1PX6A

A folding mutant of human class pi glutathione transferase, created by mutating aspartate 153 of the wild-type protein to asparagine
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
209
structure length
209
Chain Sequence
PPYTVVYFPVRGRCAALRMLLADQGQSWKEEVVTVETWQEGSLKASCLYGQLPKFQDGDLTLYQSNTILRHLGRTLGLYGKDQQEAALVDMVNDGVEDLRCKYISLIYTNYEAGKDDYVKALPGQLKPFETLLSQNQGGKTFIVGDQISFANYNLLDLLLIHEVLAPGCLDAFPLLSAYVGRLSARPKLKAFLASPEYVNLPINGNGKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glutathione S-transferase P
publication title The multi-functional role of a highly conserved aspartic acid residue in glutathione transferase P1-1
rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 82
structure length 209
sequence length 209
chains with identical sequence B
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2003-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
A PF14497 GST_C_3 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 1px6A02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1px6A01
3GKKA 1WMJA 4GRFA 3RAZA 1MTCA 3TUEA 1V58A 2PVOC 2H30A 1G0TA 4V2LA 2NVLA 1SD8A 1YEXA 2F3MA 5G1LA 4CHSA 1K0AA 1ABAA 5C00A 1XOBA 4V2NA 5D8IA 4K8MA 3FK8A 5GSSA 1O8WA 1R7HA 2PWJA 2KP1A 5KN2A 3TJKA 1V2AA 2YJ7A 3ZITA 4PQHA 3WT1A 5JWRB 3O3TA 2R4VA 5H5RA 1HNAA 5AIVA 2IN3A 4G0KA 2M46A 5B8BA 3MNGA 4OWYA 2OE1A 5FT3A 1PX7A 5D96A 4G0IA 3FZ5A 1TKDB 3L4NA 4NHWA 2H0IA 1U3IA 1RW1A 2H1AA 5CRGA 5IPHA 2LS5A 3QR6A 4KB3A 5A4VA 1PN9A 5G2ZA 1ZL9A 1H4OA 3E9JB 1JZWA 2XBIA 3F63A 1AQVA 3VURA 2C80A 1SK0A 2XC2A 1YQ1A 4XS4B 1AQWA 1EV9A 3UJ1A 1Z6MA 3KXOA 3U6VA 1VGLA 3M9JA 3G7YA 2IWTA 3DWVA 3UVHA 3QD9A 1TOFA 5IMDA 4MJEA 2FA8A 3AY8A 4K9ZA 2YWOA 4MP4A 4HUAA 1G7EA 3ZIVA 2OBKA 1YJ6A 4WR5A 4O5RA 1HD2A 2L59A 3HXSA 1THOA 2IJYA 4IQAA 3HJPA 3FZ4A 2ON5A 3PR8A 1NM3A 2V6KA 5J9BA 1GLPA 3G9BA 4I2UA 2QSIA 2C3TA 2GVPA 4TXVA 2BMXA 4KCEA 4RUVA 3GN3A 3HZ8A 2GSTA 4CW9A 2C0FA 3GV1A 4I6XA 3TB2A 1FB0A 2HYXA 4CDOA 1TJDA 3V1WA 1A0FA 4NMUA 1XVQA 3HYPA 2HE3A 3IDVA 3VWXA 3IV4A 2OA7A 4TR4A 3FR6A 4MJCA 1J0FA 1GTAA 3QAGA 1TI3A 3HVSA 4DSQA 3NIVA 3GIXA 3IR4A 2HT9A 5ECRB 4DSRA 3EE2A 4HZ4A 4ZB6A 4ZBAA 3D0ZA 3KMOA 2JSZA 4NAXA 4HI7A 3D5JA 1EEMA 5EY6A 1GP1A 2H66A 2WFCA 3APQA 5F07A 3UBLA 3O76A 3I43A 1Y25A 1THXA 4PUAA 1SENA 1TI1A 5J4UA 3CSIA 3TRQA 3VI7A 11GSA 1CQHA 2GDRA 2ZNMA 1OC8A 1A8LA 4PXOA 3KD0A 1NHYA 2C0GA 5DBQA 5DJLA 4OMVA 1ACVA 3GL3A 4LL1B 1T8EB 1GTUA 3L0HA 4ISDA 3ED3A 1VF2A 4ECIA 4BVXB 1V40A 2H74A 1KTEA 3DD3A 3HDCA 3QMXA 2UZ8A 4D73B 2VM1A 4KGIA 1EEJA 3U5RE 1YKCA 2O87A 2R37A 3EWLA 4MF6A 1AW9A 1ERWA 2L6DA 5E4WA 3N5OA 2VLUA 1UVZA 1J08A 4K0GA 2M72A 2XPDA 3ZVJD 4IBPA 1B4QA 3M3MA 2P31A 1OE7A 4BL7B 4RI7A 1YEPA 4PUFC 3QFBC 1AAZA 5E59A 3I9V2 5D9TA 2P5RA 5GZZB 3FEUA 3FY7A 3WD6A 1U88A 4TVEA 3RPPA 5F8BA 2E2GA 5ECLB 3MSZA 4MPFA 2H0HA 4L5LA 1YF0A 3F0IA 4MMMA 2IFQA 3C1SA 4EVMA 2N5FA 3DIEA 1RK4A 1M2AA 4KE3A 2H1GA 2H76A 3C73A 5DCHA 3TJFA 1Y6EA 1TTZA 16GSA 2M80A 2I4AA 4AJ8A 2EIRA 4BWSA 1K0MA 3VWVA 2O7KA 5KN3A 1O6JA 1Q98A 4N10A 5DALB 2WRTA 4L5OA 5HQPA 3KCMA 3KM6A 3C1RA 4TR3A 1E6BA 5CRWA 2HRKB 4PQ1A 4EF0A 2WDUA 3O6TA 7GSSA 4ILFA 2VIMA 3LEFA 5IPGA 1EZKA 1K0BA 1C72A 1GSSA 1RQMA 5J3RA 4NV5A 10GSA 5IIZA 4XRDA 3ZL5A 2QC7A 5DQSA 1YZXA 3WGDA 1JZOA 1M0UA 5ECSA 2PN8A 2VLTA 1KNGA 5D9WA 3LWAA 2HRAA 4DVCA 3Q6OA 5IOWA 2OE3A 4L0UA 4OFMA 2H72A 5A5KA 1A2MA 3FR9A 4NHZA 1Z5YE 2VCXA 4F0BA 2FUG2 2C0DA 4FYUA 4Q5NA 4ZL9A 1USBA 3TJJA 4IVFA 1M7TA 3D4MA 3IOSA 2LRTA 4FQUA 1QQ2A 4Z7XA 5ECNB 1M2DA 2CZ3A 3KP9A 4J57E 4ID0A 1OVNA 3EMXA 5HR3A 2E2MA 5HFKA 3ME7A 3LYPA 2VD1A 5B6MA 1OKTA 1XW5A 4I2TA 2E0QA 4IN0A 3P90A 4KCAA 5AN1A 1T00A 4MCUA 1K3YA 5ID2B 5DDLA 2PMTA 5LD0A 2B5EA 4IJ3A 1T7PB 5CP1A 3GHAA 4HDEA 1N2AA 2V32A 1SU9A 5DAKB 2B1KA 2IMKA 2DC5A 1PGTA 2YN1A 2FA4A 4TR1A 6GSVA 3IBHA 5G5FA 5G5EA 3E0UA 3TKSA 1WOUA 2H0GA 2HQTA 1DSBA 1E2YA 3A2WA 2LNTA 2LV3A 2K8SA 5HFGA 4IHUA 2XBQA 3UMAA 2YOIA 1JFUA 2FWEA 2TRXA 3GKMA 5L71A 2O89A 2HNLA 1SJZA 4G19A 1GSUA 2OKAA 3Q18A 2F9SA 4I5QA 4TXOA 2WZ9A 1FO5A 1GWCA 6GSWA 1PQNA 1QK8A 3GA4A 4O32A 4GCIA 2CVDA 2GSQA 2FWGA 3IK9A 3R3EA 4LMWA 1QMVA 2REMA 5A4WA 2H01A 3N9JA 3KGKA 4K1FA 1X9MB 2H71A 4PURA 3TDGA 2AJQB 1J9BA 5J41A 3MWHA 3TJBA 4OCFA 4OCEA 3ME8A 1HNCA 1SJIA 5G30A 4POBA 6GSXA 2J23A 5HR1A 5IMVA 4G2EA 4BVXA 3FZ9A 4E8HA 1GH2A 3S9FA 5CRDA 4OFNA 4D73A 1HQOA 1ZZYA 3ZRDA 3GURA 1WP0A 4QL9A 1O73A 3DGQA 1LJRA 1F2EA 2H6ZA 3W6GA 3GTUB 2C8UA 4FH8A 4PNGA 4FIWA 2DJKA 2QKEA 5IMCA 1JLVA 4MH3A 20GSA 2DBCA 3GL5A 3C7MA 4K7OA 2CX4A 2X8GA 1PA3A 2I9HA 4DSSB 8GSSA 3L78A 4J56E 3IAM2 2YV7A 2HZEB 2WJUA 3QOUA 5J9CA 3W8SA 1XWBA 3EURA 1NW2A 4MZCA 3P2AA 4G9HA 1Q4JA 2O85A 4RQRA 4TKYA 4KAEA 6GSYA 3QDNA 3G7IA 2CVBA 1ZOFA 4MH2A 5COHA 3R2QA 3RBTA 3I69A 4Q5FA 2VCQA 1SKWB 5AISA 3ZIJA 2DJ2A 3F3QA 2GQKA 2V2GA 4ECCA 1B48A 2L4CA 4K6XA 1V9WA 6GSUA 1SK2A 4JU5A 2DJJA 2YP6A 4V2MA 2DJ1A 1GSQA 2B3SA 2C3NA 3ERWA 3HY2A 2GLRA 2RUEA 4GXZA 1A8YA 4DEJA 4ZIJA 1XCCA 4I8BA 3FZAA 1IYHA 3LG6A 5ECHB 1WJKA 4FO5A 3H1NA 1PMTA 4F82A 1MDJA 1WIKA 4PQIA 5IMFA 1T1VA 3QPMA 3ZVJA 5F06A 5B7CA 2GT5A 4POMA 4GWRA 4N11A 5KN1A 3TKPA 3TGZA 3F6FA 3VI5A 4HQSA 1OKDA 2CA8A 1GUKA 2VLVA 3DYRA 3TJGA 1PX6A 1NHOA 3CBUA 4EO3A 2NPBA 2HSMA 3APOA 3HA9A 4N30A 2ZCTA 3PH9A 1K0NA 4HU7A 2GTUA 5JWOB 2MMAA 4HJ2A 3LSZA 2LNSA 4KNDA 4TRXA 1A2JA 1XWGA 4TOPA 1B8XA 2XPEA 3LGCA 1F3BA 3QFAC 1Z3EA 3L9VA 4HJMA 3UVTA 5HR2A 1X5EA 2CAQA 1TU8A 2R2JA 3KTLA 1O85A 2DIZA 2IL3A 3APSA 2X99A 5J5NA 2B5YA 4POLA 1SJ6A 5HFIA 1SD9A 1EP7A 1W4VA 1X5CA 1SK1A 1EGRA 3GSSA 4L0WA 2PERA 3HCZA 4OO5A 4TN8A 1QFNA 4HEA2 1GTBA 1XIYA 1R5AA 5IO0A 2B7KA 1GRXA 4MZWA 3A2VA 2GZPA 3GSTA 5ECPB 4XRAA 1UN2A 4IS0A 1S3AA 3A2XA 1GTIA 1F6MC 3F4SA 5JCUA 1VF4A 1O7UA 1FHEA 3LFLA 4MPGA 4GLTA 1VF1A 4ZILA 4F2IA 3KZQA 2VOCA 4X0XA 3IK7A 4LMVA 3ZMKA 4GQFA 2V6OA 4JRRA 1WWJA 1A0RP 4KUNA 3VWUA 1GLQA 2KP2A 3FKFA 4HZ2A 3F6DA 3NOFA 3SWLA 2VL2A 4GSSA 2H1BA 4BA7A 4ZBBA 1GUMA 2NBSA 2L6CA 5CRHA 4OFTA 3LQ7A 4GSNA 1UC7A 4HOJA 3UAPA 14GSA 2HRFA 1G6YA 5ELGA 2JZRA 3HVXA 1TK8B 1M99A 4ML1A 4K7NA 2LKUA 1X5DA 2CX3A 4IGJA 2A4VA 1T3BA 2WULA 2GZZA 4WF4A 3EU3A 1TDIA 1I9DA 4JR4A 3J7Yk 4PGTA 3GKXA 3GTUA 1S3CA 1V57A 2VM2A 1GSDA 1ZCPA 3GH6A 4IP1A 1ERTA 2I1UA 1MD4A 4WR4A 3F8UA 1CQGA 4V1Ap 3BJ5A 4EDZA 2EIQA 3DEXA 2MMZA 3W8JA 4KF9A 2MMOA 3ZMLA 2KHPA 4JBBA 1FOVA 3DKSA 3IXRA 5G31A 4XS1A 4N0VA 1O8XA 2RUFA 4YQMA 4KW6A 4MK3A 4I97A 5INYA 4IQ1A 1AC1A 1A23A 2EIOA 3D6IA 3IA1A 2A2SA 2LQOA 4MF5A 2DMMA 4PX1A 4ZXGA 2KUCA 1GNEA 4F03A 3WGEA 1K3OA 4AJ6A 4ECJA 4NV2A 3DVWA 5AIXA 4XS4A 1XFLA 2DIYA 3F9UA 4J2FA 1GSYA 1WRYA 2VL3A 3D21A 1EGOA 3GX0A 3LYKA 4WXTA 4TW5A 4POKA 1U87A 2TIRA 4RI6A 2LJRA 1TW9A 4JZQA 5FWGA 1ERVA 3TCOA 1QUWA 2R6KA 2OADA 4EL1A 1FB6A 2PUKC 1ZGNA 4AJ7A 2A2RA 2PPTA 1MDKA 3HVVA 1OYJA 2R5GA 4Q5RA 5GAND 4ECBA 3GNJA 2B6MA 3F3RA 3ZREA 1TK0B 1TRUA 3VPTA 1ZYEA 1XW6A 2H6YA 1BEDA 2FCHA 1R4WA 4X1UA 1SKRB 3EU4A 4WBJA 4XS6A 5JWQB 1ST9A 2OJLA 4YAPA 2LJAA 4RQXA 2VUPA 5KN0A 4IW9A 1GNWA 3LXZA 2KOKA 2AB6A 3CRUA 2RM6A 1M9AA 5ECIB 4YQUA 4WETA 2X8HA 4ZL8A 4JR6A 17GSA 3J7Yb 2NDOA 2DLXA 3IC8A 2YZHA 1X9SB 1XZOA 2C1YA 3UIWA 2WCIA 2K9FA 3RHCA 1XXUA 1NSWA 3H79A 1GULA 2AYTA 2FD3A 1AIUA 1XOAA 5DCGA 3EVIA 2NTOA 3F4TA 3GYKA 1TP9A 1F3AA 4BWQA 1H75A 1JZDA 1T4YA 2VAFA 5CREA 3D4TA 1XWKA 1YDKA 22GSA 3UBKA 1Z7RA 1JZRA 4E8EA 1TRWA 5ENUA 1DE1A 1BG5A 6GSTA 3EMPA 2RIIA 2X64A 3UOMA 1SKSB 4WF5A 1QXHA 1AQXA 2HZFA 3Q74A 3DVXA 5CNWA 2LRNA 3TKSC 2CV4A 3FYGA 1FVJA 1R26A 2GT6A 4TR0A 5IQYA 1LBKA 3EYTA 2DSAA 1SL1B 4WBRD 3BCIA 5AGYA 2C4JA 2PBJA 4IKHA 4FYBA 3FW2A 3IE3A 3E3EA 1TXXA 4IELA 3JCML 2YWIA 3HJOA 5DJMA 2H1DA 3EC3A 2H75A 1OC3A 4BL7A 4MZBA 1I5GA 5D9VA 4HU9A 5JCGA 2DJ3A 3KIJA 1B9XC 4AF2A 4YQVA 2OBIA 4ACSA 4XTSA 1WE0A 3C8EA 1W89A 1XPVA 4IP6A 5G1KA 1BJXA 2C3QA 4LL4B 2VO4A 4V1Ag 1AUCA 2IMDA 1XWAA 1SL0B 3KMNA 1V98A 3GH9A 1BYEA 3FRCA 4USSA 2IMFA 2HI7A 3ERFA 1HNBA 3IAS2 2F8AA 1MD3A 4OD7A 2WGRA 4HS1A 1YF1A 1FVKA 4KH7A 3ZTLA 2B5XA 3ZFLA 5DALA 5EVOA 4BVYB 1FG4A 2HRNA 1PD21 4HQZA 2X8CA 2HRKA 1PKWA 4EUYA 1JHBA 1G6WA 2B1LA 1TU7A 4EE0A 3L9SA 4JE1A 1PL2A 2YWMA 3WGXA 3G7JA 2L4QA 4FYCA 2Z9SA 1EOGA 4MLYA 5C04A 2J9HA 2ES7A 3VWWA 5IM9A 4NPBA 3TKSE 5EL8A 2I81A 2K6VA 4H86A 1FAAA 2CZ2A 2MBTA 2JL4A 3UARA 3BCKA 1QGVA 3KTBA 1Z7PA 3KJYA 2FLSA 1WPIA 3CTGA 2H73A 5IOXA 3ERGA 4X43A 5D73A 2VCWA 3IPZA 1X0RA 5DQYA 3RPNA 2PGTA 2B7JA 3M8NA 4MJAA 3LJRA 2JADA 2HSYA 1TRVA 1ERUA 3ZFBA 3IRAA 1SYXA 5HR0A 13GSA 2F51A 5B8AA 2V1MA 1U3AA 5BMUA 1B4PA 2L5OA 1ON4A 3CTFA 3HHVA 3GX8A 1UA5A 4TR1B 1GUHA 9GSSA 2H70A 2IMIA 2IIYA 2YANA 3BBYA 1OC9B 1KBNA 2VD0A 2H8LA 5H5QA 2MBSA 5A4UA 3P8WA 3A5WA 1FW1A 4YH2A 5GAPD 1OAZA 3VLNA 5CAXA 4PTSA 1DUGA 2QGVA 1EWXA 5ID2A 3ZZXA 1AXDA 2BJXA 1K0DA 3M9KA 3KH9A 2GSRA 5DAKA 4TXOB 2VCVA 1HYUA 3GRXA 2K18A 1U6TA 1O81A 4GQCA 4L8EA 3BD2A 2YCDA 5IMZA 1ZMAA 2ZUPA 1KEBA 3KEBA 1XVWA 1URMA 3UEMA 3NZNA 1TK5B 3CSJA 1Z6NA 2AHEA 1TRSA 3IHQA 2P0GA 4QL7A 2AV4A 2LRCA 2ALBA 3LORA 1Z9HA 2H6XA 2IPAA 2GS3A 6GSSA 4NXIA 5IMAA 2D2ZA 1SL2B 2TRCP 1XBSA 2R3XA 2HXKA 1K0OA 3C71A 3TOTA 4F0CA 1XWCA 3CRTA 3OR5A 1F37A 4XCSA 5KEJA 2JSYA 4F9ZA 2OACA 2DJ0A 5D93A 2LJKA 2RM5A 5H5SA 3TKQA 2AAWA 1M2BA 3CYNA 3CMIA 2CAIA 1PRXA 3ISOA 4Q5QA 5ABRA 2GQMA 2L5LA 4XIHA 3KP8A 2JACA 2LEGA 1A24A 4KSOA 2FWFA 1VF3A 3HD5A 2FNOA 4P3YB 2YJHA 1ML6A 3RDWA 3UL3A 1IYIA 2RLIA 2FY6A 4KSMA 4ZBDA 4ZB8A 2YWNA 2HFDA 3DRNA 4K7IA 4IJIA 4O92A 3DXBA 1R5PA 2DMLA 4MDCA 3HKRA 2MYGA 4MA9A 4MJBA 1T4ZA 1G7OA 5ELAA 3GFKA 4DSSA 5LNKe 2G0FA 2HZEA 3TOUA 4PNFA 2WB9A 4AGSA 1EP8A 2I3YA 3FR3A 5CYYA 4EDYA 4EKZA 1DE2A 1JLWA 2VCTA 3F4RA 2KLXA 2GGTA 2VL2C 18GSA 2L57A 3PPUA 3GKNA 1K3LA 2YPMA 4MABA 1EOHA 3GMFA 2JZSA 1XW9A 4EXJA 4NWYA 1GSFA 2JZTA 2CQ9A 2HLSA 1ZYQB 2F8FA 3A3TA 4LA1A 3H93A 4ZL7A 2HSNB 2FHEA 3VPQA 4GF0A 4LLRA 4WKWA 3Q19A 1BX9A 4BVYA 1LU4A 2G2QA 4K0NA 1S3DA 3K8NA 3DMLA 5CO3A 5DVBA 5JCWA 4KDUA 2BTOT 2E7PA 3QCPA 3WT2A 1VRSD 5FHIA 5F05A 4EC0A 1PSQA 2VCZA 3MDKA 2N5AA 2YV9A 2MZCA 3PGTA 3TRXA 3H8QA 4GSTA 4BPYA 5ECMB 4K2DA 3QAWA 4MF7A 3QAVA 2C0EA 2EC4A 2ON7A 3H4KA 2HSHA 3CSHA 2HSMB 2WS2A 12GSA 2K8VA 4ML6A 3ZYWA 2GSSA 2PU9C 3BOAA 3MAKA 4N0ZA 5IO2A 1GL8A 2OE0A 3ZLPA 5D9XA 2GZYA 1K0CA 4WEYA 4JEDA 3D22A 2IMEA 3KH7A 3SBCA 3PINA 4KDXA 2VL9A 1BAYA 1PKZA 2GQLA 19GSA 2P5QA 3M1GA 3TKRA 3I6AA 2LQQA 5ECQB 1PL1A 3GUSA 3TRPA 2H19A 3VFIA 5ECOB 1GSEA 2CVKA 2O8VB 4YAVA 2FWHA 3VK9A 1OC9A 2AUVA 3IC4A 4ZB9A 4ULXA 5ECKB 1X9WB 4XHMA 1N8JA 3CXGA 2FGXA 1ILOA 5EPFA 5LCZA 2YZUA 2LSTA 3RHBA 1DBYA 2MMNA 4OO4A 1OE8A 4G10A 1MDIA 4KA0A 3P7XA 5F0GA 1EV4A 4GTUA 3HZ4A 3M0FA 4O7HA 3LXTA 4QQ7A 1YY7A 5B6NA 3L9UA 1M9BA 3HJMA 2CT6A 2XHFA 4G0LA 2YNXA 1B9YC 5GSTA 2LUSA 4KX4A 1F9MA 2JU5A 2N5BA 2PVQA 2LTKA 1BQ7A 2IFQB 1A2LA 3FHKA 1YKAA 1SYRA 3EINA 4KDYA 3US3A 2V41A 3WYWA 1MEKA
