2V32 A;  5CRE A;  1A0R P;  4ECJ A;  2B1K A;  3HMJ G;  5ECI B;  1JZD A;  3APO A;  1TK8 B;  1B4Q A;  2ES7 A;  3LSZ A;  2NDO A;  2XPE A;  2CV4 A;  1GLQ A;  3M0F A;  1FB0 A;  2WW2 A;  4YQV A;  2GST A;  4ZBA A;  4V2L A;  4ZL9 A;  5FWG A;  3L4N A;  4N10 A;  4WET A;  4POL A;  2VD1 A;  4KX4 A;  1TK0 B;  4F03 A;  3C73 A;  3M9K A;  2DJ0 A;  1VF3 A;  1WP0 A;  3KTL A;  2MYG A;  4ILF A;  3RGB C;  2NTO A;  3RBT A;  1BYE A;  2PVQ A;  3TGZ A;  3CYN A;  3QAG A;  3TDG A;  3IAS 2;  1YF1 A;  2IL3 A;  4LL1 B;  1AQX A;  13GS A;  1ACV A;  1ILO A;  5DBQ A;  4KDY A;  4X0X A;  2GGT A;  4OFT A;  2LNT A;  2X49 A;  2JSZ A;  1DE1 A;  3FR3 A;  2HI7 A;  4F0B A;  4IVF A;  20GS A;  1KNG A;  4EL1 A;  1BG5 A;  1G7E A;  4YAV A;  1U3A A;  3KZQ A;  5G2Z A;  4PGT A;  2V41 A;  3DVW A;  2YV9 A;  4GST A;  2AJQ B;  2YZH A;  3TKS C;  4GDF A;  2L6C A;  3LWA A;  2CZ3 A;  1TRS A;  5D96 A;  1FG4 A;  4HJM A;  2O85 A;  1GTI A;  1SD8 A;  1PGT A;  2KHP A;  3FK8 A;  1JZO A;  1USB A;  2HT9 A;  4BVX A;  1PX7 A;  1EOG A;  2VCZ A;  1E2Y A;  2BMX A;  2HSM B;  3H93 A;  5C04 A;  2YN1 A;  2H6Y A;  3QFB C;  4AKI A;  1XXU A;  1EZK A;  4MJC A;  5GST A;  2A2P A;  4WXT A;  1OC8 A;  4N30 A;  4PUR A;  2WCI A;  5A34 B;  1SK2 A;  4ZXG A;  1SJZ A;  2YPM A;  1X5C A;  2H73 A;  4GLT A;  4HEA 2;  3S9F A;  5KN1 A;  4MH2 A;  3EVI A;  3CSH A;  3CSJ A;  1A2M A;  2C3N A;  3DGQ A;  2IIY A;  5IIZ A;  4D73 A;  2X8C A;  2B5E A;  1T7P B;  3FRC A;  3ISO A;  3D5J A;  4MP4 A;  1G7O A;  1MEK A;  1TTZ A;  3IA1 A;  5AN1 A;  3H8Q A;  4JED A;  1LJR A;  4LA1 A;  1DUG A;  4ICY A;  3GTU B;  3N9J A;  1Z7R A;  4OMV A;  3P90 A;  3H4K A;  2LST A;  5DAL A;  3F6F A;  1GSD A;  2CZ2 A;  3W6G A;  1G0T A;  2I4A A;  4EUY A;  5J40 A;  1XW6 A;  2VL2 A;  4NXI A;  2R0C A;  4GTU A;  4OCE A;  1ERT A;  3UBK A;  2O5V A;  4BVY B;  3R3E A;  4EDY A;  1LU4 A;  4QMK A;  2PVO C;  4KUN A;  2H0G A;  4G01 A;  2H76 A;  1YQ1 A;  2R5G A;  1S3A A;  4NAX A;  3AY8 A;  3TKS E;  4N0Z A;  1B8X A;  3RPP A;  4WF4 A;  4K6X A;  1S3C A;  2I81 A;  3F0I A;  1FHE A;  2XPD A;  1GUL A;  3ZVJ D;  2KP1 A;  2LQQ A;  3E3E A;  2O7K A;  1EGO A;  2IN3 A;  1E6B A;  4MDC A;  1MDK A;  5A5H B;  5B6M A;  3MYD A;  1XIY A;  2C4J A;  5CNW A;  1K3Y A;  2WRT A;  1EOH A;  5IMZ A;  3ZTL A;  3QAV A;  2V6O A;  2WW0 A;  2YOI A;  3GFK A;  1PKW A;  2EFE A;  1XWK A;  3L9V A;  3VK9 A;  2AHE A;  4E8H A;  1UC7 A;  5H5S A;  5D9X A;  3US3 A;  12GS A;  3A2V A;  3E0U A;  3TCO A;  4L5L A;  3FMW A;  1PRX A;  3ZL5 A;  3VPT A;  3ZIV A;  3PH9 A;  4POM A;  2FWG A;  3ZZX A;  1M2D A;  1I1I P;  3GH6 A;  3VPQ A;  4DSS B;  2AUV A;  1OKD A;  5COH A;  1G6W A;  4ZL7 A;  4LMV A;  2EIQ A;  5LD0 A;  2IMK A;  4TR1 B;  3KCM A;  4Z2U A;  1HNA A;  1J9B A;  1ON4 A;  4RQX A;  4BA7 A;  4IN0 A;  4IP6 A;  5CYY A;  1XWC A;  5INY A;  2FNO A;  2I9H A;  2XC2 A;  4YQM A;  4KCA A;  1Z5Y E;  4MLY A;  1XWB A;  3LYK A;  1TU7 A;  2CA8 A;  5D8I A;  1A2J A;  2PU9 C;  4GRF A;  5AIV A;  1WIK A;  2Z9S A;  1LBK A;  1NW2 A;  1R26 A;  3GHA A;  1TRW A;  2LNS A;  1FB6 A;  4FYU A;  4FH8 A;  1GWC A;  3KTB A;  4YQU A;  2M72 A;  4MK3 A;  2DJK A;  1S3R A;  4XS1 A;  1YEW C;  2A2R A;  5DCG A;  3TOT