1PX6A

A folding mutant of human class pi glutathione transferase, created by mutating aspartate 153 of the wild-type protein to asparagine
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
209
structure length
209
Chain Sequence
PPYTVVYFPVRGRCAALRMLLADQGQSWKEEVVTVETWQEGSLKASCLYGQLPKFQDGDLTLYQSNTILRHLGRTLGLYGKDQQEAALVDMVNDGVEDLRCKYISLIYTNYEAGKDDYVKALPGQLKPFETLLSQNQGGKTFIVGDQISFANYNLLDLLLIHEVLAPGCLDAFPLLSAYVGRLSARPKLKAFLASPEYVNLPINGNGKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Glutathione S-transferase P
publication title The multi-functional role of a highly conserved aspartic acid residue in glutathione transferase P1-1
rcsb
source organism Homo sapiens
total genus 82
structure length 209
sequence length 209
chains with identical sequence B
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2003-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
A PF14497 GST_C_3 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 1px6A02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1px6A01
3FEUA 1ML6A 2OA7A 5HR3A 3W8SA 1USBA 2IL3A 1M2BA 1YY7A 1V40A 3QAVA 2QGVA 3BCKA 3F9UA 4BL7B 1ZL9A 4ECBA 3Q6OA 3O6TA 2JU5A 3D22A 1A8YA 3SBCA 1IYHA 4ZL8A 3TKQA 1PL1A 1N8JA 3CRTA 2JSYA 5DCHA 3EMPA 1XVQA 1ON4A 5IMDA 2E0QA 4MJCA 1OC9A 2NVLA 5IMVA 4ZL7A 4KX4A 2YJ7A 2GZZA 3F0IA 4PNGA 2FUG2 2KP1A 4NXIA 4G9HA 4YQVA 2H0GA 3DXBA 3FZAA 1Z6NA 5GAND 2GZYA 1R7HA 2WZ9A 1TI3A 1YQ1A 2PPTA 5IIZA 3VWUA 3GTUB 4DSSB 1YF0A 2ZUPA 2L5OA 2D2ZA 2H73A 4EKZA 5JWOB 3QPMA 1ILOA 5D9XA 3MWHA 5B6NA 5IOXA 3UEMA 2YJHA 4BWSA 4F03A 3QFBC 2C80A 1GNWA 3C8EA 1ERTA 2HSYA 2K9FA 2LJKA 3TJBA 1KBNA 1MD4A 3L9UA 2PERA 3FR9A 1VRSD 1TRSA 1TRUA 2NDOA 1Y6EA 1GLQA 2IFQA 2CVBA 3CMIA 2WGRA 3EU3A 1MDIA 2LJRA 5J41A 2GT6A 1AQXA 3KMNA 1HNBA 5ECKB 4NHWA 2VAFA 2O87A 4JR6A 2EIOA 1PMTA 3FZ5A 4L0WA 1K3OA 1CQGA 3EMXA 2C0FA 2CX4A 1K0CA 2QSIA 3QDNA 