chains in the Genus database with same CATH superfamily
3GKKA 1WMJA 4GRFA 3RAZA 1MTCA 3TUEA 1V58A 2PVOC 4K5SA 2H30A 2H1LA 1G0TA 4V2LA 2NVLA 1SD8A 1YEXA 2F3MA 5G1LA 4CHSA 1K0AA 1ABAA 5C00A 1XOBA 4V2NA 5D8IA 4K8MA 3FK8A 5GSSA 1O8WA 1R7HA 2PWJA 2KP1A 5KN2A 3TJKA 1V2AA 2YJ7A 3ZITA 4PQHA 3WT1A 5JWRB 3O3TA 2R4VA 5H5RA 1HNAA 5AIVA 2IN3A 4G0KA 2M46A 5B8BA 3MNGA 4OWYA 2OE1A 5FT3A 1PX7A 5D96A 4G0IA 3FZ5A 1TKDB 4K2XA 3L4NA 4NHWA 2H0IA 1U3IA 1RW1A 2H1AA 5CRGA 5IPHA 2LS5A 3QR6A 4KB3A 5A4VA 1PN9A 5G2ZA 1ZL9A 1H4OA 3E9JB 1JZWA 2XBIA 3F63A 1AQVA 3VURA 2C80A 1SK0A 2XC2A 1YQ1A 4XS4B 1AQWA 1EV9A 4EIQA 3UJ1A 1Z6MA 3KXOA 3U6VA 1VGLA 3M9JA 3G7YA 2IWTA 3DWVA 3UVHA 3QD9A 1TOFA 5IMDA 4MJEA 2FA8A 3AY8A 4K9ZA 2YWOA 4MP4A 4HUAA 1G7EA 3ZIVA 2OBKA 1YJ6A 4WR5A 4O5RA 1HD2A 2L59A 3HXSA 1THOA 2IJYA 4IQAA 3HJPA 3FZ4A 2ON5A 3PR8A 1NM3A 2V6KA 5J9BA 4FXYP 1GLPA 3G9BA 4I2UA 2QSIA 2C3TA 2GVPA 4TXVA 2BMXA 4KCEA 4RUVA 3GN3A 2O3EA 3HZ8A 2GSTA 4CW9A 2WW1A 2C0FA 3GV1A 4I6XA 3TB2A 1FB0A 2HYXA 4CDOA 1TJDA 3V1WA 5A5HA 1A0FA 4NMUA 4AKIA 1XVQA 3HYPA 2HE3A 3IDVA 3VWXA 3IV4A 2OA7A 4TR4A 3FR6A 4MJCA 1J0FA 1GTAA 3QAGA 1TI3A 3HVSA 4DSQA 3NIVA 5J40A 3GIXA 3IR4A 2HT9A 5ECRB 4DSRA 3EE2A 4HZ4A 4ZB6A 4ZBAA 2WVXB 3D0ZA 3KMOA 2JSZA 4NAXA 4HI7A 3D5JA 1EEMA 5EY6A 2WFCA 1GP1A 2H66A 3APQA 5A34B 5F07A 3UBLA 3O76A 3I43A 1Y25A 1THXA 4PUAA 1SENA 1TI1A 5J4UA 5A1NA 3CSIA 3TRQA 3VI7A 11GSA 1CQHA 2GDRA 2ZNMA 1OC8A 1A8LA 4PXOA 3KD0A 1NHYA 2C0GA 5DBQA 5DJLA 4OMVA 1ACVA 3GL3A 4LL1B 1PN0A 1T8EB 1GTUA 3L0HA 4ISDA 3ED3A 1VF2A 4ECIA 4BVXB 1V40A 2H74A 1KTEA 3DD3A 3HDCA 3QMXA 4A5PA 2UZ8A 4D73B 2VM1A 4KGIA 1EEJA 3U5RE 1XG8A 1YKCA 2O87A 2R37A 3EWLA 4MF6A 1AW9A 1ERWA 2L6DA 5E4WA 3N5OA 2VLUA 1UVZA 1J08A 4K0GA 2M72A 2XPDA 3ZVJD 4IBPA 1B4QA 3M3MA 2P31A 1OE7A 4BL7B 4RI7A 1YEPA 4PUFC 3QFBC 1AAZA 5E59A 3I9V2 5D9TA 2P5RA 5GZZB 3FEUA 3FY7A 3WD6A 1U88A 4TVEA 3RPPA 5F8BA 2E2GA 2QA2A 5ECLB 3MSZA 4MPFA 2H0HA 4L5LA 1YF0A 3F0IA 4MMMA 2IFQA 3C1SA 2R0PA 4EVMA 2N5FA 4Z2RA 3DIEA 1RK4A 1M2AA 4KE3A 2H1GA 2H76A 3C73A 5DCHA 3TJFA 1Y6EA 1TTZA 2DKIA 16GSA 2M80A 2I4AA 4AJ8A 2EIRA 4BWSA 1K0MA 3VWVA 2O7KA 4ICYA 5KN3A 1O6JA 2DKHA 1Q98A 4N10A 5DALB 2WRTA 4L5OA 5HQPA 3KCMA 3KM6A 3C1RA 4TR3A 1E6BA 5CRWA 2HRKB 4CY6A 4PQ1A 4EF0A 2WDUA 3O6TA 7GSSA 4ILFA 2VIMA 3LEFA 5IPGA 1EZKA 1K0BA 1C72A 1GSSA 1RQMA 5J3RA 4NV5A 10GSA 5IIZA 4XRDA 3ZL5A 2QC7A 5DQSA 1YZXA 3WGDA 1JZOA 1YEWC 1M0UA 5ECSA 2PN8A 2VLTA 1KNGA 5D9WA 3LWAA 2HRAA 4DVCA 3Q6OA 5IOWA 2OE3A 4L0UA 4OFMA 2H72A 5A5KA 1A2MA 3FR9A 4NHZA 1Z5YE 2VCXA 4F0BA 3HVNA 2FUG2 4E68A 2C0DA 4FYUA 4Q5NA 4ZL9A 1USBA 3TJJA 4IVFA 1M7TA 3D4MA 3IOSA 2LRTA 4FQUA 1QQ2A 4Z7XA 5ECNB 1M2DA 2CZ3A 3KP9A 4J57E 4ID0A 1OVNA 3EMXA 5HR3A 2E2MA 5HFKA 3ME7A 3LYPA 2VD1A 5B6MA 1OKTA 1XW5A 4I2TA 2E0QA 4IN0A 3P90A 4KCAA 5AN1A 1T00A 4MCUA 2A2PA 1K3YA 5ID2B 5DDLA 2PMTA 5LD0A 2B5EA 1S3RA 4IJ3A 1T7PB 5CP1A 3GHAA 4HDEA 1N2AA 2V32A 1SU9A 5DAKB 2B1KA 2IMKA 2DC5A 1PGTA 2YN1A 2FA4A 4TR1A 6GSVA 3IBHA 5G5FA 5G5EA 3E0UA 3TKSA 1WOUA 2H0GA 2HQTA 2UV8G 1DSBA 1E2YA 3A2WA 2LNTA 2LV3A 2K8SA 5HFGA 4IHUA 2XBQA 3UMAA 2WVZA 2YOIA 1JFUA 2FWEA 2TRXA 3GKMA 5L71A 2O89A 2R0GA 2HNLA 3MYDA 1SJZA 4G19A 1GSUA 2OKAA 3Q18A 2F9SA 4I5QA 4TXOA 2WZ9A 1FO5A 1GWCA 6GSWA 1PQNA 1QK8A 5J4YA 1SVMA 3GA4A 4O32A 4GCIA 2CVDA 2GSQA 2FWGA 3IK9A 3R3EA 4LMWA 1QMVA 2REMA 5A4WA 2H01A 3N9JA 3KGKA 4K1FA 1X9MB 5A34A 2H71A 4PURA 3TDGA 2AJQB 1J9BA 5J41A 3MWHA 3TJBA 4OCFA 4OCEA 3ME8A 1HNCA 1SJIA 5G30A 4POBA 6GSXA 2J23A 5HR1A 5IMVA 4G2EA 2O36A 4BVXA 3FZ9A 4E8HA 1GH2A 3S9FA 5CRDA 2QA1A 4OFNA 4D73A 1HQOA 1ZZYA 3ZRDA 3GURA 1WP0A 4QL9A 1O73A 4ZB7A 3DGQA 1LJRA 1F2EA 2H6ZA 3W6GA 3GTUB 4AKHA 2C8UA 4FH8A 4PNGA 4FIWA 2DJKA 2QKEA 5IMCA 1JLVA 4MH3A 20GSA 2DBCA 3GL5A 3C7MA 4K7OA 2CX4A 2X8GA 1PA3A 2I9HA 4DSSB 8GSSA 3L78A 4J56E 3IAM2 2YV7A 2HZEB 2WJUA 3QOUA 5J9CA 3W8SA 4AKGA 1XWBA 3EURA 1NW2A 4MZCA 3P2AA 4G9HA 1Q4JA 2O85A 4RQRA 4TKYA 4KAEA 6GSYA 3QDNA 3G7IA 2CVBA 1ZOFA 4MH2A 5COHA 3R2QA 3RBTA 3I69A 4Q5FA 5J47A 2VCQA 1SKWB 5AISA 3ZIJA 2DJ2A 3F3QA 2GQKA 2V2GA 4ECCA 1B48A 2L4CA 4K6XA 1V9WA 6GSUA 1SK2A 4JU5A 2DJJA 2YP6A 4V2MA 2DJ1A 1GSQA 2B3SA 2C3NA 3ERWA 3HY2A 2GLRA 2RUEA 4GXZA 2HSNA 1A8YA 4DEJA 4ZIJA 1XCCA 4I8BA 3FZAA 1IYHA 3LG6A 5ECHB 1WJKA 4FO5A 3H1NA 4W66A 1PMTA 4F82A 1MDJA 1WIKA 4PQIA 5IMFA 1T1VA 3QPMA 3ZVJA 5F06A 2EFEA 5B7CA 2GT5A 4POMA 4GWRA 4N11A 5KN1A 3TKPA 3TGZA 3F6FA 3VI5A 4HQSA 1OKDA 2CA8A 1GUKA 1I1IP 2VLVA 3DYRA 3TJGA 1PX6A 1NHOA 3CBUA 4EO3A 2NPBA 2HSMA 3APOA 3HA9A 4N30A 2ZCTA 3PH9A 1K0NA 4HU7A 2GTUA 5JWOB 2MMAA 4HJ2A 3LSZA 2LNSA 4KNDA 4TRXA 1A2JA 1XWGA 4TOPA 1B8XA 2XPEA 3LGCA 1F3BA 3QFAC 1Z3EA 3L9VA 4HJMA 3UVTA 5HR2A 1SVLA 1X5EA 2CAQA 1TU8A 2R2JA 3RGBC 3KTLA 1O85A 2DIZA 2IL3A 3APSA 2X99A 5J5NA 2B5YA 4POLA 1SJ6A 1M3JA 5HFIA 1SD9A 1EP7A 1W4VA 1X5CA 1SK1A 1EGRA 3GSSA 4L0WA 2PERA 3HCZA 4OO5A 4TN8A 4AKXB 1QFNA 4HEA2 1GTBA 1XIYA 1R5AA 5IO0A 2B7KA 1GRXA 4MZWA 3A2VA 2GZPA 3GSTA 5ECPB 4XRAA 1UN2A 4IS0A 1S3AA 3A2XA 3FMWA 1GTIA 1F6MC 3F4SA 5JCUA 1VF4A 1O7UA 1FHEA 3CHXC 3LFLA 4MPGA 4GLTA 1VF1A 4ZILA 4F2IA 3KZQA 2VOCA 4X0XA 3IK7A 4LMVA 3ZMKA 4Z2TA 4GQFA 2V6OA 4JRRA 1WWJA 1A0RP 4KUNA 3VWUA 1GLQA 2KP2A 3FKFA 4HZ2A 3F6DA 3NOFA 3SWLA 2VL2A 4GSSA 2H1BA 4BA7A 4ZBBA 1GUMA 4HSCX 2NBSA 2L6CA 5CRHA 4OFTA 3LQ7A 4GSNA 5KOXA 1UC7A 4HOJA 3UAPA 14GSA 2HRFA 1G6YA 5ELGA 4AI6A 2JZRA 3HVXA 1TK8B 1M99A 4ML1A 4K7NA 2LKUA 1X5DA 2CX3A 4IGJA 2A4VA 1T3BA 2WULA 2GZZA 4WF4A 3EU3A 1TDIA 1I9DA 4JR4A 3J7Yk 4PGTA 3GKXA 3GTUA 1S3CA 1V57A 2VM2A 1GSDA 1ZCPA 3GH6A 4PI0C 4IP1A 1ERTA 2I1UA 1MD4A 4WR4A 3F8UA 1CQGA 4V1Ap 3BJ5A 4EDZA 2EIQA 3DEXA 2MMZA 3W8JA 4KF9A 2EFCA 2MMOA 3ZMLA 2KHPA 4JBBA 1FOVA 3DKSA 3IXRA 5G31A 4XS1A 4N0VA 1O8XA 2RUFA 4YQMA 4KW6A 4MK3A 4I97A 5INYA 3CQFA 4IQ1A 1AC1A 1A23A 2EIOA 3D6IA 4GDFA 3IA1A 2A2SA 2LQOA 4MF5A 2DMMA 1ZYNA 3TU3B 4PX1A 4ZXGA 2KUCA 1GNEA 4F03A 3WGEA 1K3OA 4AJ6A 4ECJA 4NV2A 3DVWA 5AIXA 4XS4A 1XFLA 2DIYA 3F9UA 4J2FA 1GSYA 1WRYA 2VL3A 3D21A 1EGOA 3GX0A 3LYKA 4WXTA 4TW5A 4POKA 1U87A 2TIRA 5BMUB 4RI6A 2LJRA 1TW9A 4JZQA 4PHZC 5FWGA 1ERVA 3TCOA 1QUWA 2R6KA 2OADA 4EL1A 1FB6A 2PUKC 1ZGNA 4AJ7A 2A2RA 2PPTA 1MDKA 3HVVA 1OYJA 2R5GA 5A5HB 4Q5RA 5GAND 4ECBA 3GNJA 2B6MA 1S4BP 3F3RA 3ZREA 1TK0B 1TRUA 3VPTA 1ZYEA 1XW6A 2H6YA 1BEDA 2FCHA 1R4WA 4K5RA 4X1UA 1SKRB 3EU4A 4WBJA 4XS6A 5JWQB 1ST9A 2OJLA 4YAPA 2LJAA 4RQXA 2VUPA 5KN0A 4IW9A 1GNWA 3LXZA 2KOKA 4YKGA 2AB6A 3CRUA 2RM6A 1M9AA 2EFDA 4QMKA 5ECIB 4YQUA 4WETA 2X8HA 4ZL8A 1YVLA 4JR6A 17GSA 5A1NB 2NDOA 3J7Yb 2DLXA 3IC8A 2YZHA 1X9SB 1XZOA 2C1YA 3UIWA 2WCIA 1FOHA 2K9FA 3RHCA 1XXUA 1NSWA 3H79A 1GULA 2AYTA 4EIPA 2FD3A 1AIUA 1XOAA 5DCGA 3EVIA 2NTOA 3F4TA 3GYKA 3RFRC 1TP9A 2WVXA 1F3AA 4BWQA 4G01A 1H75A 1JZDA 1T4YA 2VAFA 5CREA 3D4TA 1XWKA 1YDKA 22GSA 3UBKA 1Z7RA 1JZRA 4E8EA 1TRWA 5ENUA 1DE1A 1BG5A 6GSTA 3EMPA 1Y1UA 2RIIA 2X64A 2VKZG 3UOMA 1SKSB 4WF5A 4N3ZA 1QXHA 1AQXA 2HZFA 3Q74A 3DVXA 5CNWA 2LRNA 3TKSC 2CV4A 3FYGA 1FVJA 1R26A 2GT6A 4TR0A 5IQYA 1LBKA 3EYTA 2DSAA 1SL1B 4WBRD 3BCIA 5AGYA 2C4JA 2PBJA 4IKHA 4FYBA 4CY8A 3FW2A 3MIXA 3IE3A 3E3EA 1TXXA 2O5VA 4IELA 3JCML 3HMJG 2YWIA 3HJOA 5DJMA 2H1DA 3EC3A 2H75A 1OC3A 4BL7A 4MZBA 1I5GA 5D9VA 4HU9A 5JCGA 2DJ3A 3KIJA 1B9XC 4AF2A 4YQVA 2OBIA 4ACSA 4XTSA 1WE0A 3C8EA 1W89A 1XPVA 4IP6A 5G1KA 1BJXA 2C3QA 3CWGA 2VO4A 4LL4B 4V1Ag 1AUCA 2IMDA 1XWAA 1SL0B 3KMNA 1V98A 3GH9A 1BYEA 3FRCA 4USSA 2IMFA 2HI7A 2WW0A 3ERFA 1HNBA 3IAS2 2F8AA 1MD3A 4OD7A 2WGRA 4HS1A 1YF1A 1FVKA 4KH7A 3ZTLA 2B5XA 3ZFLA 5DALA 5EVOA 4BVYB 1FG4A 2HRNA 1PD21 4HQZA 2X8CA 2HRKA 1PKWA 4EUYA 1JHBA 1G6WA 2B1LA 1TU7A 4EE0A 3L9SA 4JE1A 1PL2A 2YWMA 3WGXA 3G7JA 2L4QA 4FYCA 2Z9SA 1EOGA 4MLYA 5C04A 2J9HA 2ES7A 3VWWA 5IM9A 5J4VA 4NPBA 3TKSE 5EL8A 2I81A 1ZYPA 2K6VA 4H86A 1FAAA 2CZ2A 2MBTA 2JL4A 3UARA 3BCKA 1QGVA 3KTBA 1Z7PA 3KJYA 2FLSA 1WPIA 3CTGA 2H73A 5IOXA 3ERGA 4X43A 5D73A 2VCWA 3IPZA 1X0RA 5DQYA 3RPNA 2PGTA 2B7JA 3M8NA 4MJAA 2EFHA 3LJRA 2JADA 2HSYA 2X49A 1TRVA 1ERUA 3ZFBA 3IRAA 4O5UA 1SYXA 5HR0A 13GSA 2F51A 5B8AA 2V1MA 1U3AA 5BMUA 1B4PA 2L5OA 1ON4A 3CTFA 3HHVA 3GX8A 1UA5A 4TR1B 1GUHA 9GSSA 2H70A 4O5QA 2IMIA 2IIYA 2YANA 3BBYA 1OC9B 1KBNA 2VD0A 2H8LA 5H5QA 2MBSA 5A4UA 3P8WA 3A5WA 1FW1A 4YH2A 5GAPD 1OAZA 3VLNA 5CAXA 4PTSA 1DUGA 2QGVA 1EWXA 5ID2A 5BRTA 3ZZXA 1AXDA 2BJXA 1K0DA 3M9KA 3KH9A 2GSRA 5DAKA 4TXOB 2VCVA 1HYUA 3GRXA 3IHGA 2K18A 1U6TA 1O81A 4GQCA 4L8EA 3BD2A 2YCDA 5IMZA 1ZMAA 2ZUPA 1KEBA 4BIKA 3KEBA 1XVWA 1SVOA 1URMA 3UEMA 3NZNA 1TK5B 3CSJA 1Z6NA 2AHEA 1TRSA 3IHQA 1BG1A 2P0GA 4QL7A 2AV4A 2LRCA 2ALBA 3LORA 1Z9HA 2H6XA 2IPAA 2GS3A 