3SWLA

Crystal structure analysis of h74a mutant of human clic1
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
232
structure length
232
Chain Sequence
PQVELFVKAGSDGAKIGNCPFSQRLFMVLWLKGVTFNVTTVDTKRRTETVQKLCPGGQLPFLLYGTEVATDTNKIEEFLEAVLCPPRYPKLAALNPESNTAGLDIFAKFSAYIKNSNPALNDNLEKGLLKALKVLDNYLTSPLPEEVDETSAEDEGVSQRKFLDGNELTLADCNLLPKLHIVQVVCKKYRGFTIPEAFRGVHRYLSNAYAREEFASTCPDDEEIELAYEQVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Chloride intracellular channel protein 1
publication title Role of individual histidines in the pH-dependent global stability of human chloride intracellular channel 1.
pubmed doi rcsb
source organism Homo sapiens
total genus 76
structure length 232
sequence length 232
ec nomenclature
pdb deposition date 2011-07-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13409 GST_N_2 Glutathione S-transferase, N-terminal domain
A PF13410 GST_C_2 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 3swlA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3swlA01
5CNWA 1UVZA 3RAZA 4ZILA 3KD0A 3D21A 3HD5A 3MWHA 3QPMA 3J7Yk 3ZIJA 3HY2A 1HNAA 1JLWA 5AIVA 3RHBA 1MDJA 4YAPA 2XBQA 4JEDA 1Z7RA 22GSA 3VPQA 3ISOA 2VD1A 2MBTA 2WULA 4F82A 1AQXA 4IS0A 1BAYA 2GZZA 4GXZA 2C0FA 2JZSA 1OVNA 1U3IA 1AQVA 1JZWA 2REMA 4XIHA 4IBPA 5KN2A 5AISA 1FVJA 1PRXA 3QAVA 4BA7A 1J9BA 3KIJA 1OAZA 5D96A 3TUEA 2PBJA 2RM6A 4TXOA 3C7MA 3GHAA 5A4WA 3LFLA 3FR9A 3QR6A 2R5GA 3O3TA 4OFNA 2FA4A 3ZFLA 3I9V2 4XTSA 1MTCA 3TDGA 4KX4A 1X5EA 4ECJA 3EE2A 3TKSC 2RUFA 4ZL9A 10GSA 2JU5A 5IIZA 4ID0A 1WE0A 1GTUA 3FR6A 4I2UA 3FY7A 2MMZA 4GCIA 2I9HA 4N0VA 4IN0A 2B5YA 3HJOA 2E7PA 4FIWA 1OC9A 4JR4A 2PVOC 4XS4A 2WCIA 5CRGA 2HRKA 4N30A 4L8EA 1AUCA 1NHYA 3BBYA 3RDWA 5BMUA 3IPZA 2AUVA 1QQ2A 3QDNA 3JCML 2HLSA 3KP9A 4K7OA 5GSSA 1XW9A 4BL7B 4OFMA 4ECIA 5HR3A 3TKRA 1M7TA 2Z9SA 4K2DA 2EIQA 4MDCA 2JL4A 3GV1A 1TDIA 4G0IA 4QL9A 2L4QA 3P2AA 1YF0A 3VPTA 2LJKA 3IR4A 4V1Ap 2H1DA 4I2TA 4KUNA 2B7KA 1ACVA 2GDRA 4FO5A 2K8VA 1PKWA 4KCEA 1TI3A 1N8JA 1F3BA 4KAEA 4EDYA 3M0FA 2KUCA 1B4QA 4J56E 3LORA 4XCSA 2YPMA 4HU7A 4KA0A 1SJZA 3CYNA 1WMJA 2C0GA 1ZCPA 4GSNA 2F3MA 4JR6A 4EVMA 5B7CA 2YWMA 4MPGA 2CVBA 1XWKA 4PUAA 3KM6A 1OC3A 2DIZA 1AAZA 1V57A 4KCAA 1DE1A 1PMTA 4V1Ag 1LU4A 4KDYA 5CRDA 3ZL5A 1A2JA 5ELGA 3TGZA 5KN3A 1T1VA 1HNCA 1VF1A 1YY7A 3ERGA 2VLVA 3TJBA 1GTIA 2OBIA 4MP4A 2H1GA 5G30A 4RQRA 4DSSB 5ECQB 3WGDA 3D5JA 2H0HA 2P5QA 4ZBBA 3IRAA 3GSTA 5IOXA 2I4AA 3UBKA 3US3A 2V1MA 4WBJA 2QKEA 2OACA 4D73B 3R2QA 5DBQA 2GSQA 1AXDA 1I5GA 4MJAA 2XPDA 3Q6OA 1G7EA 4WKWA 4OCEA 1OKDA 5ECIB 5HFIA 4PNGA 4AF2A 2DC5A 2LNSA 2F8AA 3CRTA 2RUEA 2V6OA 2GGTA 4HOJA 4IQAA 2IWTA 3IK7A 2WFCA 4TR1A 1EZKA 2GSRA 3G7IA 4BVYA 1BJXA 3IOSA 4TR4A 2C3QA 3VWUA 5E59A 1GUMA 1GUKA 4ECBA 5J41A 1XOBA 1BQ7A 5CP1A 2YN1A 2QGVA 5G5FA 2VM2A 4XHMA 3EYTA 1EGRA 4IHUA 3ZLPA 2LSTA 4NMUA 1PA3A 1UC7A 3GL5A 5L71A 2H1BA 3TKSE 3TJKA 2WB9A 2I1UA 2DBCA 1FO5A 3UIWA 3ZREA 1M9BA 1YQ1A 2K9FA 3F4RA 2CX4A 2XPEA 3QFAC 1G0TA 3WT2A 4MK3A 4CHSA 4V2MA 5AGYA 1FW1A 3HDCA 3EINA 3RBTA 2WJUA 3GA4A 4EE0A 3QFBC 1H4OA 1K3OA 4L5LA 5EPFA 1NW2A 4YQUA 1THXA 2NTOA 5CRHA 4BWQA 3C1RA 3V1WA 3L4NA 1SKWB 2HNLA 1BX9A 3QOUA 2E0QA 3ZTLA 4F9ZA 1TTZA 4POMA 2GZYA 3NOFA 2AV4A 5LD0A 4F0CA 2A2SA 2GQLA 1SD9A 4HUAA 4AJ8A 1FVKA 3VFIA 1VGLA 4MLYA 12GSA 3F3QA 1WWJA 1XVWA 1M99A 3UOMA 2HE3A 1V40A 1GH2A 1O73A 4ML1A 4DSRA 2IPAA 1Z3EA 6GSYA 2NPBA 2XBIA 1WPIA 3FW2A 1K3LA 4DSQA 1K3YA 3EVIA 3U6VA 3KJYA 1V58A 1M2BA 2IMIA 4LLRA 2F9SA 1IYHA 1VF4A 3KZQA 2LNTA 2DJKA 3KTBA 2HSNB 3F8UA 6GSXA 4G19A 3CTGA 2IFQB 2IMFA 4G2EA 4HJ2A 1ERTA 5CAXA 3QD9A 1JZOA 5EVOA 2CQ9A 3FZ4A 1MD4A 1QXHA 1U3AA 3LJRA 3ZMLA 4NHWA 2PGTA 3RPNA 5JCGA 4TVEA 4FYCA 1G7OA 4HJMA 1GUHA 3VK9A 2FGXA 4J57E 2A4VA 3KH7A 3ZRDA 1JLVA 3UBLA 2ES7A 5HQPA 3J7Yb 1MDIA 4L0WA 2PU9C 2PVQA 5GAND 4HS1A 4K8MA 3Q18A 5JWOB 3CSIA 2NBSA 18GSA 3F4TA 4XRDA 2K8SA 2CZ2A 4GWRA 3A2WA 2C8UA 4NAXA 2NVLA 5DJLA 5KEJA 3KGKA 1DUGA 2PWJA 5IMAA 4IW9A 2HRFA 2VCXA 3ZFBA 5IQYA 4ZXGA 1S3DA 2H0GA 3O6TA 1FOVA 5DAKA 3NZNA 4ISDA 2I3YA 2C0EA 2LKUA 2JZRA 2HQTA 2YV7A 1OE8A 4ZB9A 5KN0A 1PGTA 2GSSA 3C8EA 5ECPB 3F6DA 3APOA 2DSAA 3PINA 4YQMA 1O6JA 5IPGA 2L6DA 3H4KA 2FHEA 1AIUA 2HSYA 1O8WA 1PSQA 2GVPA 2TRCP 1TRUA 2LRCA 3VWVA 5HR2A 1JZDA 2B5EA 6GSTA 5IO2A 3LGCA 5ECHB 4TR3A 4K0GA 5C04A 4G0KA 5KN1A 1EV9A 4ILFA 1YF1A 1NM3A 2GS3A 4K0NA 2CZ3A 5ELAA 2L5OA 3I43A 1ERVA 1T3BA 3HVVA 4TXOB 4MF5A 2M72A 3HZ8A 2WRTA 2HRNA 2DJJA 1USBA 5DALA 1X9WB 2R37A 4LA1A 3LG6A 3BCIA 1FG4A 2V41A 4MZBA 4PXOA 2MMNA 2PPTA 5J9BA 3TKPA 1Z9HA 4FQUA 1THOA 5F06A 3L9VA 3APQA 2HXKA 1SL0B 4XRAA 3LQ7A 1OC9B 1SENA 4WF4A 4XS4B 5G1LA 2HRKB 4GSSA 1TXXA 4K6XA 2CX3A 1EOHA 1WOUA 5IO0A 4MPFA 3F6FA 4WXTA 2OE1A 1EEMA 1FB0A 2H01A 1K0MA 4KDUA 5A4UA 2C1YA 4V2LA 3EU4A 4NHZA 2DIYA 1GRXA 4ACSA 1A0RP 2HYXA 1Z5YE 3ED3A 5AIXA 1TKDB 2GT6A 6GSWA 3L9UA 5HR1A 4JZQA 1JZRA 1K0AA 3F3RA 4PUFC 4IVFA 3VI7A 1M2DA 1DBYA 4EO3A 2C3TA 3I69A 1GSUA 1J0FA 3KH9A 1SU9A 1M2AA 2IMDA 3DD3A 5JWRB 2CA8A 4I5QA 3EURA 1A8YA 3DKSA 4MH3A 4HU9A 4IJ3A 1F37A 4WR5A 3KTLA 2TIRA 4RQXA 4G0LA 1XWAA 1FB6A 1EGOA 1SYRA 4K1FA 5HFGA 3NIVA 2B1KA 4ZIJA 2QSIA 2L4CA 3FZ5A 2O7KA 1Z6NA 2KHPA 1R26A 1ZYQB 4NWYA 5EL8A 3PPUA 2B5XA 1GTAA 1E6BA 4EKZA 4P3YB 3H8QA 2OE0A 4PNFA 2FWFA 4EL1A 5J3RA 1GNEA 4IQ1A 5FWGA 3TJGA 4MJEA 2V2GA 5JWQB 5DDLA 7GSSA 3D22A 4ML6A 3ZMKA 5D9XA 3FKFA 3GUSA 1AQWA 1WP0A 5ENUA 4KF9A 1S3AA 1KBNA 2E2GA 2DLXA 1AW9A 2BJXA 3CBUA 2JADA 1W4VA 5GSTA 1GSEA 4N0ZA 4PX1A 4WEYA 3DEXA 4IKHA 1Y6EA 1E2YA 4PGTA 2GT5A 3IC4A 3ZVJA 3CMIA 1DE2A 1SK1A 2LQOA 5IMZA 1QMVA 3VLNA 2GLRA 2KOKA 4LL1B 1UN2A 1A2MA 1XIYA 3QAGA 1X9SB 5DCHA 2HI7A 4L5OA 1GP1A 2D2ZA 3GSSA 1H75A 2IMKA 4BVXA 3UVTA 5EY6A 5H5SA 2AB6A 3DVWA 3TB2A 4AJ6A 4TR1B 4BVYB 3GL3A 2M80A 3H79A 1T4ZA 1YKAA 1JFUA 3ZIVA 3LYKA 2FA8A 1O81A 2LJAA 5F05A 1Q98A 1XWGA 4X0XA 5HR0A 3UMAA 1RW1A 5D9WA 1OC8A 3S9FA 2LTKA 2RIIA 2VLTA 2EC4A 3UJ1A 2H30A 3DMLA 5G2ZA 2WGRA 2GQKA 3ERFA 1SJ6A 2LRNA 4K7IA 3Q74A 3IDVA 1F3AA 2H19A 3GKXA 3WD6A 2YJHA 2R2JA 4FH8A 4H86A 2WDUA 6GSSA 5G31A 1GSQA 1MDKA 3GMFA 2J9HA 2FWGA 5IM9A 2H0IA 1EWXA 2C3NA 4MZWA 3HKRA 1Z7PA 3N5OA 1TRSA 2OJLA 4PQHA 1PL1A 1SL2B 4G10A 1FAAA 1CQGA 4JBBA 3TOTA 4Q5FA 1XPVA 3GRXA 4K9ZA 1SKRB 3RHCA 2V6KA 4QQ7A 4EC0A 3E3EA 13GSA 4TOPA 5F8BA 2I81A 3D0ZA 3PH9A 5ECMB 2H73A 2KP2A 20GSA 5G5EA 1GULA 4OO5A 3F4SA 1B8XA 1GLQA 1PX7A 3OR5A 3CTFA 3IAM2 3QAWA 5ECNB 2OKAA 2HZEA 2XC2A 3DWVA 5C00A 3WYWA 2H76A 4MJBA 2VCWA 3A2XA 1SKSB 4EUYA 5DQSA 4RI6A 1GSSA 2YWOA 5F07A 1QGVA 3GTUA 1XWCA 2N5AA 2MBSA 1F6MC 2B1LA 2GSTA 3WGXA 5B8BA 1A2LA 3BJ5A 5IMVA 4PURA 2VD0A 4IP6A 5CYYA 11GSA 3PGTA 4HDEA 1XOAA 4X1UA 2M46A 2XHFA 3MAKA 5GZZB 4EF0A 4OO4A 2RM5A 3IE3A 3F63A 1V98A 2LRTA 5A4VA 1ZZYA 1UA5A 4ZBAA 1YEXA 1VF3A 2CV4A 2J23A 1XVQA 3O76A 1V9WA 2IIYA 2ZNMA 4IGJA 2X8CA 4GRFA 1ZL9A 4PQ1A 3EMXA 4ZL7A 4K7NA 2MYGA 4GF0A 1TI1A 1YDKA 1XFLA 1AC1A 2HRAA 3FR3A 5DCGA 4FYUA 4I97A 1VF2A 1PX6A 3IK9A 1QFNA 3ZITA 2VO4A 2DJ3A 3IC8A 2VL2A 5IMDA 5J4UA 2NDOA 1XBSA 1EEJA 2YOIA 4ZB8A 3WT1A 5IOWA 1XZOA 4PQIA 4N11A 2VL9A 3EMPA 2P31A 2CVKA 4WBRD 4EXJA 3GNJA 4O7HA 3E9JB 3HJMA 1TRWA 3QMXA 2CVDA 5ID2A 4POBA 2H6ZA 3CSHA 3HVXA 4TKYA 4TR0A 5D93A 2VCVA 4JU5A 3W8SA 4IP1A 4HQZA 3GN3A 3KMOA 3UVHA 4HZ2A 19GSA 3FK8A 4RUVA 1URMA 1HQOA 5DAKB 4ZBDA 2HSMA 5ECRB 4TW5A 3M8NA 1X5CA 3ZYWA 1Z6MA 2EIRA 5IMCA 3GH9A 3DGQA 5ECSA 2H66A 3LXTA 1NHOA 3P90A 1U6TA 2PMTA 3D6IA 3IBHA 5IMFA 1SJIA 3TRQA 3IHQA 1O8XA 4F0BA 2YWIA 1B4PA 4OFTA 3M9KA 1F9MA 5G1KA 3P7XA 4MH2A 1PKZA 1J08A 1CQHA 3HZ4A 1K0OA 4QL7A 4N10A 3LEFA 1YJ6A 5J9CA 1TK5B 4RI7A 1A24A 4G9HA 2K18A 1OE7A 2VCTA 1TK0B 4MMMA 2IL3A 2YZHA 2WS2A 3BCKA 4Z7XA 1XCCA 3KCMA 2C80A 3UL3A 4GQFA 5DALB 2ALBA 3TRXA 17GSA 5CREA 1S3CA 1HYUA 3KEBA 1M0UA 1TU8A 3VURA 1ML6A 2H6YA 5HFKA 1R4WA 4V2NA 4IELA 4E8EA 3DRNA 1XXUA 5D9TA 3I6AA 3HJPA 3H1NA 4GLTA 2GZPA 1WIKA 4KH7A 4OWYA 2LJRA 5H5RA 3FZ9A 2FD3A 2YANA 2PN8A 4DVCA 5ECOB 2C4JA 3GX0A 1XW5A 1Y25A 4BPYA 2LV3A 4CW9A 1ON4A 1BEDA 5FHIA 1ZYEA 4ZB6A 2PUKC 3LWAA 4KDXA 4YAVA 3D4TA 2TRXA 5D73A 4MABA 4X43A 3TJJA 4WF5A 3VWWA 2LQQA 3M9JA 3GX8A 4HQSA 4LMVA 5LNKe 5DJMA 2K6VA 4BL7A 5JCWA 1R5PA 1TU7A 3SWLA 1Q4JA 4IJIA 2EIOA 1T00A 5A5KA 1T4YA 3TKSA 3LYPA 4JRRA 5B8AA 4NV5A 5B6NA 4MZCA 1VRSD 2VOCA 3VWXA 3HHVA 3HVSA 3BOAA 1I9DA 5DQYA 1GSDA 1F2EA 1K0NA 5JCUA 1GWCA 1RK4A 3D4MA 1K0BA 3GIXA 1RQMA 3C1SA 4TRXA 1SK0A 3HA9A 3TCOA 2X99A 3MSZA 2HSHA 1A8LA 3CSJA 3EWLA 2JSYA 3GKKA 2RLIA 2VLUA 4HZ4A 1YZXA 2R6KA 1HD2A 1ZMAA 3DVXA 5LCZA 2YP6A 2H70A 1TOFA 3F9UA 2VAFA 1KEBA 2VCZA 2DMLA 2HZFA 4O5RA 4WETA 2IMEA 3Q19A 2E2MA 3GFKA 2OBKA 2CAIA 1O85A 3CXGA 3WGEA 2YNXA 5D8IA 3A2VA 3K8NA 2OA7A 3KXOA 1YEPA 1X9MB 2BMXA 2P5RA 2IJYA 3DYRA 2DJ0A 1PN9A 4MA9A 3RPPA 5B6MA 1KNGA 5GAPD 3KMNA 3MDKA 3GYKA 3UEMA 3PR8A 2FY6A 4DSSA 4NPBA 2PERA 2VCQA 5J5NA 4NV2A 2H71A 2F51A 1WJKA 1T7PB 2DMMA 1W89A 2ZUPA 2ON5A 4I8BA 3VI5A 4D73A 4KB3A 2GQMA 4POKA 2MMOA 2DJ1A 1LJRA 1K0CA 2FCHA 3CRUA 2OE3A 3W6GA 3GH6A 4BVXB 1QK8A 2MZCA 1ZOFA 2OADA 4TN8A 1R7HA 4Q5NA 4USSA 3TRPA 3FRCA 2AAWA 3HXSA 4OCFA 1OYJA 4AJ7A 5AN1A 3LSZA 1JHBA 3R3EA 2N5FA 2GTUA 1GSYA 1ERUA 2H8LA 4KNDA 4POLA 2X64A 2YJ7A 3L9SA 2H6XA 3EU3A 2B7JA 2IN3A 2A2RA 3TOUA 3C73A 3C71A 1ERWA 1IYIA 1B9XC 4YH2A 2H74A 1PD21 4MF6A 3M1GA 4L0UA 1SYXA 1BG5A 2C0DA 2X8GA 4CDOA 1GL8A 2AYTA 1SD8A 1O7UA 1K0DA 3DIEA 2WZ9A 4Q5RA 4GTUA 3KP8A 2L6CA 1TK8B 3MNGA 1PQNA 4ZL8A 2DJ2A 5INYA 1NSWA 2CT6A 3FZAA 1GLPA 1G6WA 2V32A 2YWNA 5CRWA 2O89A 1XWBA 2R3XA 4F03A 1WRYA 2VL3A 4F2IA 4HEA2 1YKCA 3GURA 3F0IA 3L0HA 2VM1A 3FYGA 3APSA 4GQCA 3BD2A 2X8HA 2AHEA 6GSVA 4EDZA 4WR4A 4FYBA 2YZUA 1A0FA 2H1AA 4AGSA 1LBKA 4HI7A 1MEKA 1U87A 2JACA 2KP1A 3E0UA 2L57A 3G9BA 2BTOT 2VUPA 1M9AA 9GSSA 5ABRA 2HZEB 2B6MA 2MMAA 1X5DA 2O8VB 1GSFA 1ZGNA 1GNWA 2R4VA 3IXRA 4MCUA 1ST9A 1PL2A 2FNOA 4DEJA 2CAQA 4BWSA 1FHEA 1EP7A 2FWEA 1G6YA 1EV4A 5H5QA 1X0RA 3P8WA 4LL4B 2G0FA 3GTUB 1ABAA 2QC7A 2L5LA 1SL1B 2F8FA 2P0GA 1TW9A 2VL2C 5ECLB 2L59A 1MD3A 4KSOA 1R5AA 5COHA 4PTSA 3QCPA 2O85A 3AY8A 2HFDA 3G7YA 2N5BA 1V2AA 1KTEA 1C72A 4KE3A 2H72A 1N2AA 2B3SA 5IPHA 4YQVA 16GSA 2FLSA 6GSUA 3FHKA 5E4WA 4ECCA 1TJDA 3HCZA 1BYEA 4KW6A 5DVBA 3GKMA 1ILOA 2O87A 5FT3A 8GSSA 3TJFA 1GTBA 5CO3A 4KSMA 3L78A 2IFQA 2LUSA 1A23A 2LEGA 3UAPA 1U88A 2YV9A 3IA1A 4OD7A 1B48A 1EP8A 4E8HA 1SK2A 4NXIA 2ZCTA 4KGIA 5D9VA 4XS6A 2LS5A 3N9JA 3FEUA 1B9YC 2KLXA 2YCDA 3LXZA 4XS1A 4JE1A 2FUG2 2FWHA 3EC3A 3GKNA 2JSZA 2VIMA 2G2QA 4Q5QA 1DSBA 1QUWA 3G7JA 2HT9A 2H75A 5ID2B 1TRVA 4O32A 4MF7A 3A3TA 4J2FA 3A5WA 5ECKB 4MJCA 3U5RE 2HSMB 3ZVJD 2ON7A 1TP9A 14GSA 2UZ8A 3IAS2 3HYPA 1XW6A 1OKTA 3H93A 4TXVA 2AJQB 5F0GA 3SBCA 3TKQA 1EOGA 2JZTA 3DXBA 4I6XA 3UARA 4OMVA 3M3MA 1T8EB 4LMWA 4GSTA 3ME8A 4ULXA 3ME7A 4O92A 3ERWA 1HNBA 3W8JA 3ZZXA 3IV4A