A;  4MF6 A;  4EC0 A;  1GTA A;  5B7C A;  4WR5 A;  3DXB A;  4K8M A;  1YEX A;  3LG6 A;  1R5P A;  5HFK A;  1EWX A;  1BG1 A;  3GYK A;  3IR4 A;  4OO5 A;  5ID2 A;  3GL3 A;  3EYT A;  4IQ1 A;  1XWA A;  4K9Z A;  1Q98 A;  2DJJ A;  2GS3 A;  4MCU A;  4KA0 A;  2JU5 A;  1OYJ A;  4TXO A;  3DML A;  3RHC A;  1O8X A;  4TXV A;  2LRT A;  3TU3 B;  4HOJ A;  4PQI A;  3W8J A;  4IKH A;  3FZ5 A;  2YAN A;  7GSS A;  2QC7 A;  3KH7 A;  4IHU A;  4J56 E;  5G5E A;  3MSZ A;  4AKG A;  1WPI A;  2PPT A;  3CTF A;  1PL2 A;  4XRA A;  2RUE A;  4V2N A;  3O6T A;  2C0G A;  2JAC A;  1K0O A;  3TJG A;  4NHZ A;  3FHK A;  3HZ4 A;  1QXH A;  4HU9 A;  3WGX A;  1ZYQ B;  1V9W A;  3TRQ A;  3C71 A;  3GX8 A;  3CWG A;  2QSI A;  4XTS A;  2JAD A;  2V2G A;  1GNE A;  3ERW A;  2B5X A;  4MJB A;  4I2T A;  2WFC A;  1T1V A;  4FYC A;  1PX6 A;  1M3I A;  2L59 A;  3WGD A;  1JZR A;  3PIN A;  2HNL A;  2EIR A;  2I3Y A;  4LMW A;  2WW3 A;  5ELG A;  1ERU A;  3EUR A;  3FEU A;  5ECH B;  4K5S A;  5A4W A;  3A5W A;  4KAE A;  4ECB A;  3SWL A;  2X99 A;  3TJK A;  5G1L A;  4X4J A;  4F2I A;  3EE2 A;  4PQ1 A;  3RDW A;  2CT6 A;  2LQO A;  2B7K A;  3KMO A;  2F3M A;  1PKZ A;  4NHW A;  1B48 A;  4CW9 A;  2H70 A;  2IFQ B;  3UEM A;  3CXG A;  2AAW A;  5AIS A;  3EWL A;  1XOB A;  3ZRD A;  2YZU A;  2F8F A;  4O32 A;  3ZFL A;  2WUL A;  4IJ3 A;  2VO4 A;  3C1S A;  2GZY A;  4KW6 A;  1XG8 A;  2X8G A;  3LYP A;  4ZBD A;  2LJK A;  2O89 A;  1GH2 A;  2WVY A;  4YKF A;  5ECP B;  3O76 A;  3WD6 A;  3KP9 A;  4F82 A;  1YY7 A;  1TK5 B;  1HNC A;  3I6A A;  5DJL A;  5AGY A;  3IXR A;  4EDZ A;  4WBJ A;  3HVS A;  3TRP A;  3LFL A;  4K1F A;  1OAZ A;  3DVX A;  5IMA A;  1T8E B;  5IO0 A;  1T4Y A;  2GTU A;  4BVX B;  4YKG A;  2E7P A;  5KN3 A;  2MBS A;  1GSS A;  3P2A A;  2PMT A;  3GKN A;  1T00 A;  2AV4 A;  3WGE A;  3UBL A;  1KTE A;  5KOX A;  2HSY A;  1Y6E A;  2H01 A;  1XW9 A;  1RQM A;  2H75 A;  4IW9 A;  4EF0 A;  2DSA A;  5DJM A;  3FW2 A;  2XBQ A;  1QMV A;  2K9F A;  4Q5R A;  5GAN D;  5D73 A;  4EVM A;  5BMU B;  1G6Y A;  4NV5 A;  4PX1 A;  1A24 A;  2H66 A;  2GT6 A;  1PFO A;  4GF0 A;  4CY8 A;  3TKR A;  5JCW A;  4RI7 A;  4KF9 A;  1XOA A;  3QCP A;  1R5A A;  3Q74 A;  3A3T A;  4MPF A;  4WBR D;  1XBS A;  4X43 A;  2R4V A;  1BED A;  1QGV A;  1O6J A;  2LV3 A;  4K7O A;  5G30 A;  3FR9 A;  4NMU A;  4XRD A;  1URM A;  5H5R A;  5DCH A;  5G1K A;  3GST A;  5FHI A;  4NPB A;  4YH2 A;  4HS1 A;  1SJI A;  3D6I A;  2C8U A;  4HDE A;  2VM2 A;  1GSF A;  4WF5 A;  2JZS A;  1A8L A;  2H1A A;  3C1R A;  1GSQ A;  3F3R A;  1S4B P;  4MJE A;  4PI0 C;  4H86 A;  4QL7 A;  1FVJ A;  1J0F A;  2GSQ A;  2BTO T;  3HVV A;  4FO5 A;  22GS A;  1ZL9 A;  4MAB A;  4TR0 A;  1YKC A;  1TXU A;  4PHZ C;  4GCI A;  2R37 A;  4WEY A;  4TR3 A;  1FVK A;  4ID0 A;  3HDC A;  2V6K A;  4JBB A;  1BJX A;  3HXS A;  5DAK A;  3WYW A;  3DD3 A;  2VIM A;  3ZIT A;  1EGR A;  2PBJ A;  4AKX B;  1N2A A;  2WVZ A;  1FW1 A;  1XZO A;  3G7J A;  2HSN B;  4XS4 B;  3GL5 A;  4V1A g;  2FHE A;  3QDN A;  4K7I A;  3GUS A;  2GSR A;  1MDI A;  1QQ2 A;  4GQF A;  2MZC A;  4O5R A;  1F2E A;  5B6N A;  3I9V 2;  1DSB A;  2OE1 A;  5A4U A;  2DKH A;  1Y25 A;  1TKD B;  3IRA A;  2IMF A;  1U3I A;  1ZYE A;  3KP8 A;  4MA9 