6GSSA 4NXIA 5IMAA 2D2ZA 1SL2B 2TRCP 1XBSA 2R3XA 2HXKA 1K0OA 3C71A 3TOTA 4F0CA 1XWCA 3CRTA 3OR5A 1F37A 4XCSA 1N25A 5KEJA 2JSYA 4F9ZA 2OACA 2DJ0A 5D93A 2LJKA 2RM5A 5H5SA 4Z2UA 3TKQA 2AAWA 1M2BA 3CYNA 3CMIA 2CAIA 1PRXA 3EPTA 3ISOA 4Q5QA 5ABRA 2GQMA 2L5LA 4XIHA 3KP8A 2JACA 2LEGA 1A24A 4X4JA 4KSOA 2FWFA 1VF3A 3HD5A 2FNOA 4P3YB 2YJHA 1ML6A 3RDWA 3UL3A 1IYIA 2RLIA 2FY6A 4KSMA 4ZBDA 4ZB8A 2YWNA 2HFDA 3DRNA 4K7IA 4IJIA 4O92A 3DXBA 1R5PA 2DMLA 4MDCA 3HKRA 2MYGA 4MA9A 4MJBA 1T4ZA 1G7OA 5ELAA 3GFKA 4DSSA 5LNKe 2G0FA 2HZEA 3TOUA 4PNFA 2WB9A 4AGSA 1EP8A 2I3YA 3FR3A 5CYYA 4EDYA 4EKZA 1DE2A 1JLWA 2VCTA 3LW9A 3F4RA 2KLXA 2GGTA 2VL2C 18GSA 2L57A 4YKFA 3PPUA 3GKNA 1K3LA 2YPMA 4MABA 1EOHA 3GMFA 2JZSA 1XW9A 4EXJA 4NWYA 1GSFA 2JZTA 2CQ9A 2HLSA 1ZYQB 2F8FA 3A3TA 4LA1A 3H93A 4ZL7A 2HSNB 2FHEA 2R0CA 3VPQA 4GF0A 4LLRA 4WKWA 3Q19A 1BX9A 4BVYA 1LU4A 2G2QA 4K0NA 1S3DA 3K8NA 3DMLA 5CO3A 5DVBA 5JCWA 4KDUA 2BTOT 2E7PA 3QCPA 3WT2A 1M3IA 1VRSD 5FHIA 5F05A 4EC0A 1PSQA 2VCZA 3MDKA 2N5AA 2YV9A 2WW3A 2MZCA 3PGTA 3TRXA 3H8QA 4GSTA 4BPYA 5ECMB 4K2DA 3QAWA 4MF7A 3QAVA 2C0EA 2EC4A 2ON7A 1PFOA 2A4HA 3H4KA 2HSHA 3CSHA 2HSMB 2WS2A 12GSA 2K8VA 4ML6A 3ZYWA 2GSSA 2PU9C 3BOAA 3MAKA 4N0ZA 2WW2A 5IO2A 1GL8A 2OE0A 3ZLPA 5D9XA 2GZYA 3A5IA 1K0CA 4WEYA 4JEDA 3D22A 2IMEA 3KH7A 3SBCA 5KOWA 3PINA 4KDXA 2VL9A 1BAYA 1PKZA 2GQLA 19GSA 2P5QA 3M1GA 3TKRA 3I6AA 2LQQA 5ECQB 1PL1A 3GUSA 3TRPA 2H19A 3VFIA 2WZSA 5ECOB 1GSEA 2CVKA 2O8VB 4YAVA 2FWHA 3VK9A 1OC9A 2AUVA 3IC4A 4ZB9A 4MNNA 4ULXA 5ECKB 1X9WB 4XHMA 1N8JA 3CXGA 1BF5A 2FGXA 1ILOA 5EPFA 5LCZA 2WVYA 2YZUA 2LSTA 3RHBA 1DBYA 2MMNA 4OO4A 1OE8A 4G10A 1MDIA 1TXUA 4KA0A 3P7XA 5F0GA 1EV4A 4GTUA 3HZ4A 3M0FA 4O7HA 3LXTA 4QQ7A 1YY7A 5B6NA 3HJMA 1M9BA 2CT6A 3L9UA 2XHFA 4G0LA 2YNXA 1B9YC 5GSTA 2LUSA 4KX4A 1F9MA 2JU5A 2N5BA 2PVQA 2LTKA 1BQ7A 2IFQB 1A2LA 3FHKA 1YKAA 1SYRA 3EINA 4KDYA 3US3A 2X4AA 2V41A 4PI2C 3WYWA 1MEKA 2OT3A
chains in the Genus database with same CATH topology
3GKKA 1WMJA 4GRFA 3RAZA 1MTCA 3TUEA 1V58A 2PVOC 4K5SA 2H30A 2H1LA 1G0TA 4V2LA 2NVLA 1SD8A 1YEXA 2F3MA 5G1LA 4CHSA 1K0AA 1ABAA 5C00A 1XOBA 4V2NA 5D8IA 4K8MA 3FK8A 5GSSA 1O8WA 1R7HA 2PWJA 2KP1A 5KN2A 3TJKA 1V2AA 2YJ7A 3ZITA 4PQHA 3WT1A 5JWRB 3O3TA 2R4VA 5H5RA 1HNAA 5AIVA 2IN3A 4G0KA 2M46A 5B8BA 3MNGA 4OWYA 2OE1A 5FT3A 1PX7A 5D96A 4G0IA 3FZ5A 1TKDB 4K2XA 3L4NA 4NHWA 2H0IA 1U3IA 1RW1A 2H1AA 5CRGA 5IPHA 2LS5A 3QR6A 4KB3A 5A4VA 1PN9A 5G2ZA 1ZL9A 1H4OA 3E9JB 1JZWA 2XBIA 3F63A 1AQVA 3VURA 2C80A 1SK0A 2XC2A 1YQ1A 4XS4B 1AQWA 1EV9A 4EIQA 3UJ1A 1Z6MA 3KXOA 3U6VA 1VGLA 3M9JA 3G7YA 2IWTA 3DWVA 3UVHA 3QD9A 1TOFA 5IMDA 4MJEA 2FA8A 3AY8A 4K9ZA 2YWOA 4MP4A 4HUAA 1G7EA 3ZIVA 2OBKA 1YJ6A 4WR5A 4O5RA 1HD2A 2L59A 3HXSA 1THOA 2IJYA 4IQAA 3HJPA 3FZ4A 2ON5A 3PR8A 1NM3A 2V6KA 5J9BA 1GLPA 3G9BA 4I2UA 2QSIA 2C3TA 2GVPA 4TXVA 2BMXA 4KCEA 4RUVA 3GN3A 3HZ8A 2GSTA 4CW9A 2C0FA 3GV1A 4I6XA 3TB2A 1FB0A 2HYXA 4CDOA 1TJDA 3V1WA 5A5HA 1A0FA 4NMUA 4AKIA 1XVQA 3HYPA 2HE3A 3IDVA 3VWXA 3IV4A 2OA7A 4TR4A 3FR6A 4MJCA 1J0FA 1GTAA 3QAGA 1TI3A 3HVSA 4DSQA 3NIVA 5J40A 3GIXA 3IR4A 2HT9A 5ECRB 4DSRA 3EE2A 4HZ4A 4ZB6A 4ZBAA 3D0ZA 3KMOA 2JSZA 4NAXA 4HI7A 3D5JA 1EEMA 5EY6A 2WFCA 1GP1A 2H66A 3APQA 5A34B 5F07A 3UBLA 3O76A 3I43A 1Y25A 1THXA 4PUAA 1SENA 1TI1A 5J4UA 5A1NA 3CSIA 3TRQA 3VI7A 11GSA 1CQHA 2GDRA 2ZNMA 1OC8A 1A8LA 4PXOA 3KD0A 1NHYA 2C0GA 5DBQA 5DJLA 4OMVA 1ACVA 3GL3A 4LL1B 1PN0A 1T8EB 1GTUA 3L0HA 4ISDA 3ED3A 1VF2A 4ECIA 4BVXB 1V40A 2H74A 1KTEA 3DD3A 3HDCA 3QMXA 4A5PA 2UZ8A 4D73B 2VM1A 4KGIA 1EEJA 3U5RE 1YKCA 2O87A 2R37A 3EWLA 4MF6A 1AW9A 1ERWA 2L6DA 5E4WA 3N5OA 2VLUA 1UVZA 1J08A 4K0GA 2M72A 2XPDA 3ZVJD 4IBPA 1B4QA 3M3MA 2P31A 1OE7A 4BL7B 4RI7A 1YEPA 4PUFC 3QFBC 1AAZA 5E59A 3I9V2 5D9TA 2P5RA 5GZZB 3FEUA 3FY7A 3WD6A 1U88A 4TVEA 3RPPA 5F8BA 2E2GA 2QA2A 5ECLB 3MSZA 4MPFA 2H0HA 4L5LA 1YF0A 3F0IA 4MMMA 2IFQA 3C1SA 2R0PA 4EVMA 2N5FA 4Z2RA 3DIEA 1RK4A 1M2AA 4KE3A 2H1GA 2H76A 3C73A 5DCHA 3TJFA 1Y6EA 1TTZA 2DKIA 16GSA 2M80A 2I4AA 4AJ8A 2EIRA 4BWSA 1K0MA 3VWVA 2O7KA 4ICYA 5KN3A 1O6JA 2DKHA 1Q98A 4N10A 5DALB 2WRTA 4L5OA 5HQPA 3KCMA 3KM6A 3C1RA 4TR3A 1E6BA 5CRWA 2HRKB 4CY6A 4PQ1A 4EF0A 2WDUA 3O6TA 7GSSA 4ILFA 2VIMA 3LEFA 5IPGA 1EZKA 1K0BA 1C72A 1GSSA 1RQMA 5J3RA 4NV5A 10GSA 5IIZA 4XRDA 3ZL5A 2QC7A 5DQSA 1YZXA 3WGDA 1JZOA 1M0UA 5ECSA 2PN8A 2VLTA 1KNGA 5D9WA 3LWAA 2HRAA 4DVCA 3Q6OA 5IOWA 2OE3A 4L0UA 4OFMA 2H72A 5A5KA 1A2MA 3FR9A 4NHZA 1Z5YE 2VCXA 4F0BA 2FUG2 4E68A 2C0DA 4FYUA 4Q5NA 4ZL9A 1USBA 3TJJA 4IVFA 1M7TA 3D4MA 3IOSA 2LRTA 4FQUA 1QQ2A 4Z7XA 5ECNB 1M2DA 2CZ3A 3KP9A 4J57E 4ID0A 1OVNA 3EMXA 5HR3A 2E2MA 5HFKA 3ME7A 3LYPA 2VD1A 5B6MA 1OKTA 1XW5A 4I2TA 2E0QA 4IN0A 3P90A 4KCAA 5AN1A 1T00A 4MCUA 2A2PA 1K3YA 5ID2B 5DDLA 2PMTA 5LD0A 2B5EA 4IJ3A 1T7PB 5CP1A 3GHAA 4HDEA 1N2AA 2V32A 1SU9A 5DAKB 2B1KA 2IMKA 2DC5A 1PGTA 2YN1A 2FA4A 4TR1A 6GSVA 3IBHA 5G5FA 5G5EA 3E0UA 3TKSA 1WOUA 2H0GA 2HQTA 2UV8G 1DSBA 1E2YA 3A2WA 2LNTA 2LV3A 2K8SA 5HFGA 4IHUA 2XBQA 3UMAA 2YOIA 1JFUA 2FWEA 2TRXA 3GKMA 5L71A 2O89A 2R0GA 2HNLA 3MYDA 1SJZA 4G19A 1GSUA 2OKAA 3Q18A 2F9SA 4I5QA 4TXOA 2WZ9A 1FO5A 1GWCA 6GSWA 1PQNA 1QK8A 5J4YA 1SVMA 3GA4A 4O32A 4GCIA 2CVDA 2GSQA 2FWGA 3IK9A 3R3EA 4LMWA 1QMVA 2REMA 5A4WA 2H01A 3N9JA 3KGKA 4K1FA 1X9MB 5A34A 2H71A 4PURA 3TDGA 2AJQB 1J9BA 5J41A 3MWHA 3TJBA 4OCFA 4OCEA 3ME8A 1HNCA 1SJIA 5G30A 4POBA 6GSXA 2J23A 5HR1A 5IMVA 4G2EA 4BVXA 3FZ9A 4E8HA 1GH2A 3S9FA 5CRDA 2QA1A 4OFNA 4D73A 1HQOA 1ZZYA 3ZRDA 3GURA 1WP0A 4QL9A 1O73A 4ZB7A 3DGQA 1LJRA 1F2EA 2H6ZA 3W6GA 3GTUB 4AKHA 2C8UA 4FH8A 4PNGA 4FIWA 2DJKA 2QKEA 5IMCA 1JLVA 4MH3A 20GSA 2DBCA 3GL5A 3C7MA 4K7OA 2CX4A 2X8GA 1PA3A 2I9HA 4DSSB 8GSSA 3L78A 4J56E 3IAM2 2YV7A 2HZEB 2WJUA 3QOUA 5J9CA 3W8SA 4AKGA 1XWBA 3EURA 1NW2A 4MZCA 3P2AA 4G9HA 1Q4JA 2O85A 4RQRA 4TKYA 4KAEA 6GSYA 3QDNA 3G7IA 2CVBA 1ZOFA 4MH2A 5COHA 3R2QA 3RBTA 3I69A 4Q5FA 5J47A 2VCQA 1SKWB 5AISA 3ZIJA 2DJ2A 3F3QA 2GQKA 2V2GA 4ECCA 1B48A 2L4CA 4K6XA 1V9WA 6GSUA 1SK2A 4JU5A 2DJJA 2YP6A 4V2MA 2DJ1A 1GSQA 2B3SA 2C3NA 3ERWA 3HY2A 2GLRA 2RUEA 4GXZA 2HSNA 1A8YA 4DEJA 4ZIJA 1XCCA 4I8BA 3FZAA 1IYHA 3LG6A 5ECHB 1WJKA 4FO5A 3H1NA 4W66A 1PMTA 4F82A 1MDJA 1WIKA 4PQIA 5IMFA 1T1VA 3QPMA 3ZVJA 5F06A 2EFEA 5B7CA 2GT5A 4POMA 4GWRA 4N11A 5KN1A 3TKPA 3TGZA 3F6FA 3VI5A 4HQSA 1OKDA 2CA8A 1GUKA 2VLVA 3DYRA 3TJGA 1PX6A 1NHOA 3CBUA 4EO3A 2NPBA 2HSMA 3APOA 3HA9A 4N30A 2ZCTA 3PH9A 1K0NA 4HU7A 2GTUA 5JWOB 2MMAA 4HJ2A 3LSZA 2LNSA 4KNDA 4TRXA 1A2JA 1XWGA 4TOPA 1B8XA 2XPEA 3LGCA 1F3BA 3QFAC 1Z3EA 3L9VA 4HJMA 3UVTA 5HR2A 1SVLA 1X5EA 2CAQA 1TU8A 2R2JA 3KTLA 1O85A 2DIZA 2IL3A 3APSA 2X99A 5J5NA 2B5YA 4POLA 1SJ6A 5HFIA 1SD9A 1EP7A 1W4VA 1X5CA 1SK1A 1EGRA 3GSSA 4L0WA 2PERA 3HCZA 4OO5A 4TN8A 4AKXB 1QFNA 4HEA2 1GTBA 1XIYA 1R5AA 5IO0A 2B7KA 1GRXA 4MZWA 3A2VA 2GZPA 3GSTA 5ECPB 4XRAA 1UN2A 4IS0A 1S3AA 3A2XA 3FMWA 1GTIA 1F6MC 3F4SA 5JCUA 1VF4A 1O7UA 1FHEA 3LFLA 4MPGA 4GLTA 1VF1A 4ZILA 4F2IA 3KZQA 2VOCA 4X0XA 3IK7A 4LMVA 3ZMKA 4Z2TA 4GQFA 2V6OA 4JRRA 1WWJA 1A0RP 4KUNA 3VWUA 1GLQA 2KP2A 3FKFA 4HZ2A 3F6DA 3NOFA 3SWLA 2VL2A 4GSSA 2H1BA 4BA7A 4ZBBA 1GUMA 2NBSA 2L6CA 5CRHA 4OFTA 3LQ7A 4GSNA 5KOXA 1UC7A 4HOJA 3UAPA 14GSA 2HRFA 1G6YA 5ELGA 4AI6A 2JZRA 3HVXA 1TK8B 1M99A 4ML1A 4K7NA 2LKUA 1X5DA 2CX3A 4IGJA 2A4VA 1T3BA 2WULA 2GZZA 4WF4A 3EU3A 1TDIA 1I9DA 4JR4A 3J7Yk 4PGTA 3GKXA 3GTUA 1S3CA 1V57A 2VM2A 1GSDA 1ZCPA 3GH6A 4IP1A 1ERTA 2I1UA 1MD4A 4WR4A 3F8UA 1CQGA 4V1Ap 3BJ5A 4EDZA 2EIQA 3DEXA 2MMZA 3W8JA 4KF9A 2EFCA 2MMOA 3ZMLA 2KHPA 4JBBA 1FOVA 3DKSA 3IXRA 5G31A 4XS1A 4N0VA 1O8XA 2RUFA 4YQMA 4KW6A 4MK3A 4I97A 5INYA 4IQ1A 1AC1A 1A23A 2EIOA 3D6IA 4GDFA 3IA1A 2A2SA 2LQOA 4MF5A 2DMMA 1ZYNA 3TU3B 4PX1A 4ZXGA 2KUCA 1GNEA 4F03A 3WGEA 1K3OA 4AJ6A 4ECJA 4NV2A 3DVWA 5AIXA 4XS4A 1XFLA 2DIYA 3F9UA 4J2FA 1GSYA 1WRYA 2VL3A 3D21A 1EGOA 3GX0A 3LYKA 4WXTA 4TW5A 4POKA 1U87A 2TIRA 5BMUB 4RI6A 2LJRA 1TW9A 4JZQA 5FWGA 1ERVA 3TCOA 1QUWA 2R6KA 2OADA 4EL1A 1FB6A 2PUKC 1ZGNA 4AJ7A 2A2RA 2PPTA 1MDKA 3HVVA 1OYJA 2R5GA 5A5HB 4Q5RA 5GAND 4ECBA 3GNJA 2B6MA 3F3RA 3ZREA 1TK0B 1TRUA 3VPTA 1ZYEA 1XW6A 2H6YA 1BEDA 2FCHA 1R4WA 4K5RA 4X1UA 1SKRB 3EU4A 4WBJA 4XS6A 5JWQB 1ST9A 2OJLA 4YAPA 2LJAA 4RQXA 2VUPA 5KN0A 4IW9A 1GNWA 3LXZA 2KOKA 4YKGA 2AB6A 3CRUA 2RM6A 1M9AA 2EFDA 4QMKA 5ECIB 4YQUA 4WETA 2X8HA 4ZL8A 1YVLA 4JR6A 17GSA 5A1NB 2NDOA 3J7Yb 2DLXA 3IC8A 2YZHA 1X9SB 1XZOA 2C1YA 3UIWA 2WCIA 1FOHA 2K9FA 3RHCA 1XXUA 1NSWA 3H79A 1GULA 2AYTA 4EIPA 2FD3A 1AIUA 1XOAA 5DCGA 3EVIA 2NTOA 3F4TA 3GYKA 1TP9A 1F3AA 4BWQA 4G01A 1H75A 1JZDA 1T4YA 2VAFA 5CREA 3D4TA 1XWKA 1YDKA 22GSA 3UBKA 1Z7RA 1JZRA 4E8EA 1TRWA 5ENUA 1DE1A 1BG5A 6GSTA 3EMPA 1Y1UA 2RIIA 2X64A 2VKZG 3UOMA 1SKSB 4WF5A 4N3ZA 1QXHA 1AQXA 2HZFA 3Q74A 3DVXA 5CNWA 2LRNA 3TKSC 2CV4A 3FYGA 1FVJA 1R26A 2GT6A 4TR0A 5IQYA 1LBKA 3EYTA 2DSAA 1SL1B 4WBRD 3BCIA 5AGYA 2C4JA 2PBJA 4IKHA 4FYBA 4CY8A 3FW2A 3MIXA 3IE3A 3E3EA 1TXXA 2O5VA 4IELA 3JCML 3HMJG 2YWIA 3HJOA 5DJMA 2H1DA 3EC3A 2H75A 1OC3A 4BL7A 4MZBA 1I5GA 5D9VA 4HU9A 5JCGA 2DJ3A 3KIJA 1B9XC 4AF2A 4YQVA 2OBIA 4ACSA 4XTSA 1WE0A 3C8EA 1W89A 1XPVA 4IP6A 5G1KA 1BJXA 2C3QA 3CWGA 2VO4A 4LL4B 4V1Ag 1AUCA 2IMDA 1XWAA 1SL0B 3KMNA 1V98A 3GH9A 1BYEA 3FRCA 4USSA 2IMFA 2HI7A 3ERFA 1HNBA 3IAS2 2F8AA 1MD3A 4OD7A 2WGRA 4HS1A 1YF1A 1FVKA 4KH7A 3ZTLA 2B5XA 3ZFLA 5DALA 5EVOA 4BVYB 1FG4A 2HRNA 1PD21 4HQZA 2X8CA 2HRKA 1PKWA 4EUYA 1JHBA 1G6WA 2B1LA 1TU7A 4EE0A 3L9SA 4JE1A 1PL2A 2YWMA 3WGXA 3G7JA 2L4QA 4FYCA 2Z9SA 1EOGA 4MLYA 5C04A 2J9HA 2ES7A 3VWWA 5IM9A 5J4VA 4NPBA 3TKSE 5EL8A 2I81A 1ZYPA 2K6VA 4H86A 1FAAA 2CZ2A 2MBTA 2JL4A 3UARA 3BCKA 1QGVA 3KTBA 1Z7PA 3KJYA 2FLSA 1WPIA 3CTGA 2H73A 5IOXA 3ERGA 4X43A 5D73A 2VCWA 3IPZA 1X0RA 5DQYA 