chains in the Genus database with same CATH superfamily
5CNWA 1UVZA 3RAZA 1SVOA 4ZILA 3KD0A 3D21A 3HD5A 3MWHA 3QPMA 3J7Yk 3ZIJA 4FXYP 3HY2A 1HNAA 1JLWA 5AIVA 3RHBA 1MDJA 4YAPA 2XBQA 4JEDA 1Z7RA 22GSA 3VPQA 3ISOA 2VD1A 2MBTA 2WULA 4F82A 1AQXA 4IS0A 1BAYA 2GZZA 4GXZA 2C0FA 2JZSA 1OVNA 1U3IA 1AQVA 1JZWA 2REMA 4XIHA 4IBPA 5KN2A 5AISA 1FVJA 1PRXA 3QAVA 4BA7A 1J9BA 3KIJA 1OAZA 5D96A 3TUEA 2PBJA 4YKFA 2RM6A 4TXOA 3C7MA 3GHAA 5A4WA 3LFLA 3FR9A 3QR6A 2R5GA 3O3TA 4OFNA 2R0GA 2FA4A 3ZFLA 3I9V2 4XTSA 1MTCA 3TDGA 4KX4A 1X5EA 4ECJA 3EE2A 3TKSC 2RUFA 4ZL9A 10GSA 2JU5A 5IIZA 4ID0A 1WE0A 1GTUA 3FR6A 1YEWC 4I2UA 3FY7A 2MMZA 4GCIA 2I9HA 4N0VA 4IN0A 2B5YA 3HJOA 2E7PA 4FIWA 1OC9A 4JR4A 2PVOC 4XS4A 2WCIA 5CRGA 2HRKA 4N30A 4L8EA 1AUCA 1NHYA 3BBYA 3RDWA 5BMUA 3IPZA 2AUVA 1QQ2A 3QDNA 3JCML 2HLSA 3KP9A 4K7OA 5GSSA 1XW9A 4BL7B 4OFMA 4ECIA 5HR3A 3TKRA 1M7TA 2Z9SA 4K2DA 2EIQA 4MDCA 2JL4A 3GV1A 1TDIA 4G0IA 4QL9A 2L4QA 1YVLA 3P2AA 1YF0A 3VPTA 4PHZC 2LJKA 3IR4A 4V1Ap 2H1DA 4I2TA 4KUNA 2B7KA 4AKGA 1ACVA 2GDRA 4FO5A 2K8VA 1PKWA 4KCEA 1TI3A 1N8JA 1F3BA 4KAEA 4EDYA 3M0FA 2KUCA 1B4QA 4J56E 3LORA 4XCSA 2YPMA 4HU7A 4KA0A 1SJZA 4X4JA 3CYNA 1WMJA 2C0GA 1ZCPA 4GSNA 2F3MA 4JR6A 5A1NB 5B7CA 4EVMA 2YWMA 4MPGA 2CVBA 2WW0A 1XWKA 4PUAA 3KM6A 1I1IP 1OC3A 2DIZA 1AAZA 1V57A 4KCAA 1DE1A 1PMTA 4V1Ag 1LU4A 4KDYA 5CRDA 3ZL5A 1A2JA 5ELGA 2A4HA 3TGZA 5KN3A 1T1VA 1HNCA 1VF1A 1YY7A 3ERGA 2VLVA 3TJBA 1GTIA 2OBIA 4MP4A 2H1GA 5G30A 4RQRA 4DSSB 5ECQB 3WGDA 3D5JA 2H0HA 2P5QA 1ZYNA 4ZBBA 3IRAA 3GSTA 5IOXA 2I4AA 3UBKA 3US3A 4ICYA 2V1MA 4WBJA 2QKEA 2OACA 2WZSA 4D73B 3R2QA 5DBQA 2GSQA 1AXDA 1I5GA 3MIXA 4MJAA 2XPDA 3Q6OA 1G7EA 4WKWA 4OCEA 1OKDA 5ECIB 5HFIA 4PNGA 4AF2A 2DC5A 2LNSA 2F8AA 3CRTA 2RUEA 2V6OA 2GGTA 4HOJA 4IQAA 2IWTA 3IK7A 2WFCA 4TR1A 1EZKA 2GSRA 3G7IA 4BVYA 1BJXA 3IOSA 4TR4A 2C3QA 3VWUA 1SVLA 5E59A 1GUMA 1GUKA 4ECBA 5J41A 1XOBA 1BQ7A 5CP1A 2YN1A 1FOHA 2QGVA 5G5FA 2VM2A 2X49A 4XHMA 3EYTA 2O36A 1EGRA 4IHUA 3ZLPA 2LSTA 4NMUA 1PA3A 1UC7A 3GL5A 5L71A 2H1BA 3TKSE 3TJKA 5A34B 2EFEA 2WB9A 2I1UA 2DBCA 1FO5A 1M3JA 3UIWA 3ZREA 1M9BA 1YQ1A 2K9FA 3F4RA 2CX4A 2XPEA 3QFAC 1G0TA 3WT2A 4MK3A 4CHSA 4V2MA 5AGYA 1FW1A 3HDCA 3EINA 3RBTA 2WJUA 3GA4A 4EE0A 3QFBC 1H4OA 1K3OA 4L5LA 5EPFA 1NW2A 4YQUA 1THXA 2NTOA 5CRHA 5J40A 4BWQA 3C1RA 3V1WA 3L4NA 1SKWB 2HNLA 4AKIA 1BX9A 3QOUA 2E0QA 3ZTLA 4F9ZA 1TTZA 4POMA 2GZYA 3NOFA 2AV4A 5LD0A 4F0CA 2A2SA 2GQLA 2EFHA 1SD9A 4HUAA 4AJ8A 1FVKA 3VFIA 1VGLA 4MLYA 12GSA 3F3QA 1WWJA 1XVWA 1M99A 3UOMA 2HE3A 1V40A 1GH2A 1O73A 4ML1A 4DSRA 2IPAA 1Z3EA 6GSYA 2NPBA 2XBIA 3FW2A 1WPIA 1K3LA 2UV8G 4DSQA 1K3YA 3EVIA 3U6VA 3KJYA 5KOWA 2WW3A 1V58A 1M2BA 2IMIA 4LLRA 2F9SA 1IYHA 1VF4A 3KZQA 2LNTA 2DJKA 3KTBA 2HSNB 3F8UA 6GSXA 4G19A 3CTGA 2IFQB 2IMFA 4G2EA 4HJ2A 1ERTA 5CAXA 3QD9A 1JZOA 3CWGA 5EVOA 2CQ9A 3FZ4A 1MD4A 1QXHA 1U3AA 3LJRA 3ZMLA 4NHWA 2PGTA 3RPNA 4Z2RA 5JCGA 4TVEA 2EFCA 4FYCA 1G7OA 4HJMA 1GUHA 2WVYA 3VK9A 2FGXA 4J57E 2A4VA 3KH7A 3ZRDA 1JLVA 3UBLA 2ES7A 5HQPA 3J7Yb 1MDIA 4L0WA 2PU9C 2PVQA 5GAND 4HS1A 4K8MA 3Q18A 5JWOB 3CSIA 2NBSA 18GSA 3F4TA 4XRDA 2K8SA 2CZ2A 4GWRA 3A2WA 2C8UA 4NAXA 2NVLA 5DJLA 5KEJA 3KGKA 1DUGA 3FMWA 2O5VA 2PWJA 5IMAA 4IW9A 2HRFA 2VCXA 3ZFBA 5IQYA 4ZXGA 1S3DA 2H0GA 3O6TA 1FOVA 5DAKA 3NZNA 1ZYPA 4ISDA 2I3YA 2C0EA 2LKUA 2JZRA 2HQTA 2YV7A 1OE8A 4ZB9A 5KN0A 1PGTA 2GSSA 3C8EA 5ECPB 3F6DA 3APOA 2DSAA 3PINA 4YQMA 3HVNA 1O6JA 5IPGA 2L6DA 3H4KA 2FHEA 1AIUA 2HSYA 1O8WA 1PSQA 2GVPA 2TRCP 1TRUA 2LRCA 3VWVA 5HR2A 1JZDA 2B5EA 6GSTA 2WVXB 5IO2A 3LGCA 5ECHB 1Y1UA 4TR3A 4K0GA 5C04A 4G0KA 1PFOA 5KN1A 1EV9A 4ILFA 1YF1A 1NM3A 2GS3A 4K0NA 4AKXB 2CZ3A 5ELAA 2L5OA 3I43A 1ERVA 1T3BA 3HVVA 4TXOB 4MF5A 2M72A 3HZ8A 2WRTA 2HRNA 2DJJA 1USBA 5DALA 1X9WB 2R37A 4LA1A 3LG6A 3BCIA 1FG4A 2V41A 4MZBA 4PXOA 2MMNA 2PPTA 5J9BA 3TKPA 1Z9HA 4FQUA 1THOA 4Z2TA 5F06A 3L9VA 3APQA 2HXKA 1SL0B 4XRAA 2H1LA 3LQ7A 1OC9B 1SENA 4WF4A 4XS4B 5G1LA 2HRKB 4GSSA 1TXXA 4K6XA 2CX3A 1EOHA 1WOUA 5IO0A 5BMUB 4MPFA 3F6FA 4WXTA 2OE1A 4AKHA 1EEMA 1FB0A 2H01A 1K0MA 4KDUA 5A4UA 2C1YA 4V2LA 4CY6A 2O3EA 3EU4A 4NHZA 2DIYA 1GRXA 4ACSA 1A0RP 2HYXA 1Z5YE 3ED3A 5AIXA 1TKDB 2GT6A 6GSWA 3L9UA 5HR1A 4JZQA 1JZRA 2R0PA 1K0AA 3F3RA 4PUFC 4IVFA 3VI7A 1M2DA 1DBYA 4EO3A 2C3TA 3I69A 1GSUA 1J0FA 3KH9A 1SU9A 1N25A 1M2AA 2IMDA 3DD3A 5JWRB 2CA8A 4I5QA 4CY8A 3EURA 1A8YA 3DKSA 4MH3A 4EIPA 4HU9A 4IJ3A 1F37A 4WR5A 3KTLA 2TIRA 3CQFA 4RQXA 4G0LA 1XWAA 1FB6A 1EGOA 1SYRA 4K1FA 5HFGA 3NIVA 2B1KA 4ZIJA 2DKIA 2QSIA 2L4CA 3FZ5A 2O7KA 1Z6NA 2VKZG 2KHPA 1R26A 1ZYQB 4NWYA 5EL8A 3PPUA 2B5XA 1GTAA 1E6BA 4EKZA 4P3YB 3H8QA 2OE0A 4PNFA 2FWFA 4EL1A 5J3RA 1GNEA 4IQ1A 5FWGA 3TJGA 4MJEA 2V2GA 5JWQB 5DDLA 7GSSA 3D22A 4ML6A 3ZMKA 5D9XA 3FKFA 3GUSA 1AQWA 1WP0A 5ENUA 4KF9A 1S3AA 1KBNA 2E2GA 2DLXA 1AW9A 2BJXA 3CBUA 2JADA 1W4VA 5GSTA 1GSEA 4N0ZA 4PX1A 4WEYA 3DEXA 4IKHA 1Y6EA 1E2YA 5A5HA 4PGTA 2GT5A 3IC4A 3ZVJA 3CMIA 1DE2A 1SK1A 2LQOA 5IMZA 1QMVA 3VLNA 2GLRA 2KOKA 4LL1B 1UN2A 1A2MA 1XIYA 3QAGA 1X9SB 5DCHA 2HI7A 4L5OA 5J4YA 1GP1A 2D2ZA 4W66A 3GSSA 1H75A 2IMKA 4BVXA 3UVTA 5EY6A 5H5SA 2AB6A 3DVWA 3TB2A 4AJ6A 4TR1B 4BVYB 3GL3A 2M80A 3H79A 1T4ZA 1YKAA 1JFUA 3ZIVA 3LYKA 2FA8A 1O81A 2LJAA 5F05A 1Q98A 1XWGA 4X0XA 5HR0A 3UMAA 1RW1A 5D9WA 1OC8A 3S9FA 2LTKA 2RIIA 2VLTA 2EC4A 3UJ1A 2H30A 3DMLA 5G2ZA 2WGRA 2GQKA 5KOXA 3ERFA 1SJ6A 2LRNA 4K7IA 3Q74A 3IDVA 1F3AA 2H19A 3GKXA 3WD6A 2YJHA 2R2JA 4FH8A 4H86A 2WDUA 6GSSA 5G31A 1GSQA 1MDKA 3GMFA 2J9HA 2FWGA 4O5QA 5IM9A 2WW1A 2H0IA 1EWXA 2C3NA 4MZWA 3HKRA 1Z7PA 2WVZA 3N5OA 1TRSA 2OJLA 4PQHA 1PL1A 1SL2B 4G10A 1FAAA 1CQGA 4JBBA 3TOTA 4Q5FA 1XPVA 3GRXA 4K9ZA 1SKRB 3RHCA 2V6KA 4QQ7A 4EC0A 3E3EA 13GSA 4N3ZA 4TOPA 5F8BA 2I81A 3D0ZA 3PH9A 5ECMB 2H73A 2KP2A 20GSA 1TXUA 5G5EA 1GULA 2QA1A 4OO5A 3F4SA 1B8XA 1GLQA 1PX7A 3OR5A 3CTFA 3IAM2 3QAWA 5ECNB 2OKAA 2HZEA 2XC2A 3DWVA 5C00A 3WYWA 2H76A 4MJBA 2VCWA 3A2XA 1SKSB 4EUYA 5DQSA 4RI6A 1GSSA 2YWOA 5F07A 1QGVA 3GTUA 1XWCA 2N5AA 2MBSA 1F6MC 2B1LA 2GSTA 3WGXA 5B8BA 1A2LA 3BJ5A 5IMVA 4PURA 2VD0A 4IP6A 5CYYA 11GSA 3PGTA 4HDEA 1XOAA 4X1UA 2M46A 2XHFA 3MAKA 5GZZB 4EF0A 4OO4A 4E68A 2RM5A 3IE3A 3F63A 1V98A 2LRTA 5A4VA 1ZZYA 1UA5A 4ZBAA 1YEXA 1VF3A 2CV4A 2J23A 1XVQA 3O76A 1V9WA 2IIYA 2ZNMA 4IGJA 2X8CA 4GRFA 1ZL9A 4PQ1A 3EMXA 4ZL7A 4K7NA 2MYGA 4GF0A 1TI1A 1YDKA 1XFLA 1AC1A 2HRAA 3FR3A 5DCGA 4FYUA 4I97A 1VF2A 3RFRC 1PX6A 3IK9A 1QFNA 3ZITA 2VO4A 2DJ3A 3IC8A 2VL2A 5IMDA 1S3RA 5J4UA 2NDOA 1XBSA 1EEJA 2YOIA 4ZB8A 3WT1A 5IOWA 1XZOA 4PQIA 4N11A 2VL9A 3EMPA 2P31A 2CVKA 4WBRD 4EXJA 3GNJA 4O7HA 3E9JB 3HJMA 1TRWA 3QMXA 2CVDA 5ID2A 4POBA 2H6ZA 3CSHA 3HVXA 4TKYA 4TR0A 5D93A 4BIKA 4MNNA 2VCVA 4JU5A 3W8SA 4IP1A 4HQZA 3GN3A 3KMOA 3UVHA 4HZ2A 19GSA 3FK8A 4RUVA 1URMA 1HQOA 5DAKB 4ZBDA 2HSMA 5ECRB 4TW5A 3M8NA 1X5CA 3ZYWA 1Z6MA 3IHGA 2EIRA 5IMCA 3GH9A 3DGQA 5ECSA 2H66A 3LXTA 1NHOA 3P90A 1U6TA 2PMTA 3D6IA 3IBHA 5IMFA 1SJIA 3TRQA 4K5RA 3IHQA 3TU3B 1O8XA 4F0BA 2YWIA 1B4PA 4OFTA 3M9KA 1F9MA 5G1KA 3P7XA 4MH2A 1PKZA 1J08A 1CQHA 3HZ4A 1K0OA 4QL7A 4N10A 3LEFA 1YJ6A 5J9CA 1TK5B 4RI7A 1A24A 4G9HA 2WVXA 2K18A 1OE7A 5J47A 2VCTA 1TK0B 4MMMA 2IL3A 2YZHA 2WS2A 3BCKA 4Z2UA 4Z7XA 1XCCA 3KCMA 2C80A 3UL3A 3A5IA 4GQFA 5DALB 4GDFA 2ALBA 3TRXA 17GSA 5CREA 1S3CA 1HYUA 3KEBA 1M0UA 1TU8A 3VURA 1ML6A 2H6YA 5HFKA 1R4WA 4V2NA 4IELA 4E8EA 3DRNA 1XXUA 5D9TA 3I6AA 3HJPA 3H1NA 4GLTA 2GZPA 1WIKA 4KH7A 4OWYA 2LJRA 5H5RA 3FZ9A 2FD3A 2YANA 2PN8A 4DVCA 5ECOB 2C4JA 3GX0A 1XW5A 1Y25A 4BPYA 2LV3A 2X4AA 4CW9A 1ON4A 1BEDA 1SVMA 5FHIA 1ZYEA 4ZB6A 2PUKC 3LWAA 1BG1A 4KDXA 4YAVA 3D4TA 2TRXA 5D73A 4MABA 4X43A 3TJJA 4WF5A 3VWWA 2LQQA 3M9JA 3GX8A 4HQSA 3HMJG 4LMVA 5LNKe 5DJMA 4PI0C 2K6VA 4BL7A 5JCWA 1R5PA 1TU7A 3SWLA 3LW9A 1Q4JA 4IJIA 2EIOA 1T00A 5A5KA 1T4YA 3TKSA 3LYPA 4JRRA 5B8AA 4NV5A 5B6NA 4MZCA 1VRSD 2VOCA 3VWXA 3HHVA 3HVSA 3BOAA 1I9DA 5DQYA 1GSDA 1F2EA 1K0NA 5JCUA 1GWCA 1RK4A 3D4MA 1K0BA 3GIXA 1RQMA 3C1SA 4TRXA 1SK0A 3HA9A 3TCOA 2X99A 3MSZA 2HSHA 1A8LA 3CSJA 3EWLA 4A5PA 4PI2C 2JSYA 3GKKA 2RLIA 2VLUA 4HZ4A 1YZXA 2R6KA 1HD2A 1ZMAA 3DVXA 4K5SA 5LCZA 2YP6A 5A1NA 2H70A 1TOFA 3F9UA 2VAFA 1KEBA 2VCZA 2DMLA 2HZFA 4O5RA 4WETA 2IMEA 3Q19A 5J4VA 2E2MA 3GFKA 2OBKA 2CAIA 1O85A 3CXGA 3WGEA 2YNXA 5D8IA 3A2VA 3K8NA 2OA7A 3KXOA 1YEPA 1X9MB 4EIQA 2BMXA 2P5RA 2IJYA 3DYRA 2DJ0A 5A5HB 1PN9A 4MA9A 3RPPA 5B6MA 1KNGA 5GAPD 3KMNA 3MDKA 3GYKA 3UEMA 3PR8A 2FY6A 4DSSA 4NPBA 2PERA 2VCQA 5J5NA 4NV2A 2H71A 2F51A 1WJKA 1T7PB 2A2PA 2DMMA 1W89A 2ZUPA 2ON5A 4I8BA 3VI5A 4D73A 4KB3A 2GQMA 4POKA 2MMOA 2DJ1A 1LJRA 2R0CA 4YKGA 1K0CA 2FCHA 3CRUA 2OE3A 3W6GA 3GH6A 4BVXB 1QK8A 2MZCA 1ZOFA 