A;  2O36 A;  3F4R A;  1GL8 A;  4TW5 A;  2JSY A;  5A5K A;  1TOF A;  1GTU A;  1ZGN A;  2JZT A;  3BBY A;  3IBH A;  2P0G A;  4IBP A;  3APS A;  3F9U A;  3FKF A;  2GQL A;  4MF7 A;  2HRK B;  3ERG A;  3UAR A;  10GS A;  2WDU A;  1SEN A;  4ECI A;  2B7J A;  2AB6 A;  1Y1U A;  4FIW A;  1F3B A;  3HHV A;  2C0E A;  2LEG A;  4HJ2 A;  4L5O A;  1SYR A;  3L9S A;  3QR6 A;  5IMF A;  4PTS A;  2OE3 A;  2D2Z A;  5AIX A;  1GP1 A;  2F8A A;  3UJ1 A;  3QFA C;  2P5R A;  4MJA A;  1MD4 A;  2N5F A;  3A5I A;  3KEB A;  2H74 A;  6GSV A;  1GNW A;  4HZ2 A;  5ELA A;  1H75 A;  3TKS A;  3IDV A;  4XIH A;  3RFR C;  1V98 A;  2F9S A;  4ULX A;  3RPN A;  3CBU A;  1ERW A;  1RW1 A;  4Q5N A;  3F8U A;  1VF1 A;  4K0G A;  3MAK A;  2A2S A;  4FQU A;  3TRX A;  3OR5 A;  2WVX B;  3LGC A;  5EPF A;  1EEM A;  2O8V B;  3P7X A;  1YDK A;  1GTB A;  5JWO B;  4AJ6 A;  5DQS A;  2H19 A;  1GUK A;  4GSN A;  1PQN A;  1IYH A;  5ECL B;  2WW1 A;  3TJF A;  5CP1 A;  6GSS A;  4KDX A;  1NHO A;  2FWH A;  4MNN A;  1XWG A;  4J57 E;  5J9C A;  2R6K A;  2CVD A;  14GS A;  4GXZ A;  2G2Q A;  2OKA A;  4EIP A;  2L6D A;  5J4U A;  5GAP D;  4JE1 A;  2MMO A;  4K2D A;  1R7H A;  1YKA A;  4HQZ A;  2KLX A;  3EU3 A;  4DVC A;  3V1W A;  2H1G A;  3HZ8 A;  3K8N A;  2IMI A;  1SVO A;  4EKZ A;  3VWV A;  1MTC A;  4PI2 C;  4EO3 A;  2HSM A;  4TKY A;  1F6M C;  4AJ8 A;  2H0H A;  4WR4 A;  4JU5 A;  2MMA A;  3ZFB A;  5A34 A;  4MZC A;  2CVK A;  3ERF A;  1XVQ A;  2ZUP A;  3MWH A;  1XCC A;  2EIO A;  4OFN A;  2WB9 A;  3VWW A;  5J47 A;  1M9B A;  4AGS A;  3EMX A;  2WZS A;  3FY7 A;  3LEF A;  1AUC A;  6GSW A;  2HZE B;  1ZMA A;  3ME7 A;  5F07 A;  1V2A A;  1TI3 A;  3KXO A;  4POB A;  1TI1 A;  4LLR A;  4IJI A;  2E2M A;  2TRC P;  4OFM A;  2NPB A;  5B8B A;  3GV1 A;  5HQP A;  4NV2 A;  4RQR A;  2ON5 A;  5G31 A;  4CY6 A;  5B8A A;  3IK7 A;  3W8S A;  4ZBB A;  3GTU A;  1HQO A;  3IK9 A;  4PNF A;  1Z9H A;  4BL7 B;  2CX4 A;  4TRX A;  4KB3 A;  3MNG A;  1SKS B;  3CRU A;  3H79 A;  2HSH A;  5IPH A;  1HNB A;  1OC9 B;  2FD3 A;  4BVY A;  2R3X A;  3EPT A;  2GT5 A;  5F06 A;  2RM5 A;  4G0I A;  5JWR B;  4QL9 A;  4XCS A;  4E8E A;  2H0I A;  4OD7 A;  4PUF C;  1TRU A;  4PNG A;  5HR1 A;  3IE3 A;  1VF4 A;  5A1N B;  4GSS A;  2DBC A;  2HXK A;  1WE0 A;  3JCM L;  5DVB A;  5F05 A;  3IOS A;  4BWS A;  1EV9 A;  2VCQ A;  1AQW A;  3BD2 A;  5DQY A;  5A5H A;  2CAI A;  5ECK B;  2OJL A;  1U6T A;  2XBI A;  4I97 A;  4GQC A;  1SL2 B;  3E9J B;  2VLT A;  1YEP A;  3ZML A;  5IM9 A;  1K0A A;  3GMF A;  4O5Q A;  3EMP A;  4ML1 A;  3VWU A;  1V40 A;  1ERV A;  1SD9 A;  2DIY A;  3ZIJ A;  2IMD A;  6GST A;  2L4C A;  8GSS A;  1M3J A;  2YJH A;  1S3D A;  2H6Z A;  2YCD A;  4KND A;  1X9M B;  3M8N A;  2TRX A;  5KN2 A;  1GSY A;  2UV8 G;  3QD9 A;  5HR3 A;  3UMA A;  4MZB A;  1NHY A;  3HCZ A;  4IQA A;  3WT1 A;  1SKW B;  3M3M A;  1V57 A;  4DSS A;  1WJK A;  3F6D A;  2HQT A;  3IV4 A;  5CRD A;  2VOC A;  2N5A A;  3NIV A;  2LTK A;  4TR1 A;  5IOW A;  2C1Y A;  1X0R A;  1Z3E A;  5FT3 A;  2GQK A;  1M99 A;  3DYR A;  5IO2 A;  5DDL A;  5JCU A;  1AAZ A;  4AJ7 A;  4TVE A;  1SL0 B;  2YNX A;  1F9M A;  1SKR B;  2A4H A;  1H4O A;  1I5G A;  5LCZ A;  4HZ4 A;  3Q6O A;  1JHB A;  4ISD A;  