3RPNA 2PGTA 2B7JA 3M8NA 4MJAA 2EFHA 3LJRA 2JADA 2HSYA 2X49A 1TRVA 1ERUA 3ZFBA 3IRAA 4O5UA 1SYXA 5HR0A 13GSA 2F51A 5B8AA 2V1MA 1U3AA 5BMUA 1B4PA 2L5OA 1ON4A 3CTFA 3HHVA 3GX8A 1UA5A 4TR1B 1GUHA 9GSSA 2H70A 4O5QA 2IMIA 2IIYA 2YANA 3BBYA 1OC9B 1KBNA 2VD0A 2H8LA 5H5QA 2MBSA 5A4UA 3P8WA 3A5WA 1FW1A 4YH2A 5GAPD 1OAZA 3VLNA 5CAXA 4PTSA 1DUGA 2QGVA 1EWXA 5ID2A 5BRTA 3ZZXA 1AXDA 2BJXA 1K0DA 3M9KA 3KH9A 2GSRA 5DAKA 4TXOB 2VCVA 1HYUA 3GRXA 3IHGA 2K18A 1U6TA 1O81A 4GQCA 4L8EA 3BD2A 2YCDA 5IMZA 1ZMAA 2ZUPA 1KEBA 3KEBA 1XVWA 1SVOA 1URMA 3UEMA 3NZNA 1TK5B 3CSJA 1Z6NA 2AHEA 1TRSA 3IHQA 1BG1A 2P0GA 4QL7A 2AV4A 2LRCA 2ALBA 3LORA 1Z9HA 2H6XA 2IPAA 2GS3A 6GSSA 4NXIA 5IMAA 2D2ZA 1SL2B 2TRCP 1XBSA 2R3XA 2HXKA 1K0OA 3C71A 3TOTA 4F0CA 1XWCA 3CRTA 3OR5A 1F37A 4XCSA 1N25A 5KEJA 2JSYA 4F9ZA 2OACA 2DJ0A 5D93A 2LJKA 2RM5A 5H5SA 4Z2UA 3TKQA 2AAWA 1M2BA 3CYNA 3CMIA 2CAIA 1PRXA 3EPTA 3ISOA 4Q5QA 5ABRA 2GQMA 2L5LA 4XIHA 3KP8A 2JACA 2LEGA 1A24A 4X4JA 4KSOA 2FWFA 1VF3A 3HD5A 2FNOA 4P3YB 2YJHA 1ML6A 3RDWA 3UL3A 1IYIA 2RLIA 2FY6A 4KSMA 4ZBDA 4ZB8A 2YWNA 2HFDA 3DRNA 4K7IA 4IJIA 4O92A 3DXBA 1R5PA 2DMLA 4MDCA 3HKRA 2MYGA 4MA9A 4MJBA 1T4ZA 1G7OA 5ELAA 3GFKA 4DSSA 5LNKe 2G0FA 2HZEA 3TOUA 4PNFA 2WB9A 4AGSA 1EP8A 2I3YA 3FR3A 5CYYA 4EDYA 4EKZA 1DE2A 1JLWA 2VCTA 3LW9A 3F4RA 2KLXA 2GGTA 2VL2C 18GSA 2L57A 4YKFA 3PPUA 3GKNA 1K3LA 2YPMA 4MABA 1EOHA 3GMFA 2JZSA 1XW9A 4EXJA 4NWYA 1GSFA 2JZTA 2CQ9A 2HLSA 1ZYQB 2F8FA 3A3TA 4LA1A 3H93A 4ZL7A 2HSNB 2FHEA 2R0CA 3VPQA 4GF0A 4LLRA 4WKWA 3Q19A 1BX9A 4BVYA 1LU4A 2G2QA 4K0NA 1S3DA 3K8NA 3DMLA 5CO3A 5DVBA 5JCWA 4KDUA 2BTOT 2E7PA 3QCPA 3WT2A 1VRSD 5FHIA 5F05A 4EC0A 1PSQA 2VCZA 3MDKA 2N5AA 2YV9A 2MZCA 3PGTA 3TRXA 3H8QA 4GSTA 4BPYA 5ECMB 4K2DA 3QAWA 4MF7A 3QAVA 2C0EA 2EC4A 2ON7A 2A4HA 3H4KA 2HSHA 3CSHA 2HSMB 2WS2A 12GSA 2K8VA 4ML6A 3ZYWA 2GSSA 2PU9C 3BOAA 3MAKA 4N0ZA 5IO2A 1GL8A 2OE0A 3ZLPA 5D9XA 2GZYA 3A5IA 1K0CA 4WEYA 4JEDA 3D22A 2IMEA 3KH7A 3SBCA 5KOWA 3PINA 4KDXA 2VL9A 1BAYA 1PKZA 2GQLA 19GSA 2P5QA 3M1GA 3TKRA 3I6AA 2LQQA 5ECQB 1PL1A 3GUSA 3TRPA 2H19A 3VFIA 5ECOB 1GSEA 2CVKA 2O8VB 4YAVA 2FWHA 3VK9A 1OC9A 2AUVA 3IC4A 4ZB9A 4MNNA 4ULXA 5ECKB 1X9WB 4XHMA 1N8JA 3CXGA 1BF5A 2FGXA 1ILOA 5EPFA 5LCZA 2YZUA 2LSTA 3RHBA 1DBYA 2MMNA 4OO4A 1OE8A 4G10A 1MDIA 1TXUA 4KA0A 3P7XA 5F0GA 1EV4A 4GTUA 3HZ4A 3M0FA 4O7HA 3LXTA 4QQ7A 1YY7A 5B6NA 3L9UA 1M9BA 3HJMA 2CT6A 2XHFA 4G0LA 2YNXA 1B9YC 5GSTA 2LUSA 4KX4A 1F9MA 2JU5A 2N5BA 2PVQA 2LTKA 1BQ7A 2IFQB 1A2LA 3FHKA 1YKAA 1SYRA 3EINA 4KDYA 3US3A 2X4AA 2V41A 3WYWA 1MEKA 2OT3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GKK A;  1WMJ A;  4GRF A;  3RAZ A;  1MTC A;  3TUE A;  1V58 A;  2PVO C;  2H30 A;  1G0T A;  4V2L A;  2NVL A;  1SD8 A;  1YEX A;  2F3M A;  5G1L A;  4CHS A;  1K0A A;  1ABA A;  5C00 A;  1XOB A;  4V2N A;  5D8I A;  4K8M A;  3FK8 A;  5GSS A;  1O8W A;  1R7H A;  2PWJ A;  2KP1 A;  5KN2 A;  3TJK A;  1V2A A;  2YJ7 A;  3ZIT A;  4PQH A;  3WT1 A;  5JWR B;  3O3T A;  2R4V A;  5H5R A;  1HNA A;  5AIV A;  2IN3 A;  4G0K A;  2M46 A;  5B8B A;  3MNG A;  4OWY A;  2OE1 A;  5FT3 A;  1PX7 A;  5D96 A;  4G0I A;  3FZ5 A;  1TKD B;  3L4N A;  4NHW A;  2H0I A;  1U3I A;  1RW1 A;  2H1A A;  5CRG A;  5IPH A;  2LS5 A;  3QR6 A;  4KB3 A;  5A4V A;  1PN9 A;  5G2Z A;  1ZL9 A;  1H4O A;  3E9J B;  1JZW A;  2XBI A;  3F63 A;  1AQV A;  3VUR A;  2C80 A;  1SK0 A;  2XC2 A;  1YQ1 A;  4XS4 B;  1AQW A;  1EV9 A;  3UJ1 A;  1Z6M A;  3KXO A;  3U6V A;  1VGL A;  3M9J A;  3G7Y A;  2IWT A;  3DWV A;  3UVH A;  3QD9 A;  1TOF A;  5IMD A;  4MJE A;  2FA8 A;  3AY8 A;  4K9Z A;  2YWO A;  4MP4 A;  4HUA A;  1G7E A;  3ZIV A;  2OBK A;  1YJ6 A;  4WR5 A;  4O5R A;  1HD2 A;  2L59 A;  3HXS A;  1THO A;  2IJY A;  4IQA A;  3HJP A;  3FZ4 A;  2ON5 A;  3PR8 A;  1NM3 A;  2V6K A;  5J9B A;  1GLP A;  3G9B A;  4I2U A;  2QSI A;  2C3T A;  2GVP A;  4TXV A;  2BMX A;  4KCE A;  4RUV A;  3GN3 A;  3HZ8 A;  2GST A;  4CW9 A;  2C0F A;  3GV1 A;  4I6X A;  3TB2 A;  1FB0 A;  2HYX A;  4CDO A;  1TJD A;  3V1W A;  1A0F A;  4NMU A;  1XVQ A;  3HYP A;  2HE3 A;  3IDV A;  3VWX A;  3IV4 A;  2OA7 A;  4TR4 A;  3FR6 A;  4MJC A;  1J0F A;  1GTA A;  3QAG A;  1TI3 A;  3HVS A;  4DSQ A;  3NIV A;  3GIX A;  3IR4 A;  2HT9 A;  5ECR B;  4DSR A;  3EE2 A;  4HZ4 A;  4ZB6 A;  4ZBA A;  3D0Z A;  3KMO A;  2JSZ A;  4NAX A;  4HI7 A;  3D5J A;  1EEM A;  5EY6 A;  1GP1 A;  2H66 A;  2WFC A;  3APQ A;  5F07 A;  3UBL A;  3O76 A;  3I43 A;  1Y25 A;  1THX A;  4PUA A;  1SEN A;  1TI1 A;  5J4U A;  3CSI A;  3TRQ A;  3VI7 A;  11GS A;  1CQH A;  2GDR A;  2ZNM A;  1OC8 A;  1A8L A;  4PXO A;  3KD0 A;  1NHY A;  2C0G A;  5DBQ A;  5DJL A;  4OMV A;  1ACV A;  3GL3 A;  4LL1 B;  1T8E B;  1GTU A;  3L0H A;  4ISD A;  3ED3 A;  1VF2 A;  4ECI A;  4BVX B;  1V40 A;  2H74 A;  1KTE A;  3DD3 A;  3HDC A;  3QMX A;  2UZ8 A;  4D73 B;  2VM1 A;  4KGI A;  1EEJ A;  3U5R E;  1YKC A;  2O87 A;  2R37 A;  3EWL A;  4MF6 A;  1AW9 A;  1ERW A;  2L6D A;  5E4W A;  3N5O A;  2VLU A;  1UVZ A;  1J08 A;  4K0G A;  2M72 A;  2XPD A;  3ZVJ D;  4IBP A;  1B4Q A;  3M3M A;  2P31 A;  1OE7 A;  4BL7 B;  4RI7 A;  1YEP A;  4PUF C;  3QFB C;  1AAZ A;  5E59 A;  3I9V 2;  5D9T A;  2P5R A;  5GZZ B;  3FEU A;  3FY7 A;  3WD6 A;  1U88 A;  4TVE A;  3RPP A;  5F8B A;  2E2G A;  5ECL B;  3MSZ A;  4MPF A;  2H0H A;  4L5L A;  1YF0 A;  3F0I A;  4MMM A;  2IFQ A;  3C1S A;  4EVM A;  2N5F A;  3DIE A;  1RK4 A;  1M2A A;  4KE3 A;  2H1G A;  2H76 A;  3C73 A;  5DCH A;  3TJF A;  1Y6E A;  1TTZ A;  16GS A;  2M80 A;  2I4A A;  4AJ8 A;  2EIR A;  4BWS A;  1K0M A;  3VWV A;  2O7K A;  5KN3 A;  1O6J A;  1Q98 A;  4N10 A;  5DAL B;  2WRT A;  4L5O A;  5HQP A;  3KCM A;  3KM6 A;  3C1R A;  4TR3 A;  1E6B A;  5CRW A;  2HRK B;  4PQ1 A;  4EF0 A;  2WDU A;  3O6T A;  7GSS A;  4ILF A;  2VIM A;  3LEF A;  5IPG A;  1EZK A;  1K0B A;  1C72 A;  1GSS A;  1RQM A;  5J3R A;  4NV5 A;  10GS A;  5IIZ A;  4XRD A;  3ZL5 A;  2QC7 A;  5DQS A;  1YZX A;  3WGD A;  1JZO A;  1M0U A;  5ECS A;  2PN8 A;  2VLT A;  1KNG A;  5D9W A;  3LWA A;  2HRA A;  4DVC A;  3Q6O A;  5IOW A;  2OE3 A;  4L0U A;  4OFM A;  2H72 A;  5A5K A;  1A2M A;  3FR9 A;  4NHZ A;  1Z5Y E;  2VCX A;  4F0B A;  2FUG 2;  2C0D A;  4FYU A;  4Q5N A;  4ZL9 A;  1USB A;  3TJJ A;  4IVF A;  1M7T A;  3D4M A;  3IOS A;  2LRT A;  4FQU A;  1QQ2 A;  4Z7X A;  5ECN B;  1M2D A;  2CZ3 A;  3KP9 A;  4J57 E;  4ID0 A;  1OVN A;  3EMX A;  5HR3 A;  2E2M A;  5HFK A;  3ME7 A;  3LYP A;  2VD1 A;  5B6M A;  1OKT A;  1XW5 A;  4I2T A;  2E0Q A;  4IN0 A;  3P90 A;  4KCA A;  5AN1 A;  1T00 A;  4MCU A;  1K3Y A;  5ID2 B;  5DDL A;  2PMT A;  5LD0 A;  2B5E A;  4IJ3 A;  1T7P B;  5CP1 A;  3GHA A;  4HDE A;  1N2A A;  2V32 A;  1SU9 A;  5DAK B;  2B1K A;  2IMK A;  2DC5 A;  1PGT A;  2YN1 A;  2FA4 A;  4TR1 A;  6GSV A;  3IBH A;  5G5F A;  5G5E A;  3E0U A;  3TKS A;  1WOU A;  2H0G A;  2HQT A;  1DSB A;  1E2Y A;  3A2W A;  2LNT A;  2LV3 A;  2K8S A;  5HFG A;  4IHU A;  2XBQ A;  3UMA A;  2YOI A;  1JFU A;  2FWE A;  2TRX A;  3GKM A;  5L71 A;  2O89 A;  2HNL A;  1SJZ A;  4G19 A;  1GSU A;  2OKA A;  3Q18 A;  2F9S A;  4I5Q A;  4TXO A;  2WZ9 A;  1FO5 A;  1GWC A;  6GSW A;  1PQN A;  1QK8 A;  3GA4 A;  4O32 A;  4GCI A;  2CVD A;  2GSQ A;  2FWG A;  3IK9 A;  3R3E A;  4LMW A;  1QMV A;  2REM A;  5A4W A;  2H01 A;  3N9J A;  3KGK A;  4K1F A;  1X9M B;  2H71 A;  4PUR A;  3TDG A;  2AJQ B;  1J9B A;  5J41 A;  3MWH A;  3TJB A;  4OCF A;  4OCE A;  3ME8 A;  1HNC A;  1SJI A;  5G30 A;  4POB A;  6GSX A;  2J23 A;  5HR1 A;  5IMV A;  4G2E A;  4BVX A;  3FZ9 A;  4E8H A;  1GH2 A;  3S9F A;  5CRD A;  4OFN A;  4D73 A;  1HQO A;  1ZZY A;  3ZRD A;  3GUR A;  1WP0 A;  4QL9 A;  1O73 A;  3DGQ A;  1LJR A;  1F2E A;  2H6Z A;  3W6G A;  3GTU B;  2C8U A;  4FH8 A;  4PNG A;  4FIW A;  2DJK A;  2QKE A;  5IMC A;  1JLV A;  4MH3 A;  20GS A;  2DBC A;  3GL5 A;  3C7M A;  4K7O A;  2CX4 A;  2X8G A;  1PA3 A;  2I9H A;  4DSS B;  8GSS A;  3L78 A;  4J56 E;  3IAM 2;  2YV7 A;  2HZE B;  2WJU A;  3QOU A;  5J9C A;  3W8S A;  1XWB A;  3EUR A;  1NW2 A;  4MZC A;  3P2A A;  4G9H A;  1Q4J A;  2O85 A;  4RQR A;  4TKY A;  4KAE A;  6GSY A;  3QDN A;  3G7I A;  2CVB A;  1ZOF A;  4MH2 A;  5COH A;  3R2Q A;  3RBT A;  3I69 A;  4Q5F A;  2VCQ A;  1SKW B;  5AIS A;  3ZIJ A;  2DJ2 A;  3F3Q A;  2GQK A;  2V2G A;  4ECC A;  1B48 A;  2L4C A;  4K6X A;  1V9W A;  6GSU A;  1SK2 A;  4JU5 A;  2DJJ A;  2YP6 A;  4V2M A;  2DJ1 A;  1GSQ A;  2B3S A;  2C3N A;  3ERW A;  3HY2 A;  2GLR A;  2RUE A;  4GXZ A;  1A8Y A;  4DEJ A;  4ZIJ A;  1XCC A;  4I8B A;  3FZA A;  1IYH A;  3LG6 A;  5ECH B;  1WJK A;  4FO5 A;  3H1N A;  1PMT A;  4F82 A;  1MDJ A;  1WIK A;  4PQI A;  5IMF A;  1T1V A;  3QPM A;  3ZVJ A;  5F06 A;  5B7C A;  2GT5 A;  4POM A;  4GWR A;  4N11 A;  5KN1 A;  3TKP A;  3TGZ A;  3F6F A;  3VI5 A;  4HQS A;  1OKD A;  2CA8 A;  1GUK A;  2VLV A;  3DYR A;  3TJG A;  1PX6 A;  1NHO A;  3CBU A;  4EO3 A;  2NPB A;  2HSM A;  3APO A;  3HA9 A;  4N30 A;  2ZCT A;  3PH9 A;  1K0N A;  4HU7 A;  2GTU A;  5JWO B;  2MMA A;  4HJ2 A;  3LSZ A;  2LNS A;  4KND A;  4TRX A;  1A2J A;  1XWG A;  4TOP A;  1B8X A;  2XPE A;  3LGC A;  1F3B A;  3QFA C;  1Z3E A;  3L9V A;  4HJM A;  3UVT A;  5HR2 A;  1X5E A;  2CAQ A;  1TU8 A;  2R2J A;  3KTL A;  1O85 A;  2DIZ A;  2IL3 A;  3APS A;  2X99 A;  5J5N A;  2B5Y A;  4POL A;  1SJ6 A;  5HFI A;  1SD9 A;  1EP7 A;  1W4V A;  1X5C A;  1SK1 A;  1EGR A;  3GSS A;  4L0W A;  2PER A;  3HCZ A;  4OO5 A;  4TN8 A;  1QFN A;  4HEA 2;  1GTB A;  1XIY A;  1R5A A;  5IO0 A;  2B7K A;  1GRX A;  4MZW A;  3A2V A;  2GZP A;  3GST A;  5ECP B;  4XRA A;  1UN2 A;  4IS0 A;  1S3A A;  3A2X A;  1GTI A;  1F6M C;  3F4S A;  5JCU A;  1VF4 A;  1O7U A;  1FHE A;  3LFL A;  4MPG A;  4GLT A;  1VF1 A;  4ZIL A;  4F2I A;  3KZQ A;  2VOC A;  4X0X A;  3IK7 A;  4LMV A;  3ZMK A;  4GQF A;  2V6O A;  4JRR A;  1WWJ A;  1A0R P;  4KUN A;  3VWU A;  1GLQ A;  2KP2 A;  3FKF A;  4HZ2 A;  3F6D A;  3NOF A;  3SWL A;  2VL2 A;  4GSS A;  2H1B A;  4BA7 A;  4ZBB A;  1GUM A;  2NBS A;  2L6C A;  5CRH A;  4OFT A;  3LQ7 A;  4GSN A;  1UC7 A;  4HOJ A;  3UAP A;  14GS A;  2HRF A;  1G6Y A;  5ELG A;  2JZR A;  3HVX A;  1TK8 B;  1M99 A;  4ML1 A;  4K7N A;  2LKU A;  1X5D A;  2CX3 A;  4IGJ A;  2A4V A;  1T3B A;  2WUL A;  2GZZ A;  4WF4 A;  3EU3 A;  1TDI A;  1I9D A;  4JR4 A;  3J7Y k;  4PGT A;  3GKX A;  3GTU A;  1S3C A;  1V57 A;  2VM2 A;  1GSD A;  1ZCP A;  3GH6 A;  4IP1 A;  1ERT A;  2I1U A;  1MD4 A;  4WR4 A;  3F8U A;  1CQG A;  4V1A p;  3BJ5 A;  4EDZ A;  2EIQ A;  3DEX A;  2MMZ A;  3W8J A;  4KF9 A;  2MMO A;  3ZML A;  2KHP A;  4JBB A;  1FOV A;  3DKS A;  3IXR A;  5G31 A;  4XS1 A;  4N0V A;  1O8X A;  2RUF A;  4YQM A;  4KW6 A;  4MK3 A;  4I97 A;  5INY A;  4IQ1 A;  1AC1 A;  1A23 A;  2EIO A;  3D6I A;  3IA1 A;  2A2S A;  2LQO A;  4MF5 A;  2DMM A;  4PX1 A;  4ZXG A;  2KUC A;  1GNE A;  4F03 A;  3WGE A;  1K3O A;  4AJ6 A;  4ECJ A;  4NV2 A;  3DVW A;  5AIX A;  4XS4 A;  1XFL A;  2DIY A;  3F9U A;  4J2F A;  1GSY A;  1WRY A;  2VL3 A;  3D21 A;  1EGO A;  3GX0 A;  3LYK A;  4WXT A;  4TW5 A;  4POK A;  1U87 A;  2TIR A;  4RI6 A;  2LJR A;  1TW9 A;  4JZQ A;  5FWG A;  1ERV A;  3TCO A;  1QUW A;  2R6K A;  2OAD A;  4EL1 A;  1FB6 A;  2PUK C;  1ZGN A;  4AJ7 A;  2A2R A;  2PPT A;  1MDK A;  3HVV A;  1OYJ A;  2R5G A;  4Q5R A;  5GAN D;  4ECB A;  3GNJ A;  2B6M A;  3F3R A;  3ZRE A;  1TK0 B;  1TRU A;  3VPT A;  1ZYE A;  1XW6 A;  2H6Y A;  1BED A;  2FCH A;  1R4W A;  4X1U A;  1SKR B;  3EU4 A;  4WBJ A;  4XS6 A;  5JWQ B;  1ST9 A;  2OJL A;  4YAP A;  2LJA A;  4RQX A;  2VUP A;  5KN0 A;  4IW9 A;  1GNW A;  3LXZ A;  2KOK A;  2AB6 A;  3CRU A;  2RM6 A;  1M9A A;  5ECI B;  4YQU A;  4WET A;  2X8H A;  4ZL8 A;  4JR6 A;  17GS A;  3J7Y b;  2NDO A;  2DLX A;  3IC8 A;  2YZH A;  1X9S B;  1XZO A;  2C1Y A;  3UIW A;  2WCI A;  2K9F A;  3RHC A;  1XXU A;  1NSW A;  3H79 A;  1GUL A;  2AYT A;  2FD3 A;  1AIU A;  1XOA A;  5DCG A;  3EVI A;  2NTO A;  3F4T A;  3GYK A;  1TP9 A;  1F3A A;  4BWQ A;  1H75 A;  1JZD A;  1T4Y A;  2VAF A;  5CRE A;  3D4T A;  1XWK A;  1YDK A;  22GS A;  3UBK A;  1Z7R A;  1JZR A;  4E8E A;  1TRW A;  5ENU A;  1DE1 A;  1BG5 A;  6GST A;  3EMP A;  2RII A;  2X64 A;  3UOM A;  1SKS B;  4WF5 A;  1QXH A;  1AQX A;  2HZF A;  3Q74 A;  3DVX A;  5CNW A;  2LRN A;  3TKS C;  2CV4 A;  3FYG A;  1FVJ A;  1R26 A;  2GT6 A;  4TR0 A;  5IQY A;  1LBK A;  3EYT A;  2DSA A;  1SL1 B;  4WBR D;  3BCI A;  5AGY A;  2C4J A;  2PBJ A;  4IKH A;  4FYB A;  3FW2 A;  3IE3 A;  3E3E A;  1TXX A;  4IEL A;  3JCM L;  2YWI A;  3HJO A;  5DJM A;  2H1D A;  3EC3 A;  2H75 A;  1OC3 A;  4BL7 A;  4MZB A;  1I5G A;  5D9V A;  4HU9 A;  5JCG A;  2DJ3 A;  3KIJ A;  1B9X C;  4AF2 A;  4YQV A;  2OBI A;  4ACS A;  4XTS A;  1WE0 A;  3C8E A;  1W89 A;  1XPV A;  4IP6 A;  5G1K A;  1BJX A;  2C3Q A;  4LL4 B;  2VO4 A;  4V1A g;  1AUC A;  2IMD A;  1XWA A;  1SL0 B;  3KMN A;  1V98 A;  3GH9 A;  1BYE A;  3FRC A;  4USS A;  2IMF A;  2HI7 A;  3ERF A;  1HNB A;  3IAS 2;  2F8A A;  1MD3 A;  4OD7 A;  2WGR A;  4HS1 A;  1YF1 A;  1FVK A;  4KH7 A;  3ZTL A;  2B5X A;  3ZFL A;  5DAL A;  5EVO A;  4BVY B;  1FG4 A;  2HRN A;  1PD2 1;  4HQZ A;  2X8C A;  2HRK A;  1PKW A;  4EUY A;  1JHB A;  1G6W A;  2B1L A;  1TU7 A;  4EE0 A;  3L9S A;  4JE1 A;  1PL2 A;  2YWM A;  3WGX A;  3G7J A;  2L4Q A;  4FYC A;  2Z9S A;  1EOG A;  4MLY A;  5C04 A;  2J9H A;  2ES7 A;  3VWW A;  5IM9 A;  4NPB A;  3TKS E;  5EL8 A;  2I81 A;  2K6V A;  4H86 A;  1FAA A;  2CZ2 A;  2MBT A;  2JL4 A;  3UAR A;  3BCK A;  1QGV A;  3KTB A;  1Z7P A;  3KJY A;  2FLS A;  1WPI A;  3CTG A;  2H73 A;  5IOX A;  3ERG A;  4X43 A;  5D73 A;  2VCW A;  3IPZ A;  1X0R A;  5DQY A;  3RPN A;  2PGT A;  2B7J A;  3M8N A;  4MJA A;  3LJR A;  2JAD A;  2HSY A;  1TRV A;  1ERU A;  3ZFB A;  3IRA A;  1SYX A;  5HR0 A;  13GS A;  2F51 A;  5B8A A;  2V1M A;  1U3A A;  5BMU A;  1B4P A;  2L5O A;  1ON4 A;  3CTF A;  3HHV A;  3GX8 A;  1UA5 A;  4TR1 B;  1GUH A;  9GSS A;  2H70 A;  2IMI A;  2IIY A;  2YAN A;  3BBY A;  1OC9 B;  1KBN A;  2VD0 A;  2H8L A;  5H5Q A;  2MBS A;  5A4U A;  3P8W A;  3A5W A;  1FW1 A;  4YH2 A;  5GAP D;  1OAZ A;  3VLN A;  5CAX A;  4PTS A;  1DUG A;  2QGV A;  1EWX A;  5ID2 A;  3ZZX A;  1AXD A;  2BJX A;  1K0D A;  3M9K A;  3KH9 A;  2GSR A;  5DAK A;  4TXO B;  2VCV A;  1HYU A;  3GRX A;  2K18 A;  1U6T A;  1O81 A;  4GQC A;  4L8E A;  3BD2 A;  2YCD A;  5IMZ A;  1ZMA A;  2ZUP A;  1KEB A;  3KEB A;  1XVW A;  1URM A;  3UEM A;  3NZN A;  1TK5 B;  3CSJ A;  1Z6N A;  2AHE A;  1TRS A;  3IHQ A;  2P0G A;  4QL7 A;  2AV4 A;  2LRC A;  2ALB A;  3LOR A;  1Z9H A;  2H6X A;  2IPA A;  2GS3 A;  6GSS A;  4NXI A;  5IMA A;  2D2Z A;  1SL2 B;  2TRC P;  1XBS A;  2R3X A;  2HXK A;  1K0O A;  3C71 A;  3TOT A;  4F0C A;  1XWC A;  3CRT A;  3OR5 A;  1F37 A;  4XCS A;  5KEJ A;  2JSY A;  4F9Z A;  2OAC A;  2DJ0 A;  5D93 A;  2LJK A;  2RM5 A;  5H5S A;  3TKQ A;  2AAW A;  1M2B A;  3CYN A;  3CMI A;  2CAI A;  1PRX A;  3ISO A;  4Q5Q A;  5ABR A;  2GQM A;  2L5L A;  4XIH A;  3KP8 A;  2JAC A;  2LEG A;  1A24 A;  4KSO A;  2FWF A;  1VF3 A;  3HD5 A;  2FNO A;  4P3Y B;  2YJH A;  1ML6 A;  3RDW A;  3UL3 A;  1IYI A;  2RLI A;  2FY6 A;  4KSM A;  4ZBD A;  4ZB8 A;  2YWN A;  2HFD A;  3DRN A;  4K7I A;  4IJI A;  4O92 A;  3DXB A;  1R5P A;  2DML A;  4MDC A;  3HKR A;  2MYG A;  4MA9 A;  4MJB A;  1T4Z A;  1G7O A;  5ELA A;  3GFK A;  4DSS A;  5LNK e;  2G0F A;  2HZE A;  3TOU A;  4PNF A;  2WB9 A;  4AGS A;  1EP8 A;  2I3Y A;  3FR3 A;  5CYY A;  4EDY A;  4EKZ A;  1DE2 A;  1JLW A;  2VCT A;  3F4R A;  2KLX A;  2GGT A;  2VL2 C;  18GS A;  2L57 A;  3PPU A;  3GKN A;  1K3L A;  2YPM A;  4MAB A;  1EOH A;  3GMF A;  2JZS A;  1XW9 A;  4EXJ A;  4NWY A;  1GSF A;  2JZT A;  2CQ9 A;  2HLS A;  1ZYQ B;  2F8F A;  3A3T A;  4LA1 A;  3H93 A;  4ZL7 A;  2HSN B;  2FHE A;  3VPQ A;  4GF0 A;  4LLR A;  4WKW A;  3Q19 A;  1BX9 A;  4BVY A;  1LU4 A;  2G2Q A;  4K0N A;  1S3D A;  3K8N A;  3DML A;  5CO3 A;  5DVB A;  5JCW A;  4KDU A;  2BTO T;  2E7P A;  3QCP A;  3WT2 A;  1VRS D;  5FHI A;  5F05 A;  4EC0 A;  1PSQ A;  2VCZ A;  3MDK A;  2N5A A;  2YV9 A;  2MZC A;  3PGT A;  3TRX A;  3H8Q A;  4GST A;  4BPY A;  5ECM B;  4K2D A;  3QAW A;  4MF7 A;  3QAV A;  2C0E A;  2EC4 A;  2ON7 A;  3H4K A;  2HSH A;  3CSH A;  2HSM B;  2WS2 A;  12GS A;  2K8V A;  4ML6 A;  3ZYW A;  2GSS A;  2PU9 C;  3BOA A;  3MAK A;  4N0Z A;  5IO2 A;  1GL8 A;  2OE0 A;  3ZLP A;  5D9X A;  2GZY A;  1K0C A;  4WEY A;  4JED A;  3D22 A;  2IME A;  3KH7 A;  3SBC A;  3PIN A;  4KDX A;  2VL9 A;  1BAY A;  1PKZ A;  2GQL A;  19GS A;  2P5Q A;  3M1G A;  3TKR A;  3I6A A;  2LQQ A;  5ECQ B;  1PL1 A;  3GUS A;  3TRP A;  2H19 A;  3VFI A;  5ECO B;  1GSE A;  2CVK A;  2O8V B;  4YAV A;  2FWH A;  3VK9 A;  1OC9 A;  2AUV A;  3IC4 A;  4ZB9 A;  4ULX A;  5ECK B;  1X9W B;  4XHM A;  1N8J A;  3CXG A;  2FGX A;  1ILO A;  5EPF A;  5LCZ A;  2YZU A;  2LST A;  3RHB A;  1DBY A;  2MMN A;  4OO4 A;  1OE8 A;  4G10 A;  1MDI A;  4KA0 A;  3P7X A;  5F0G A;  1EV4 A;  4GTU A;  3HZ4 A;  3M0F A;  4O7H A;  3LXT A;  4QQ7 A;  1YY7 A;  5B6N A;  3L9U A;  1M9B A;  3HJM A;  2CT6 A;  2XHF A;  4G0L A;  2YNX A;  1B9Y C;  5GST A;  2LUS A;  4KX4 A;  1F9M A;  2JU5 A;  2N5B A;  2PVQ A;  2LTK A;  1BQ7 A;  2IFQ B;  1A2L A;  3FHK A;  1YKA A;  1SYR A;  3EIN A;  4KDY A;  3US3 A;  2V41 A;  3WYW A;  1MEK A; 
#chains in the Genus database with same CATH topology
 3GKK A;  1WMJ A;  4GRF A;  3RAZ A;  1MTC A;  3TUE A;  1V58 A;  2PVO C;  4K5S A;  2H30 A;  2H1L A;  1G0T A;  4V2L A;  2NVL A;  1SD8 A;  1YEX A;  2F3M A;  5G1L A;  4CHS A;  1K0A A;  1ABA A;  5C00 A;  1XOB A;  4V2N A;  5D8I A;  4K8M A;  3FK8 A;  5GSS A;  1O8W A;  1R7H A;  2PWJ A;  2KP1 A;  5KN2 A;  3TJK A;  1V2A A;  2YJ7 A;  3ZIT A;  4PQH A;  3WT1 A;  5JWR B;  3O3T A;  2R4V A;  5H5R A;  1HNA A;  5AIV A;  2IN3 A;  4G0K A;  2M46 A;  5B8B A;  3MNG A;  4OWY A;  2OE1 A;  5FT3 A;  1PX7 A;  5D96 A;  4G0I A;  3FZ5 A;  1TKD B;  4K2X A;  3L4N A;  4NHW A;  2H0I A;  1U3I A;  1RW1 A;  2H1A A;  5CRG A;  5IPH A;  2LS5 A;  3QR6 A;  4KB3 A;  5A4V A;  1PN9 A;  5G2Z A;  1ZL9 A;  1H4O A;  3E9J B;  1JZW A;  2XBI A;  3F63 A;  1AQV A;  3VUR A;  2C80 A;  1SK0 A;  2XC2 A;  1YQ1 A;  4XS4 B;  1AQW A;  1EV9 A;  4EIQ A;  3UJ1 A;  1Z6M A;  3KXO A;  3U6V A;  1VGL A;  3M9J A;  3G7Y A;  2IWT A;  3DWV A;  3UVH A;  3QD9 A;  1TOF A;  5IMD A;  4MJE A;  2FA8 A;  3AY8 A;  4K9Z A;  2YWO A;  4MP4 A;  4HUA A;  1G7E A;  3ZIV A;  2OBK A;  1YJ6 A;  4WR5 A;  4O5R A;  1HD2 A;  2L59 A;  3HXS A;  1THO A;  2IJY A;  4IQA A;  3HJP A;  3FZ4 A;  2ON5 A;  3PR8 A;  1NM3 A;  2V6K A;  5J9B A;  4FXY P;  1GLP A;  3G9B A;  4I2U A;  2QSI A;  2C3T A;  2GVP A;  4TXV A;  2BMX A;  4KCE A;  4RUV A;  3GN3 A;  2O3E A;  3HZ8 A;  2GST A;  4CW9 A;  2WW1 A;  2C0F A;  3GV1 A;  4I6X A;  3TB2 A;  1FB0 A;  2HYX A;  4CDO A;  1TJD A;  3V1W A;  5A5H A;  1A0F A;  4NMU A;  4AKI A;  1XVQ A;  3HYP A;  2HE3 A;  3IDV A;  3VWX A;  3IV4 A;  2OA7 A;  4TR4 A;  3FR6 A;  4MJC A;  1J0F A;  1GTA A;  3QAG A;  1TI3 A;  3HVS A;  4DSQ A;  3NIV A;  5J40 A;  3GIX A;  3IR4 A;  2HT9 A;  5ECR B;  4DSR A;  3EE2 A;  4HZ4 A;  4ZB6 A;  4ZBA A;  2WVX B;  3D0Z A;  3KMO A;  2JSZ A;  4NAX A;  4HI7 A;  3D5J A;  1EEM A;  5EY6 A;  2WFC A;  1GP1 A;  2H66 A;  3APQ A;  5A34 B;  5F07 A;  3UBL A;  3O76 A;  3I43 A;  1Y25 A;  1THX A;  4PUA A;  1SEN A;  1TI1 A;  5J4U A;  5A1N A;  3CSI A;  3TRQ A;  3VI7 A;  11GS A;  1CQH A;  2GDR A;  2ZNM A;  1OC8 A;  1A8L A;  4PXO A;  3KD0 A;  1NHY A;  2C0G A;  5DBQ A;  