2OADA 4TN8A 1R7HA 4Q5NA 4USSA 3TRPA 3FRCA 2AAWA 3HXSA 4OCFA 1OYJA 4AJ7A 5AN1A 3LSZA 1JHBA 4QMKA 3R3EA 2N5FA 2GTUA 1GSYA 1ERUA 2H8LA 4KNDA 4POLA 2X64A 2YJ7A 3L9SA 2H6XA 3EU3A 2B7JA 2IN3A 2A2RA 3TOUA 3C73A 4K2XA 3C71A 1ERWA 1IYIA 1B9XC 4YH2A 2H74A 1PD21 4MF6A 2WW2A 3M1GA 4L0UA 1SYXA 1BG5A 2C0DA 2X8GA 4CDOA 1GL8A 2AYTA 1SD8A 1O7UA 1BF5A 1K0DA 3DIEA 2WZ9A 4Q5RA 4GTUA 3KP8A 2L6CA 5A34A 1TK8B 3MNGA 1PQNA 4ZL8A 2DJ2A 5INYA 1NSWA 2CT6A 3FZAA 1GLPA 1G6WA 2V32A 2YWNA 5CRWA 2O89A 1XWBA 2R3XA 4F03A 1WRYA 2VL3A 4F2IA 4HEA2 1YKCA 3GURA 3F0IA 3L0HA 2VM1A 3FYGA 3APSA 4GQCA 3BD2A 2X8HA 2AHEA 6GSVA 4EDZA 4WR4A 4FYBA 2YZUA 1A0FA 2H1AA 4AGSA 1LBKA 4HI7A 1MEKA 1U87A 2JACA 2KP1A 3E0UA 2L57A 3RGBC 3G9BA 2BTOT 2VUPA 1M9AA 9GSSA 5ABRA 2HZEB 2B6MA 2MMAA 1X5DA 2O8VB 1GSFA 1ZGNA 1GNWA 2R4VA 3IXRA 4MCUA 1ST9A 1PL2A 2FNOA 4DEJA 2CAQA 4BWSA 1FHEA 1EP7A 2FWEA 1G6YA 1EV4A 5H5QA 1X0RA 3P8WA 4LL4B 2G0FA 3GTUB 1ABAA 2QC7A 4O5UA 2L5LA 1SL1B 2F8FA 2P0GA 1TW9A 2VL2C 5ECLB 2L59A 1MD3A 4KSOA 1R5AA 5COHA 4PTSA 3QCPA 2O85A 3AY8A 2HFDA 3G7YA 2N5BA 1V2AA 1PN0A 1KTEA 1C72A 4KE3A 2H72A 1N2AA 2B3SA 5IPHA 4YQVA 16GSA 2FLSA 6GSUA 3FHKA 5E4WA 4ECCA 1TJDA 3HCZA 2QA2A 1BYEA 3EPTA 4KW6A 5DVBA 3MYDA 3GKMA 1ILOA 2O87A 5FT3A 8GSSA 3TJFA 1GTBA 2HSNA 5CO3A 4KSMA 3L78A 2DKHA 2IFQA 2LUSA 3CHXC 1A23A 2LEGA 3UAPA 1U88A 2YV9A 3IA1A 4OD7A 1B48A 1EP8A 4E8HA 1SK2A 4NXIA 2ZCTA 4KGIA 5D9VA 4XS6A 2LS5A 3N9JA 3FEUA 1B9YC 2KLXA 1XG8A 2YCDA 3LXZA 4XS1A 4JE1A 2FUG2 2FWHA 3EC3A 3GKNA 2JSZA 2VIMA 2G2QA 4Q5QA 1DSBA 1QUWA 3G7JA 2HT9A 2H75A 5ID2B 1TRVA 4O32A 4MF7A 2EFDA 3A3TA 4J2FA 1S4BP 3A5WA 2OT3A 5ECKB 4MJCA 3U5RE 2HSMB 3ZVJD 2ON7A 1TP9A 14GSA 2UZ8A 3IAS2 3HYPA 1XW6A 1OKTA 3H93A 4TXVA 2AJQB 5F0GA 3SBCA 3TKQA 1EOGA 2JZTA 3DXBA 4G01A 4ZB7A 4I6XA 4HSCX 5BRTA 3UARA 4OMVA 3M3MA 1T8EB 4LMWA 4GSTA 3ME8A 1M3IA 4ULXA 3ME7A 4O92A 3ERWA 1HNBA 3W8JA 3ZZXA 3IV4A 4AI6A
chains in the Genus database with same CATH topology
5CNWA 1UVZA 3RAZA 1SVOA 4ZILA 3KD0A 3D21A 3HD5A 3MWHA 3QPMA 3J7Yk 3ZIJA 3HY2A 1HNAA 1JLWA 5AIVA 3RHBA 1MDJA 4YAPA 2XBQA 4JEDA 1Z7RA 22GSA 3VPQA 3ISOA 2VD1A 2MBTA 2WULA 4F82A 1AQXA 4IS0A 1BAYA 2GZZA 4GXZA 2C0FA 2JZSA 1OVNA 1U3IA 1AQVA 1JZWA 2REMA 4XIHA 4IBPA 5KN2A 5AISA 1FVJA 1PRXA 3QAVA 4BA7A 1J9BA 3KIJA 1OAZA 5D96A 3TUEA 2PBJA 4YKFA 2RM6A 4TXOA 3C7MA 3GHAA 5A4WA 3LFLA 3FR9A 3QR6A 2R5GA 3O3TA 4OFNA 2R0GA 2FA4A 3ZFLA 3I9V2 4XTSA 1MTCA 3TDGA 4KX4A 1X5EA 4ECJA 3EE2A 3TKSC 2RUFA 4ZL9A 10GSA 2JU5A 5IIZA 4ID0A 1WE0A 1GTUA 3FR6A 4I2UA 3FY7A 2MMZA 4GCIA 2I9HA 4N0VA 4IN0A 2B5YA 3HJOA 2E7PA 4FIWA 1OC9A 4JR4A 2PVOC 4XS4A 2WCIA 5CRGA 2HRKA 4N30A 4L8EA 1AUCA 1NHYA 3BBYA 3RDWA 5BMUA 3IPZA 2AUVA 1QQ2A 3QDNA 3JCML 2HLSA 3KP9A 4K7OA 5GSSA 1XW9A 4BL7B 4OFMA 4ECIA 5HR3A 3TKRA 1M7TA 2Z9SA 4K2DA 2EIQA 4MDCA 2JL4A 3GV1A 1TDIA 4G0IA 4QL9A 2L4QA 1YVLA 3P2AA 1YF0A 3VPTA 2LJKA 3IR4A 4V1Ap 2H1DA 4I2TA 4KUNA 2B7KA 4AKGA 1ACVA 2GDRA 4FO5A 2K8VA 1PKWA 4KCEA 1TI3A 1N8JA 1F3BA 4KAEA 4EDYA 3M0FA 2KUCA 1B4QA 4J56E 3LORA 4XCSA 2YPMA 4HU7A 4KA0A 1SJZA 4X4JA 3CYNA 1WMJA 2C0GA 1ZCPA 4GSNA 2F3MA 4JR6A 5A1NB 5B7CA 4EVMA 2YWMA 4MPGA 2CVBA 1XWKA 4PUAA 3KM6A 1OC3A 2DIZA 1AAZA 1V57A 4KCAA 1DE1A 1PMTA 4V1Ag 1LU4A 4KDYA 5CRDA 3ZL5A 1A2JA 5ELGA 2A4HA 3TGZA 5KN3A 1T1VA 1HNCA 1VF1A 1YY7A 3ERGA 2VLVA 3TJBA 1GTIA 2OBIA 4MP4A 2H1GA 5G30A 4RQRA 4DSSB 5ECQB 3WGDA 3D5JA 2H0HA 2P5QA 1ZYNA 4ZBBA 3IRAA 3GSTA 5IOXA 2I4AA 3UBKA 3US3A 4ICYA 2V1MA 4WBJA 2QKEA 2OACA 4D73B 3R2QA 5DBQA 2GSQA 1AXDA 1I5GA 3MIXA 4MJAA 2XPDA 3Q6OA 1G7EA 4WKWA 4OCEA 1OKDA 5ECIB 5HFIA 4PNGA 4AF2A 2DC5A 2LNSA 2F8AA 3CRTA 2RUEA 2V6OA 2GGTA 4HOJA 4IQAA 2IWTA 3IK7A 2WFCA 4TR1A 1EZKA 2GSRA 3G7IA 4BVYA 1BJXA 3IOSA 4TR4A 2C3QA 3VWUA 1SVLA 5E59A 1GUMA 1GUKA 4ECBA 5J41A 1XOBA 1BQ7A 5CP1A 2YN1A 1FOHA 2QGVA 5G5FA 2VM2A 2X49A 4XHMA 3EYTA 1EGRA 4IHUA 3ZLPA 2LSTA 4NMUA 1PA3A 1UC7A 3GL5A 5L71A 2H1BA 3TKSE 3TJKA 5A34B 2EFEA 2WB9A 2I1UA 2DBCA 1FO5A 3UIWA 3ZREA 1M9BA 1YQ1A 2K9FA 3F4RA 2CX4A 2XPEA 3QFAC 1G0TA 3WT2A 4MK3A 4CHSA 4V2MA 5AGYA 1FW1A 3HDCA 3EINA 3RBTA 2WJUA 3GA4A 4EE0A 3QFBC 1H4OA 1K3OA 4L5LA 5EPFA 1NW2A 4YQUA 1THXA 2NTOA 5CRHA 5J40A 4BWQA 3C1RA 3V1WA 3L4NA 1SKWB 2HNLA 4AKIA 1BX9A 3QOUA 2E0QA 3ZTLA 4F9ZA 1TTZA 4POMA 2GZYA 3NOFA 2AV4A 5LD0A 4F0CA 2A2SA 2GQLA 2EFHA 1SD9A 4HUAA 4AJ8A 1FVKA 3VFIA 1VGLA 4MLYA 12GSA 3F3QA 1WWJA 1XVWA 1M99A 3UOMA 2HE3A 1V40A 1GH2A 1O73A 4ML1A 4DSRA 2IPAA 1Z3EA 6GSYA 2NPBA 2XBIA 3FW2A 1WPIA 1K3LA 2UV8G 4DSQA 1K3YA 3EVIA 3U6VA 3KJYA 5KOWA 1V58A 1M2BA 2IMIA 4LLRA 2F9SA 1IYHA 1VF4A 3KZQA 2LNTA 2DJKA 3KTBA 2HSNB 3F8UA 6GSXA 4G19A 3CTGA 2IFQB 2IMFA 4G2EA 4HJ2A 1ERTA 5CAXA 3QD9A 1JZOA 3CWGA 5EVOA 2CQ9A 3FZ4A 1MD4A 1QXHA 1U3AA 3LJRA 3ZMLA 4NHWA 2PGTA 3RPNA 4Z2RA 5JCGA 4TVEA 2EFCA 4FYCA 1G7OA 4HJMA 1GUHA 3VK9A 2FGXA 4J57E 2A4VA 3KH7A 3ZRDA 1JLVA 3UBLA 2ES7A 5HQPA 3J7Yb 1MDIA 4L0WA 2PU9C 2PVQA 5GAND 4HS1A 4K8MA 3Q18A 5JWOB 3CSIA 2NBSA 18GSA 3F4TA 4XRDA 2K8SA 2CZ2A 4GWRA 3A2WA 2C8UA 4NAXA 2NVLA 5DJLA 5KEJA 3KGKA 1DUGA 3FMWA 2O5VA 2PWJA 5IMAA 4IW9A 2HRFA 2VCXA 3ZFBA 5IQYA 4ZXGA 1S3DA 2H0GA 3O6TA 1FOVA 5DAKA 3NZNA 1ZYPA 4ISDA 2I3YA 2C0EA 2LKUA 2JZRA 2HQTA 2YV7A 1OE8A 4ZB9A 5KN0A 1PGTA 2GSSA 3C8EA 5ECPB 3F6DA 3APOA 2DSAA 3PINA 4YQMA 1O6JA 5IPGA 2L6DA 3H4KA 2FHEA 1AIUA 2HSYA 1O8WA 1PSQA 2GVPA 2TRCP 1TRUA 2LRCA 3VWVA 5HR2A 1JZDA 2B5EA 6GSTA 5IO2A 3LGCA 5ECHB 1Y1UA 4TR3A 4K0GA 5C04A 4G0KA 5KN1A 1EV9A 4ILFA 1YF1A 1NM3A 2GS3A 4K0NA 4AKXB 2CZ3A 5ELAA 2L5OA 3I43A 1ERVA 1T3BA 3HVVA 4TXOB 4MF5A 2M72A 3HZ8A 2WRTA 2HRNA 2DJJA 1USBA 5DALA 1X9WB 2R37A 4LA1A 3LG6A 3BCIA 1FG4A 2V41A 4MZBA 4PXOA 2MMNA 2PPTA 5J9BA 3TKPA 1Z9HA 4FQUA 1THOA 4Z2TA 5F06A 3L9VA 3APQA 2HXKA 1SL0B 4XRAA 2H1LA 3LQ7A 1OC9B 1SENA 4WF4A 4XS4B 5G1LA 2HRKB 4GSSA 1TXXA 4K6XA 2CX3A 1EOHA 1WOUA 5IO0A 5BMUB 4MPFA 3F6FA 4WXTA 2OE1A 4AKHA 1EEMA 1FB0A 2H01A 1K0MA 4KDUA 5A4UA 2C1YA 4V2LA 4CY6A 3EU4A 4NHZA 2DIYA 1GRXA 4ACSA 1A0RP 2HYXA 1Z5YE 3ED3A 5AIXA 1TKDB 2GT6A 6GSWA 3L9UA 5HR1A 4JZQA 1JZRA 2R0PA 1K0AA 3F3RA 4PUFC 4IVFA 3VI7A 1M2DA 1DBYA 4EO3A 2C3TA 3I69A 1GSUA 1J0FA 3KH9A 1SU9A 1N25A 1M2AA 2IMDA 3DD3A 5JWRB 2CA8A 4I5QA 4CY8A 3EURA 1A8YA 3DKSA 4MH3A 4EIPA 4HU9A 4IJ3A 1F37A 4WR5A 3KTLA 2TIRA 4RQXA 4G0LA 1XWAA 1FB6A 1EGOA 1SYRA 4K1FA 5HFGA 3NIVA 2B1KA 4ZIJA 2DKIA 2QSIA 2L4CA 3FZ5A 2O7KA 1Z6NA 2VKZG 2KHPA 1R26A 1ZYQB 4NWYA 5EL8A 3PPUA 2B5XA 1GTAA 1E6BA 4EKZA 4P3YB 3H8QA 2OE0A 4PNFA 2FWFA 4EL1A 5J3RA 1GNEA 4IQ1A 5FWGA 3TJGA 4MJEA 2V2GA 5JWQB 5DDLA 7GSSA 3D22A 4ML6A 3ZMKA 5D9XA 3FKFA 3GUSA 1AQWA 1WP0A 5ENUA 4KF9A 1S3AA 1KBNA 2E2GA 2DLXA 1AW9A 2BJXA 3CBUA 2JADA 1W4VA 5GSTA 1GSEA 4N0ZA 4PX1A 4WEYA 3DEXA 4IKHA 1Y6EA 1E2YA 5A5HA 4PGTA 2GT5A 3IC4A 3ZVJA 3CMIA 1DE2A 1SK1A 2LQOA 5IMZA 1QMVA 3VLNA 2GLRA 2KOKA 4LL1B 1UN2A 1A2MA 1XIYA 3QAGA 1X9SB 5DCHA 2HI7A 4L5OA 5J4YA 1GP1A 2D2ZA 4W66A 3GSSA 1H75A 2IMKA 4BVXA 3UVTA 5EY6A 5H5SA 2AB6A 3DVWA 3TB2A 4AJ6A 4TR1B 4BVYB 3GL3A 2M80A 3H79A 1T4ZA 1YKAA 1JFUA 3ZIVA 3LYKA 2FA8A 1O81A 2LJAA 5F05A 1Q98A 1XWGA 4X0XA 5HR0A 3UMAA 1RW1A 5D9WA 1OC8A 3S9FA 2LTKA 2RIIA 2VLTA 2EC4A 3UJ1A 2H30A 3DMLA 5G2ZA 2WGRA 2GQKA 5KOXA 3ERFA 1SJ6A 2LRNA 4K7IA 3Q74A 3IDVA 1F3AA 2H19A 3GKXA 3WD6A 2YJHA 2R2JA 4FH8A 4H86A 2WDUA 6GSSA 5G31A 1GSQA 1MDKA 3GMFA 2J9HA 2FWGA 4O5QA 5IM9A 2H0IA 1EWXA 2C3NA 4MZWA 3HKRA 1Z7PA 3N5OA 1TRSA 2OJLA 4PQHA 1PL1A 1SL2B 4G10A 1FAAA 1CQGA 4JBBA 3TOTA 4Q5FA 1XPVA 3GRXA 4K9ZA 1SKRB 3RHCA 2V6KA 4QQ7A 4EC0A 3E3EA 13GSA 4N3ZA 4TOPA 5F8BA 2I81A 3D0ZA 3PH9A 5ECMB 2H73A 2KP2A 20GSA 1TXUA 5G5EA 1GULA 2QA1A 4OO5A 3F4SA 1B8XA 1GLQA 1PX7A 3OR5A 3CTFA 3IAM2 3QAWA 5ECNB 2OKAA 2HZEA 2XC2A 3DWVA 5C00A 3WYWA 2H76A 4MJBA 2VCWA 3A2XA 1SKSB 4EUYA 5DQSA 4RI6A 1GSSA 2YWOA 5F07A 1QGVA 3GTUA 1XWCA 2N5AA 2MBSA 1F6MC 2B1LA 2GSTA 3WGXA 5B8BA 1A2LA 3BJ5A 5IMVA 4PURA 2VD0A 4IP6A 5CYYA 11GSA 3PGTA 4HDEA 1XOAA 4X1UA 2M46A 2XHFA 3MAKA 5GZZB 4EF0A 4OO4A 4E68A 2RM5A 3IE3A 3F63A 1V98A 2LRTA 5A4VA 1ZZYA 1UA5A 4ZBAA 1YEXA 1VF3A 2CV4A 2J23A 1XVQA 3O76A 1V9WA 2IIYA 2ZNMA 4IGJA 2X8CA 4GRFA 1ZL9A 4PQ1A 3EMXA 4ZL7A 4K7NA 2MYGA 4GF0A 1TI1A 1YDKA 1XFLA 1AC1A 2HRAA 3FR3A 5DCGA 4FYUA 4I97A 1VF2A 1PX6A 3IK9A 1QFNA 3ZITA 2VO4A 2DJ3A 3IC8A 2VL2A 5IMDA 5J4UA 2NDOA 1XBSA 1EEJA 2YOIA 4ZB8A 3WT1A 5IOWA 1XZOA 4PQIA 4N11A 2VL9A 3EMPA 2P31A 2CVKA 4WBRD 4EXJA 3GNJA 4O7HA 3E9JB 3HJMA 1TRWA 3QMXA 2CVDA 5ID2A 4POBA 2H6ZA 3CSHA 3HVXA 4TKYA 4TR0A 5D93A 4MNNA 2VCVA 4JU5A 3W8SA 4IP1A 4HQZA 3GN3A 3KMOA 3UVHA 4HZ2A 19GSA 3FK8A 4RUVA 1URMA 1HQOA 5DAKB 4ZBDA 2HSMA 5ECRB 4TW5A 3M8NA 1X5CA 3ZYWA 1Z6MA 3IHGA 2EIRA 5IMCA 3GH9A 3DGQA 5ECSA 2H66A 3LXTA 1NHOA 3P90A 1U6TA 2PMTA 3D6IA 3IBHA 5IMFA 1SJIA 3TRQA 4K5RA 3IHQA 3TU3B 1O8XA 4F0BA 2YWIA 1B4PA 4OFTA 3M9KA 1F9MA 5G1KA 3P7XA 4MH2A 1PKZA 1J08A 1CQHA 3HZ4A 1K0OA 4QL7A 4N10A 3LEFA 1YJ6A 5J9CA 1TK5B 4RI7A 1A24A 4G9HA 2K18A 1OE7A 5J47A 2VCTA 1TK0B 4MMMA 2IL3A 2YZHA 2WS2A 3BCKA 4Z2UA 4Z7XA 1XCCA 3KCMA 2C80A 3UL3A 3A5IA 4GQFA 5DALB 4GDFA 2ALBA 3TRXA 17GSA 5CREA 1S3CA 1HYUA 3KEBA 1M0UA 1TU8A 3VURA 1ML6A 2H6YA 5HFKA 1R4WA 4V2NA 4IELA 4E8EA 3DRNA 1XXUA 5D9TA 3I6AA 3HJPA 3H1NA 4GLTA 2GZPA 1WIKA 4KH7A 4OWYA 2LJRA 5H5RA 3FZ9A 2FD3A 2YANA 2PN8A 4DVCA 5ECOB 2C4JA 3GX0A 1XW5A 1Y25A 4BPYA 2LV3A 2X4AA 4CW9A 1ON4A 1BEDA 1SVMA 5FHIA 1ZYEA 4ZB6A 2PUKC 3LWAA 1BG1A 4KDXA 4YAVA 3D4TA 2TRXA 5D73A 4MABA 4X43A 3TJJA 4WF5A 3VWWA 2LQQA 3M9JA 3GX8A 4HQSA 3HMJG 4LMVA 5LNKe 5DJMA 2K6VA 4BL7A 5JCWA 1R5PA 1TU7A 3SWLA 3LW9A 1Q4JA 4IJIA 2EIOA 1T00A 5A5KA 1T4YA 3TKSA 3LYPA 4JRRA 5B8AA 4NV5A 5B6NA 4MZCA 1VRSD 2VOCA 3VWXA 3HHVA 3HVSA 3BOAA 1I9DA 5DQYA 1GSDA 1F2EA 1K0NA 5JCUA 1GWCA 1RK4A 3D4MA 1K0BA 3GIXA 1RQMA 3C1SA 