4KSM A;  3F63 A;  5IMD A;  1AC1 A;  1DBY A;  3EC3 A;  3J7Y k;  2B1L A;  4K7N A;  5CRG A;  2UZ8 A;  1Z6N A;  5CRW A;  2R0G A;  2P5Q A;  5HR0 A;  4JR6 A;  4Q5F A;  3CQF A;  5G5F A;  5ECR B;  2H6X A;  4A5P A;  1M0U A;  2J9H A;  3FR6 A;  3F4T A;  2YWN A;  1M9A A;  2B3S A;  1M7T A;  2M80 A;  1K0C A;  2KOK A;  3GSS A;  3U5R E;  3D22 A;  4N0V A;  5IMC A;  1UN2 A;  2GVP A;  1A23 A;  3Q18 A;  1QFN A;  1F37 A;  1AIU A;  4L8E A;  4ML6 A;  3CSI A;  3ED3 A;  4HSC X;  2ZCT A;  2DC5 A;  1U87 A; 
#chains in the Genus database with same CATH homology
 5GSS A;  2DJ2 A;  2HZF A;  1OC3 A;  1PN9 A;  5JCG A;  16GS A;  2F51 A;  4TN8 A;  2VCT A;  2VCX A;  3D4T A;  1BQ7 A;  5CO3 A;  2C0D A;  3TUE A;  2K8S A;  17GS A;  3ZVJ A;  2NBS A;  2VD0 A;  4ZB8 A;  5ECO B;  2VUP A;  4D73 B;  1J08 A;  4ZIL A;  3LXZ A;  1SK0 A;  5D93 A;  1TU8 A;  3A2W A;  3IPZ A;  3SBC A;  1OVN A;  5J3R A;  1SYX A;  3HJP A;  4KCE A;  5KN0 A;  1WRY A;  4ZL8 A;  2P31 A;  3KD0 A;  3EU4 A;  4EXJ A;  2CVB A;  3UIW A;  2VCV A;  5DAL B;  3CRT A;  1PD2 1;  2GSS A;  3I43 A;  1V58 A;  2B5Y A;  2IWT A;  1GUM A;  4J2F A;  2DJ1 A;  2G0F A;  1YZX A;  1ML6 A;  2IJY A;  4PUA A;  5H5Q A;  2EFC A;  2FWF A;  2YWO A;  1BF5 A;  3VUR A;  4RI6 A;  4Z2R A;  2JL4 A;  4ZB9 A;  3ME8 A;  2PUK C;  5CRH A;  2BJX A;  1A8Y A;  3TKP A;  2MMZ A;  2HRN A;  1SL1 B;  1QUW A;  4ZB7 A;  1M2B A;  2GDR A;  2K6V A;  3KGK A;  2K18 A;  1N8J A;  2IFQ A;  2VCW A;  4G2E A;  4X1U A;  4DEJ A;  1YVL A;  1Z7P A;  4G0L A;  3RAZ A;  3BCI A;  2ALB A;  3N5O A;  3H1N A;  2V1M A;  2VL2 C;  3IAM 2;  1VRS D;  3D21 A;  4IP1 A;  4G10 A;  1ZYP A;  3C8E A;  5D9T A;  1JLV A;  2LRN A;  4NWY A;  2HLS A;  3GH9 A;  1XW5 A;  3VFI A;  2ZNM A;  4V2M A;  2WGR A;  2C3Q A;  1ZYN A;  3HY2 A;  1X9W B;  2E2G A;  1NM3 A;  2VM1 A;  4QQ7 A;  2YV7 A;  2N5B A;  2L5O A;  2EC4 A;  4ACS A;  1ST9 A;  3MIX A;  1ZZY A;  6GSX A;  3TJJ A;  4N3Z A;  1JZW A;  1THX A;  1MD3 A;  4USS A;  4ZB6 A;  1XFL A;  1FOV A;  2IPA A;  4Q5Q A;  3F3Q A;  2OBK A;  4XS6 A;  4I6X A;  3HD5 A;  3ZRE A;  1HYU A;  2PN8 A;  4DSR A;  2C80 A;  2H30 A;  1FOH A;  4TOP A;  3GKX A;  1O8W A;  5ENU A;  5A4V A;  3UAP A;  5ECQ B;  1CQH A;  3KH9 A;  3KIJ A;  1O85 A;  1EV4 A;  1GRX A;  5BMU A;  1TW9 A;  2H1D A;  5E59 A;  5CAX A;  2VLU A;  2HE3 A;  4W66 A;  3DKS A;  1PSQ A;  3L0H A;  3VLN A;  2FA4 A;  1O7U A;  3NOF A;  3M1G A;  3NZN A;  1SJ6 A;  3VWX A;  2GZZ A;  3C7M A;  1GLP A;  3BOA A;  1TRV A;  4GWR A;  2M46 A;  2RLI A;  1K0N A;  18GS A;  4BWQ A;  4I2U A;  2WZ9 A;  2DJ3 A;  5C00 A;  3D0Z A;  1SVL A;  1THO A;  3PPU A;  1EP7 A;  4FYB A;  6GSU A;  2AYT A;  4K5R A;  1NSW A;  1ZCP A;  3DRN A;  4CDO A;  3ZLP A;  4I8B A;  1SVM A;  2DMM A;  5ECS A;  1WMJ A;  4V1A p;  4POK A;  5ID2 B;  2CAQ A;  2DKI A;  1EEJ A;  3LJR A;  1ABA A;  3G9B A;  2CX3 A;  2VLV A;  5IOX A;  1O81 A;  4HU7 A;  4TXO B;  1I9D A;  5J4Y A;  2L5L A;  3KM6 A;  3QAW A;  2HFD A;  4MF5 A;  1VGL A;  4P3Y B;  1PA3 A;  2FY6 A;  2FUG 2;  2OAD A;  3LW9 A;  1BX9 A;  3ZYW A;  2YP6 A;  2OA7 A;  2B6M A;  1B4P A;  1WWJ A;  4JZQ A;  4MPG A;  3TB2 A;  2ON7 A;  5ECN B;  4RUV A;  2FA8 A;  1X9S B;  1AXD A;  4HUA A;  