5DJL A;  4OMV A;  1ACV A;  3GL3 A;  4LL1 B;  1PN0 A;  1T8E B;  1GTU A;  3L0H A;  4ISD A;  3ED3 A;  1VF2 A;  4ECI A;  4BVX B;  1V40 A;  2H74 A;  1KTE A;  3DD3 A;  3HDC A;  3QMX A;  4A5P A;  2UZ8 A;  4D73 B;  2VM1 A;  4KGI A;  1EEJ A;  3U5R E;  1XG8 A;  1YKC A;  2O87 A;  2R37 A;  3EWL A;  4MF6 A;  1AW9 A;  1ERW A;  2L6D A;  5E4W A;  3N5O A;  2VLU A;  1UVZ A;  1J08 A;  4K0G A;  2M72 A;  2XPD A;  3ZVJ D;  4IBP A;  1B4Q A;  3M3M A;  2P31 A;  1OE7 A;  4BL7 B;  4RI7 A;  1YEP A;  4PUF C;  3QFB C;  1AAZ A;  5E59 A;  3I9V 2;  5D9T A;  2P5R A;  5GZZ B;  3FEU A;  3FY7 A;  3WD6 A;  1U88 A;  4TVE A;  3RPP A;  5F8B A;  2E2G A;  2QA2 A;  5ECL B;  3MSZ A;  4MPF A;  2H0H A;  4L5L A;  1YF0 A;  3F0I A;  4MMM A;  2IFQ A;  3C1S A;  2R0P A;  4EVM A;  2N5F A;  4Z2R A;  3DIE A;  1RK4 A;  1M2A A;  4KE3 A;  2H1G A;  2H76 A;  3C73 A;  5DCH A;  3TJF A;  1Y6E A;  1TTZ A;  2DKI A;  16GS A;  2M80 A;  2I4A A;  4AJ8 A;  2EIR A;  4BWS A;  1K0M A;  3VWV A;  2O7K A;  4ICY A;  5KN3 A;  1O6J A;  2DKH A;  1Q98 A;  4N10 A;  5DAL B;  2WRT A;  4L5O A;  5HQP A;  3KCM A;  3KM6 A;  3C1R A;  4TR3 A;  1E6B A;  5CRW A;  2HRK B;  4CY6 A;  4PQ1 A;  4EF0 A;  2WDU A;  3O6T A;  7GSS A;  4ILF A;  2VIM A;  3LEF A;  5IPG A;  1EZK A;  1K0B A;  1C72 A;  1GSS A;  1RQM A;  5J3R A;  4NV5 A;  10GS A;  5IIZ A;  4XRD A;  3ZL5 A;  2QC7 A;  5DQS A;  1YZX A;  3WGD A;  1JZO A;  1YEW C;  1M0U A;  5ECS A;  2PN8 A;  2VLT A;  1KNG A;  5D9W A;  3LWA A;  2HRA A;  4DVC A;  3Q6O A;  5IOW A;  2OE3 A;  4L0U A;  4OFM A;  2H72 A;  5A5K A;  1A2M A;  3FR9 A;  4NHZ A;  1Z5Y E;  2VCX A;  4F0B A;  3HVN A;  2FUG 2;  4E68 A;  2C0D A;  4FYU A;  4Q5N A;  4ZL9 A;  1USB A;  3TJJ A;  4IVF A;  1M7T A;  3D4M A;  3IOS A;  2LRT A;  4FQU A;  1QQ2 A;  4Z7X A;  5ECN B;  1M2D A;  2CZ3 A;  3KP9 A;  4J57 E;  4ID0 A;  1OVN A;  3EMX A;  5HR3 A;  2E2M A;  5HFK A;  3ME7 A;  3LYP A;  2VD1 A;  5B6M A;  1OKT A;  1XW5 A;  4I2T A;  2E0Q A;  4IN0 A;  3P90 A;  4KCA A;  5AN1 A;  1T00 A;  4MCU A;  2A2P A;  1K3Y A;  5ID2 B;  5DDL A;  2PMT A;  5LD0 A;  2B5E A;  1S3R A;  4IJ3 A;  1T7P B;  5CP1 A;  3GHA A;  4HDE A;  1N2A A;  2V32 A;  1SU9 A;  5DAK B;  2B1K A;  2IMK A;  2DC5 A;  1PGT A;  2YN1 A;  2FA4 A;  4TR1 A;  6GSV A;  3IBH A;  5G5F A;  5G5E A;  3E0U A;  3TKS A;  1WOU A;  2H0G A;  2HQT A;  2UV8 G;  1DSB A;  1E2Y A;  3A2W A;  2LNT A;  2LV3 A;  2K8S A;  5HFG A;  4IHU A;  2XBQ A;  3UMA A;  2WVZ A;  2YOI A;  1JFU A;  2FWE A;  2TRX A;  3GKM A;  5L71 A;  2O89 A;  2R0G A;  2HNL A;  3MYD A;  1SJZ A;  4G19 A;  1GSU A;  2OKA A;  3Q18 A;  2F9S A;  4I5Q A;  4TXO A;  2WZ9 A;  1FO5 A;  1GWC A;  6GSW A;  1PQN A;  1QK8 A;  5J4Y A;  1SVM A;  3GA4 A;  4O32 A;  4GCI A;  2CVD A;  2GSQ A;  2FWG A;  3IK9 A;  3R3E A;  4LMW A;  1QMV A;  2REM A;  5A4W A;  2H01 A;  3N9J A;  3KGK A;  4K1F A;  1X9M B;  5A34 A;  2H71 A;  4PUR A;  3TDG A;  2AJQ B;  1J9B A;  5J41 A;  3MWH A;  3TJB A;  4OCF A;  4OCE A;  3ME8 A;  1HNC A;  1SJI A;  5G30 A;  4POB A;  6GSX A;  2J23 A;  5HR1 A;  5IMV A;  4G2E A;  2O36 A;  4BVX A;  3FZ9 A;  4E8H A;  1GH2 A;  3S9F A;  5CRD A;  2QA1 A;  4OFN A;  4D73 A;  1HQO A;  1ZZY A;  3ZRD A;  3GUR A;  1WP0 A;  4QL9 A;  1O73 A;  4ZB7 A;  3DGQ A;  1LJR A;  1F2E A;  2H6Z A;  3W6G A;  3GTU B;  4AKH A;  2C8U A;  4FH8 A;  4PNG A;  4FIW A;  2DJK A;  2QKE A;  5IMC A;  1JLV A;  4MH3 A;  20GS A;  2DBC A;  3GL5 A;  3C7M A;  4K7O A;  2CX4 A;  2X8G A;  1PA3 A;  2I9H A;  4DSS B;  8GSS A;  3L78 A;  4J56 E;  3IAM 2;  2YV7 A;  2HZE B;  2WJU A;  3QOU A;  5J9C A;  3W8S A;  4AKG A;  1XWB A;  3EUR A;  1NW2 A;  4MZC A;  3P2A A;  4G9H A;  1Q4J A;  2O85 A;  4RQR A;  4TKY A;  4KAE A;  6GSY A;  3QDN A;  3G7I A;  2CVB A;  1ZOF A;  4MH2 A;  5COH A;  3R2Q A;  3RBT A;  3I69 A;  4Q5F A;  5J47 A;  2VCQ A;  1SKW B;  5AIS A;  3ZIJ A;  2DJ2 A;  3F3Q A;  2GQK A;  2V2G A;  4ECC A;  1B48 A;  2L4C A;  4K6X A;  1V9W A;  6GSU A;  1SK2 A;  4JU5 A;  2DJJ A;  2YP6 A;  4V2M A;  2DJ1 A;  1GSQ A;  2B3S A;  2C3N A;  3ERW A;  3HY2 A;  2GLR A;  2RUE A;  4GXZ A;  2HSN A;  1A8Y A;  4DEJ A;  4ZIJ A;  1XCC A;  4I8B A;  3FZA A;  1IYH A;  3LG6 A;  5ECH B;  1WJK A;  4FO5 A;  3H1N A;  4W66 A;  1PMT A;  4F82 A;  1MDJ A;  1WIK A;  4PQI A;  5IMF A;  1T1V A;  3QPM A;  3ZVJ A;  5F06 A;  2EFE A;  5B7C A;  2GT5 A;  4POM A;  4GWR A;  4N11 A;  5KN1 A;  3TKP A;  3TGZ A;  3F6F A;  3VI5 A;  4HQS A;  1OKD A;  2CA8 A;  1GUK A;  1I1I P;  2VLV A;  3DYR A;  3TJG A;  1PX6 A;  1NHO A;  3CBU A;  4EO3 A;  2NPB A;  2HSM A;  3APO A;  3HA9 A;  4N30 A;  2ZCT A;  3PH9 A;  1K0N A;  4HU7 A;  2GTU A;  5JWO B;  2MMA A;  4HJ2 A;  3LSZ A;  2LNS A;  4KND A;  4TRX A;  1A2J A;  1XWG A;  4TOP A;  1B8X A;  2XPE A;  3LGC A;  1F3B A;  3QFA C;  1Z3E A;  3L9V A;  4HJM A;  3UVT A;  5HR2 A;  1SVL A;  1X5E A;  2CAQ A;  1TU8 A;  2R2J A;  3RGB C;  3KTL A;  1O85 A;  2DIZ A;  2IL3 A;  3APS A;  2X99 A;  5J5N A;  2B5Y A;  4POL A;  1SJ6 A;  1M3J A;  5HFI A;  1SD9 A;  1EP7 A;  1W4V A;  1X5C A;  1SK1 A;  1EGR A;  3GSS A;  4L0W A;  2PER A;  3HCZ A;  4OO5 A;  4TN8 A;  4AKX B;  1QFN A;  4HEA 2;  1GTB A;  1XIY A;  1R5A A;  5IO0 A;  2B7K A;  1GRX A;  4MZW A;  3A2V A;  2GZP A;  3GST A;  5ECP B;  4XRA A;  1UN2 A;  4IS0 A;  1S3A A;  3A2X A;  3FMW A;  1GTI A;  1F6M C;  3F4S A;  5JCU A;  1VF4 A;  1O7U A;  1FHE A;  3CHX C;  3LFL A;  4MPG A;  4GLT A;  1VF1 A;  4ZIL A;  4F2I A;  3KZQ A;  2VOC A;  4X0X A;  3IK7 A;  4LMV A;  3ZMK A;  4Z2T A;  4GQF A;  2V6O A;  4JRR A;  1WWJ A;  1A0R P;  4KUN A;  3VWU A;  1GLQ A;  2KP2 A;  3FKF A;  4HZ2 A;  3F6D A;  3NOF A;  3SWL A;  2VL2 A;  4GSS A;  2H1B A;  4BA7 A;  4ZBB A;  1GUM A;  4HSC X;  2NBS A;  2L6C A;  5CRH A;  4OFT A;  3LQ7 A;  4GSN A;  5KOX A;  1UC7 A;  4HOJ A;  3UAP A;  14GS A;  2HRF A;  1G6Y A;  5ELG A;  4AI6 A;  2JZR A;  3HVX A;  1TK8 B;  1M99 A;  4ML1 A;  4K7N A;  2LKU A;  1X5D A;  2CX3 A;  4IGJ A;  2A4V A;  1T3B A;  2WUL A;  2GZZ A;  4WF4 A;  3EU3 A;  1TDI A;  1I9D A;  4JR4 A;  3J7Y k;  4PGT A;  3GKX A;  3GTU A;  1S3C A;  1V57 A;  2VM2 A;  1GSD A;  1ZCP A;  3GH6 A;  4PI0 C;  4IP1 A;  1ERT A;  2I1U A;  1MD4 A;  4WR4 A;  3F8U A;  1CQG A;  4V1A p;  3BJ5 A;  4EDZ A;  2EIQ A;  3DEX A;  2MMZ A;  3W8J A;  4KF9 A;  2EFC A;  2MMO A;  3ZML A;  2KHP A;  4JBB A;  1FOV A;  3DKS A;  3IXR A;  5G31 A;  4XS1 A;  4N0V A;  1O8X A;  2RUF A;  4YQM A;  4KW6 A;  4MK3 A;  4I97 A;  5INY A;  3CQF A;  4IQ1 A;  1AC1 A;  1A23 A;  2EIO A;  3D6I A;  4GDF A;  3IA1 A;  2A2S A;  2LQO A;  4MF5 A;  2DMM A;  1ZYN A;  3TU3 B;  4PX1 A;  4ZXG A;  2KUC A;  1GNE A;  4F03 A;  3WGE A;  1K3O A;  4AJ6 A;  4ECJ A;  4NV2 A;  3DVW A;  5AIX A;  4XS4 A;  1XFL A;  2DIY A;  3F9U A;  4J2F A;  1GSY A;  1WRY A;  2VL3 A;  3D21 A;  1EGO A;  3GX0 A;  3LYK A;  4WXT A;  4TW5 A;  4POK A;  1U87 A;  2TIR A;  5BMU B;  4RI6 A;  2LJR A;  1TW9 A;  4JZQ A;  4PHZ C;  5FWG A;  1ERV A;  3TCO A;  1QUW A;  2R6K A;  2OAD A;  4EL1 A;  1FB6 A;  2PUK C;  1ZGN A;  4AJ7 A;  2A2R A;  2PPT A;  1MDK A;  3HVV A;  1OYJ A;  2R5G A;  5A5H B;  4Q5R A;  5GAN D;  4ECB A;  3GNJ A;  2B6M A;  1S4B P;  3F3R A;  3ZRE A;  1TK0 B;  1TRU A;  3VPT A;  1ZYE A;  1XW6 A;  2H6Y A;  1BED A;  2FCH A;  1R4W A;  4K5R A;  4X1U A;  1SKR B;  3EU4 A;  4WBJ A;  4XS6 A;  5JWQ B;  1ST9 A;  2OJL A;  4YAP A;  2LJA A;  4RQX A;  2VUP A;  5KN0 A;  4IW9 A;  1GNW A;  3LXZ A;  2KOK A;  4YKG A;  2AB6 A;  3CRU A;  2RM6 A;  1M9A A;  2EFD A;  4QMK A;  5ECI B;  4YQU A;  4WET A;  2X8H A;  4ZL8 A;  1YVL A;  4JR6 A;  17GS A;  5A1N B;  2NDO A;  3J7Y b;  2DLX A;  3IC8 A;  2YZH A;  1X9S B;  1XZO A;  2C1Y A;  3UIW A;  2WCI A;  1FOH A;  2K9F A;  3RHC A;  1XXU A;  1NSW A;  3H79 A;  1GUL A;  2AYT A;  4EIP A;  2FD3 A;  1AIU A;  1XOA A;  5DCG A;  3EVI A;  2NTO A;  3F4T A;  3GYK A;  3RFR C;  1TP9 A;  2WVX A;  1F3A A;  4BWQ A;  4G01 A;  1H75 A;  1JZD A;  1T4Y A;  2VAF A;  5CRE A;  3D4T A;  1XWK A;  1YDK A;  22GS A;  3UBK A;  1Z7R A;  1JZR A;  4E8E A;  1TRW A;  5ENU A;  1DE1 A;  1BG5 A;  6GST A;  3EMP A;  1Y1U A;  2RII A;  2X64 A;  2VKZ G;  3UOM A;  1SKS B;  4WF5 A;  4N3Z A;  1QXH A;  1AQX A;  2HZF A;  3Q74 A;  3DVX A;  5CNW A;  2LRN A;  3TKS C;  2CV4 A;  3FYG A;  1FVJ A;  1R26 A;  2GT6 A;  4TR0 A;  5IQY A;  1LBK A;  3EYT A;  2DSA A;  1SL1 B;  4WBR D;  3BCI A;  5AGY A;  2C4J A;  2PBJ A;  4IKH A;  4FYB A;  4CY8 A;  3FW2 A;  3MIX A;  3IE3 A;  3E3E A;  1TXX A;  2O5V A;  4IEL A;  3JCM L;  3HMJ G;  2YWI A;  3HJO A;  5DJM A;  2H1D A;  3EC3 A;  2H75 A;  1OC3 A;  4BL7 A;  4MZB A;  1I5G A;  5D9V A;  4HU9 A;  5JCG A;  2DJ3 A;  3KIJ A;  1B9X C;  4AF2 A;  4YQV A;  2OBI A;  4ACS A;  4XTS A;  1WE0 A;  3C8E A;  1W89 A;  1XPV A;  4IP6 A;  5G1K A;  1BJX A;  2C3Q A;  3CWG A;  2VO4 A;  4LL4 B;  4V1A g;  1AUC A;  2IMD A;  1XWA A;  1SL0 B;  3KMN A;  1V98 A;  3GH9 A;  1BYE A;  3FRC A;  4USS A;  2IMF A;  2HI7 A;  2WW0 A;  3ERF A;  1HNB A;  3IAS 2;  2F8A A;  1MD3 A;  4OD7 A;  2WGR A;  4HS1 A;  1YF1 A;  1FVK A;  4KH7 A;  3ZTL A;  2B5X A;  3ZFL A;  5DAL A;  5EVO A;  4BVY B;  1FG4 A;  2HRN A;  1PD2 1;  4HQZ A;  2X8C A;  2HRK A;  1PKW A;  4EUY A;  1JHB A;  1G6W A;  2B1L A;  1TU7 A;  4EE0 A;  3L9S A;  4JE1 A;  1PL2 A;  2YWM A;  3WGX A;  3G7J A;  2L4Q A;  4FYC A;  2Z9S A;  1EOG A;  4MLY A;  5C04 A;  2J9H A;  2ES7 A;  3VWW A;  5IM9 A;  5J4V A;  4NPB A;  3TKS E;  5EL8 A;  2I81 A;  1ZYP A;  2K6V A;  4H86 A;  1FAA A;  2CZ2 A;  2MBT A;  2JL4 A;  3UAR A;  3BCK A;  1QGV A;  3KTB A;  1Z7P A;  3KJY A;  2FLS A;  1WPI A;  3CTG A;  2H73 A;  5IOX A;  3ERG A;  4X43 A;  5D73 A;  2VCW A;  3IPZ A;  1X0R A;  5DQY A;  3RPN A;  2PGT A;  2B7J A;  3M8N A;  4MJA A;  2EFH A;  3LJR A;  