2HQTA 1QFNA 1Z7RA 22GSA 2R6KA 1GSDA 2H72A 4KA0A 1GULA 2YPMA 2P5RA 1A2JA 1JZWA 3BOAA 2WRTA 5BMUA 2HE3A 2F9SA 3TJFA 1GH2A 4MJAA 4TRXA 1AUCA 4N30A 1S3DA 4OO5A 1XW6A 2ALBA 1VF3A 4RUVA 2H01A 6GSXA 3W6GA 5G30A 1N2AA 2L5LA 4XS6A 2IWTA 2HYXA 1PA3A 1YEPA 3LFLA 3QOUA 4G0LA 3TKSC 2I9HA 2CA8A 2OACA 2FY6A 4HS1A 4K8MA 3ERGA 4KH7A 2KP2A 1GTAA 1FW1A 2OADA 2FD3A 3VK9A 3PR8A 2VL2C 2DJ0A 1PSQA 3HCZA 1ERUA 1XW5A 1QXHA 4AJ6A 1GRXA 4O5RA 3LYPA 1GP1A 1M2AA 3IXRA 3ZLPA 1U88A 2YZHA 2YANA 3I6AA 4F0BA 1W4VA 1ZYQB 2CV4A 3NOFA 1Z9HA 3C71A 1K0BA 4EE0A 4TN8A 2LRCA 3L9VA 2L4QA 3GX8A 3L4NA 18GSA 2GS3A 3CSHA 3KP8A 3M9JA 3HJMA 2YV7A 3H4KA 3F8UA 3HY2A 2NTOA 2VCTA 3J7Yk 3DEXA 2G2QA 1X9WB 3D6IA 3TUEA 5JCUA 2O8VB 5ECOB 4MP4A 4IKHA 3H8QA 4ZILA 3UJ1A 5DBQA 4K0NA 3GH9A 2VCWA 5IOWA 2K8SA 3M9KA 2VCQA 3D5JA 2DMMA 3FZ4A 4MCUA 1XOAA 4JZQA 3R2QA 1ST9A 3VPTA 2GZPA 1PKWA 1NM3A 2XPEA 2LJAA 2F8FA 3WT2A 4OFTA 2HNLA 2H1BA 1THXA 4V1Ag 3ERFA 2H6XA 1S3CA 3IAS2 2I81A 2I1UA 2J23A 1E2YA 3TRQA 2A2RA 2DC5A 4MF6A 2C0DA 1SK2A 2Z9SA 4KNDA 3G7IA 1DE1A 3GKKA 3ZYWA 1EV4A 5EL8A 1IYIA 1K0OA 2OJLA 1G6WA 5INYA 4TXOA 3TDGA 4TVEA 4KDYA 2ZNMA 3ZZXA 4L5LA 4POLA 3TKRA 4RQRA 4YH2A 1FOVA 4BWQA 3HXSA 4IJIA 2V41A 3KD0A 4ML6A 3UOMA 5A4VA 1SYRA 3C1RA 3DGQA 3PPUA 4XCSA 2G0FA 3I69A 1I5GA 4ILFA 4ECCA 1BG5A 5A4WA 4FYBA 1M0UA 4HQSA 4GXZA 3CSJA 2REMA 3N9JA 2F51A 3ZFBA 4TR0A 4XS4A 8GSSA 4E8EA 3IDVA 3M3MA 3HDCA 1QK8A 2GSQA 2HZEA 4N11A 1RW1A 4HZ2A 3OR5A 4KSMA 4MZWA 5FHIA 1T4YA 4LL4B 1F2EA 5EY6A 5KN1A 1GTIA 3KJYA 1OE7A 4OCFA 1SL2B 1V58A 3LEFA 5IPHA 1TRVA 1NHYA 2TRXA 3P90A 3HVVA 4XS1A 1GLPA 4EC0A 2H0HA 4KCAA 1E6BA 4IQ1A 5LNKe 1ZMAA 4BVXB 4WF5A 1UA5A 3HKRA 1Q98A 2FWFA 1VGLA 1YKAA 5J5NA 3CXGA 4AGSA 3RPNA 2V1MA 3CTFA 4HUAA 3TOTA 2AYTA 5LCZA 1XBSA 1F3BA 2VL3A 4MK3A 3FHKA 1EGRA 3UIWA 3EU4A 1TDIA 2AHEA 3IC8A 3BD2A 5D93A 1SU9A 1K0AA 3TKSE 3TKSA 2LKUA 3F6FA 3TRPA 5JCGA 3CRUA 3KMOA 