3LQ7 A;  4L0W A;  4MH3 A;  3KJY A;  5LNK e;  2L4Q A;  3GKK A;  3L78 A;  4EE0 A;  2I1U A;  1Z6M A;  2MMN A;  2HSN A;  4XS4 A;  4OO4 A;  1T4Z A;  1B9X C;  2QGV A;  1TDI A;  3A2X A;  1A0F A;  2REM A;  4Z2T A;  2FWE A;  3TKQ A;  1XVW A;  3HVX A;  19GS A;  5KEJ A;  2X4A A;  3U6V A;  3GN3 A;  2YWM A;  4JRR A;  2QA2 A;  4HQS A;  4G0K A;  4ZIJ A;  1AQV A;  6GSY A;  4JR4 A;  1K0D A;  4TR4 A;  3QMX A;  2R0P A;  5ECM B;  3IC4 A;  3LXT A;  2C3T A;  1XPV A;  5D9V A;  2C0F A;  2JZR A;  2L57 A;  2O87 A;  2X64 A;  1SU9 A;  2HRK A;  3FYG A;  2CQ9 A;  3J7Y b;  1JFU A;  4AKH A;  2H1B A;  4OCF A;  4CHS A;  3KMN A;  4AF2 A;  1UA5 A;  5BRT A;  4IGJ A;  2VAF A;  3HYP A;  2VL3 A;  4K2X A;  4G19 A;  2H1L A;  2J23 A;  1U88 A;  2IME A;  3QPM A;  3Q19 A;  1YJ6 A;  1PL1 A;  2X8H A;  1SK1 A;  5J4V A;  1IYI A;  4I5Q A;  2LJR A;  4F9Z A;  3CMI A;  1B9Y C;  1O73 A;  2LJA A;  2FGX A;  3PGT A;  2DIZ A;  4F0C A;  5IMV A;  2FCH A;  1PN0 A;  2DML A;  2HYX A;  5F0G A;  3GUR A;  4PQH A;  5F8B A;  4G9H A;  2GQM A;  5HFG A;  5ABR A;  1YF0 A;  3PR8 A;  1K0B A;  1W89 A;  1BAY A;  3M9J A;  3D4M A;  1A2L A;  3APQ A;  3BCK A;  1QK8 A;  1Q4J A;  2YWI A;  2RII A;  1K3O A;  2VL9 A;  1M2A A;  2RUF A;  3GKM A;  5J5N A;  1VF2 A;  5D9W A;  5EVO A;  4O7H A;  1ZOF A;  1DE2 A;  4WKW A;  3IHG A;  3HJM A;  5E4W A;  3L9U A;  1N25 A;  2KUC A;  1GSE A;  4KDU A;  3UVH A;  2QKE A;  2E0Q A;  3GNJ A;  3FZ4 A;  4PXO A;  3F4S A;  3IC8 A;  3TJB A;  1K0M A;  3FZ9 A;  1KEB A;  2NVL A;  3FZA A;  3UL3 A;  3P8W A;  2H72 A;  3O3T A;  2VKZ G;  3CTG A;  3MDK A;  4EIQ A;  4O92 A;  1JLW A;  2K8V A;  2OE0 A;  3EIN A;  2WJU A;  5EY6 A;  2GLR A;  3HKR A;  3VI7 A;  1AW9 A;  3IHQ A;  4AI6 A;  2A4V A;  3UVT A;  2LRC A;  2PER A;  5IQY A;  3R2Q A;  1TJD A;  1RK4 A;  3HJO A;  2HZE A;  4OWY A;  3UOM A;  4L0U A;  2PWJ A;  2H8L A;  4KH7 A;  2EFD A;  5KOW A;  5EL8 A;  5HFI A;  2MBT A;  4KE3 A;  1PMT A;  1GSU A;  5J9B A;  2PGT A;  3TOU A;  2EFH A;  2R2J A;  5IPG A;  4BL7 A;  1KBN A;  2HRA A;  2H71 A;  4LL4 B;  9GSS A;  2OT3 A;  3VI5 A;  1W4V A;  3HA9 A;  3LOR A;  3G7I A;  2HRF A;  2XHF A;  1UVZ A;  2LS5 A;  2KP2 A;  1TXX A;  1OC9 A;  4IEL A;  2GZP A;  2YJ7 A;  1FO5 A;  4MZW A;  5GZZ B;  4BPY A;  4ECC A;  3ZMK A;  1EP8 A;  5DAK B;  4Z7X A;  4YAP A;  1MDJ A;  1OKT A;  1FAA A;  1X5D A;  3GIX A;  5A1N A;  2OBI A;  3BJ5 A;  3GRX A;  4MMM A;  5HR2 A;  1CQG A;  1OE7 A;  3DWV A;  1TP9 A;  2LUS A;  1K3L A;  1R4W A;  2FLS A;  2RM6 A;  3DIE A;  2WS2 A;  1C72 A;  4KGI A;  4IS0 A;  5JWQ B;  1F3A A;  4E68 A;  11GS A;  3GA4 A;  4DSQ A;  1X5E A;  2OAC A;  3WT2 A;  3RHB A;  1HD2 A;  3DEX A;  1WOU A;  3QOU A;  2DLX A;  4K0N A;  1GUH A;  3I69 A;  3G7Y A;  4N11 A;  4HI7 A;  2TIR A;  2QA1 A;  5L71 A;  4XHM A;  1T3B A;  4O5U A;  3GX0 A;  2LKU A;  4KSO A;  1OE8 A;  5J41 A;  2V32 A;  5CRE A;  1A0R P;  4ECJ A;  2B1K A;  3HMJ G;  5ECI B;  1JZD A;  3APO A;  1TK8 B;  1B4Q A;  2ES7 A;  3LSZ A;  2NDO A;  2XPE A;  2CV4 A;  1GLQ A;  3M0F A;  1FB0 A;  4YQV A;  2GST A;  4ZBA A;  4V2L A;  4ZL9 A;  5FWG A;  3L4N A;  4N10 A;  4WET A;  4POL A;  2VD1 A;  4KX4 A;  1TK0 B;  4F03 A;  3C73 A;  3M9K A;  2DJ0 