2JAD A;  2HSY A;  2X49 A;  1TRV A;  1ERU A;  3ZFB A;  3IRA A;  4O5U A;  1SYX A;  5HR0 A;  13GS A;  2F51 A;  5B8A A;  2V1M A;  1U3A A;  5BMU A;  1B4P A;  2L5O A;  1ON4 A;  3CTF A;  3HHV A;  3GX8 A;  1UA5 A;  4TR1 B;  1GUH A;  9GSS A;  2H70 A;  4O5Q A;  2IMI A;  2IIY A;  2YAN A;  3BBY A;  1OC9 B;  1KBN A;  2VD0 A;  2H8L A;  5H5Q A;  2MBS A;  5A4U A;  3P8W A;  3A5W A;  1FW1 A;  4YH2 A;  5GAP D;  1OAZ A;  3VLN A;  5CAX A;  4PTS A;  1DUG A;  2QGV A;  1EWX A;  5ID2 A;  5BRT A;  3ZZX A;  1AXD A;  2BJX A;  1K0D A;  3M9K A;  3KH9 A;  2GSR A;  5DAK A;  4TXO B;  2VCV A;  1HYU A;  3GRX A;  3IHG A;  2K18 A;  1U6T A;  1O81 A;  4GQC A;  4L8E A;  3BD2 A;  2YCD A;  5IMZ A;  1ZMA A;  2ZUP A;  1KEB A;  4BIK A;  3KEB A;  1XVW A;  1SVO A;  1URM A;  3UEM A;  3NZN A;  1TK5 B;  3CSJ A;  1Z6N A;  2AHE A;  1TRS A;  3IHQ A;  1BG1 A;  2P0G A;  4QL7 A;  2AV4 A;  2LRC A;  2ALB A;  3LOR A;  1Z9H A;  2H6X A;  2IPA A;  2GS3 A;  6GSS A;  4NXI A;  5IMA A;  2D2Z A;  1SL2 B;  2TRC P;  1XBS A;  2R3X A;  2HXK A;  1K0O A;  3C71 A;  3TOT A;  4F0C A;  1XWC A;  3CRT A;  3OR5 A;  1F37 A;  4XCS A;  1N25 A;  5KEJ A;  2JSY A;  4F9Z A;  2OAC A;  2DJ0 A;  5D93 A;  2LJK A;  2RM5 A;  5H5S A;  4Z2U A;  3TKQ A;  2AAW A;  1M2B A;  3CYN A;  3CMI A;  2CAI A;  1PRX A;  3EPT A;  3ISO A;  4Q5Q A;  5ABR A;  2GQM A;  2L5L A;  4XIH A;  3KP8 A;  2JAC A;  2LEG A;  1A24 A;  4X4J A;  4KSO A;  2FWF A;  1VF3 A;  3HD5 A;  2FNO A;  4P3Y B;  2YJH A;  1ML6 A;  3RDW A;  3UL3 A;  1IYI A;  2RLI A;  2FY6 A;  4KSM A;  4ZBD A;  4ZB8 A;  2YWN A;  2HFD A;  3DRN A;  4K7I A;  4IJI A;  4O92 A;  3DXB A;  1R5P A;  2DML A;  4MDC A;  3HKR A;  2MYG A;  4MA9 A;  4MJB A;  1T4Z A;  1G7O A;  5ELA A;  3GFK A;  4DSS A;  5LNK e;  2G0F A;  2HZE A;  3TOU A;  4PNF A;  2WB9 A;  4AGS A;  1EP8 A;  2I3Y A;  3FR3 A;  5CYY A;  4EDY A;  4EKZ A;  1DE2 A;  1JLW A;  2VCT A;  3LW9 A;  3F4R A;  2KLX A;  2GGT A;  2VL2 C;  18GS A;  2L57 A;  4YKF A;  3PPU A;  3GKN A;  1K3L A;  2YPM A;  4MAB A;  1EOH A;  3GMF A;  2JZS A;  1XW9 A;  4EXJ A;  4NWY A;  1GSF A;  2JZT A;  2CQ9 A;  2HLS A;  1ZYQ B;  2F8F A;  3A3T A;  4LA1 A;  3H93 A;  4ZL7 A;  2HSN B;  2FHE A;  2R0C A;  3VPQ A;  4GF0 A;  4LLR A;  4WKW A;  3Q19 A;  1BX9 A;  4BVY A;  1LU4 A;  2G2Q A;  4K0N A;  1S3D A;  3K8N A;  3DML A;  5CO3 A;  5DVB A;  5JCW A;  4KDU A;  2BTO T;  2E7P A;  3QCP A;  3WT2 A;  1M3I A;  1VRS D;  5FHI A;  5F05 A;  4EC0 A;  1PSQ A;  2VCZ A;  3MDK A;  2N5A A;  2YV9 A;  2WW3 A;  2MZC A;  3PGT A;  3TRX A;  3H8Q A;  4GST A;  4BPY A;  5ECM B;  4K2D A;  3QAW A;  4MF7 A;  3QAV A;  2C0E A;  2EC4 A;  2ON7 A;  1PFO A;  2A4H A;  3H4K A;  2HSH A;  3CSH A;  2HSM B;  2WS2 A;  12GS A;  2K8V A;  4ML6 A;  3ZYW A;  2GSS A;  2PU9 C;  3BOA A;  3MAK A;  4N0Z A;  2WW2 A;  5IO2 A;  1GL8 A;  2OE0 A;  3ZLP A;  5D9X A;  2GZY A;  3A5I A;  1K0C A;  4WEY A;  4JED A;  3D22 A;  2IME A;  3KH7 A;  3SBC A;  5KOW A;  3PIN A;  4KDX A;  2VL9 A;  1BAY A;  1PKZ A;  2GQL A;  19GS A;  2P5Q A;  3M1G A;  3TKR A;  3I6A A;  2LQQ A;  5ECQ B;  1PL1 A;  3GUS A;  3TRP A;  2H19 A;  3VFI A;  2WZS A;  5ECO B;  1GSE A;  2CVK A;  2O8V B;  4YAV A;  2FWH A;  3VK9 A;  1OC9 A;  2AUV A;  3IC4 A;  4ZB9 A;  4MNN A;  4ULX A;  5ECK B;  1X9W B;  4XHM A;  1N8J A;  3CXG A;  1BF5 A;  2FGX A;  1ILO A;  5EPF A;  5LCZ A;  2WVY A;  2YZU A;  2LST A;  3RHB A;  1DBY A;  2MMN A;  4OO4 A;  1OE8 A;  4G10 A;  1MDI A;  1TXU A;  4KA0 A;  3P7X A;  5F0G A;  1EV4 A;  4GTU A;  3HZ4 A;  3M0F A;  4O7H A;  3LXT A;  4QQ7 A;  1YY7 A;  5B6N A;  3HJM A;  1M9B A;  2CT6 A;  3L9U A;  2XHF A;  4G0L A;  2YNX A;  1B9Y C;  5GST A;  2LUS A;  4KX4 A;  1F9M A;  2JU5 A;  2N5B A;  2PVQ A;  2LTK A;  1BQ7 A;  2IFQ B;  1A2L A;  3FHK A;  1YKA A;  1SYR A;  3EIN A;  4KDY A;  3US3 A;  2X4A A;  2V41 A;  4PI2 C;  3WYW A;  1MEK A;  2OT3 A; 
#chains in the Genus database with same CATH homology
 3GKK A;  1WMJ A;  4GRF A;  3RAZ A;  1MTC A;  3TUE A;  1V58 A;  2PVO C;  4K5S A;  2H30 A;  2H1L A;  1G0T A;  4V2L A;  2NVL A;  1SD8 A;  1YEX A;  2F3M A;  5G1L A;  4CHS A;  1K0A A;  1ABA A;  5C00 A;  1XOB A;  4V2N A;  5D8I A;  4K8M A;  3FK8 A;  5GSS A;  1O8W A;  1R7H A;  2PWJ A;  2KP1 A;  5KN2 A;  3TJK A;  1V2A A;  2YJ7 A;  3ZIT A;  4PQH A;  3WT1 A;  5JWR B;  3O3T A;  2R4V A;  5H5R A;  1HNA A;  5AIV A;  2IN3 A;  4G0K A;  2M46 A;  5B8B A;  3MNG A;  4OWY A;  2OE1 A;  5FT3 A;  1PX7 A;  5D96 A;  4G0I A;  3FZ5 A;  1TKD B;  4K2X A;  3L4N A;  4NHW A;  2H0I A;  1U3I A;  1RW1 A;  2H1A A;  5CRG A;  5IPH A;  2LS5 A;  3QR6 A;  4KB3 A;  5A4V A;  1PN9 A;  5G2Z A;  1ZL9 A;  1H4O A;  3E9J B;  1JZW A;  2XBI A;  3F63 A;  1AQV A;  3VUR A;  2C80 A;  1SK0 A;  2XC2 A;  1YQ1 A;  4XS4 B;  1AQW A;  1EV9 A;  4EIQ A;  3UJ1 A;  1Z6M A;  3KXO A;  3U6V A;  1VGL A;  3M9J A;  3G7Y A;  2IWT A;  3DWV A;  3UVH A;  3QD9 A;  1TOF A;  5IMD A;  4MJE A;  2FA8 A;  3AY8 A;  4K9Z A;  2YWO A;  4MP4 A;  4HUA A;  1G7E A;  3ZIV A;  2OBK A;  1YJ6 A;  4WR5 A;  4O5R A;  1HD2 A;  2L59 A;  3HXS A;  1THO A;  2IJY A;  4IQA A;  3HJP A;  3FZ4 A;  2ON5 A;  3PR8 A;  1NM3 A;  2V6K A;  5J9B A;  1GLP A;  3G9B A;  4I2U A;  2QSI A;  2C3T A;  2GVP A;  4TXV A;  2BMX A;  4KCE A;  4RUV A;  3GN3 A;  3HZ8 A;  2GST A;  4CW9 A;  2C0F A;  3GV1 A;  4I6X A;  3TB2 A;  1FB0 A;  2HYX A;  4CDO A;  1TJD A;  3V1W A;  5A5H A;  1A0F A;  4NMU A;  4AKI A;  1XVQ A;  3HYP A;  2HE3 A;  3IDV A;  3VWX A;  3IV4 A;  2OA7 A;  4TR4 A;  3FR6 A;  4MJC A;  1J0F A;  1GTA A;  3QAG A;  1TI3 A;  3HVS A;  4DSQ A;  3NIV A;  5J40 A;  3GIX A;  3IR4 A;  2HT9 A;  5ECR B;  4DSR A;  3EE2 A;  4HZ4 A;  4ZB6 A;  4ZBA A;  3D0Z A;  3KMO A;  2JSZ A;  4NAX A;  4HI7 A;  3D5J A;  1EEM A;  5EY6 A;  2WFC A;  1GP1 A;  2H66 A;  3APQ A;  5A34 B;  5F07 A;  3UBL A;  3O76 A;  3I43 A;  1Y25 A;  1THX A;  4PUA A;  1SEN A;  1TI1 A;  5J4U A;  5A1N A;  3CSI A;  3TRQ A;  3VI7 A;  11GS A;  1CQH A;  2GDR A;  2ZNM A;  1OC8 A;  1A8L A;  4PXO A;  3KD0 A;  1NHY A;  2C0G A;  5DBQ A;  5DJL A;  4OMV A;  1ACV A;  3GL3 A;  4LL1 B;  1PN0 A;  1T8E B;  1GTU A;  3L0H A;  4ISD A;  3ED3 A;  1VF2 A;  4ECI A;  4BVX B;  1V40 A;  2H74 A;  1KTE A;  3DD3 A;  3HDC A;  3QMX A;  4A5P A;  2UZ8 A;  4D73 B;  2VM1 A;  4KGI A;  1EEJ A;  3U5R E;  1YKC A;  2O87 A;  2R37 A;  3EWL A;  4MF6 A;  1AW9 A;  1ERW A;  2L6D A;  5E4W A;  3N5O A;  2VLU A;  1UVZ A;  1J08 A;  4K0G A;  2M72 A;  2XPD A;  3ZVJ D;  4IBP A;  1B4Q A;  3M3M A;  2P31 A;  1OE7 A;  4BL7 B;  4RI7 A;  1YEP A;  4PUF C;  3QFB C;  1AAZ A;  5E59 A;  3I9V 2;  5D9T A;  2P5R A;  5GZZ B;  3FEU A;  3FY7 A;  3WD6 A;  1U88 A;  4TVE A;  3RPP A;  5F8B A;  2E2G A;  2QA2 A;  5ECL B;  3MSZ A;  4MPF A;  2H0H A;  4L5L A;  1YF0 A;  3F0I A;  4MMM A;  2IFQ A;  3C1S A;  2R0P A;  4EVM A;  2N5F A;  4Z2R A;  3DIE A;  1RK4 A;  1M2A A;  4KE3 A;  2H1G A;  2H76 A;  3C73 A;  5DCH A;  3TJF A;  1Y6E A;  1TTZ A;  2DKI A;  16GS A;  2M80 A;  2I4A A;  4AJ8 A;  2EIR A;  4BWS A;  1K0M A;  3VWV A;  2O7K A;  4ICY A;  5KN3 A;  1O6J A;  2DKH A;  1Q98 A;  4N10 A;  5DAL B;  2WRT A;  4L5O A;  5HQP A;  3KCM A;  3KM6 A;  3C1R A;  4TR3 A;  1E6B A;  5CRW A;  2HRK B;  4CY6 A;  4PQ1 A;  4EF0 A;  2WDU A;  3O6T A;  7GSS A;  4ILF A;  2VIM A;  3LEF A;  5IPG A;  1EZK A;  1K0B A;  1C72 A;  1GSS A;  1RQM A;  5J3R A;  4NV5 A;  10GS A;  5IIZ A;  4XRD A;  3ZL5 A;  2QC7 A;  5DQS A;  1YZX A;  3WGD A;  1JZO A;  1M0U A;  5ECS A;  2PN8 A;  2VLT A;  1KNG A;  5D9W A;  3LWA A;  2HRA A;  4DVC A;  3Q6O A;  5IOW A;  2OE3 A;  4L0U A;  4OFM A;  2H72 A;  5A5K A;  1A2M A;  3FR9 A;  4NHZ A;  1Z5Y E;  2VCX A;  4F0B A;  2FUG 2;  4E68 A;  2C0D A;  4FYU A;  4Q5N A;  4ZL9 A;  1USB A;  3TJJ A;  4IVF A;  1M7T A;  3D4M A;  3IOS A;  2LRT A;  4FQU A;  1QQ2 A;  4Z7X A;  5ECN B;  1M2D A;  2CZ3 A;  3KP9 A;  4J57 E;  4ID0 A;  1OVN A;  3EMX A;  5HR3 A;  2E2M A;  5HFK A;  3ME7 A;  3LYP A;  2VD1 A;  5B6M A;  1OKT A;  1XW5 A;  4I2T A;  2E0Q A;  4IN0 A;  3P90 A;  4KCA A;  5AN1 A;  1T00 A;  4MCU A;  2A2P A;  1K3Y A;  5ID2 B;  5DDL A;  2PMT A;  5LD0 A;  2B5E A;  4IJ3 A;  1T7P B;  5CP1 A;  3GHA A;  4HDE A;  1N2A A;  2V32 A;  1SU9 A;  5DAK B;  2B1K A;  2IMK A;  2DC5 A;  1PGT A;  2YN1 A;  2FA4 A;  4TR1 A;  6GSV A;  3IBH A;  5G5F A;  5G5E A;  3E0U A;  3TKS A;  1WOU A;  2H0G A;  2HQT A;  2UV8 G;  1DSB A;  1E2Y A;  3A2W A;  2LNT A;  2LV3 A;  2K8S A;  5HFG A;  4IHU A;  2XBQ A;  3UMA A;  2YOI A;  1JFU A;  2FWE A;  2TRX A;  3GKM A;  5L71 A;  2O89 A;  2R0G A;  2HNL A;  3MYD A;  1SJZ A;  4G19 A;  1GSU A;  2OKA A;  3Q18 A;  2F9S A;  4I5Q A;  4TXO A;  2WZ9 A;  1FO5 A;  1GWC A;  6GSW A;  1PQN A;  1QK8 A;  5J4Y A;  1SVM A;  3GA4 A;  4O32 A;  4GCI A;  2CVD A;  2GSQ A;  2FWG A;  3IK9 A;  3R3E A;  4LMW A;  1QMV A;  2REM A;  5A4W A;  2H01 A;  3N9J A;  3KGK A;  4K1F A;  1X9M B;  5A34 A;  2H71 A;  4PUR A;  3TDG A;  2AJQ B;  1J9B A;  5J41 A;  3MWH A;  3TJB A;  4OCF A;  4OCE A;  3ME8 A;  1HNC A;  1SJI A;  5G30 A;  4POB A;  6GSX A;  2J23 A;  5HR1 A;  5IMV A;  4G2E A;  4BVX A;  3FZ9 A;  4E8H A;  1GH2 A;  3S9F A;  5CRD A;  2QA1 A;  4OFN A;  4D73 A;  1HQO A;  1ZZY A;  3ZRD A;  3GUR A;  1WP0 A;  4QL9 A;  1O73 A;  4ZB7 A;  3DGQ A;  1LJR A;  1F2E A;  2H6Z A;  3W6G A;  3GTU B;  4AKH A;  2C8U A;  4FH8 A;  4PNG A;  4FIW A;  2DJK A;  2QKE A;  5IMC A;  1JLV A;  4MH3 A;  20GS A;  2DBC A;  3GL5 A;  3C7M A;  4K7O A;  2CX4 A;  2X8G A;  1PA3 A;  2I9H A;  4DSS B;  8GSS A;  3L78 A;  4J56 E;  3IAM 2;  2YV7 A;  2HZE B;  2WJU A;  3QOU A;  5J9C A;  3W8S A;  4AKG A;  1XWB A;  3EUR A;  1NW2 A;  4MZC A;  3P2A A;  4G9H A;  1Q4J A;  2O85 A;  4RQR A;  4TKY A;  4KAE A;  6GSY A;  3QDN A;  3G7I A;  2CVB A;  