2YOIA 4IN0A 1KEBA 2EIRA 4WBRD 1A24A 3MSZA 4MABA 5ECNB 2HRNA 2RLIA 1ZOFA 2VL2A 2DJ3A 5B7CA 5GSTA 4HU7A 3KIJA 1FB0A 3EE2A 1O81A 4ZIJA 1XVWA 1TK5B 3R3EA 5ELGA 3CTGA 4V2NA 3Q18A 1SD9A 1FO5A 1SL0B 5IMZA 3FZ9A 2GTUA 2V6KA 4AF2A 2GGTA 2IN3A 5F8BA 1YKCA 3BJ5A 2P0GA 4ECIA 2HXKA 2IMFA 4USSA 2C3QA 2L4CA 4P3YB 5ECHB 4PUAA 2MMOA 5FT3A 1VF4A 2H1GA 4Z7XA 1AXDA 3MNGA 4HZ4A 1S3AA 5JWQB 1X9MB 4MZCA 4ZBBA 1OAZA 3LQ7A 1GUKA 4X1UA 1EGOA 3D0ZA 1XCCA 4FYUA 1SKSB 1HNAA 5ECMB 16GSA 1TOFA 2VM2A 5DJLA 1V98A 4HI7A 1GSQA 1AAZA 4DSRA 3WD6A 5G5EA 2FWHA 2YWOA 3WGEA 4N0ZA 3MDKA 2HT9A 4RI6A 2EIQA 1JLWA 4PGTA 2PVOC 5CO3A 3GV1A 3D4TA 3EYTA 4TR1A 1TXXA 2C1YA 4WF4A 3DD3A 4JU5A 4L8EA 3GNJA 2L6DA 1ABAA 2AV4A 14GSA 4TW5A 3QFAC 4ML1A 4CW9A 4EVMA 7GSSA 4PTSA 1J08A 4F2IA 4YQMA 4ID0A 4LL1B 3LJRA 3HVXA 4PUFC 2HI7A 3EC3A 1SJIA 3ZITA 2DJ2A 5D9VA 1K0NA 3GUSA 1Z3EA 4ZB9A 5DDLA 3QR6A 1XFLA 3K8NA 2GSRA 4POBA 4WR5A 2VD0A 2VLUA 5DVBA 4Q5FA 4I97A 3C1SA 3E9JB 1ERVA 2VCVA 2FWEA 3TRXA 1Q4JA 2CZ3A 2DJKA 2LRTA 2IPAA 3ZTLA 4TR3A 5AN1A 5B8BA 4K7OA 2DMLA 3HA9A 4XHMA 2DBCA 4ZB6A 2HSMA 4I5QA 4AJ7A 2H74A 4HDEA 2FCHA 1TP9A 5F0GA 4KAEA 2B7JA 1O7UA 2N5AA 3G9BA 5G31A 1H75A 3GL5A 2FGXA 2B7KA 5ENUA 3U5RE 3FR3A 3P8WA 2WDUA 3I43A 4NMUA 2VCXA 1BQ7A 4JRRA 1X9SB 1WMJA 5HR1A 2B3SA 5E59A 4J56E 2DIYA 2HZFA 4EO3A 2N5BA 3IE3A 3TGZA 5COHA 3GKMA 2VCZA 4MLYA 5KN0A 4ZXGA 1OC9B 1SJ6A 4XIHA 2GQKA 3VURA 1JZOA 2E2GA 3U6VA 1W89A 4EL1A 3KH7A 3F6DA 2M72A 1KTEA 3D4MA 3KTBA 1HD2A 2KLXA 2WB9A 2YP6A 1ZCPA 5E4WA 5G1LA 3FK8A 3LXTA 2LV3A 4L5OA 1GUMA 1O85A 1PKZA 5IQYA 1AQWA 1G0TA 4K9ZA 2JADA 1F37A 2RM6A 5IMCA 1RK4A 1BYEA 1OYJA 4EXJA 5F06A 1YEXA 3V1WA 3J7Yb 1EEMA 2VOCA 5J4UA 4N10A 1OVNA 2V32A 1WP0A 2YV9A 1LJRA 2WFCA 2YNXA 2XBQA 3F3RA 3APQA 3JCML 2B5XA 4FQUA 3DMLA 2B6MA 1OKTA 5FWGA 4GSSA 4WETA 6GSYA 3O76A 2KHPA 5C00A 1XXUA 3L9SA 4JR4A 3NZNA 4J2FA 1SK1A 3GH6A 2IFQB 1J0FA 1EOHA 