4TRXA 1SK0A 3HA9A 3TCOA 2X99A 3MSZA 2HSHA 1A8LA 3CSJA 3EWLA 4A5PA 2JSYA 3GKKA 2RLIA 2VLUA 4HZ4A 1YZXA 2R6KA 1HD2A 1ZMAA 3DVXA 4K5SA 5LCZA 2YP6A 5A1NA 2H70A 1TOFA 3F9UA 2VAFA 1KEBA 2VCZA 2DMLA 2HZFA 4O5RA 4WETA 2IMEA 3Q19A 5J4VA 2E2MA 3GFKA 2OBKA 2CAIA 1O85A 3CXGA 3WGEA 2YNXA 5D8IA 3A2VA 3K8NA 2OA7A 3KXOA 1YEPA 1X9MB 4EIQA 2BMXA 2P5RA 2IJYA 3DYRA 2DJ0A 5A5HB 1PN9A 4MA9A 3RPPA 5B6MA 1KNGA 5GAPD 3KMNA 3MDKA 3GYKA 3UEMA 3PR8A 2FY6A 4DSSA 4NPBA 2PERA 2VCQA 5J5NA 4NV2A 2H71A 2F51A 1WJKA 1T7PB 2A2PA 2DMMA 1W89A 2ZUPA 2ON5A 4I8BA 3VI5A 4D73A 4KB3A 2GQMA 4POKA 2MMOA 2DJ1A 1LJRA 2R0CA 4YKGA 1K0CA 2FCHA 3CRUA 2OE3A 3W6GA 3GH6A 4BVXB 1QK8A 2MZCA 1ZOFA 2OADA 4TN8A 1R7HA 4Q5NA 4USSA 3TRPA 3FRCA 2AAWA 3HXSA 4OCFA 1OYJA 4AJ7A 5AN1A 3LSZA 1JHBA 4QMKA 3R3EA 2N5FA 2GTUA 1GSYA 1ERUA 2H8LA 4KNDA 4POLA 2X64A 2YJ7A 3L9SA 2H6XA 3EU3A 2B7JA 2IN3A 2A2RA 3TOUA 3C73A 4K2XA 3C71A 1ERWA 1IYIA 1B9XC 4YH2A 2H74A 1PD21 4MF6A 3M1GA 4L0UA 1SYXA 1BG5A 2C0DA 2X8GA 4CDOA 1GL8A 2AYTA 1SD8A 1O7UA 1BF5A 1K0DA 3DIEA 2WZ9A 4Q5RA 4GTUA 3KP8A 2L6CA 5A34A 1TK8B 3MNGA 1PQNA 4ZL8A 2DJ2A 5INYA 1NSWA 2CT6A 3FZAA 1GLPA 1G6WA 2V32A 2YWNA 5CRWA 2O89A 1XWBA 2R3XA 4F03A 1WRYA 2VL3A 4F2IA 4HEA2 1YKCA 3GURA 3F0IA 3L0HA 2VM1A 3FYGA 3APSA 4GQCA 3BD2A 2X8HA 2AHEA 6GSVA 4EDZA 4WR4A 4FYBA 2YZUA 1A0FA 2H1AA 4AGSA 1LBKA 4HI7A 1MEKA 1U87A 2JACA 2KP1A 3E0UA 2L57A 3G9BA 2BTOT 2VUPA 1M9AA 9GSSA 5ABRA 2HZEB 2B6MA 2MMAA 1X5DA 2O8VB 1GSFA 1ZGNA 1GNWA 2R4VA 3IXRA 4MCUA 1ST9A 1PL2A 2FNOA 4DEJA 2CAQA 4BWSA 1FHEA 1EP7A 2FWEA 1G6YA 1EV4A 5H5QA 1X0RA 3P8WA 4LL4B 2G0FA 3GTUB 1ABAA 2QC7A 4O5UA 2L5LA 1SL1B 2F8FA 2P0GA 1TW9A 2VL2C 5ECLB 2L59A 1MD3A 4KSOA 1R5AA 5COHA 4PTSA 3QCPA 2O85A 3AY8A 2HFDA 3G7YA 2N5BA 1V2AA 1PN0A 1KTEA 1C72A 4KE3A 2H72A 1N2AA 2B3SA 5IPHA 4YQVA 16GSA 2FLSA 6GSUA 3FHKA 5E4WA 4ECCA 1TJDA 3HCZA 2QA2A 1BYEA 3EPTA 4KW6A 5DVBA 3MYDA 3GKMA 1ILOA 2O87A 5FT3A 8GSSA 3TJFA 1GTBA 2HSNA 5CO3A 4KSMA 3L78A 2DKHA 2IFQA 2LUSA 1A23A 2LEGA 3UAPA 1U88A 2YV9A 3IA1A 4OD7A 1B48A 1EP8A 4E8HA 1SK2A 4NXIA 2ZCTA 4KGIA 5D9VA 4XS6A 2LS5A 3N9JA 3FEUA 1B9YC 2KLXA 2YCDA 3LXZA 4XS1A 4JE1A 2FUG2 2FWHA 3EC3A 3GKNA 2JSZA 2VIMA 2G2QA 4Q5QA 1DSBA 1QUWA 3G7JA 2HT9A 2H75A 5ID2B 1TRVA 4O32A 4MF7A 2EFDA 3A3TA 4J2FA 3A5WA 2OT3A 5ECKB 4MJCA 3U5RE 2HSMB 3ZVJD 2ON7A 1TP9A 14GSA 2UZ8A 3IAS2 3HYPA 1XW6A 1OKTA 3H93A 4TXVA 2AJQB 5F0GA 3SBCA 3TKQA 1EOGA 2JZTA 3DXBA 4G01A 4ZB7A 4I6XA 5BRTA 3UARA 4OMVA 3M3MA 1T8EB 4LMWA 4GSTA 3ME8A 4ULXA 3ME7A 4O92A 3ERWA 1HNBA 3W8JA 3ZZXA 3IV4A 4AI6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CNW A;  1UVZ A;  3RAZ A;  4ZIL A;  3KD0 A;  3D21 A;  3HD5 A;  3MWH A;  3QPM A;  3J7Y k;  3ZIJ A;  3HY2 A;  1HNA A;  1JLW A;  5AIV A;  3RHB A;  1MDJ A;  4YAP A;  2XBQ A;  4JED A;  1Z7R A;  22GS A;  3VPQ A;  3ISO A;  2VD1 A;  2MBT A;  2WUL A;  4F82 A;  1AQX A;  4IS0 A;  1BAY A;  2GZZ A;  4GXZ A;  2C0F A;  2JZS A;  1OVN A;  1U3I A;  1AQV A;  1JZW A;  2REM A;  4XIH A;  4IBP A;  5KN2 A;  5AIS A;  1FVJ A;  1PRX A;  3QAV A;  4BA7 A;  1J9B A;  3KIJ A;  1OAZ A;  5D96 A;  3TUE A;  2PBJ A;  2RM6 A;  4TXO A;  3C7M A;  3GHA A;  5A4W A;  3LFL A;  3FR9 A;  3QR6 A;  2R5G A;  3O3T A;  4OFN A;  2FA4 A;  3ZFL A;  3I9V 2;  4XTS A;  1MTC A;  3TDG A;  4KX4 A;  1X5E A;  4ECJ A;  3EE2 A;  3TKS C;  2RUF A;  4ZL9 A;  10GS A;  2JU5 A;  5IIZ A;  4ID0 A;  1WE0 A;  1GTU A;  3FR6 A;  4I2U A;  3FY7 A;  2MMZ A;  4GCI A;  2I9H A;  4N0V A;  4IN0 A;  2B5Y A;  3HJO A;  2E7P A;  4FIW A;  1OC9 A;  4JR4 A;  2PVO C;  4XS4 A;  2WCI A;  5CRG A;  2HRK A;  4N30 A;  4L8E A;  1AUC A;  1NHY A;  3BBY A;  3RDW A;  5BMU A;  3IPZ A;  2AUV A;  1QQ2 A;  3QDN A;  3JCM L;  2HLS A;  3KP9 A;  4K7O A;  5GSS A;  1XW9 A;  4BL7 B;  4OFM A;  4ECI A;  5HR3 A;  3TKR A;  1M7T A;  2Z9S A;  4K2D A;  2EIQ A;  4MDC A;  2JL4 A;  3GV1 A;  1TDI A;  4G0I A;  4QL9 A;  2L4Q A;  3P2A A;  1YF0 A;  3VPT A;  2LJK A;  3IR4 A;  4V1A p;  2H1D A;  4I2T A;  4KUN A;  2B7K A;  1ACV A;  2GDR A;  4FO5 A;  2K8V A;  1PKW A;  4KCE A;  1TI3 A;  1N8J A;  1F3B A;  4KAE A;  4EDY A;  3M0F A;  2KUC A;  1B4Q A;  4J56 E;  3LOR A;  4XCS A;  2YPM A;  4HU7 A;  4KA0 A;  1SJZ A;  3CYN A;  1WMJ A;  2C0G A;  1ZCP A;  4GSN A;  2F3M A;  4JR6 A;  4EVM A;  5B7C A;  2YWM A;  4MPG A;  2CVB A;  1XWK A;  4PUA A;  3KM6 A;  1OC3 A;  2DIZ A;  1AAZ A;  1V57 A;  4KCA A;  1DE1 A;  1PMT A;  4V1A g;  1LU4 A;  4KDY A;  5CRD A;  3ZL5 A;  1A2J A;  5ELG A;  3TGZ A;  5KN3 A;  1T1V A;  1HNC A;  1VF1 A;  1YY7 A;  3ERG A;  2VLV A;  3TJB A;  1GTI A;  2OBI A;  4MP4 A;  2H1G A;  5G30 A;  4RQR A;  4DSS B;  5ECQ B;  3WGD A;  3D5J A;  2H0H A;  2P5Q A;  4ZBB A;  3IRA A;  3GST A;  5IOX A;  2I4A A;  3UBK A;  3US3 A;  2V1M A;  4WBJ A;  2QKE A;  2OAC A;  4D73 B;  3R2Q A;  5DBQ A;  2GSQ A;  1AXD A;  1I5G A;  4MJA A;  2XPD A;  3Q6O A;  1G7E A;  4WKW A;  4OCE A;  1OKD A;  5ECI B;  5HFI A;  4PNG A;  4AF2 A;  2DC5 A;  2LNS A;  2F8A A;  3CRT A;  2RUE A;  2V6O A;  2GGT A;  4HOJ A;  4IQA A;  2IWT A;  3IK7 A;  2WFC A;  4TR1 A;  1EZK A;  2GSR A;  3G7I A;  4BVY A;  1BJX A;  3IOS A;  4TR4 A;  2C3Q A;  3VWU A;  5E59 A;  1GUM A;  1GUK A;  4ECB A;  5J41 A;  1XOB A;  1BQ7 A;  5CP1 A;  2YN1 A;  2QGV A;  5G5F A;  2VM2 A;  4XHM A;  3EYT A;  1EGR A;  4IHU A;  3ZLP A;  2LST A;  4NMU A;  1PA3 A;  1UC7 A;  3GL5 A;  5L71 A;  2H1B A;  3TKS E;  3TJK A;  2WB9 A;  2I1U A;  2DBC A;  1FO5 A;  3UIW A;  3ZRE A;  1M9B A;  1YQ1 A;  2K9F A;  3F4R A;  2CX4 A;  2XPE A;  3QFA C;  1G0T A;  3WT2 A;  4MK3 A;  4CHS A;  4V2M A;  5AGY A;  1FW1 A;  3HDC A;  3EIN A;  3RBT A;  2WJU A;  3GA4 A;  4EE0 A;  3QFB C;  1H4O A;  1K3O A;  4L5L A;  5EPF A;  1NW2 A;  4YQU A;  1THX A;  2NTO A;  5CRH A;  4BWQ A;  3C1R A;  3V1W A;  3L4N A;  1SKW B;  2HNL A;  1BX9 A;  3QOU A;  2E0Q A;  3ZTL A;  4F9Z A;  1TTZ A;  4POM A;  2GZY A;  3NOF A;  2AV4 A;  5LD0 A;  4F0C A;  2A2S A;  2GQL A;  1SD9 A;  4HUA A;  4AJ8 A;  1FVK A;  3VFI A;  1VGL A;  4MLY A;  12GS A;  3F3Q A;  1WWJ A;  1XVW A;  1M99 A;  3UOM A;  2HE3 A;  1V40 A;  1GH2 A;  1O73 A;  4ML1 A;  4DSR A;  2IPA A;  1Z3E A;  6GSY A;  2NPB A;  2XBI A;  1WPI A;  3FW2 A;  1K3L A;  4DSQ A;  1K3Y A;  3EVI A;  3U6V A;  3KJY A;  1V58 A;  1M2B A;  2IMI A;  4LLR A;  2F9S A;  1IYH A;  1VF4 A;  3KZQ A;  2LNT A;  2DJK A;  3KTB A;  2HSN B;  3F8U A;  6GSX A;  4G19 A;  3CTG A;  2IFQ B;  2IMF A;  4G2E A;  4HJ2 A;  1ERT A;  5CAX A;  3QD9 A;  1JZO A;  5EVO A;  2CQ9 A;  3FZ4 A;  1MD4 A;  1QXH A;  1U3A A;  3LJR A;  3ZML A;  4NHW A;  2PGT A;  3RPN A;  5JCG A;  4TVE A;  4FYC A;  1G7O A;  4HJM A;  1GUH A;  3VK9 A;  2FGX A;  4J57 E;  2A4V A;  3KH7 A;  3ZRD A;  1JLV A;  3UBL A;  2ES7 A;  5HQP A;  3J7Y b;  1MDI A;  4L0W A;  2PU9 C;  2PVQ A;  5GAN D;  4HS1 A;  4K8M A;  3Q18 A;  5JWO B;  3CSI A;  2NBS A;  18GS A;  3F4T A;  4XRD A;  2K8S A;  2CZ2 A;  4GWR A;  3A2W A;  2C8U A;  4NAX A;  2NVL A;  5DJL A;  5KEJ A;  3KGK A;  1DUG A;  2PWJ A;  5IMA A;  4IW9 A;  2HRF A;  2VCX A;  3ZFB A;  5IQY A;  4ZXG A;  1S3D A;  2H0G A;  3O6T A;  1FOV A;  5DAK A;  3NZN A;  4ISD A;  2I3Y A;  2C0E A;  2LKU A;  2JZR A;  2HQT A;  2YV7 A;  1OE8 A;  4ZB9 A;  5KN0 A;  1PGT A;  2GSS A;  3C8E A;  5ECP B;  3F6D A;  3APO A;  2DSA A;  3PIN A;  4YQM A;  1O6J A;  5IPG A;  2L6D A;  3H4K A;  2FHE A;  1AIU A;  2HSY A;  1O8W A;  1PSQ A;  2GVP A;  2TRC P;  1TRU A;  2LRC A;  3VWV A;  5HR2 A;  1JZD A;  2B5E A;  6GST A;  5IO2 A;  3LGC A;  5ECH B;  4TR3 A;  4K0G A;  5C04 A;  4G0K A;  5KN1 A;  1EV9 A;  4ILF A;  1YF1 A;  1NM3 A;  2GS3 A;  4K0N A;  2CZ3 A;  5ELA A;  2L5O A;  3I43 A;  1ERV A;  1T3B A;  3HVV A;  4TXO B;  4MF5 A;  2M72 A;  3HZ8 A;  2WRT A;  2HRN A;  2DJJ A;  1USB A;  5DAL A;  1X9W B;  2R37 A;  4LA1 A;  3LG6 A;  3BCI A;  1FG4 A;  2V41 A;  4MZB A;  4PXO A;  2MMN A;  2PPT A;  5J9B A;  3TKP A;  1Z9H A;  4FQU A;  1THO A;  5F06 A;  3L9V A;  3APQ A;  2HXK A;  1SL0 B;  4XRA A;  3LQ7 A;  1OC9 B;  1SEN A;  4WF4 A;  4XS4 B;  5G1L A;  2HRK B;  4GSS A;  1TXX A;  4K6X A;  2CX3 A;  1EOH A;  1WOU A;  5IO0 A;  4MPF A;  3F6F A;  4WXT A;  2OE1 A;  1EEM A;  1FB0 A;  2H01 A;  1K0M A;  4KDU A;  5A4U A;  2C1Y A;  4V2L A;  3EU4 A;  4NHZ A;  2DIY A;  1GRX A;  4ACS A;  1A0R P;  2HYX A;  1Z5Y E;  3ED3 A;  5AIX A;  1TKD B;  2GT6 A;  6GSW A;  3L9U A;  5HR1 A;  4JZQ A;  1JZR A;  1K0A A;  3F3R A;  4PUF C;  4IVF A;  3VI7 A;  1M2D A;  1DBY A;  4EO3 A;  2C3T A;  3I69 A;  1GSU A;  1J0F A;  3KH9 A;  1SU9 A;  1M2A A;  2IMD A;  3DD3 A;  5JWR B;  2CA8 A;  4I5Q A;  3EUR A;  1A8Y A;  3DKS A;  4MH3 A;  4HU9 A;  4IJ3 A;  1F37 A;  4WR5 A;  3KTL A;  2TIR A;  4RQX A;  4G0L A;  1XWA A;  1FB6 A;  1EGO A;  1SYR A;  4K1F A;  5HFG A;  3NIV A;  2B1K A;  4ZIJ A;  2QSI A;  2L4C A;  3FZ5 A;  2O7K A;  1Z6N A;  2KHP A;  1R26 A;  1ZYQ B;  4NWY A;  5EL8 A;  3PPU A;  2B5X A;  1GTA A;  1E6B A;  4EKZ A;  4P3Y B;  3H8Q A;  2OE0 A;  4PNF A;  2FWF A;  4EL1 A;  5J3R A;  1GNE A;  4IQ1 A;  5FWG A;  3TJG A;  4MJE A;  2V2G A;  5JWQ B;  5DDL A;  7GSS A;  3D22 A;  4ML6 A;  3ZMK A;  5D9X A;  3FKF A;  3GUS A;  1AQW A;  1WP0 A;  5ENU A;  4KF9 A;  1S3A A;  1KBN A;  2E2G A;  2DLX A;  1AW9 A;  2BJX A;  3CBU A;  2JAD A;  1W4V A;  5GST A;  1GSE A;  4N0Z A;  4PX1 A;  4WEY A;  3DEX A;  4IKH A;  1Y6E A;  1E2Y A;  4PGT A;  2GT5 A;  3IC4 A;  3ZVJ A;  3CMI A;  1DE2 A;  1SK1 A;  2LQO A;  5IMZ A;  1QMV A;  3VLN A;  2GLR A;  2KOK A;  4LL1 B;  1UN2 A;  1A2M A;  1XIY A;  3QAG A;  1X9S B;  5DCH A;  2HI7 A;  4L5O A;  1GP1 A;  2D2Z A;  3GSS A;  1H75 A;  2IMK A;  4BVX A;  3UVT A;  5EY6 A;  5H5S A;  2AB6 A;  3DVW A;  3TB2 A;  4AJ6 A;  4TR1 B;  4BVY B;  3GL3 A;  2M80 A;  3H79 