1ZOF A;  4MH2 A;  5COH A;  3R2Q A;  3RBT A;  3I69 A;  4Q5F A;  5J47 A;  2VCQ A;  1SKW B;  5AIS A;  3ZIJ A;  2DJ2 A;  3F3Q A;  2GQK A;  2V2G A;  4ECC A;  1B48 A;  2L4C A;  4K6X A;  1V9W A;  6GSU A;  1SK2 A;  4JU5 A;  2DJJ A;  2YP6 A;  4V2M A;  2DJ1 A;  1GSQ A;  2B3S A;  2C3N A;  3ERW A;  3HY2 A;  2GLR A;  2RUE A;  4GXZ A;  2HSN A;  1A8Y A;  4DEJ A;  4ZIJ A;  1XCC A;  4I8B A;  3FZA A;  1IYH A;  3LG6 A;  5ECH B;  1WJK A;  4FO5 A;  3H1N A;  4W66 A;  1PMT A;  4F82 A;  1MDJ A;  1WIK A;  4PQI A;  5IMF A;  1T1V A;  3QPM A;  3ZVJ A;  5F06 A;  2EFE A;  5B7C A;  2GT5 A;  4POM A;  4GWR A;  4N11 A;  5KN1 A;  3TKP A;  3TGZ A;  3F6F A;  3VI5 A;  4HQS A;  1OKD A;  2CA8 A;  1GUK A;  2VLV A;  3DYR A;  3TJG A;  1PX6 A;  1NHO A;  3CBU A;  4EO3 A;  2NPB A;  2HSM A;  3APO A;  3HA9 A;  4N30 A;  2ZCT A;  3PH9 A;  1K0N A;  4HU7 A;  2GTU A;  5JWO B;  2MMA A;  4HJ2 A;  3LSZ A;  2LNS A;  4KND A;  4TRX A;  1A2J A;  1XWG A;  4TOP A;  1B8X A;  2XPE A;  3LGC A;  1F3B A;  3QFA C;  1Z3E A;  3L9V A;  4HJM A;  3UVT A;  5HR2 A;  1SVL A;  1X5E A;  2CAQ A;  1TU8 A;  2R2J A;  3KTL A;  1O85 A;  2DIZ A;  2IL3 A;  3APS A;  2X99 A;  5J5N A;  2B5Y A;  4POL A;  1SJ6 A;  5HFI A;  1SD9 A;  1EP7 A;  1W4V A;  1X5C A;  1SK1 A;  1EGR A;  3GSS A;  4L0W A;  2PER A;  3HCZ A;  4OO5 A;  4TN8 A;  4AKX B;  1QFN A;  4HEA 2;  1GTB A;  1XIY A;  1R5A A;  5IO0 A;  2B7K A;  1GRX A;  4MZW A;  3A2V A;  2GZP A;  3GST A;  5ECP B;  4XRA A;  1UN2 A;  4IS0 A;  1S3A A;  3A2X A;  3FMW A;  1GTI A;  1F6M C;  3F4S A;  5JCU A;  1VF4 A;  1O7U A;  1FHE A;  3LFL A;  4MPG A;  4GLT A;  1VF1 A;  4ZIL A;  4F2I A;  3KZQ A;  2VOC A;  4X0X A;  3IK7 A;  4LMV A;  3ZMK A;  4Z2T A;  4GQF A;  2V6O A;  4JRR A;  1WWJ A;  1A0R P;  4KUN A;  3VWU A;  1GLQ A;  2KP2 A;  3FKF A;  4HZ2 A;  3F6D A;  3NOF A;  3SWL A;  2VL2 A;  4GSS A;  2H1B A;  4BA7 A;  4ZBB A;  1GUM A;  2NBS A;  2L6C A;  5CRH A;  4OFT A;  3LQ7 A;  4GSN A;  5KOX A;  1UC7 A;  4HOJ A;  3UAP A;  14GS A;  2HRF A;  1G6Y A;  5ELG A;  4AI6 A;  2JZR A;  3HVX A;  1TK8 B;  1M99 A;  4ML1 A;  4K7N A;  2LKU A;  1X5D A;  2CX3 A;  4IGJ A;  2A4V A;  1T3B A;  2WUL A;  2GZZ A;  4WF4 A;  3EU3 A;  1TDI A;  1I9D A;  4JR4 A;  3J7Y k;  4PGT A;  3GKX A;  3GTU A;  1S3C A;  1V57 A;  2VM2 A;  1GSD A;  1ZCP A;  3GH6 A;  4IP1 A;  1ERT A;  2I1U A;  1MD4 A;  4WR4 A;  3F8U A;  1CQG A;  4V1A p;  3BJ5 A;  4EDZ A;  2EIQ A;  3DEX A;  2MMZ A;  3W8J A;  4KF9 A;  2EFC A;  2MMO A;  3ZML A;  2KHP A;  4JBB A;  1FOV A;  3DKS A;  3IXR A;  5G31 A;  4XS1 A;  4N0V A;  1O8X A;  2RUF A;  4YQM A;  4KW6 A;  4MK3 A;  4I97 A;  5INY A;  4IQ1 A;  1AC1 A;  1A23 A;  2EIO A;  3D6I A;  4GDF A;  3IA1 A;  2A2S A;  2LQO A;  4MF5 A;  2DMM A;  1ZYN A;  3TU3 B;  4PX1 A;  4ZXG A;  2KUC A;  1GNE A;  4F03 A;  3WGE A;  1K3O A;  4AJ6 A;  4ECJ A;  4NV2 A;  3DVW A;  5AIX A;  4XS4 A;  1XFL A;  2DIY A;  3F9U A;  4J2F A;  1GSY A;  1WRY A;  2VL3 A;  3D21 A;  1EGO A;  3GX0 A;  3LYK A;  4WXT A;  4TW5 A;  4POK A;  1U87 A;  2TIR A;  5BMU B;  4RI6 A;  2LJR A;  1TW9 A;  4JZQ A;  5FWG A;  1ERV A;  3TCO A;  1QUW A;  2R6K A;  2OAD A;  4EL1 A;  1FB6 A;  2PUK C;  1ZGN A;  4AJ7 A;  2A2R A;  2PPT A;  1MDK A;  3HVV A;  1OYJ A;  2R5G A;  5A5H B;  4Q5R A;  5GAN D;  4ECB A;  3GNJ A;  2B6M A;  3F3R A;  3ZRE A;  1TK0 B;  1TRU A;  3VPT A;  1ZYE A;  1XW6 A;  2H6Y A;  1BED A;  2FCH A;  1R4W A;  4K5R A;  4X1U A;  1SKR B;  3EU4 A;  4WBJ A;  4XS6 A;  5JWQ B;  1ST9 A;  2OJL A;  4YAP A;  2LJA A;  4RQX A;  2VUP A;  5KN0 A;  4IW9 A;  1GNW A;  3LXZ A;  2KOK A;  4YKG A;  2AB6 A;  3CRU A;  2RM6 A;  1M9A A;  2EFD A;  4QMK A;  5ECI B;  4YQU A;  4WET A;  2X8H A;  4ZL8 A;  1YVL A;  4JR6 A;  17GS A;  5A1N B;  2NDO A;  3J7Y b;  2DLX A;  3IC8 A;  2YZH A;  1X9S B;  1XZO A;  2C1Y A;  3UIW A;  2WCI A;  1FOH A;  2K9F A;  3RHC A;  1XXU A;  1NSW A;  3H79 A;  1GUL A;  2AYT A;  4EIP A;  2FD3 A;  1AIU A;  1XOA A;  5DCG A;  3EVI A;  2NTO A;  3F4T A;  3GYK A;  1TP9 A;  1F3A A;  4BWQ A;  4G01 A;  1H75 A;  1JZD A;  1T4Y A;  2VAF A;  5CRE A;  3D4T A;  1XWK A;  1YDK A;  22GS A;  3UBK A;  1Z7R A;  1JZR A;  4E8E A;  1TRW A;  5ENU A;  1DE1 A;  1BG5 A;  6GST A;  3EMP A;  1Y1U A;  2RII A;  2X64 A;  2VKZ G;  3UOM A;  1SKS B;  4WF5 A;  4N3Z A;  1QXH A;  1AQX A;  2HZF A;  3Q74 A;  3DVX A;  5CNW A;  2LRN A;  3TKS C;  2CV4 A;  3FYG A;  1FVJ A;  1R26 A;  2GT6 A;  4TR0 A;  5IQY A;  1LBK A;  3EYT A;  2DSA A;  1SL1 B;  4WBR D;  3BCI A;  5AGY A;  2C4J A;  2PBJ A;  4IKH A;  4FYB A;  4CY8 A;  3FW2 A;  3MIX A;  3IE3 A;  3E3E A;  1TXX A;  2O5V A;  4IEL A;  3JCM L;  3HMJ G;  2YWI A;  3HJO A;  5DJM A;  2H1D A;  3EC3 A;  2H75 A;  1OC3 A;  4BL7 A;  4MZB A;  1I5G A;  5D9V A;  4HU9 A;  5JCG A;  2DJ3 A;  3KIJ A;  1B9X C;  4AF2 A;  4YQV A;  2OBI A;  4ACS A;  4XTS A;  1WE0 A;  3C8E A;  1W89 A;  1XPV A;  4IP6 A;  5G1K A;  1BJX A;  2C3Q A;  3CWG A;  2VO4 A;  4LL4 B;  4V1A g;  1AUC A;  2IMD A;  1XWA A;  1SL0 B;  3KMN A;  1V98 A;  3GH9 A;  1BYE A;  3FRC A;  4USS A;  2IMF A;  2HI7 A;  3ERF A;  1HNB A;  3IAS 2;  2F8A A;  1MD3 A;  4OD7 A;  2WGR A;  4HS1 A;  1YF1 A;  1FVK A;  4KH7 A;  3ZTL A;  2B5X A;  3ZFL A;  5DAL A;  5EVO A;  4BVY B;  1FG4 A;  2HRN A;  1PD2 1;  4HQZ A;  2X8C A;  2HRK A;  1PKW A;  4EUY A;  1JHB A;  1G6W A;  2B1L A;  1TU7 A;  4EE0 A;  3L9S A;  4JE1 A;  1PL2 A;  2YWM A;  3WGX A;  3G7J A;  2L4Q A;  4FYC A;  2Z9S A;  1EOG A;  4MLY A;  5C04 A;  2J9H A;  2ES7 A;  3VWW A;  5IM9 A;  5J4V A;  4NPB A;  3TKS E;  5EL8 A;  2I81 A;  1ZYP A;  2K6V A;  4H86 A;  1FAA A;  2CZ2 A;  2MBT A;  2JL4 A;  3UAR A;  3BCK A;  1QGV A;  3KTB A;  1Z7P A;  3KJY A;  2FLS A;  1WPI A;  3CTG A;  2H73 A;  5IOX A;  3ERG A;  4X43 A;  5D73 A;  2VCW A;  3IPZ A;  1X0R A;  5DQY A;  3RPN A;  2PGT A;  2B7J A;  3M8N A;  4MJA A;  2EFH A;  3LJR A;  2JAD A;  2HSY A;  2X49 A;  1TRV A;  1ERU A;  3ZFB A;  3IRA A;  4O5U A;  1SYX A;  5HR0 A;  13GS A;  2F51 A;  5B8A A;  2V1M A;  1U3A A;  5BMU A;  1B4P A;  2L5O A;  1ON4 A;  3CTF A;  3HHV A;  3GX8 A;  1UA5 A;  4TR1 B;  1GUH A;  9GSS A;  2H70 A;  4O5Q A;  2IMI A;  2IIY A;  2YAN A;  3BBY A;  1OC9 B;  1KBN A;  2VD0 A;  2H8L A;  5H5Q A;  2MBS A;  5A4U A;  3P8W A;  3A5W A;  1FW1 A;  4YH2 A;  5GAP D;  1OAZ A;  3VLN A;  5CAX A;  4PTS A;  1DUG A;  2QGV A;  1EWX A;  5ID2 A;  5BRT A;  3ZZX A;  1AXD A;  2BJX A;  1K0D A;  3M9K A;  3KH9 A;  2GSR A;  5DAK A;  4TXO B;  2VCV A;  1HYU A;  3GRX A;  3IHG A;  2K18 A;  1U6T A;  1O81 A;  4GQC A;  4L8E A;  3BD2 A;  2YCD A;  5IMZ A;  1ZMA A;  2ZUP A;  1KEB A;  3KEB A;  1XVW A;  1SVO A;  1URM A;  3UEM A;  3NZN A;  1TK5 B;  3CSJ A;  1Z6N A;  2AHE A;  1TRS A;  3IHQ A;  1BG1 A;  2P0G A;  4QL7 A;  2AV4 A;  2LRC A;  2ALB A;  3LOR A;  1Z9H A;  2H6X A;  2IPA A;  2GS3 A;  6GSS A;  4NXI A;  5IMA A;  2D2Z A;  1SL2 B;  2TRC P;  1XBS A;  2R3X A;  2HXK A;  1K0O A;  3C71 A;  3TOT A;  4F0C A;  1XWC A;  3CRT A;  3OR5 A;  1F37 A;  4XCS A;  1N25 A;  5KEJ A;  2JSY A;  4F9Z A;  2OAC A;  2DJ0 A;  5D93 A;  2LJK A;  2RM5 A;  5H5S A;  4Z2U A;  3TKQ A;  2AAW A;  1M2B A;  3CYN A;  3CMI A;  2CAI A;  1PRX A;  3EPT A;  3ISO A;  4Q5Q A;  5ABR A;  2GQM A;  2L5L A;  4XIH A;  3KP8 A;  2JAC A;  2LEG A;  1A24 A;  4X4J A;  4KSO A;  2FWF A;  1VF3 A;  3HD5 A;  2FNO A;  4P3Y B;  2YJH A;  1ML6 A;  3RDW A;  3UL3 A;  1IYI A;  2RLI A;  2FY6 A;  4KSM A;  4ZBD A;  4ZB8 A;  2YWN A;  2HFD A;  3DRN A;  4K7I A;  4IJI A;  4O92 A;  3DXB A;  1R5P A;  2DML A;  4MDC A;  3HKR A;  2MYG A;  4MA9 A;  4MJB A;  1T4Z A;  1G7O A;  5ELA A;  3GFK A;  4DSS A;  5LNK e;  2G0F A;  2HZE A;  3TOU A;  4PNF A;  2WB9 A;  4AGS A;  1EP8 A;  2I3Y A;  3FR3 A;  5CYY A;  4EDY A;  4EKZ A;  1DE2 A;  1JLW A;  2VCT A;  3LW9 A;  3F4R A;  2KLX A;  2GGT A;  2VL2 C;  18GS A;  2L57 A;  4YKF A;  3PPU A;  3GKN A;  1K3L A;  2YPM A;  4MAB A;  1EOH A;  3GMF A;  2JZS A;  1XW9 A;  4EXJ A;  4NWY A;  1GSF A;  2JZT A;  2CQ9 A;  2HLS A;  1ZYQ B;  2F8F A;  3A3T A;  4LA1 A;  3H93 A;  4ZL7 A;  2HSN B;  2FHE A;  2R0C A;  3VPQ A;  4GF0 A;  4LLR A;  4WKW A;  3Q19 A;  1BX9 A;  4BVY A;  1LU4 A;  2G2Q A;  4K0N A;  1S3D A;  3K8N A;  3DML A;  5CO3 A;  5DVB A;  5JCW A;  4KDU A;  2BTO T;  2E7P A;  3QCP A;  3WT2 A;  1VRS D;  5FHI A;  5F05 A;  4EC0 A;  1PSQ A;  2VCZ A;  3MDK A;  2N5A A;  2YV9 A;  2MZC A;  3PGT A;  3TRX A;  3H8Q A;  4GST A;  4BPY A;  5ECM B;  4K2D A;  3QAW A;  4MF7 A;  3QAV A;  2C0E A;  2EC4 A;  2ON7 A;  2A4H A;  3H4K A;  2HSH A;  3CSH A;  2HSM B;  2WS2 A;  12GS A;  2K8V A;  4ML6 A;  3ZYW A;  2GSS A;  2PU9 C;  3BOA A;  3MAK A;  4N0Z A;  5IO2 A;  1GL8 A;  2OE0 A;  3ZLP A;  5D9X A;  2GZY A;  3A5I A;  1K0C A;  4WEY A;  4JED A;  3D22 A;  2IME A;  3KH7 A;  3SBC A;  5KOW A;  3PIN A;  4KDX A;  2VL9 A;  1BAY A;  1PKZ A;  2GQL A;  19GS A;  2P5Q A;  3M1G A;  3TKR A;  3I6A A;  2LQQ A;  5ECQ B;  1PL1 A;  3GUS A;  3TRP A;  2H19 A;  3VFI A;  5ECO B;  1GSE A;  2CVK A;  2O8V B;  4YAV A;  2FWH A;  3VK9 A;  1OC9 A;  2AUV A;  3IC4 A;  4ZB9 A;  4MNN A;  4ULX A;  5ECK B;  1X9W B;  4XHM A;  1N8J A;  3CXG A;  1BF5 A;  2FGX A;  1ILO A;  5EPF A;  5LCZ A;  2YZU A;  2LST A;  3RHB A;  1DBY A;  2MMN A;  4OO4 A;  1OE8 A;  4G10 A;  1MDI A;  1TXU A;  4KA0 A;  3P7X A;  5F0G A;  1EV4 A;  4GTU A;  3HZ4 A;  3M0F A;  4O7H A;  3LXT A;  4QQ7 A;  1YY7 A;  5B6N A;  3L9U A;  1M9B A;  3HJM A;  2CT6 A;  2XHF A;  4G0L A;  2YNX A;  1B9Y C;  5GST A;  2LUS A;  4KX4 A;  1F9M A;  2JU5 A;  2N5B A;  2PVQ A;  2LTK A;  1BQ7 A;  2IFQ B;  1A2L A;  3FHK A;  1YKA A;  1SYR A;  3EIN A;  4KDY A;  3US3 A;  2X4A A;  2V41 A;  3WYW A;  1MEK A;  2OT3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...