1XOBA 4X0XA 4DSQA 1BX9A 1G6YA 3EWLA 2IMDA 3A2WA 3VI7A 2M46A 3LG6A 1QMVA 3HHVA 1ZGNA 2H19A 3ZIVA 2RM5A 3LGCA 3ZIJA 1UN2A 1ZYEA 3IHQA 3TJGA 5DALA 2K8VA 5J9BA 4KE3A 1KNGA 3I9V2 3FY7A 1WWJA 3A5WA 1Z7PA 5ECSA 4Q5NA 3UVTA 2MMNA 1QQ2A 3ZMKA 5G2ZA 3HD5A 2H76A 5J9CA 2OBIA 4MA9A 5HFKA 3H93A 5CRHA 4MPGA 3PGTA 3IC4A 3KXOA 1GSEA 2CQ9A 1PRXA 1GL8A 2MBTA 3EURA 2HRKA 1JFUA 5G1KA 2H1DA 4YAPA 4EUYA 3TJJA 3LYKA 2IIYA 4K7NA 5KN2A 4I2UA 4MH2A 3UARA 4DEJA 3ZL5A 4ZL9A 2AJQB 1O73A 1WJKA 3APOA 3HVSA 3RHCA 4MF7A 3UVHA 4WXTA 3FW2A 1DE2A 1GSUA 4XRAA 2RUEA 2YWMA 1FB6A 3KTLA 3RPPA 2X64A 4BVYA 3APSA 2PU9C 5KEJA 4IQAA 3KEBA 3QD9A 3QCPA 2J9HA 1M9BA 3TOUA 2BTOT 3PH9A 2H6YA 3ME7A 2AUVA 1O8XA 4K1FA 3CYNA 5ELAA 3FKFA 3HZ8A 2C8UA 4DVCA 4KUNA 1SK0A 4ZB8A 5IO0A 2N5FA 1B9XC 4IBPA 3WYWA 1TRWA 3VI5A 3IOSA 4QL7A 4XRDA 4AJ8A 2F8AA 2C3NA 1SL1B 5IMFA 2CZ2A 2WULA 4IVFA 3UAPA 2GSTA 4K2DA 3DIEA 1A0FA 3ZREA 4KGIA 1AQVA 1SENA 2O89A 1K3YA 5DQSA 4F9ZA 1JZDA 1BAYA 3GA4A 1ERWA 4KDUA 2V6OA 2R3XA 2H8LA 4NV2A 1EEJA 2VIMA 1WIKA 3H1NA 1WE0A 2YCDA 2E7PA 3L0HA 4RI7A 2HRKB 2BJXA 1Z6MA 2X8HA 2H6ZA 2VLVA 1XWCA 4JE1A 5J3RA 4TOPA 1U3IA 3UL3A 2GQLA 2LNSA 3QMXA 1URMA 4GSNA 4K6XA 1M7TA 4MJBA 3UMAA 1B48A 5G5FA 2ES7A 5IPGA 1TU8A 1OKDA 5GAPD 2NPBA 1O6JA 4K0GA 4MH3A 1NHOA 4IGJA 4OCEA 1T00A 5D96A 2KUCA 2OBKA 4MMMA 4NWYA 3ED3A 1GTUA 4TXOB 4I2TA 4PNFA 5HR0A 4BVYB 2TIRA 5IM9A 4EF0A 4G2EA 4HQZA 1K3LA 3VWVA 3N5OA 2I4AA 3ZRDA 2GDRA 4IW9A 3UBLA 2XHFA 4WEYA 3KP9A 1G7EA 3ZMLA 1QUWA 5CNWA 2K18A 4BL7A 1X5DA 4HU9A 2ON7A 1XW9A 2I3YA 5KN3A 1TW9A 4KW6A 5HFIA 2PBJA 5D73A 3EVIA 4TKYA 3GKXA 1PX7A 4XS4B 5D9TA 4IHUA 3A2XA 2EC4A 2IMKA 2V2GA 2MMAA 1O8WA 2IJYA 5H5RA 5ECQB 3SWLA 2HZEB 4MF5A 4ACSA 5JCWA 11GSA 1B8XA 2B1LA 5H5QA 1PL2A 4K7IA 3GIXA 3A3TA 3PINA 2RUFA 3FYGA 3TJKA 3CSIA 1GNEA 2VM1A 1X0RA 3FR6A 1G7OA 3EINA 2C3TA 4HJMA 4G10A 2ZCTA 2C0EA 1GWCA 2IMIA 3TCOA 3KGKA 1GUHA 2X8CA 4EDZA 4MDCA 1HQOA 2AB6A 2HLSA 3GTUA 3HJOA 1MDJA 1UC7A 1T1VA 4DSSA 5ABRA 3S9FA 4XTSA 4D73A 3US3A 1DBYA 3DVXA 4PQ1A 2DJJA 3ERWA 1F6MC 2H0IA 3DWVA 5ECPB 2VL9A 2B5EA 4GWRA 4Q5RA 2JZTA 2L6CA 2OE1A 1VF1A 4ULXA 5DAKA 5F07A 4BA7A 1OC8A 3ZVJD 5CRWA 2DLXA 3F4SA 2DSAA 1B9YC 3VLNA 2FA4A 4IJ3A 3GURA 4V1Ap 6GSVA 3M1GA 2FLSA 1C72A 2JZRA 2NBSA 2JSZA 5CRGA 1K0MA 5AISA 6GSWA 5AIVA 3E3EA 2MZCA 5CP1A 3H79A 4GLTA 1A2MA 2H1AA 4NAXA 4FO5A 1NSWA 1TK0B 5JWRB 10GSA 2K6VA 4NPBA 1T7PB 1ACVA 1J9BA 4QL9A 3IBHA 4PX1A 1T4ZA 3KH9A 4RQXA 3L78A 3D21A 2LSTA 4TR4A 5D9WA 4D73B 1YDKA 4OD7A 4HEA2 1M2DA 4JEDA 4OO4A 2IMEA 4I6XA 5CRDA 4WKWA 1GSSA 2GLRA 3WGXA 1R4WA 1U6TA 3IPZA 2C4JA 2X8GA 4GSTA 1V9WA 1XWKA 4TR1B 1K0DA 5HR2A 1EV9A 5DAKB 3TB2A 1U3AA 2CAQA 1ZZYA 13GSA 9GSSA 4FH8A 2WS2A 1MTCA 2YZUA 4TXVA 6GSSA 1BEDA 3DKSA 3IR4A 3M8NA 4IP1A 3KZQA 4OWYA 2H30A 4MJEA 5CAXA 4WR4A 3GL3A 4NV5A 4OFMA 2CAIA 5AIXA 1V57A 5IMAA 3GYKA 1MD3A 4MPFA 2JL4A 1PX6A 4OFNA 3IK7A 3C7MA 4LMWA 2HSNB 1MEKA 5EVOA 4L0UA 4O92A 2LS5A 1HYUA 2VLTA 1WOUA 4N0VA 3UBKA 2CX3A 3HJPA 17GSA 1F9MA 2H75A 3GN3A 3AY8A 3WT1A 1A2LA 3GX0A 1FHEA 1Y25A 2L59A 1PN9A 3TKPA 1RQMA 5H5SA 1X5EA 3DYRA 1GSFA 2HSMB 1SD8A 2R2JA 2OKAA 3VWWA 1A23A 1M99A 4IS0A 5A4UA 1V2AA 3ZFLA 4ZBDA 2A4VA 2R37A 3DRNA 2YN1A 2OE3A 2YWIA 1SKRB 2F3MA 4PURA 1LBKA 2JZSA 2R4VA 1TK8B 2QKEA 4GF0A 1NW2A 2A2SA 2R5GA 4X43A 5GZZB 2GSSA 1B4PA 3RHBA 2PMTA 4Q5QA 2PUKC 6GSTA 4GQCA 3F4RA 5GSSA 3O3TA 2FHEA 1YJ6A 1A8LA 1HNCA 5IO2A 4OMVA 2GT5A 2P5QA 4GTUA 5AGYA 4CHSA 3Q19A 2PN8A 1XPVA 1F3AA 3P7XA 3A2VA 2CVKA 4JBBA 1T3BA 1AC1A 3FRCA 2VUPA 3LSZA 4BPYA 1XWGA 2PWJA 4FIWA 4H86A 5ID2A 1YZXA 3VFIA 3NIVA 20GSA 4V2LA 3DVWA 5B6MA 3GRXA 4I8BA 4G0IA 1B4QA 3G7JA 5A5KA 2FWGA 1T8EB 4BVXA 2WCIA 2HRFA 1TI1A 1QGVA 2QC7A 1DUGA 5DQYA 1LU4A 1THOA 1SYXA 2X99A 1OC3A 3IRAA 1R26A 3VWXA 4F82A 3LWAA 2H66A 2O7KA 4YAVA 1M9AA 1SKWB 2AAWA 1FG4A 3RBTA 2CVDA 