A;  1T4Z A;  1YKA A;  1JFU A;  3ZIV A;  3LYK A;  2FA8 A;  1O81 A;  2LJA A;  5F05 A;  1Q98 A;  1XWG A;  4X0X A;  5HR0 A;  3UMA A;  1RW1 A;  5D9W A;  1OC8 A;  3S9F A;  2LTK A;  2RII A;  2VLT A;  2EC4 A;  3UJ1 A;  2H30 A;  3DML A;  5G2Z A;  2WGR A;  2GQK A;  3ERF A;  1SJ6 A;  2LRN A;  4K7I A;  3Q74 A;  3IDV A;  1F3A A;  2H19 A;  3GKX A;  3WD6 A;  2YJH A;  2R2J A;  4FH8 A;  4H86 A;  2WDU A;  6GSS A;  5G31 A;  1GSQ A;  1MDK A;  3GMF A;  2J9H A;  2FWG A;  5IM9 A;  2H0I A;  1EWX A;  2C3N A;  4MZW A;  3HKR A;  1Z7P A;  3N5O A;  1TRS A;  2OJL A;  4PQH A;  1PL1 A;  1SL2 B;  4G10 A;  1FAA A;  1CQG A;  4JBB A;  3TOT A;  4Q5F A;  1XPV A;  3GRX A;  4K9Z A;  1SKR B;  3RHC A;  2V6K A;  4QQ7 A;  4EC0 A;  3E3E A;  13GS A;  4TOP A;  5F8B A;  2I81 A;  3D0Z A;  3PH9 A;  5ECM B;  2H73 A;  2KP2 A;  20GS A;  5G5E A;  1GUL A;  4OO5 A;  3F4S A;  1B8X A;  1GLQ A;  1PX7 A;  3OR5 A;  3CTF A;  3IAM 2;  3QAW A;  5ECN B;  2OKA A;  2HZE A;  2XC2 A;  3DWV A;  5C00 A;  3WYW A;  2H76 A;  4MJB A;  2VCW A;  3A2X A;  1SKS B;  4EUY A;  5DQS A;  4RI6 A;  1GSS A;  2YWO A;  5F07 A;  1QGV A;  3GTU A;  1XWC A;  2N5A A;  2MBS A;  1F6M C;  2B1L A;  2GST A;  3WGX A;  5B8B A;  1A2L A;  3BJ5 A;  5IMV A;  4PUR A;  2VD0 A;  4IP6 A;  5CYY A;  11GS A;  3PGT A;  4HDE A;  1XOA A;  4X1U A;  2M46 A;  2XHF A;  3MAK A;  5GZZ B;  4EF0 A;  4OO4 A;  2RM5 A;  3IE3 A;  3F63 A;  1V98 A;  2LRT A;  5A4V A;  1ZZY A;  1UA5 A;  4ZBA A;  1YEX A;  1VF3 A;  2CV4 A;  2J23 A;  1XVQ A;  3O76 A;  1V9W A;  2IIY A;  2ZNM A;  4IGJ A;  2X8C A;  4GRF A;  1ZL9 A;  4PQ1 A;  3EMX A;  4ZL7 A;  4K7N A;  2MYG A;  4GF0 A;  1TI1 A;  1YDK A;  1XFL A;  1AC1 A;  2HRA A;  3FR3 A;  5DCG A;  4FYU A;  4I97 A;  1VF2 A;  1PX6 A;  3IK9 A;  1QFN A;  3ZIT A;  2VO4 A;  2DJ3 A;  3IC8 A;  2VL2 A;  5IMD A;  5J4U A;  2NDO A;  1XBS A;  1EEJ A;  2YOI A;  4ZB8 A;  3WT1 A;  5IOW A;  1XZO A;  4PQI A;  4N11 A;  2VL9 A;  3EMP A;  2P31 A;  2CVK A;  4WBR D;  4EXJ A;  3GNJ A;  4O7H A;  3E9J B;  3HJM A;  1TRW A;  3QMX A;  2CVD A;  5ID2 A;  4POB A;  2H6Z A;  3CSH A;  3HVX A;  4TKY A;  4TR0 A;  5D93 A;  2VCV A;  4JU5 A;  3W8S A;  4IP1 A;  4HQZ A;  3GN3 A;  3KMO A;  3UVH A;  4HZ2 A;  19GS A;  3FK8 A;  4RUV A;  1URM A;  1HQO A;  5DAK B;  4ZBD A;  2HSM A;  5ECR B;  4TW5 A;  3M8N A;  1X5C A;  3ZYW A;  1Z6M A;  2EIR A;  5IMC A;  3GH9 A;  3DGQ A;  5ECS A;  2H66 A;  3LXT A;  1NHO A;  3P90 A;  1U6T A;  2PMT A;  3D6I A;  3IBH A;  5IMF A;  1SJI A;  3TRQ A;  3IHQ A;  1O8X A;  4F0B A;  2YWI A;  1B4P A;  4OFT A;  3M9K A;  1F9M A;  5G1K A;  3P7X A;  4MH2 A;  1PKZ A;  1J08 A;  1CQH A;  3HZ4 A;  1K0O A;  4QL7 A;  4N10 A;  3LEF A;  1YJ6 A;  5J9C A;  1TK5 B;  4RI7 A;  1A24 A;  4G9H A;  2K18 A;  1OE7 A;  2VCT A;  1TK0 B;  4MMM A;  2IL3 A;  2YZH A;  2WS2 A;  3BCK A;  4Z7X A;  1XCC A;  3KCM A;  2C80 A;  3UL3 A;  4GQF A;  5DAL B;  2ALB A;  3TRX A;  17GS A;  5CRE A;  1S3C A;  1HYU A;  3KEB A;  1M0U A;  1TU8 A;  3VUR A;  1ML6 A;  2H6Y A;  5HFK A;  1R4W A;  4V2N A;  4IEL A;  4E8E A;  3DRN A;  1XXU A;  5D9T A;  3I6A A;  3HJP A;  3H1N A;  4GLT A;  2GZP A;  1WIK A;  4KH7 A;  4OWY A;  2LJR A;  5H5R A;  3FZ9 A;  2FD3 A;  2YAN A;  2PN8 A;  4DVC A;  5ECO B;  2C4J A;  3GX0 A;  1XW5 A;  1Y25 A;  4BPY A;  2LV3 A;  4CW9 A;  1ON4 A;  1BED A;  5FHI A;  1ZYE A;  4ZB6 A;  2PUK C;  3LWA A;  4KDX A;  4YAV A;  3D4T A;  2TRX A;  5D73 A;  4MAB A;  4X43 A;  3TJJ A;  4WF5 A;  3VWW A;  2LQQ A;  3M9J A;  3GX8 A;  4HQS A;  4LMV A;  5LNK e;  5DJM A;  2K6V A;  4BL7 A;  5JCW A;  1R5P A;  1TU7 A;  3SWL A;  1Q4J A;  4IJI A;  2EIO A;  1T00 A;  5A5K A;  1T4Y A;  3TKS A;  3LYP A;  4JRR A;  5B8A A;  4NV5 A;  5B6N A;  4MZC A;  1VRS D;  2VOC A;  3VWX A;  3HHV A;  3HVS A;  3BOA A;  1I9D A;  5DQY A;  1GSD A;  1F2E A;  1K0N A;  5JCU A;  1GWC A;  1RK4 A;  3D4M A;  1K0B A;  3GIX A;  1RQM A;  3C1S A;  4TRX A;  1SK0 A;  3HA9 A;  3TCO A;  2X99 A;  3MSZ A;  2HSH A;  1A8L A;  3CSJ A;  3EWL A;  2JSY A;  3GKK A;  2RLI A;  2VLU A;  4HZ4 A;  1YZX A;  2R6K A;  1HD2 A;  1ZMA A;  3DVX A;  5LCZ A;  2YP6 A;  2H70 A;  1TOF A;  3F9U A;  2VAF A;  1KEB A;  2VCZ A;  2DML A;  2HZF A;  4O5R A;  4WET A;  2IME A;  3Q19 A;  2E2M A;  3GFK A;  2OBK A;  2CAI A;  1O85 A;  3CXG A;  3WGE A;  2YNX A;  5D8I A;  3A2V A;  3K8N A;  2OA7 A;  3KXO A;  1YEP A;  1X9M B;  2BMX A;  2P5R A;  2IJY A;  3DYR A;  2DJ0 A;  1PN9 A;  4MA9 A;  3RPP A;  5B6M A;  1KNG A;  5GAP D;  3KMN A;  3MDK A;  3GYK A;  3UEM A;  3PR8 A;  2FY6 A;  4DSS A;  4NPB A;  2PER A;  2VCQ A;  5J5N A;  4NV2 A;  2H71 A;  2F51 A;  1WJK A;  1T7P B;  2DMM A;  1W89 A;  2ZUP A;  2ON5 A;  4I8B A;  3VI5 A;  4D73 A;  4KB3 A;  2GQM A;  4POK A;  2MMO A;  2DJ1 A;  1LJR A;  1K0C A;  2FCH A;  3CRU A;  2OE3 A;  3W6G A;  3GH6 A;  4BVX B;  1QK8 A;  2MZC A;  1ZOF A;  2OAD A;  4TN8 A;  1R7H A;  4Q5N A;  4USS A;  3TRP A;  3FRC A;  2AAW A;  3HXS A;  4OCF A;  1OYJ A;  4AJ7 A;  5AN1 A;  3LSZ A;  1JHB A;  3R3E A;  2N5F A;  2GTU A;  1GSY A;  1ERU A;  2H8L A;  4KND A;  4POL A;  2X64 A;  2YJ7 A;  3L9S A;  2H6X A;  3EU3 A;  2B7J A;  2IN3 A;  2A2R A;  3TOU A;  3C73 A;  3C71 A;  1ERW A;  1IYI A;  1B9X C;  4YH2 A;  2H74 A;  1PD2 1;  4MF6 A;  3M1G A;  4L0U A;  1SYX A;  1BG5 A;  2C0D A;  2X8G A;  4CDO A;  1GL8 A;  2AYT A;  1SD8 A;  1O7U A;  1K0D A;  3DIE A;  2WZ9 A;  4Q5R A;  4GTU A;  3KP8 A;  2L6C A;  1TK8 B;  3MNG A;  1PQN A;  4ZL8 A;  2DJ2 A;  5INY A;  1NSW A;  2CT6 A;  3FZA A;  1GLP A;  1G6W A;  2V32 A;  2YWN A;  5CRW A;  2O89 A;  1XWB A;  2R3X A;  4F03 A;  1WRY A;  2VL3 A;  4F2I A;  4HEA 2;  1YKC A;  3GUR A;  3F0I A;  3L0H A;  2VM1 A;  3FYG A;  3APS A;  4GQC A;  3BD2 A;  2X8H A;  2AHE A;  6GSV A;  4EDZ A;  4WR4 A;  4FYB A;  2YZU A;  1A0F A;  2H1A A;  4AGS A;  1LBK A;  4HI7 A;  1MEK A;  1U87 A;  2JAC A;  2KP1 A;  3E0U A;  2L57 A;  3G9B A;  2BTO T;  2VUP A;  1M9A A;  9GSS A;  5ABR A;  2HZE B;  2B6M A;  2MMA A;  1X5D A;  2O8V B;  1GSF A;  1ZGN A;  1GNW A;  2R4V A;  3IXR A;  4MCU A;  1ST9 A;  1PL2 A;  2FNO A;  4DEJ A;  2CAQ A;  4BWS A;  1FHE A;  1EP7 A;  2FWE A;  1G6Y A;  1EV4 A;  5H5Q A;  1X0R A;  3P8W A;  4LL4 B;  2G0F A;  3GTU B;  1ABA A;  2QC7 A;  2L5L A;  1SL1 B;  2F8F A;  2P0G A;  1TW9 A;  2VL2 C;  5ECL B;  2L59 A;  1MD3 A;  4KSO A;  1R5A A;  5COH A;  4PTS A;  3QCP A;  2O85 A;  3AY8 A;  2HFD A;  3G7Y A;  2N5B A;  1V2A A;  1KTE A;  1C72 A;  4KE3 A;  2H72 A;  1N2A A;  2B3S A;  5IPH A;  4YQV A;  16GS A;  2FLS A;  6GSU A;  3FHK A;  5E4W A;  4ECC A;  1TJD A;  3HCZ A;  1BYE A;  4KW6 A;  5DVB A;  3GKM A;  1ILO A;  2O87 A;  5FT3 A;  8GSS A;  3TJF A;  1GTB A;  5CO3 A;  4KSM A;  3L78 A;  2IFQ A;  2LUS A;  1A23 A;  2LEG A;  3UAP A;  1U88 A;  2YV9 A;  3IA1 A;  4OD7 A;  1B48 A;  1EP8 A;  4E8H A;  1SK2 A;  4NXI A;  2ZCT A;  4KGI A;  5D9V A;  4XS6 A;  2LS5 A;  3N9J A;  3FEU A;  1B9Y C;  2KLX A;  2YCD A;  3LXZ A;  4XS1 A;  4JE1 A;  2FUG 2;  2FWH A;  3EC3 A;  3GKN A;  2JSZ A;  2VIM A;  2G2Q A;  4Q5Q A;  1DSB A;  1QUW A;  3G7J A;  2HT9 A;  2H75 A;  5ID2 B;  1TRV A;  4O32 A;  4MF7 A;  3A3T A;  4J2F A;  3A5W A;  5ECK B;  4MJC A;  3U5R E;  2HSM B;  3ZVJ D;  2ON7 A;  1TP9 A;  14GS A;  2UZ8 A;  3IAS 2;  3HYP A;  1XW6 A;  1OKT A;  3H93 A;  4TXV A;  2AJQ B;  5F0G A;  3SBC A;  3TKQ A;  1EOG A;  2JZT A;  3DXB A;  4I6X A;  3UAR A;  4OMV A;  3M3M A;  1T8E B;  4LMW A;  4GST A;  3ME8 A;  4ULX A;  3ME7 A;  4O92 A;  3ERW A;  1HNB A;  3W8J A;  3ZZX A;  3IV4 A; 
#chains in the Genus database with same CATH topology
 5CNW A;  1UVZ A;  3RAZ A;  1SVO A;  4ZIL A;  3KD0 A;  3D21 A;  3HD5 A;  3MWH A;  3QPM A;  3J7Y k;  3ZIJ A;  4FXY P;  3HY2 A;  1HNA A;  1JLW A;  5AIV A;  3RHB A;  1MDJ A;  4YAP A;  2XBQ A;  4JED A;  1Z7R A;  22GS A;  3VPQ A;  3ISO A;  2VD1 A;  2MBT A;  2WUL A;  4F82 A;  1AQX A;  4IS0 A;  1BAY A;  2GZZ A;  4GXZ A;  2C0F A;  2JZS A;  1OVN A;  1U3I A;  1AQV A;  1JZW A;  2REM A;  4XIH A;  4IBP A;  5KN2 A;  5AIS A;  1FVJ A;  1PRX A;  3QAV A;  4BA7 A;  1J9B A;  3KIJ A;  1OAZ A;  5D96 A;  3TUE A;  2PBJ A;  4YKF A;  2RM6 A;  4TXO A;  3C7M A;  3GHA A;  5A4W A;  3LFL A;  3FR9 A;  3QR6 A;  2R5G A;  3O3T A;  4OFN A;  2R0G A;  2FA4 A;  3ZFL A;  3I9V 2;  4XTS A;  1MTC A;  3TDG A;  4KX4 A;  1X5E A;  4ECJ A;  3EE2 A;  3TKS C;  2RUF A;  4ZL9 A;  10GS A;  2JU5 A;  5IIZ A;  4ID0 A;  1WE0 A;  1GTU A;  3FR6 A;  1YEW C;  4I2U A;  3FY7 A;  2MMZ A;  4GCI A;  2I9H A;  4N0V A;  4IN0 A;  2B5Y A;  3HJO A;  2E7P A;  4FIW A;  1OC9 A;  4JR4 A;  2PVO C;  4XS4 A;  2WCI A;  5CRG A;  2HRK A;  4N30 A;  4L8E A;  1AUC A;  1NHY A;  3BBY A;  3RDW A;  5BMU A;  3IPZ A;  2AUV A;  1QQ2 A;  3QDN A;  3JCM L;  2HLS A;  3KP9 A;  4K7O A;  5GSS A;  1XW9 A;  4BL7 B;  4OFM A;  4ECI A;  5HR3 A;  3TKR A;  1M7T A;  2Z9S A;  4K2D A;  2EIQ A;  4MDC A;  2JL4 A;  3GV1 A;  1TDI A;  4G0I A;  4QL9 A;  2L4Q A;  1YVL A;  3P2A A;  1YF0 A;  3VPT A;  4PHZ C;  2LJK A;  3IR4 A;  4V1A p;  2H1D A;  4I2T A;  4KUN A;  2B7K A;  4AKG A;  1ACV A;  2GDR A;  4FO5 A;  2K8V A;  1PKW A;  4KCE A;  1TI3 A;  1N8J A;  1F3B A;  4KAE A;  4EDY A;  3M0F A;  2KUC A;  1B4Q A;  4J56 E;  3LOR A;  4XCS A;  2YPM A;  4HU7 A;  4KA0 A;  1SJZ A;  4X4J A;  3CYN A;  1WMJ A;  2C0G A;  1ZCP A;  4GSN A;  2F3M A;  4JR6 A;  5A1N B;  5B7C A;  4EVM A;  2YWM A;  4MPG A;  2CVB A;  2WW0 A;  1XWK A;  4PUA A;  3KM6 A;  1I1I P;  1OC3 A;  2DIZ A;  1AAZ A;  1V57 A;  4KCA A;  1DE1 A;  1PMT A;  4V1A g;  1LU4 A;  4KDY A;  5CRD A;  3ZL5 A;  1A2J A;  5ELG A;  2A4H A;  3TGZ A;  5KN3 A;  1T1V A;  1HNC A;  1VF1 A;  1YY7 A;  3ERG A;  2VLV A;  3TJB A;  1GTI A;  2OBI A;  4MP4 A;  2H1G A;  5G30 A;  4RQR A;  4DSS B;  5ECQ B;  3WGD A;  3D5J A;  2H0H A;  2P5Q A;  1ZYN A;  4ZBB A;  3IRA A;  3GST A;  5IOX A;  2I4A A;  3UBK A;  3US3 A;  4ICY A;  2V1M A;  4WBJ A;  2QKE A;  2OAC A;  2WZS A;  4D73 B;  3R2Q A;  5DBQ A;  2GSQ A;  1AXD A;  1I5G A;  3MIX A;  4MJA A;  2XPD A;  3Q6O A;  1G7E A;  4WKW A;  4OCE A;  1OKD A;  5ECI B;  5HFI A;  4PNG A;  4AF2 A;  2DC5 A;  2LNS A;  2F8A A;  3CRT A;  2RUE A;  2V6O A;  2GGT A;  4HOJ A;  4IQA A;  2IWT A;  3IK7 A;  2WFC A;  4TR1 A;  1EZK A;  2GSR A;  3G7I A;  4BVY A;  1BJX A;  3IOS A;  4TR4 A;  2C3Q A;  3VWU A;  1SVL A;  5E59 A;  1GUM A;  1GUK A;  4ECB A;  5J41 A;  1XOB A;  1BQ7 A;  5CP1 A;  2YN1 A;  1FOH A;  2QGV A;  5G5F A;  2VM2 A;  2X49 A;  4XHM A;  3EYT A;  2O36 A;  1EGR A;  4IHU A;  3ZLP A;  2LST A;  4NMU A;  1PA3 A;  1UC7 A;  3GL5 A;  5L71 A;  2H1B A;  3TKS E;  3TJK A;  5A34 B;  2EFE A;  2WB9 A;  2I1U A;  2DBC A;  1FO5 A;  1M3J A;  3UIW A;  3ZRE A;  1M9B A;  1YQ1 A;  2K9F A;  3F4R A;  2CX4 A;  2XPE A;  3QFA C;  1G0T A;  3WT2 A;  4MK3 A;  4CHS A;  4V2M A;  5AGY A;  1FW1 A;  3HDC A;  3EIN A;  3RBT A;  2WJU A;  3GA4 A;  4EE0 A;  3QFB C;  1H4O A;  1K3O A;  4L5L A;  5EPF A;  1NW2 A;  4YQU A;  1THX A;  2NTO A;  5CRH A;  5J40 A;  4BWQ A;  3C1R A;  3V1W A;  3L4N A;  1SKW B;  2HNL A;  4AKI A;  1BX9 A;  3QOU A;  2E0Q A;  3ZTL A;  4F9Z A;  1TTZ A;  4POM A;  2GZY A;  3NOF A;  2AV4 A;  5LD0 A;  4F0C A;  2A2S A;  2GQL A;  2EFH A;  1SD9 A;  4HUA A;  4AJ8 A;  1FVK A;  3VFI A;  1VGL A;  4MLY A;  12GS A;  3F3Q A;  1WWJ A;  1XVW A;  1M99 A;  3UOM A;  2HE3 A;  1V40 A;  1GH2 A;  1O73 A;  4ML1 A;  4DSR A;  2IPA A;  1Z3E A;  6GSY A;  2NPB A;  2XBI A;  3FW2 A;  1WPI A;  1K3L A;  2UV8 G;  4DSQ A;  1K3Y A;  3EVI A;  3U6V A;  3KJY A;  5KOW A;  2WW3 A;  1V58 A;  1M2B A;  2IMI A;  4LLR A;  2F9S A;  1IYH A;  1VF4 A;  3KZQ A;  2LNT A;  2DJK A;  3KTB A;  2HSN B;  3F8U A;  6GSX A;  4G19 A;  3CTG A;  2IFQ B;  2IMF A;  4G2E A;  4HJ2 A;  1ERT A;  5CAX A;  3QD9 A;  1JZO A;  3CWG A;  5EVO A;  2CQ9 A;  3FZ4 A;  1MD4 A;  1QXH A;  1U3A A;  3LJR A;  3ZML A;  4NHW A;  2PGT A;  3RPN A;  4Z2R A;  5JCG A;  4TVE A;  2EFC A;  4FYC A;  1G7O A;  4HJM A;  1GUH A;  2WVY A;  3VK9 A;  2FGX A;  4J57 E;  2A4V A;  3KH7 A;  3ZRD A;  1JLV A;  3UBL A;  2ES7 A;  5HQP A;  3J7Y b;  1MDI A;  4L0W A;  2PU9 C;  2PVQ A;  5GAN D;  4HS1 A;  4K8M A;  3Q18 A;  5JWO B;  3CSI A;  2NBS A;  18GS A;  3F4T A;  4XRD A;  2K8S A;  2CZ2 A;  4GWR A;  3A2W A;  2C8U A;  4NAX A;  2NVL A;  5DJL A;  5KEJ A;  3KGK A;  1DUG A;  3FMW A;  2O5V A;  2PWJ A;  5IMA A;  4IW9 A;  2HRF A;  2VCX A;  3ZFB A;  5IQY A;  4ZXG A;  1S3D A;  2H0G A;  3O6T A;  1FOV A;  5DAK A;  3NZN A;  1ZYP A;  4ISD A;  2I3Y A;  2C0E A;  2LKU A;  2JZR A;  2HQT A;  2YV7 A;  1OE8 A;  4ZB9 A;  5KN0 A;  1PGT A;  2GSS A;  3C8E A;  5ECP B;  3F6D A;  3APO A;  2DSA A;  3PIN A;  4YQM A;  3HVN A;  1O6J A;  5IPG A;  2L6D A;  3H4K A;  2FHE A;  1AIU A;  2HSY A;  1O8W A;  1PSQ A;  2GVP A;  2TRC P;  1TRU A;  2LRC A;  3VWV A;  5HR2 A;  1JZD A;  2B5E A;  6GST A;  2WVX B;  5IO2 A;  3LGC A;  5ECH B;  1Y1U A;  4TR3 A;  4K0G A;  5C04 A;  4G0K A;  1PFO A;  5KN1 A;  1EV9 A;  4ILF A;  1YF1 A;  1NM3 A;  2GS3 A;  4K0N A;  4AKX B;  2CZ3 A;  5ELA A;  2L5O A;  3I43 A;  1ERV A;  1T3B A;  3HVV A;  4TXO B;  4MF5 A;  2M72 A;  3HZ8 A;  2WRT A;  2HRN A;  2DJJ A;  1USB A;  5DAL A;  1X9W B;  2R37 A;  4LA1 A;  3LG6 A;  3BCI A;  1FG4 A;  2V41 A;  4MZB A;  4PXO A;  2MMN A;  2PPT A;  5J9B A;  3TKP A;  1Z9H A;  4FQU A;  1THO A;  4Z2T A;  5F06 A;  3L9V A;  3APQ A;  2HXK A;  1SL0 B;  4XRA A;  2H1L A;  3LQ7 A;  1OC9 B;  1SEN A;  4WF4 A;  4XS4 B;  5G1L A;  2HRK B;  4GSS A;  1TXX A;  4K6X A;  2CX3 A;  1EOH A;  1WOU A;  5IO0 A;  5BMU B;  4MPF A;  3F6F A;  4WXT A;  2OE1 A;  4AKH A;  1EEM A;  1FB0 A;  2H01 A;  1K0M A;  4KDU A;  5A4U A;  2C1Y A;  4V2L A;  4CY6 A;  2O3E A;  3EU4 A;  4NHZ A;  2DIY A;  1GRX A;  4ACS A;  1A0R P;  2HYX A;  1Z5Y E;  3ED3 A;  5AIX A;  1TKD B;  2GT6 A;  6GSW A;  3L9U A;  5HR1 A;  4JZQ A;  1JZR A;  2R0P A;  1K0A A;  3F3R A;  4PUF C;  4IVF A;  3VI7 A;  1M2D A;  1DBY A;  4EO3 A;  2C3T A;  3I69 A;  1GSU A;  1J0F A;  3KH9 A;  1SU9 A;  1N25 A;  1M2A A;  2IMD A;  3DD3 A;  5JWR B;  2CA8 A;  4I5Q A;  4CY8 A;  3EUR A;  1A8Y A;  3DKS A;  4MH3 A;  4EIP A;  4HU9 A;  4IJ3 A;  1F37 A;  4WR5 A;  3KTL A;  2TIR A;  3CQF A;  4RQX A;  4G0L A;  1XWA A;  1FB6 A;  1EGO A;  1SYR A;  4K1F A;  5HFG A;  3NIV A;  2B1K A;  4ZIJ A;  2DKI A;  2QSI A;  2L4C A;  3FZ5 A;  2O7K A;  1Z6N A;  2VKZ G;  2KHP A;  1R26 A;  1ZYQ B;  4NWY A;  5EL8 A;  3PPU A;  2B5X A;  1GTA A;  1E6B A;  4EKZ A;  4P3Y B;  3H8Q A;  2OE0 A;  4PNF A;  2FWF A;  4EL1 A;  5J3R A;  1GNE A;  4IQ1 A;  5FWG A;  3TJG A;  4MJE A;  2V2G A;  5JWQ B;  5DDL A;  7GSS A;  3D22 A;  4ML6 A;  3ZMK A;  5D9X A;  3FKF A;  3GUS A;  1AQW A;  1WP0 A;  5ENU A;  4KF9 A;  1S3A A;  1KBN A;  2E2G A;  2DLX A;  1AW9 A;  2BJX A;  3CBU A;  2JAD A;  1W4V A;  5GST A;  1GSE A;  4N0Z A;  4PX1 A;  4WEY A;  3DEX A;  4IKH A;  1Y6E A;  1E2Y A;  5A5H A;  4PGT A;  2GT5 A;  3IC4 A;  3ZVJ A;  3CMI A;  1DE2 A;  1SK1 A;  2LQO A;  5IMZ A;  1QMV A;  3VLN A;  2GLR A;  2KOK A;  4LL1 B;  1UN2 A;  1A2M A;  1XIY A;  3QAG A;  1X9S B;  5DCH A;  2HI7 A;  4L5O A;  5J4Y A;  1GP1 A;  2D2Z A;  4W66 A;  3GSS A;  1H75 A;  2IMK A;  4BVX A;  3UVT A;  5EY6 A;  5H5S A;  2AB6 A;  3DVW A;  3TB2 A;  4AJ6 A;  4TR1 B;  4BVY B;  3GL3 A;  2M80 A;  3H79 A;  1T4Z A;  1YKA A;  1JFU A;  3ZIV A;  3LYK A;  2FA8 A;  1O81 A;  2LJA A;  5F05 A;  1Q98 A;  1XWG A;  4X0X A;  5HR0 A;  3UMA A;  1RW1 A;  5D9W A;  1OC8 A;  3S9F A;  2LTK A;  2RII A;  2VLT A;  2EC4 A;  3UJ1 A;  2H30 A;  3DML A;  5G2Z A;  2WGR A;  2GQK A;  5KOX A;  3ERF A;  1SJ6 A;  2LRN A;  4K7I A;  3Q74 A;  3IDV A;  1F3A A;  2H19 A;  3GKX A;  3WD6 A;  2YJH A;  2R2J A;  4FH8 A;  4H86 A;  2WDU A;  6GSS A;  5G31 A;  1GSQ A;  1MDK A;  3GMF A;  2J9H A;  2FWG A;  4O5Q A;  5IM9 A;  2WW1 A;  2H0I A;  1EWX A;  2C3N A;  4MZW A;  3HKR A;  1Z7P A;  2WVZ A;  3N5O A;  1TRS A;  2OJL A;  4PQH A;  1PL1 A;  1SL2 B;  4G10 A;  1FAA A;  1CQG A;  4JBB A;  3TOT A;  4Q5F A;  1XPV A;  3GRX A;  4K9Z A;  1SKR B;  3RHC A;  2V6K A;  4QQ7 A;  4EC0 A;  3E3E A;  13GS A;  4N3Z A;  4TOP A;  5F8B A;  2I81 A;  3D0Z A;  3PH9 A;  5ECM B;  2H73 A;  2KP2 A;  20GS A;  1TXU A;  5G5E A;  1GUL A;  2QA1 A;  4OO5 A;  3F4S A;  1B8X A;  1GLQ A;  1PX7 A;  3OR5 A;  3CTF A;  3IAM 2;  3QAW A;  5ECN B;  2OKA A;  2HZE A;  2XC2 A;  3DWV A;  5C00 A;  3WYW A;  2H76 A;  4MJB A;  2VCW A;  3A2X A;  1SKS B;  4EUY A;  5DQS A;  4RI6 A;  1GSS A;  2YWO A;  5F07 A;  1QGV A;  3GTU A;  1XWC A;  2N5A A;  2MBS A;  1F6M C;  2B1L A;  2GST A;  3WGX A;  5B8B A;  1A2L A;  3BJ5 A;  5IMV A;  4PUR A;  2VD0 A;  4IP6 A;  5CYY A;  11GS A;  3PGT A;  4HDE A;  1XOA A;  4X1U A;  2M46 A;  2XHF A;  3MAK A;  5GZZ B;  4EF0 A;  4OO4 A;  4E68 A;  2RM5 A;  3IE3 A;  3F63 A;  1V98 A;  2LRT A;  5A4V A;  1ZZY A;  1UA5 A;  4ZBA A;  1YEX A;  1VF3 A;  2CV4 A;  2J23 A;  1XVQ A;  3O76 A;  1V9W A;  2IIY A;  2ZNM A;  4IGJ A;  2X8C A;  4GRF A;  1ZL9 A;  4PQ1 A;  3EMX A;  4ZL7 A;  4K7N A;  2MYG A;  4GF0 A;  1TI1 A;  1YDK A;  1XFL A;  1AC1 A;  2HRA A;  3FR3 A;  5DCG A;  4FYU A;  4I97 A;  1VF2 A;  3RFR C;  1PX6 A;  3IK9 A;  1QFN A;  3ZIT A;  2VO4 A;  2DJ3 A;  3IC8 A;  2VL2 A;  5IMD A;  1S3R A;  5J4U A;  2NDO A;  1XBS A;  1EEJ A;  2YOI A;  4ZB8 A;  3WT1 A;  5IOW A;  1XZO A;  4PQI A;  4N11 A;  2VL9 A;  3EMP A;  2P31 A;  2CVK A;  4WBR D;  4EXJ A;  3GNJ A;  4O7H A;  3E9J B;  3HJM A;  1TRW A;  3QMX A;  2CVD A;  5ID2 A;  4POB A;  2H6Z A;  3CSH A;  3HVX A;  4TKY A;  4TR0 A;  5D93 A;  4BIK A;  4MNN A;  2VCV A;  4JU5 A;  3W8S A;  4IP1 A;  4HQZ A;  3GN3 A;  3KMO A;  3UVH A;  4HZ2 A;  19GS A;  3FK8 A;  4RUV A;  1URM A;  1HQO A;  5DAK B;  4ZBD A;  2HSM A;  5ECR B;  4TW5 A;  3M8N A;  1X5C A;  3ZYW A;  1Z6M A;  3IHG A;  2EIR A;  5IMC A;  3GH9 A;  3DGQ A;  5ECS A;  2H66 A;  3LXT A;  1NHO A;  3P90 A;  1U6T A;  2PMT A;  3D6I A;  3IBH A;  5IMF A;  1SJI A;  3TRQ A;  4K5R A;  3IHQ A;  3TU3 B;  1O8X A;  4F0B A;  2YWI A;  1B4P A;  4OFT A;  3M9K A;  1F9M A;  5G1K A;  3P7X A;  4MH2 A;  1PKZ A;  1J08 A;  1CQH A;  3HZ4 A;  1K0O A;  4QL7 A;  4N10 A;  3LEF A;  1YJ6 A;  5J9C A;  1TK5 B;  4RI7 A;  1A24 A;  4G9H A;  2WVX A;  2K18 A;  1OE7 A;  5J47 A;  2VCT A;  1TK0 B;  4MMM A;  2IL3 A;  2YZH A;  2WS2 A;  3BCK A;  4Z2U A;  4Z7X A;  1XCC A;  3KCM A;  2C80 A;  3UL3 A;  3A5I A;  4GQF A;  5DAL B;  4GDF A;  2ALB A;  3TRX A;  17GS A;  5CRE A;  1S3C A;  1HYU A;  3KEB A;  1M0U A;  1TU8 A;  3VUR A;  1ML6 A;  2H6Y A;  5HFK A;  1R4W A;  4V2N A;  4IEL A;  4E8E A;  3DRN A;  1XXU A;  5D9T A;  3I6A A;  3HJP A;  3H1N A;  4GLT A;  2GZP A;  1WIK A;  4KH7 A;  4OWY A;  2LJR A;  5H5R A;  3FZ9 A;  2FD3 A;  2YAN A;  2PN8 A;  4DVC A;  5ECO B;  2C4J A;  3GX0 A;  1XW5 A;  1Y25 A;  4BPY A;  2LV3 A;  2X4A A;  4CW9 A;  1ON4 A;  1BED A;  1SVM A;  5FHI A;  1ZYE A;  4ZB6 A;  2PUK C;  3LWA A;  1BG1 A;  4KDX A;  4YAV A;  3D4T A;  2TRX A;  5D73 A;  4MAB A;  4X43 A;  3TJJ A;  4WF5 A;  3VWW A;  2LQQ A;  3M9J A;  3GX8 A;  4HQS A;  3HMJ G;  4LMV A;  5LNK e;  5DJM A;  4PI0 C;  2K6V A;  4BL7 A;  5JCW A;  1R5P A;  1TU7 A;  3SWL A;  3LW9 A;  1Q4J A;  4IJI A;  2EIO A;  1T00 A;  5A5K A;  1T4Y A;  3TKS A;  3LYP A;  4JRR A;  5B8A A;  4NV5 A;  5B6N A;  4MZC A;  1VRS D;  2VOC A;  3VWX A;  3HHV A;  3HVS A;  3BOA A;  1I9D A;  5DQY A;  1GSD A;  1F2E A;  1K0N A;  5JCU A;  1GWC A;  1RK4 A;  3D4M A;  1K0B A;  3GIX A;  1RQM A;  3C1S A;  4TRX A;  1SK0 A;  3HA9 A;  3TCO A;  2X99 A;  3MSZ A;  2HSH A;  1A8L A;  3CSJ A;  3EWL A;  4A5P A;  4PI2 C;  2JSY A;  3GKK A;  2RLI A;  2VLU A;  4HZ4 A;  1YZX A;  2R6K A;  1HD2 A;  1ZMA A;  3DVX A;  4K5S A;  5LCZ A;  2YP6 A;  5A1N A;  2H70 A;  1TOF A;  3F9U A;  2VAF A;  1KEB A;  2VCZ A;  2DML A;  2HZF A;  4O5R A;  4WET A;  2IME A;  3Q19 A;  5J4V A;  2E2M A;  3GFK A;  2OBK A;  2CAI A;  1O85 A;  3CXG A;  3WGE A;  2YNX A;  5D8I A;  3A2V A;  3K8N A;  2OA7 A;  3KXO A;  1YEP A;  1X9M B;  4EIQ A;  2BMX A;  2P5R A;  2IJY A;  3DYR A;  2DJ0 A;  5A5H B;  1PN9 A;  4MA9 A;  3RPP A;  5B6M A;  1KNG A;  5GAP D;  3KMN A;  3MDK A;  3GYK A;  3UEM A;  3PR8 A;  2FY6 A;  4DSS A;  4NPB A;  2PER A;  2VCQ A;  5J5N A;  4NV2 A;  2H71 A;  2F51 A;  1WJK A;  1T7P B;  2A2P A;  2DMM A;  1W89 A;  2ZUP A;  2ON5 A;  4I8B A;  3VI5 A;  4D73 A;  4KB3 A;  2GQM A;  4POK A;  2MMO A;  2DJ1 A;  1LJR A;  2R0C A;  4YKG A;  1K0C A;  2FCH A;  3CRU A;  2OE3 A;  3W6G A;  3GH6 A;  4BVX B;  1QK8 A;  2MZC A;  1ZOF A;  2OAD A;  4TN8 A;  1R7H A;  4Q5N A;  4USS A;  3TRP A;  3FRC A;  2AAW A;  3HXS A;  4OCF A;  1OYJ A;  4AJ7 A;  5AN1 A;  3LSZ A;  1JHB A;  4QMK A;  3R3E A;  2N5F A;  2GTU A;  1GSY A;  1ERU A;  2H8L A;  4KND A;  4POL A;  2X64 A;  2YJ7 A;  3L9S A;  2H6X A;  3EU3 A;  2B7J A;  2IN3 A;  2A2R A;  3TOU A;  3C73 A;  4K2X A;  3C71 A;  1ERW A;  1IYI A;  1B9X C;  4YH2 A;  2H74 A;  1PD2 1;  4MF6 A;  2WW2 A;  3M1G A;  4L0U A;  1SYX A;  1BG5 A;  2C0D A;  2X8G A;  4CDO A;  1GL8 A;  2AYT A;  1SD8 A;  1O7U A;  1BF5 A;  1K0D A;  3DIE A;  2WZ9 A;  4Q5R A;  4GTU A;  3KP8 A;  2L6C A;  5A34 A;  1TK8 B;  3MNG A;  1PQN A;  4ZL8 A;  2DJ2 A;  5INY A;  1NSW A;  2CT6 A;  3FZA A;  1GLP A;  1G6W A;  2V32 A;  2YWN A;  5CRW A;  2O89 A;  1XWB A;  2R3X A;  4F03 A;  1WRY A;  2VL3 A;  4F2I A;  4HEA 2;  1YKC A;  3GUR A;  3F0I A;  3L0H A;  2VM1 A;  3FYG A;  3APS A;  4GQC A;  3BD2 A;  2X8H A;  2AHE A;  6GSV A;  4EDZ A;  4WR4 A;  4FYB A;  2YZU A;  1A0F A;  2H1A A;  4AGS A;  1LBK A;  4HI7 A;  1MEK A;  1U87 A;  2JAC A;  2KP1 A;  3E0U A;  2L57 A;  3RGB C;  3G9B A;  2BTO T;  2VUP A;  1M9A A;  9GSS A;  5ABR A;  2HZE B;  2B6M A;  2MMA A;  1X5D A;  2O8V B;  1GSF A;  1ZGN A;  1GNW A;  2R4V A;  3IXR A;  4MCU A;  1ST9 A;  1PL2 A;  2FNO A;  4DEJ A;  2CAQ A;  4BWS A;  1FHE A;  1EP7 A;  2FWE A;  1G6Y A;  1EV4 A;  5H5Q A;  1X0R A;  3P8W A;  4LL4 B;  2G0F A;  3GTU B;  1ABA A;  2QC7 A;  4O5U A;  2L5L A;  1SL1 B;  2F8F A;  2P0G A;  1TW9 A;  2VL2 C;  5ECL B;  2L59 A;  1MD3 A;  4KSO A;  1R5A A;  5COH A;  4PTS A;  3QCP A;  2O85 A;  3AY8 A;  2HFD A;  3G7Y A;  2N5B A;  1V2A A;  1PN0 A;  1KTE A;  1C72 A;  4KE3 A;  2H72 A;  1N2A A;  2B3S A;  5IPH A;  4YQV A;  16GS A;  2FLS A;  6GSU A;  3FHK A;  5E4W A;  4ECC A;  1TJD A;  3HCZ A;  2QA2 A;  1BYE A;  3EPT A;  4KW6 A;  5DVB A;  3MYD A;  3GKM A;  1ILO A;  2O87 A;  5FT3 A;  8GSS A;  3TJF A;  1GTB A;  2HSN A;  5CO3 A;  4KSM A;  3L78 A;  2DKH A;  2IFQ A;  2LUS A;  3CHX C;  1A23 A;  2LEG A;  3UAP A;  1U88 A;  2YV9 A;  3IA1 A;  4OD7 A;  1B48 A;  1EP8 A;  4E8H A;  1SK2 A;  4NXI A;  2ZCT A;  4KGI A;  5D9V A;  4XS6 A;  2LS5 A;  3N9J A;  3FEU A;  1B9Y C;  2KLX A;  1XG8 A;  2YCD A;  3LXZ A;  4XS1 A;  4JE1 A;  2FUG 2;  2FWH A;  3EC3 A;  3GKN A;  2JSZ A;  2VIM A;  2G2Q A;  4Q5Q A;  1DSB A;  1QUW A;  3G7J A;  2HT9 A;  2H75 A;  5ID2 B;  1TRV A;  4O32 A;  4MF7 A;  2EFD A;  3A3T A;  4J2F A;  1S4B P;  3A5W A;  2OT3 A;  5ECK B;  4MJC A;  3U5R E;  2HSM B;  3ZVJ D;  2ON7 A;  1TP9 A;  14GS A;  2UZ8 A;  3IAS 2;  3HYP A;  1XW6 A;  1OKT A;  3H93 A;  4TXV A;  2AJQ B;  5F0G A;  3SBC A;  3TKQ A;  1EOG A;  2JZT A;  3DXB A;  4G01 A;  4ZB7 A;  4I6X A;  4HSC X;  5BRT A;  3UAR A;  4OMV A;  3M3M A;  1T8E B;  4LMW A;  4GST A;  3ME8 A;  1M3I A;  4ULX A;  3ME7 A;  4O92 A;  3ERW A;  1HNB A;  3W8J A;  3ZZX A;  3IV4 A;  4AI6 A; 
#chains in the Genus database with same CATH homology
 5CNW A;  1UVZ A;  3RAZ A;  1SVO A;  4ZIL A;  3KD0 A;  3D21 A;  3HD5 A;  3MWH A;  3QPM A;  3J7Y k;  3ZIJ A;  3HY2 A;  1HNA A;  1JLW A;  5AIV A;  3RHB A;  1MDJ A;  4YAP A;  2XBQ A;  4JED A;  1Z7R A;  22GS A;  3VPQ A;  3ISO A;  2VD1 A;  2MBT A;  2WUL A;  4F82 A;  1AQX A;  4IS0 A;  1BAY A;  2GZZ A;  4GXZ A;  2C0F A;  2JZS A;  1OVN A;  1U3I A;  1AQV A;  1JZW A;  2REM A;  4XIH A;  4IBP A;  5KN2 A;  5AIS A;  1FVJ A;  1PRX A;  3QAV A;  4BA7 A;  1J9B A;  3KIJ A;  1OAZ A;  5D96 A;  3TUE A;  2PBJ A;  4YKF A;  2RM6 A;  4TXO A;  3C7M A;  3GHA A;  5A4W A;  3LFL A;  3FR9 A;  3QR6 A;  2R5G A;  3O3T A;  4OFN A;  2R0G A;  2FA4 A;  3ZFL A;  3I9V 2;  4XTS A;  1MTC A;  3TDG A;  4KX4 A;  1X5E A;  4ECJ A;  3EE2 A;  3TKS C;  2RUF A;  4ZL9 A;  10GS A;  2JU5 A;  5IIZ A;  4ID0 A;  1WE0 A;  1GTU A;  3FR6 A;  4I2U A;  3FY7 A;  2MMZ A;  4GCI A;  2I9H A;  4N0V A;  4IN0 A;  2B5Y A;  3HJO A;  2E7P A;  4FIW A;  1OC9 A;  4JR4 A;  2PVO C;  4XS4 A;  2WCI A;  5CRG A;  2HRK A;  4N30 A;  4L8E A;  1AUC A;  1NHY A;  3BBY A;  3RDW A;  5BMU A;  3IPZ A;  2AUV A;  1QQ2 A;  3QDN A;  3JCM L;  2HLS A;  3KP9 A;  4K7O A;  5GSS A;  1XW9 A;  4BL7 B;  4OFM A;  4ECI A;  5HR3 A;  3TKR A;  1M7T A;  2Z9S A;  4K2D A;  2EIQ A;  4MDC A;  2JL4 A;  3GV1 A;  1TDI A;  4G0I A;  4QL9 A;  2L4Q A;  1YVL A;  3P2A A;  1YF0 A;  3VPT A;  2LJK A;  3IR4 A;  4V1A p;  2H1D A;  4I2T A;  4KUN A;  2B7K A;  4AKG A;  1ACV A;  2GDR A;  4FO5 A;  2K8V A;  1PKW A;  4KCE A;  1TI3 A;  1N8J A;  1F3B A;  4KAE A;  4EDY A;  3M0F A;  2KUC A;  1B4Q A;  4J56 E;  3LOR A;  4XCS A;  2YPM A;  4HU7 A;  4KA0 A;  1SJZ A;  4X4J A;  3CYN A;  1WMJ A;  2C0G A;  1ZCP A;  4GSN A;  2F3M A;  4JR6 A;  5A1N B;  5B7C A;  4EVM A;  2YWM A;  4MPG A;  2CVB A;  1XWK A;  4PUA A;  3KM6 A;  1OC3 A;  2DIZ A;  1AAZ A;  1V57 A;  4KCA A;  1DE1 A;  1PMT A;  4V1A g;  1LU4 A;  4KDY A;  5CRD A;  3ZL5 A;  1A2J A;  5ELG A;  2A4H A;  3TGZ A;  5KN3 A;  1T1V A;  1HNC A;  1VF1 A;  1YY7 A;  3ERG A;  2VLV A;  3TJB A;  1GTI A;  2OBI A;  4MP4 A;  2H1G A;  5G30 A;  4RQR A;  4DSS B;  5ECQ B;  3WGD A;  3D5J A;  2H0H A;  2P5Q A;  1ZYN A;  4ZBB A;  3IRA A;  3GST A;  5IOX A;  2I4A A;  3UBK A;  3US3 A;  4ICY A;  2V1M A;  4WBJ A;  2QKE A;  2OAC A;  4D73 B;  3R2Q A;  5DBQ A;  2GSQ A;  1AXD A;  1I5G A;  3MIX A;  4MJA A;  2XPD A;  3Q6O A;  1G7E A;  4WKW A;  4OCE A;  1OKD A;  5ECI B;  5HFI A;  4PNG A;  4AF2 A;  2DC5 A;  2LNS A;  2F8A A;  3CRT A;  2RUE A;  2V6O A;  2GGT A;  4HOJ A;  4IQA A;  2IWT A;  3IK7 A;  2WFC A;  4TR1 A;  1EZK A;  2GSR A;  3G7I A;  4BVY A;  1BJX A;  3IOS A;  4TR4 A;  2C3Q A;  3VWU A;  1SVL A;  5E59 A;  1GUM A;  1GUK A;  4ECB A;  5J41 A;  1XOB A;  1BQ7 A;  5CP1 A;  2YN1 A;  1FOH A;  2QGV A;  5G5F A;  2VM2 A;  2X49 A;  4XHM A;  3EYT A;  1EGR A;  4IHU A;  3ZLP A;  2LST A;  4NMU A;  1PA3 A;  1UC7 A;  3GL5 A;  5L71 A;  2H1B A;  3TKS E;  3TJK A;  5A34 B;  2EFE A;  2WB9 A;  2I1U A;  2DBC A;  1FO5 A;  3UIW A;  3ZRE A;  1M9B A;  1YQ1 A;  2K9F A;  3F4R A;  2CX4 A;  2XPE A;  3QFA C;  1G0T A;  3WT2 A;  4MK3 A;  4CHS A;  4V2M A;  5AGY A;  1FW1 A;  3HDC A;  3EIN A;  3RBT A;  2WJU A;  3GA4 A;  4EE0 A;  3QFB C;  1H4O A;  1K3O A;  4L5L A;  5EPF A;  1NW2 A;  4YQU A;  1THX A;  2NTO A;  5CRH A;  5J40 A;  4BWQ A;  3C1R A;  3V1W A;  3L4N A;  1SKW B;  2HNL A;  4AKI A;  1BX9 A;  3QOU A;  2E0Q A;  3ZTL A;  4F9Z A;  1TTZ A;  4POM A;  2GZY A;  3NOF A;  2AV4 A;  5LD0 A;  4F0C A;  2A2S A;  2GQL A;  2EFH A;  1SD9 A;  4HUA A;  4AJ8 A;  1FVK A;  3VFI A;  1VGL A;  4MLY A;  12GS A;  3F3Q A;  1WWJ A;  1XVW A;  1M99 A;  3UOM A;  2HE3 A;  1V40 A;  1GH2 A;  1O73 A;  4ML1 A;  4DSR A;  2IPA A;  1Z3E A;  6GSY A;  2NPB A;  2XBI A;  3FW2 A;  1WPI A;  1K3L A;  2UV8 G;  4DSQ A;  1K3Y A;  3EVI A;  3U6V A;  3KJY A;  5KOW A;  1V58 A;  1M2B A;  2IMI A;  4LLR A;  2F9S A;  1IYH A;  1VF4 A;  3KZQ A;  2LNT A;  2DJK A;  3KTB A;  2HSN B;  3F8U A;  6GSX A;  4G19 A;  3CTG A;  2IFQ B;  2IMF A;  4G2E A;  4HJ2 A;  1ERT A;  5CAX A;  3QD9 A;  1JZO A;  3CWG A;  5EVO A;  2CQ9 A;  3FZ4 A;  1MD4 A;  1QXH A;  1U3A A;  3LJR A;  3ZML A;  4NHW A;  2PGT A;  3RPN A;  4Z2R A;  5JCG A;  4TVE A;  2EFC A;  4FYC A;  1G7O A;  4HJM A;  1GUH A;  3VK9 A;  2FGX A;  4J57 E;  2A4V A;  3KH7 A;  3ZRD A;  1JLV A;  3UBL A;  2ES7 A;  5HQP A;  3J7Y b;  1MDI A;  4L0W A;  2PU9 C;  2PVQ A;  5GAN D;  4HS1 A;  4K8M A;  3Q18 A;  5JWO B;  3CSI A;  2NBS A;  18GS A;  3F4T A;  4XRD A;  2K8S A;  2CZ2 A;  4GWR A;  3A2W A;  2C8U A;  4NAX A;  2NVL A;  5DJL A;  5KEJ A;  3KGK A;  1DUG A;  3FMW A;  2O5V A;  2PWJ A;  5IMA A;  4IW9 A;  2HRF A;  2VCX A;  3ZFB A;  5IQY A;  4ZXG A;  1S3D A;  2H0G A;  3O6T A;  1FOV A;  5DAK A;  3NZN A;  1ZYP A;  4ISD A;  2I3Y A;  2C0E A;  2LKU A;  2JZR A;  2HQT A;  2YV7 A;  1OE8 A;  4ZB9 A;  5KN0 A;  1PGT A;  2GSS A;  3C8E A;  5ECP B;  3F6D A;  3APO A;  2DSA A;  3PIN A;  4YQM A;  1O6J A;  5IPG A;  2L6D A;  3H4K A;  2FHE A;  1AIU A;  2HSY A;  1O8W A;  1PSQ A;  2GVP A;  2TRC P;  1TRU A;  2LRC A;  3VWV A;  5HR2 A;  1JZD A;  2B5E A;  6GST A;  5IO2 A;  3LGC A;  5ECH B;  1Y1U A;  4TR3 A;  4K0G A;  5C04 A;  4G0K A;  5KN1 A;  1EV9 A;  4ILF A;  1YF1 A;  1NM3 A;  2GS3 A;  4K0N A;  4AKX B;  2CZ3 A;  5ELA A;  2L5O A;  3I43 A;  1ERV A;  1T3B A;  3HVV A;  4TXO B;  4MF5 A;  2M72 A;  3HZ8 A;  2WRT A;  2HRN A;  2DJJ A;  1USB A;  5DAL A;  1X9W B;  2R37 A;  4LA1 A;  3LG6 A;  3BCI A;  1FG4 A;  2V41 A;  4MZB A;  4PXO A;  2MMN A;  2PPT A;  5J9B A;  3TKP A;  1Z9H A;  4FQU A;  1THO A;  4Z2T A;  5F06 A;  3L9V A;  3APQ A;  2HXK A;  1SL0 B;  4XRA A;  2H1L A;  3LQ7 A;  1OC9 B;  1SEN A;  4WF4 A;  4XS4 B;  5G1L A;  2HRK B;  4GSS A;  1TXX A;  4K6X A;  2CX3 A;  1EOH A;  1WOU A;  5IO0 A;  