A;  1VF3 A;  1WP0 A;  3KTL A;  2MYG A;  4ILF A;  2NTO A;  3RBT A;  1BYE A;  2PVQ A;  3TGZ A;  3CYN A;  3QAG A;  3TDG A;  3IAS 2;  1YF1 A;  2IL3 A;  4LL1 B;  1AQX A;  13GS A;  1ACV A;  1ILO A;  5DBQ A;  4KDY A;  4X0X A;  2GGT A;  4OFT A;  2LNT A;  2X49 A;  2JSZ A;  1DE1 A;  3FR3 A;  2HI7 A;  4F0B A;  4IVF A;  20GS A;  1KNG A;  4EL1 A;  1BG5 A;  1G7E A;  4YAV A;  1U3A A;  3KZQ A;  5G2Z A;  4PGT A;  2V41 A;  3DVW A;  2YV9 A;  4GST A;  2AJQ B;  2YZH A;  3TKS C;  4GDF A;  2L6C A;  3LWA A;  2CZ3 A;  1TRS A;  5D96 A;  1FG4 A;  4HJM A;  2O85 A;  1GTI A;  1SD8 A;  1PGT A;  2KHP A;  3FK8 A;  1JZO A;  1USB A;  2HT9 A;  4BVX A;  1PX7 A;  1EOG A;  2VCZ A;  1E2Y A;  2BMX A;  2HSM B;  3H93 A;  5C04 A;  2YN1 A;  2H6Y A;  3QFB C;  4AKI A;  1XXU A;  1EZK A;  4MJC A;  5GST A;  2A2P A;  4WXT A;  1OC8 A;  4N30 A;  4PUR A;  2WCI A;  5A34 B;  1SK2 A;  4ZXG A;  1SJZ A;  2YPM A;  1X5C A;  2H73 A;  4GLT A;  4HEA 2;  3S9F A;  5KN1 A;  4MH2 A;  3EVI A;  3CSH A;  3CSJ A;  1A2M A;  2C3N A;  3DGQ A;  2IIY A;  5IIZ A;  4D73 A;  2X8C A;  2B5E A;  1T7P B;  3FRC A;  3ISO A;  3D5J A;  4MP4 A;  1G7O A;  1MEK A;  1TTZ A;  3IA1 A;  5AN1 A;  3H8Q A;  4JED A;  1LJR A;  4LA1 A;  1DUG A;  4ICY A;  3GTU B;  3N9J A;  1Z7R A;  4OMV A;  3P90 A;  3H4K A;  2LST A;  5DAL A;  3F6F A;  1GSD A;  2CZ2 A;  3W6G A;  1G0T A;  2I4A A;  4EUY A;  5J40 A;  1XW6 A;  2VL2 A;  4NXI A;  2R0C A;  4GTU A;  4OCE A;  1ERT A;  3UBK A;  2O5V A;  4BVY B;  3R3E A;  4EDY A;  1LU4 A;  4QMK A;  2PVO C;  4KUN A;  2H0G A;  4G01 A;  2H76 A;  1YQ1 A;  2R5G A;  1S3A A;  4NAX A;  3AY8 A;  3TKS E;  4N0Z A;  1B8X A;  3RPP A;  4WF4 A;  4K6X A;  1S3C A;  2I81 A;  3F0I A;  1FHE A;  2XPD A;  1GUL A;  3ZVJ D;  2KP1 A;  2LQQ A;  3E3E A;  2O7K A;  1EGO A;  2IN3 A;  1E6B A;  4MDC A;  1MDK A;  5A5H B;  5B6M A;  3MYD A;  1XIY A;  2C4J A;  5CNW A;  1K3Y A;  2WRT A;  1EOH A;  5IMZ A;  3ZTL A;  3QAV A;  2V6O A;  2YOI A;  3GFK A;  1PKW A;  2EFE A;  1XWK A;  3L9V A;  3VK9 A;  2AHE A;  4E8H A;  1UC7 A;  5H5S A;  5D9X A;  3US3 A;  12GS A;  3A2V A;  3E0U A;  3TCO A;  4L5L A;  3FMW A;  1PRX A;  3ZL5 A;  3VPT A;  3ZIV A;  3PH9 A;  4POM A;  2FWG A;  3ZZX A;  1M2D A;  3GH6 A;  3VPQ A;  4DSS B;  2AUV A;  1OKD A;  5COH A;  1G6W A;  4ZL7 A;  4LMV A;  2EIQ A;  5LD0 A;  2IMK A;  4TR1 B;  3KCM A;  4Z2U A;  1HNA A;  1J9B A;  1ON4 A;  4RQX A;  4BA7 A;  4IN0 A;  4IP6 A;  5CYY A;  1XWC A;  5INY A;  2FNO A;  2I9H A;  2XC2 A;  4YQM A;  4KCA A;  1Z5Y E;  4MLY A;  1XWB A;  3LYK A;  1TU7 A;  2CA8 A;  5D8I A;  1A2J A;  2PU9 C;  4GRF A;  5AIV A;  1WIK A;  2Z9S A;  1LBK A;  1NW2 A;  1R26 A;  3GHA A;  1TRW A;  2LNS A;  1FB6 A;  4FYU A;  4FH8 A;  1GWC A;  3KTB A;  4YQU A;  2M72 A;  4MK3 A;  2DJK A;  4XS1 A;  2A2R A;  5DCG A;  3TOT A;  4MF6 A;  4EC0 A;  1GTA A;  5B7C A;  4WR5 A;  3DXB A;  4K8M A;  1YEX A;  3LG6 A;  1R5P A;  5HFK A;  1EWX A;  1BG1 A;  3GYK A;  3IR4 A;  4OO5 A;  5ID2 A;  3GL3 A;  3EYT A;  4IQ1 A;  1XWA A;  4K9Z A;  1Q98 A;  2DJJ A;  2GS3 A;  4MCU A;  4KA0 A;  2JU5 A;  1OYJ A;  4TXO A;  3DML A;  3RHC A;  1O8X A;  4TXV A;  2LRT A;  3TU3 B;  4HOJ A;  4PQI A;  3W8J A;  4IKH A;  3FZ5 A;  2YAN