1EWXA 2VO4A 1GTBA 2B1KA 1PGTA 1XIYA 1EOGA 4POMA 2O85A 1UVZA 1AIUA 3KCMA 3QAWA 4EDYA 1TJDA 4GRFA 2HFDA 1R5AA 5ECLB 5DALB 2GQMA 2TRCP 3WGDA 3C73A 2ON5A 2GVPA 3HYPA 4O32A 2L57A 1JHBA 5LD0A 4O7HA 3E0UA 4E8HA 1YF1A 3ISOA 4KCEA 3Q74A 2MYGA 2M80A 4CDOA 4YQUA 3ME8A 1VF2A 2JACA 2LNTA 3GKNA 2KOKA 2MBSA 2C0GA 3F4TA 1PD21 1EZKA 1WRYA 2YWNA 3QAGA 1U87A 3RDWA 4KSOA 1TU7A 1H4OA 3IK9A 5ID2B 3GSSA 1AW9A 3IV4A 4GQFA 5DCGA 2BMXA 3F3QA 3LORA 4V2MA 2XPDA 1TTZA 1I9DA 2DIZA 3MAKA 2LTKA 4WBJA 4J57E 1BJXA 4ZBAA 12GSA 3P2AA 1A0RP 3RAZA 5ECRB 4LA1A 5CYYA 2H70A 3F63A 5HFGA 4KDXA 4PQIA 4MZBA 6GSUA 1PQNA 1Z5YE 5DJMA 2FA8A 1MDKA 2LUSA 4IP6A 4POKA 4HJ2A 3GSTA 1XWBA 2XBIA 2P31A 1X5CA 2PGTA 2XC2A 4QQ7A 3IAM2 2HSHA 1FAAA 5F05A 1FVJA 3HZ4A 2UZ8A 2H71A 3LXZA 3CBUA 5D8IA 2CT6A 1EP7A 4FYCA 4F0CA 3GFKA 1XWAA 5CREA 2RIIA 2PVQA 2LEGA 2B5YA 3BBYA 4PXOA 4KF9A 3G7YA 19GSA 4ISDA 4IELA 1EP8A 1OE8A 2E2MA 1SJZA 1JLVA 2LRNA 1CQHA 4ECJA 3W8JA 2FNOA 3VPQA 5B8AA 4PQHA 2DJ1A 3BCIA 2LQQA 1GSYA 1DSBA 1R5PA 1XZOA 1JZRA 2HRAA 5L71A 4LMVA 2LQOA 4HOJA 3GHAA 3M0FA 5C04A 1TKDB 3KM6A 3GMFA 2MMZA 2WJUA 4KB3A 4GCIA 5ECIB 4NHZA 4LLRA 5HQPA 2OE0A 5EPFA 4G19A 1FVKA 1WPIA 3ZVJA 4G0KA 2VD1A 3IA1A
chains in the Genus database with same CATH superfamily
3FEUA 1ML6A 5J4VA 2OA7A 5HR3A 3W8SA 1USBA 2IL3A 1M2BA 1YY7A 1V40A 3QAVA 2QGVA 3BCKA 3F9UA 4BL7B 1ZL9A 4ECBA 3Q6OA 3O6TA 2JU5A 3D22A 1A8YA 3SBCA 1IYHA 4ZL8A 3TKQA 1PL1A 1N8JA 3CRTA 2JSYA 5DCHA 3EMPA 2H1LA 1XVQA 1ON4A 5IMDA 2E0QA 4MJCA 1OC9A 2NVLA 5IMVA 4ZL7A 4KX4A 2YJ7A 2GZZA 3F0IA 4PNGA 2FUG2 2KP1A 4NXIA 4G9HA 4YQVA 2H0GA 3DXBA 3FZAA 1Z6NA 5GAND 2GZYA 1R7HA 2WZ9A 1TI3A 1YQ1A 2PPTA 5IIZA 3VWUA 3GTUB 4DSSB 1YF0A 2ZUPA 1TXUA 2L5OA 2D2ZA 2H73A 5J47A 4EKZA 5JWOB 3QPMA 1ILOA 5D9XA 3MWHA 5B6NA 5IOXA 3UEMA 2YJHA 4BWSA 4F03A 3QFBC 2C80A 1GNWA 3C8EA 1ERTA 2HSYA 2K9FA 2LJKA 3TJBA 1KBNA 1MD4A 4W66A 3L9UA 2PERA 