5BMU B;  4MPF A;  3F6F A;  4WXT A;  2OE1 A;  4AKH A;  1EEM A;  1FB0 A;  2H01 A;  1K0M A;  4KDU A;  5A4U A;  2C1Y A;  4V2L A;  4CY6 A;  3EU4 A;  4NHZ A;  2DIY A;  1GRX A;  4ACS A;  1A0R P;  2HYX A;  1Z5Y E;  3ED3 A;  5AIX A;  1TKD B;  2GT6 A;  6GSW A;  3L9U A;  5HR1 A;  4JZQ A;  1JZR A;  2R0P A;  1K0A A;  3F3R A;  4PUF C;  4IVF A;  3VI7 A;  1M2D A;  1DBY A;  4EO3 A;  2C3T A;  3I69 A;  1GSU A;  1J0F A;  3KH9 A;  1SU9 A;  1N25 A;  1M2A A;  2IMD A;  3DD3 A;  5JWR B;  2CA8 A;  4I5Q A;  4CY8 A;  3EUR A;  1A8Y A;  3DKS A;  4MH3 A;  4EIP A;  4HU9 A;  4IJ3 A;  1F37 A;  4WR5 A;  3KTL A;  2TIR A;  4RQX A;  4G0L A;  1XWA A;  1FB6 A;  1EGO A;  1SYR A;  4K1F A;  5HFG A;  3NIV A;  2B1K A;  4ZIJ A;  2DKI A;  2QSI A;  2L4C A;  3FZ5 A;  2O7K A;  1Z6N A;  2VKZ G;  2KHP A;  1R26 A;  1ZYQ B;  4NWY A;  5EL8 A;  3PPU A;  2B5X A;  1GTA A;  1E6B A;  4EKZ A;  4P3Y B;  3H8Q A;  2OE0 A;  4PNF A;  2FWF A;  4EL1 A;  5J3R A;  1GNE A;  4IQ1 A;  5FWG A;  3TJG A;  4MJE A;  2V2G A;  5JWQ B;  5DDL A;  7GSS A;  3D22 A;  4ML6 A;  3ZMK A;  5D9X A;  3FKF A;  3GUS A;  1AQW A;  1WP0 A;  5ENU A;  4KF9 A;  1S3A A;  1KBN A;  2E2G A;  2DLX A;  1AW9 A;  2BJX A;  3CBU A;  2JAD A;  1W4V A;  5GST A;  1GSE A;  4N0Z A;  4PX1 A;  4WEY A;  3DEX A;  4IKH A;  1Y6E A;  1E2Y A;  5A5H A;  4PGT A;  2GT5 A;  3IC4 A;  3ZVJ A;  3CMI A;  1DE2 A;  1SK1 A;  2LQO A;  5IMZ A;  1QMV A;  3VLN A;  2GLR A;  2KOK A;  4LL1 B;  1UN2 A;  1A2M A;  1XIY A;  3QAG A;  1X9S B;  5DCH A;  2HI7 A;  4L5O A;  5J4Y A;  1GP1 A;  2D2Z A;  4W66 A;  3GSS A;  1H75 A;  2IMK A;  4BVX A;  3UVT A;  5EY6 A;  5H5S A;  2AB6 A;  3DVW A;  3TB2 A;  4AJ6 A;  4TR1 B;  4BVY B;  3GL3 A;  2M80 A;  3H79 A;  1T4Z A;  1YKA A;  1JFU A;  3ZIV A;  3LYK A;  2FA8 A;  1O81 A;  2LJA A;  5F05 A;  1Q98 A;  1XWG A;  4X0X A;  5HR0 A;  3UMA A;  1RW1 A;  5D9W A;  1OC8 A;  3S9F A;  2LTK A;  2RII A;  2VLT A;  2EC4 A;  3UJ1 A;  2H30 A;  3DML A;  5G2Z A;  2WGR A;  2GQK A;  5KOX A;  3ERF A;  1SJ6 A;  2LRN A;  4K7I A;  3Q74 A;  3IDV A;  1F3A A;  2H19 A;  3GKX A;  3WD6 A;  2YJH A;  2R2J A;  4FH8 A;  4H86 A;  2WDU A;  6GSS A;  5G31 A;  1GSQ A;  1MDK A;  3GMF A;  2J9H A;  2FWG A;  4O5Q A;  5IM9 A;  2H0I A;  1EWX A;  2C3N A;  4MZW A;  3HKR A;  1Z7P A;  3N5O A;  1TRS A;  2OJL A;  4PQH A;  1PL1 A;  1SL2 B;  4G10 A;  1FAA A;  1CQG A;  4JBB A;  3TOT A;  4Q5F A;  1XPV A;  3GRX A;  4K9Z A;  1SKR B;  3RHC A;  2V6K A;  4QQ7 A;  4EC0 A;  3E3E A;  13GS A;  4N3Z A;  4TOP A;  5F8B A;  2I81 A;  3D0Z A;  3PH9 A;  5ECM B;  2H73 A;  2KP2 A;  20GS A;  1TXU A;  5G5E A;  1GUL A;  2QA1 A;  4OO5 A;  3F4S A;  1B8X A;  1GLQ A;  1PX7 A;  3OR5 A;  3CTF A;  3IAM 2;  3QAW A;  5ECN B;  2OKA A;  2HZE A;  2XC2 A;  3DWV A;  5C00 A;  3WYW A;  2H76 A;  4MJB A;  2VCW A;  3A2X A;  1SKS B;  4EUY A;  5DQS A;  4RI6 A;  1GSS A;  2YWO A;  5F07 A;  1QGV A;  3GTU A;  1XWC A;  2N5A A;  2MBS A;  1F6M C;  2B1L A;  2GST A;  3WGX A;  5B8B A;  1A2L A;  3BJ5 A;  5IMV A;  4PUR A;  2VD0 A;  4IP6 A;  5CYY A;  11GS A;  3PGT A;  4HDE A;  1XOA A;  4X1U A;  2M46 A;  2XHF A;  3MAK A;  5GZZ B;  4EF0 A;  4OO4 A;  4E68 A;  2RM5 A;  3IE3 A;  3F63 A;  1V98 A;  2LRT A;  5A4V A;  1ZZY A;  1UA5 A;  4ZBA A;  1YEX A;  1VF3 A;  2CV4 A;  2J23 A;  1XVQ A;  3O76 A;  1V9W A;  2IIY A;  2ZNM A;  4IGJ A;  2X8C A;  4GRF A;  1ZL9 A;  4PQ1 A;  3EMX A;  4ZL7 A;  4K7N A;  2MYG A;  4GF0 A;  1TI1 A;  1YDK A;  1XFL A;  1AC1 A;  2HRA A;  3FR3 A;  5DCG A;  4FYU A;  4I97 A;  1VF2 A;  1PX6 A;  3IK9 A;  1QFN A;  3ZIT A;  2VO4 A;  2DJ3 A;  3IC8 A;  2VL2 A;  5IMD A;  5J4U A;  2NDO A;  1XBS A;  1EEJ A;  2YOI A;  4ZB8 A;  3WT1 A;  5IOW A;  1XZO A;  4PQI A;  4N11 A;  2VL9 A;  3EMP A;  2P31 A;  2CVK A;  4WBR D;  4EXJ A;  3GNJ A;  4O7H A;  3E9J B;  3HJM A;  1TRW A;  3QMX A;  2CVD A;  5ID2 A;  4POB A;  2H6Z A;  3CSH A;  3HVX A;  4TKY A;  4TR0 A;  5D93 A;  4MNN A;  2VCV A;  4JU5 A;  3W8S A;  4IP1 A;  4HQZ A;  3GN3 A;  3KMO A;  3UVH A;  4HZ2 A;  19GS A;  3FK8 A;  4RUV A;  1URM A;  1HQO A;  5DAK B;  4ZBD A;  2HSM A;  5ECR B;  4TW5 A;  3M8N A;  1X5C A;  3ZYW A;  1Z6M A;  3IHG A;  2EIR A;  5IMC A;  3GH9 A;  3DGQ A;  5ECS A;  2H66 A;  3LXT A;  1NHO A;  3P90 A;  1U6T A;  2PMT A;  3D6I A;  3IBH A;  5IMF A;  1SJI A;  3TRQ A;  4K5R A;  3IHQ A;  3TU3 B;  1O8X A;  4F0B A;  2YWI A;  1B4P A;  4OFT A;  3M9K A;  1F9M A;  5G1K A;  3P7X A;  4MH2 A;  1PKZ A;  1J08 A;  1CQH A;  3HZ4 A;  1K0O A;  4QL7 A;  4N10 A;  3LEF A;  1YJ6 A;  5J9C A;  1TK5 B;  4RI7 A;  1A24 A;  4G9H A;  2K18 A;  1OE7 A;  5J47 A;  2VCT A;  1TK0 B;  4MMM A;  2IL3 A;  2YZH A;  2WS2 A;  3BCK A;  4Z2U A;  4Z7X A;  1XCC A;  3KCM A;  2C80 A;  3UL3 A;  3A5I A;  4GQF A;  5DAL B;  4GDF A;  2ALB A;  3TRX A;  17GS A;  5CRE A;  1S3C A;  1HYU A;  3KEB A;  1M0U A;  1TU8 A;  3VUR A;  1ML6 A;  2H6Y A;  5HFK A;  1R4W A;  4V2N A;  4IEL A;  4E8E A;  3DRN A;  1XXU A;  5D9T A;  3I6A A;  3HJP A;  3H1N A;  4GLT A;  2GZP A;  1WIK A;  4KH7 A;  4OWY A;  2LJR A;  5H5R A;  3FZ9 A;  2FD3 A;  2YAN A;  2PN8 A;  4DVC A;  5ECO B;  2C4J A;  3GX0 A;  1XW5 A;  1Y25 A;  4BPY A;  2LV3 A;  2X4A A;  4CW9 A;  1ON4 A;  1BED A;  1SVM A;  5FHI A;  1ZYE A;  4ZB6 A;  2PUK C;  3LWA A;  1BG1 A;  4KDX A;  4YAV A;  3D4T A;  2TRX A;  5D73 A;  4MAB A;  4X43 A;  3TJJ A;  4WF5 A;  3VWW A;  2LQQ A;  3M9J A;  3GX8 A;  4HQS A;  3HMJ G;  4LMV A;  5LNK e;  5DJM A;  2K6V A;  4BL7 A;  5JCW A;  1R5P A;  1TU7 A;  3SWL A;  3LW9 A;  1Q4J A;  4IJI A;  2EIO A;  1T00 A;  5A5K A;  1T4Y A;  3TKS A;  3LYP A;  4JRR A;  5B8A A;  4NV5 A;  5B6N A;  4MZC A;  1VRS D;  2VOC A;  3VWX A;  3HHV A;  3HVS A;  3BOA A;  1I9D A;  5DQY A;  1GSD A;  1F2E A;  1K0N A;  5JCU A;  1GWC A;  1RK4 A;  3D4M A;  1K0B A;  3GIX A;  1RQM A;  3C1S A;  4TRX A;  1SK0 A;  3HA9 A;  3TCO A;  2X99 A;  3MSZ A;  2HSH A;  1A8L A;  3CSJ A;  3EWL A;  4A5P A;  2JSY A;  3GKK A;  2RLI A;  2VLU A;  4HZ4 A;  1YZX A;  2R6K A;  1HD2 A;  1ZMA A;  3DVX A;  4K5S A;  5LCZ A;  2YP6 A;  5A1N A;  2H70 A;  1TOF A;  3F9U A;  2VAF A;  1KEB A;  2VCZ A;  2DML A;  2HZF A;  4O5R A;  4WET A;  2IME A;  3Q19 A;  5J4V A;  2E2M A;  3GFK A;  2OBK A;  2CAI A;  1O85 A;  3CXG A;  3WGE A;  2YNX A;  5D8I A;  3A2V A;  3K8N A;  2OA7 A;  3KXO A;  1YEP A;  1X9M B;  4EIQ A;  2BMX A;  2P5R A;  2IJY A;  3DYR A;  2DJ0 A;  5A5H B;  1PN9 A;  4MA9 A;  3RPP A;  5B6M A;  1KNG A;  5GAP D;  3KMN A;  3MDK A;  3GYK A;  3UEM A;  3PR8 A;  2FY6 A;  4DSS A;  4NPB A;  2PER A;  2VCQ A;  5J5N A;  4NV2 A;  2H71 A;  2F51 A;  1WJK A;  1T7P B;  2A2P A;  2DMM A;  1W89 A;  2ZUP A;  2ON5 A;  4I8B A;  3VI5 A;  4D73 A;  4KB3 A;  2GQM A;  4POK A;  2MMO A;  2DJ1 A;  1LJR A;  2R0C A;  4YKG A;  1K0C A;  2FCH A;  3CRU A;  2OE3 A;  3W6G A;  3GH6 A;  4BVX B;  1QK8 A;  2MZC A;  1ZOF A;  2OAD A;  4TN8 A;  1R7H A;  4Q5N A;  4USS A;  3TRP A;  3FRC A;  2AAW A;  3HXS A;  4OCF A;  1OYJ A;  4AJ7 A;  5AN1 A;  3LSZ A;  1JHB A;  4QMK A;  3R3E A;  2N5F A;  2GTU A;  1GSY A;  1ERU A;  2H8L A;  4KND A;  4POL A;  2X64 A;  2YJ7 A;  3L9S A;  2H6X A;  3EU3 A;  2B7J A;  2IN3 A;  2A2R A;  3TOU A;  3C73 A;  4K2X A;  3C71 A;  1ERW A;  1IYI A;  1B9X C;  4YH2 A;  2H74 A;  1PD2 1;  4MF6 A;  3M1G A;  4L0U A;  1SYX A;  1BG5 A;  2C0D A;  2X8G A;  4CDO A;  1GL8 A;  2AYT A;  1SD8 A;  1O7U A;  1BF5 A;  1K0D A;  3DIE A;  2WZ9 A;  4Q5R A;  4GTU A;  3KP8 A;  2L6C A;  5A34 A;  1TK8 B;  3MNG A;  1PQN A;  4ZL8 A;  2DJ2 A;  5INY A;  1NSW A;  2CT6 A;  3FZA A;  1GLP A;  1G6W A;  2V32 A;  2YWN A;  5CRW A;  2O89 A;  1XWB A;  2R3X A;  4F03 A;  1WRY A;  2VL3 A;  4F2I A;  4HEA 2;  1YKC A;  3GUR A;  3F0I A;  3L0H A;  2VM1 A;  3FYG A;  3APS A;  4GQC A;  3BD2 A;  2X8H A;  2AHE A;  6GSV A;  4EDZ A;  4WR4 A;  4FYB A;  2YZU A;  1A0F A;  2H1A A;  4AGS A;  1LBK A;  4HI7 A;  1MEK A;  1U87 A;  2JAC A;  2KP1 A;  3E0U A;  2L57 A;  3G9B A;  2BTO T;  2VUP A;  1M9A A;  9GSS A;  5ABR A;  2HZE B;  2B6M A;  2MMA A;  1X5D A;  2O8V B;  1GSF A;  1ZGN A;  1GNW A;  2R4V A;  3IXR A;  4MCU A;  1ST9 A;  1PL2 A;  2FNO A;  4DEJ A;  2CAQ A;  4BWS A;  1FHE A;  1EP7 A;  2FWE A;  1G6Y A;  1EV4 A;  5H5Q A;  1X0R A;  3P8W A;  4LL4 B;  2G0F A;  3GTU B;  1ABA A;  2QC7 A;  4O5U A;  2L5L A;  1SL1 B;  2F8F A;  2P0G A;  1TW9 A;  2VL2 C;  5ECL B;  2L59 A;  1MD3 A;  4KSO A;  1R5A A;  5COH A;  4PTS A;  3QCP A;  2O85 A;  3AY8 A;  2HFD A;  3G7Y A;  2N5B A;  1V2A A;  1PN0 A;  1KTE A;  1C72 A;  4KE3 A;  2H72 A;  1N2A A;  2B3S A;  5IPH A;  4YQV A;  16GS A;  2FLS A;  6GSU A;  3FHK A;  5E4W A;  4ECC A;  1TJD A;  3HCZ A;  2QA2 A;  1BYE A;  3EPT A;  4KW6 A;  5DVB A;  3MYD A;  3GKM A;  1ILO A;  2O87 A;  5FT3 A;  8GSS A;  3TJF A;  1GTB A;  2HSN A;  5CO3 A;  4KSM A;  3L78 A;  2DKH A;  2IFQ A;  2LUS A;  1A23 A;  2LEG A;  3UAP A;  1U88 A;  2YV9 A;  3IA1 A;  4OD7 A;  1B48 A;  1EP8 A;  4E8H A;  1SK2 A;  4NXI A;  2ZCT A;  4KGI A;  5D9V A;  4XS6 A;  2LS5 A;  3N9J A;  3FEU A;  1B9Y C;  2KLX A;  2YCD A;  3LXZ A;  4XS1 A;  4JE1 A;  2FUG 2;  2FWH A;  3EC3 A;  3GKN A;  2JSZ A;  2VIM A;  2G2Q A;  4Q5Q A;  1DSB A;  1QUW A;  3G7J A;  2HT9 A;  2H75 A;  5ID2 B;  1TRV A;  4O32 A;  4MF7 A;  2EFD A;  3A3T A;  4J2F A;  3A5W A;  2OT3 A;  5ECK B;  4MJC A;  3U5R E;  2HSM B;  3ZVJ D;  2ON7 A;  1TP9 A;  14GS A;  2UZ8 A;  3IAS 2;  3HYP A;  1XW6 A;  1OKT A;  3H93 A;  4TXV A;  2AJQ B;  5F0G A;  3SBC A;  3TKQ A;  1EOG A;  2JZT A;  3DXB A;  4G01 A;  4ZB7 A;  4I6X A;  5BRT A;  3UAR A;  4OMV A;  3M3M A;  1T8E B;  4LMW A;  4GST A;  3ME8 A;  4ULX A;  3ME7 A;  4O92 A;  3ERW A;  1HNB A;  3W8J A;  3ZZX A;  3IV4 A;  4AI6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...