A;  7GSS A;  2QC7 A;  3KH7 A;  4IHU A;  4J56 E;  5G5E A;  3MSZ A;  4AKG A;  1WPI A;  2PPT A;  3CTF A;  1PL2 A;  4XRA A;  2RUE A;  4V2N A;  3O6T A;  2C0G A;  2JAC A;  1K0O A;  3TJG A;  4NHZ A;  3FHK A;  3HZ4 A;  1QXH A;  4HU9 A;  3WGX A;  1ZYQ B;  1V9W A;  3TRQ A;  3C71 A;  3GX8 A;  3CWG A;  2QSI A;  4XTS A;  2JAD A;  2V2G A;  1GNE A;  3ERW A;  2B5X A;  4MJB A;  4I2T A;  2WFC A;  1T1V A;  4FYC A;  1PX6 A;  2L59 A;  3WGD A;  1JZR A;  3PIN A;  2HNL A;  2EIR A;  2I3Y A;  4LMW A;  5ELG A;  1ERU A;  3EUR A;  3FEU A;  5ECH B;  4K5S A;  5A4W A;  3A5W A;  4KAE A;  4ECB A;  3SWL A;  2X99 A;  3TJK A;  5G1L A;  4X4J A;  4F2I A;  3EE2 A;  4PQ1 A;  3RDW A;  2CT6 A;  2LQO A;  2B7K A;  3KMO A;  2F3M A;  1PKZ A;  4NHW A;  1B48 A;  4CW9 A;  2H70 A;  2IFQ B;  3UEM A;  3CXG A;  2AAW A;  5AIS A;  3EWL A;  1XOB A;  3ZRD A;  2YZU A;  2F8F A;  4O32 A;  3ZFL A;  2WUL A;  4IJ3 A;  2VO4 A;  3C1S A;  2GZY A;  4KW6 A;  2X8G A;  3LYP A;  4ZBD A;  2LJK A;  2O89 A;  1GH2 A;  4YKF A;  5ECP B;  3O76 A;  3WD6 A;  3KP9 A;  4F82 A;  1YY7 A;  1TK5 B;  1HNC A;  3I6A A;  5DJL A;  5AGY A;  3IXR A;  4EDZ A;  4WBJ A;  3HVS A;  3TRP A;  3LFL A;  4K1F A;  1OAZ A;  3DVX A;  5IMA A;  1T8E B;  5IO0 A;  1T4Y A;  2GTU A;  4BVX B;  4YKG A;  2E7P A;  5KN3 A;  2MBS A;  1GSS A;  3P2A A;  2PMT A;  3GKN A;  1T00 A;  2AV4 A;  3WGE A;  3UBL A;  1KTE A;  5KOX A;  2HSY A;  1Y6E A;  2H01 A;  1XW9 A;  1RQM A;  2H75 A;  4IW9 A;  4EF0 A;  2DSA A;  5DJM A;  3FW2 A;  2XBQ A;  1QMV A;  2K9F A;  4Q5R A;  5GAN D;  5D73 A;  4EVM A;  5BMU B;  1G6Y A;  4NV5 A;  4PX1 A;  1A24 A;  2H66 A;  2GT6 A;  4GF0 A;  4CY8 A;  3TKR A;  5JCW A;  4RI7 A;  4KF9 A;  1XOA A;  3QCP A;  1R5A A;  3Q74 A;  3A3T A;  4MPF A;  4WBR D;  1XBS A;  4X43 A;  2R4V A;  1BED A;  1QGV A;  1O6J A;  2LV3 A;  4K7O A;  5G30 A;  3FR9 A;  4NMU A;  4XRD A;  1URM A;  5H5R A;  5DCH A;  5G1K A;  3GST A;  5FHI A;  4NPB A;  4YH2 A;  4HS1 A;  1SJI A;  3D6I A;  2C8U A;  4HDE A;  2VM2 A;  1GSF A;  4WF5 A;  2JZS A;  1A8L A;  2H1A A;  3C1R A;  1GSQ A;  3F3R A;  4MJE A;  4H86 A;  4QL7 A;  1FVJ A;  1J0F A;  2GSQ A;  2BTO T;  3HVV A;  4FO5 A;  22GS A;  1ZL9 A;  4MAB A;  4TR0 A;  1YKC A;  1TXU A;  4GCI A;  2R37 A;  4WEY A;  4TR3 A;  1FVK A;  4ID0 A;  3HDC A;  2V6K A;  4JBB A;  1BJX A;  3HXS A;  5DAK A;  3WYW A;  3DD3 A;  2VIM A;  3ZIT A;  1EGR A;  2PBJ A;  4AKX B;  1N2A A;  1FW1 A;  1XZO A;  3G7J A;  2HSN B;  4XS4 B;  3GL5 A;  4V1A g;  2FHE A;  3QDN A;  4K7I A;  3GUS A;  2GSR A;  1MDI A;  1QQ2 A;  4GQF A;  2MZC A;  4O5R A;  1F2E A;  5B6N A;  3I9V 2;  1DSB A;  2OE1 A;  5A4U A;  2DKH A;  1Y25 A;  1TKD B;  3IRA A;  2IMF A;  1U3I A;  1ZYE A;  3KP8 A;  4MA9 A;  3F4R A;  1GL8 A;  4TW5 A;  2JSY A;  5A5K A;  1TOF A;  1GTU A;  1ZGN A;  2JZT A;  3BBY A;  3IBH A;  2P0G A;  4IBP A;  3APS A;  3F9U A;  3FKF A;  2GQL A;  4MF7 A;  2HRK B;  3ERG A;  3UAR A;  10GS A;  2WDU A;  1SEN A;  4ECI A;  2B7J A;  2AB6 A;  1Y1U A;  4FIW A;  1F3B A;  3HHV A;  2C0E A;  2LEG A;  4HJ2 A;  4L5O A;  1SYR A;  3L9S A;  3QR6 A;  5IMF A;  4PTS A;  2OE3 A;  2D2Z A;  5AIX A;  1GP1 A;  2F8A A;  3UJ1 A;  3QFA C;  2P5R A;  4MJA A;  1MD4 A;  