3FR9A 1VRSD 1TRSA 1TRUA 2NDOA 1Y6EA 1GLQA 2IFQA 2CVBA 3CMIA 2WGRA 3EU3A 1MDIA 2LJRA 5J41A 2GT6A 1AQXA 3KMNA 1HNBA 5ECKB 4NHWA 2VAFA 3CWGA 2O87A 4JR6A 2EIOA 1PMTA 3FZ5A 4L0WA 1K3OA 1CQGA 3EMXA 2C0FA 2CX4A 1K0CA 2QSIA 3QDNA 2HQTA 1QFNA 1Z7RA 22GSA 2R6KA 1GSDA 2H72A 4KA0A 1GULA 2YPMA 2P5RA 1A2JA 1JZWA 3BOAA 2WRTA 5BMUA 2HE3A 2F9SA 3TJFA 1GH2A 4MJAA 4TRXA 1AUCA 4N30A 1S3DA 4OO5A 1XW6A 2ALBA 1VF3A 4RUVA 2H01A 6GSXA 1BG1A 4EIQA 3W6GA 5G30A 1N2AA 2L5LA 4XS6A 2IWTA 2HYXA 1PA3A 1YEPA 3LFLA 3QOUA 4G0LA 3TKSC 5A1NA 2I9HA 4AKHA 2CA8A 2OACA 2FY6A 4HS1A 4K8MA 3ERGA 4KH7A 2KP2A 1GTAA 1FW1A 2OADA 2FD3A 3VK9A 3PR8A 2VL2C 2DJ0A 1PSQA 3HCZA 1ERUA 1XW5A 1QXHA 4AJ6A 2A2PA 1GRXA 1SVOA 4O5RA 3LYPA 1GP1A 1M2AA 3IXRA 3ZLPA 1U88A 2YZHA 2YANA 2UV8G 3I6AA 4F0BA 1W4VA 1ZYQB 2CV4A 3NOFA 1Z9HA 3C71A 1K0BA 4EE0A 4TN8A 2LRCA 3L9VA 2L4QA 3GX8A 3L4NA 18GSA 2GS3A 3CSHA 3KP8A 3M9JA 3HJMA 2YV7A 3H4KA 3F8UA 3HY2A 2NTOA 2VCTA 3J7Yk 3DEXA 2G2QA 1X9WB 3D6IA 3TUEA 5JCUA 2O8VB 5ECOB 4MP4A 1SVMA 4IKHA 3H8QA 5BMUB 4ZILA 3UJ1A 5DBQA 4K0NA 3GH9A 2VCWA 5IOWA 2K8SA 3M9KA 2VCQA 3D5JA 2DMMA 3FZ4A 4MCUA 1XOAA 4JZQA 3R2QA 1ST9A 3VPTA 2GZPA 1PKWA 1NM3A 2EFDA 2XPEA 2LJAA 2F8FA 3WT2A 4OFTA 2HNLA 2H1BA 1THXA 4V1Ag 3ERFA 2H6XA 1S3CA 3IAS2 4CY6A 2I81A 4QMKA 2I1UA 2J23A 1E2YA 3TRQA 2A2RA 2DC5A 4MF6A 2WVZA 2C0DA 1SK2A 2Z9SA 4KNDA 3G7IA 1DE1A 3GKKA 3ZYWA 1EV4A 5EL8A 1IYIA 1K0OA 2OJLA 1G6WA 5INYA 4TXOA 3TDGA 4TVEA 4KDYA 2ZNMA 3ZZXA 4L5LA 4POLA 3TKRA 4RQRA 4YH2A 1FOVA 4BWQA 3HXSA 4IJIA 2V41A 3KD0A 4ML6A 3UOMA 5A4VA 1SYRA 3C1RA 3DGQA 3PPUA 4XCSA 2G0FA 3I69A 1I5GA 4ILFA 4ECCA 1BG5A 5A4WA 4FYBA 1M0UA 4HQSA 4GXZA 3CSJA 2REMA 3N9JA 2F51A 3ZFBA 4TR0A 4XS4A 8GSSA 4E8EA 3IDVA 3M3MA 3HDCA 4K5RA 1QK8A 2GSQA 2HZEA 4N11A 1RW1A 4HZ2A 3OR5A 4KSMA 4MZWA 5FHIA 1T4YA 4LL4B 1F2EA 5EY6A 5KN1A 1GTIA 3KJYA 1OE7A 4OCFA 1SL2B 1V58A 3LEFA 5IPHA 1TRVA 1NHYA 2TRXA 3P90A 