2N5F A;  3A5I A;  3KEB A;  2H74 A;  6GSV A;  1GNW A;  4HZ2 A;  5ELA A;  1H75 A;  3TKS A;  3IDV A;  4XIH A;  1V98 A;  2F9S A;  4ULX A;  3RPN A;  3CBU A;  1ERW A;  1RW1 A;  4Q5N A;  3F8U A;  1VF1 A;  4K0G A;  3MAK A;  2A2S A;  4FQU A;  3TRX A;  3OR5 A;  3LGC A;  5EPF A;  1EEM A;  2O8V B;  3P7X A;  1YDK A;  1GTB A;  5JWO B;  4AJ6 A;  5DQS A;  2H19 A;  1GUK A;  4GSN A;  1PQN A;  1IYH A;  5ECL B;  3TJF A;  5CP1 A;  6GSS A;  4KDX A;  1NHO A;  2FWH A;  4MNN A;  1XWG A;  4J57 E;  5J9C A;  2R6K A;  2CVD A;  14GS A;  4GXZ A;  2G2Q A;  2OKA A;  4EIP A;  2L6D A;  5J4U A;  5GAP D;  4JE1 A;  2MMO A;  4K2D A;  1R7H A;  1YKA A;  4HQZ A;  2KLX A;  3EU3 A;  4DVC A;  3V1W A;  2H1G A;  3HZ8 A;  3K8N A;  2IMI A;  1SVO A;  4EKZ A;  3VWV A;  1MTC A;  4EO3 A;  2HSM A;  4TKY A;  1F6M C;  4AJ8 A;  2H0H A;  4WR4 A;  4JU5 A;  2MMA A;  3ZFB A;  5A34 A;  4MZC A;  2CVK A;  3ERF A;  1XVQ A;  2ZUP A;  3MWH A;  1XCC A;  2EIO A;  4OFN A;  2WB9 A;  3VWW A;  5J47 A;  1M9B A;  4AGS A;  3EMX A;  3FY7 A;  3LEF A;  1AUC A;  6GSW A;  2HZE B;  1ZMA A;  3ME7 A;  5F07 A;  1V2A A;  1TI3 A;  3KXO A;  4POB A;  1TI1 A;  4LLR A;  4IJI A;  2E2M A;  2TRC P;  4OFM A;  2NPB A;  5B8B A;  3GV1 A;  5HQP A;  4NV2 A;  4RQR A;  2ON5 A;  5G31 A;  4CY6 A;  5B8A A;  3IK7 A;  3W8S A;  4ZBB A;  3GTU A;  1HQO A;  3IK9 A;  4PNF A;  1Z9H A;  4BL7 B;  2CX4 A;  4TRX A;  4KB3 A;  3MNG A;  1SKS B;  3CRU A;  3H79 A;  2HSH A;  5IPH A;  1HNB A;  1OC9 B;  2FD3 A;  4BVY A;  2R3X A;  3EPT A;  2GT5 A;  5F06 A;  2RM5 A;  4G0I A;  5JWR B;  4QL9 A;  4XCS A;  4E8E A;  2H0I A;  4OD7 A;  4PUF C;  1TRU A;  4PNG A;  5HR1 A;  3IE3 A;  1VF4 A;  5A1N B;  4GSS A;  2DBC A;  2HXK A;  1WE0 A;  3JCM L;  5DVB A;  5F05 A;  3IOS A;  4BWS A;  1EV9 A;  2VCQ A;  1AQW A;  3BD2 A;  5DQY A;  5A5H A;  2CAI A;  5ECK B;  2OJL A;  1U6T A;  2XBI A;  4I97 A;  4GQC A;  1SL2 B;  3E9J B;  2VLT A;  1YEP A;  3ZML A;  5IM9 A;  1K0A A;  3GMF A;  4O5Q A;  3EMP A;  4ML1 A;  3VWU A;  1V40 A;  1ERV A;  1SD9 A;  2DIY A;  3ZIJ A;  2IMD A;  6GST A;  2L4C A;  8GSS A;  2YJH A;  1S3D A;  2H6Z A;  2YCD A;  4KND A;  1X9M B;  3M8N A;  2TRX A;  5KN2 A;  1GSY A;  2UV8 G;  3QD9 A;  5HR3 A;  3UMA A;  4MZB A;  1NHY A;  3HCZ A;  4IQA A;  3WT1 A;  1SKW B;  3M3M A;  1V57 A;  4DSS A;  1WJK A;  3F6D A;  2HQT A;  3IV4 A;  5CRD A;  2VOC A;  2N5A A;  3NIV A;  2LTK A;  4TR1 A;  5IOW A;  2C1Y A;  1X0R A;  1Z3E A;  5FT3 A;  2GQK A;  1M99 A;  3DYR A;  5IO2 A;  5DDL A;  5JCU A;  1AAZ A;  4AJ7 A;  4TVE A;  1SL0 B;  2YNX A;  1F9M A;  1SKR B;  2A4H A;  1H4O A;  1I5G A;  5LCZ A;  4HZ4 A;  3Q6O A;  1JHB A;  4ISD A;  4KSM A;  3F63 A;  5IMD A;  1AC1 A;  1DBY A;  3EC3 A;  3J7Y k;  2B1L A;  4K7N A;  5CRG A;  2UZ8 A;  1Z6N A;  5CRW A;  2R0G A;  2P5Q A;  5HR0 A;  4JR6 A;  4Q5F A;  5G5F A;  5ECR B;  2H6X A;  4A5P A;  1M0U A;  2J9H A;  3FR6 A;  3F4T A;  2YWN A;  1M9A A;  2B3S A;  1M7T A;  2M80 A;  1K0C A;  2KOK A;  3GSS A;  3U5R E;  3D22 A;  4N0V A;  5IMC A;  1UN2 A;  2GVP A;  1A23 A;  3Q18 A;  1QFN A;  1F37 A;  1AIU A;  4L8E A;  4ML6 A;  3CSI A;  3ED3 A;  2ZCT A;  2DC5 A;  1U87 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...