3HVVA 4XS1A 1GLPA 4EC0A 2H0HA 4KCAA 1E6BA 4IQ1A 5LNKe 1ZMAA 4BVXB 4WF5A 1UA5A 3HKRA 1Q98A 2FWFA 1VGLA 1YKAA 5J5NA 3CXGA 4AGSA 3RPNA 2V1MA 3CTFA 4HUAA 2EFEA 3TOTA 2AYTA 5LCZA 1XBSA 1SVLA 1F3BA 2VL3A 4MK3A 3FHKA 1EGRA 3UIWA 3EU4A 1TDIA 2AHEA 4A5PA 3IC8A 3BD2A 5D93A 1SU9A 1K0AA 3TKSE 3TKSA 2LKUA 3F6FA 3TRPA 5JCGA 3CRUA 3KMOA 2YOIA 4IN0A 1KEBA 2EIRA 4WBRD 1A24A 3MSZA 4MABA 4YKGA 5ECNB 1ZYPA 2HRNA 2RLIA 1ZOFA 2VL2A 2DJ3A 5B7CA 5GSTA 4HU7A 4ZB7A 3KIJA 1FB0A 3EE2A 1O81A 4ZIJA 1XVWA 1TK5B 3R3EA 5ELGA 3CTGA 4V2NA 3Q18A 1SD9A 1FO5A 1SL0B 5IMZA 3FZ9A 2GTUA 2V6KA 4AF2A 2GGTA 2IN3A 5F8BA 1YKCA 3BJ5A 2P0GA 4ECIA 2HXKA 2IMFA 4USSA 2C3QA 2L4CA 4P3YB 5ECHB 4PUAA 2MMOA 5FT3A 1VF4A 2H1GA 4Z7XA 1AXDA 3MNGA 4HZ4A 1S3AA 5JWQB 2QA1A 1X9MB 2QA2A 4MZCA 4ZBBA 1OAZA 3LQ7A 1GUKA 4HSCX 4X1UA 1EGOA 3D0ZA 1XCCA 4FYUA 1SKSB 2EFHA 5J40A 1HNAA 1S4BP 5ECMB 16GSA 1TOFA 2VM2A 5DJLA 1V98A 4HI7A 1GSQA 1AAZA 4DSRA 3WD6A 5G5EA 2FWHA 2YWOA 3WGEA 1M3JA 4N0ZA 3MDKA 2HT9A 4RI6A 2EIQA 1JLWA 4PGTA 2PVOC 5CO3A 4O5UA 3GV1A 3D4TA 3EYTA 4TR1A 2EFCA 1TXXA 2C1YA 2DKIA 4WF4A 3DD3A 4JU5A 5A5HB 4L8EA 3GNJA 2L6DA 1ABAA 2O36A 2AV4A 14GSA 4TW5A 3QFAC 5BRTA 4K2XA 4ML1A 4CW9A 4EVMA 7GSSA 4PTSA 1J08A 4F2IA 4YQMA 4ID0A 4LL1B 4PI0C 3LJRA 3HVXA 4PUFC 2HI7A 3EC3A 1SJIA 3ZITA 2DJ2A 5D9VA 1K0NA 2HSNA 3GUSA 1Z3EA 4ZB9A 5DDLA 3QR6A 1XFLA 3K8NA 2GSRA 4POBA 4WR5A 2O5VA 2VD0A 2VLUA 4Q5FA 5DVBA 4I97A 3C1SA 1ZYNA 3E9JB 3MYDA 1ERVA 2VCVA 2FWEA 3TRXA 1Q4JA 2CZ3A 2DJKA 2X4AA 2LRTA 2IPAA 3ZTLA 1PFOA 5AN1A 4TR3A 3IHGA 4K7OA 2DMLA 5B8BA 3HA9A 4XHMA 2DBCA 4ZB6A 1XG8A 2HSMA 4I5QA 4AJ7A 2H74A 4HDEA 2FCHA 1TP9A 5F0GA 4GDFA 4KAEA 2B7JA 1O7UA 2N5AA 3G9BA 5G31A 1H75A 3GL5A 2FGXA 2B7KA 5ENUA 3U5RE 3FR3A 3P8WA 2WDUA 3I43A 4NMUA 2VCXA 1BQ7A 4JRRA 1PN0A 1X9SB 1WMJA 5HR1A 4E68A 2B3SA 5E59A 4J56E 2DIYA 2HZFA 4EO3A 2WW3A 1M3IA 2N5BA 3IE3A 3TGZA 5COHA 3GKMA 2VCZA 4MLYA 5KN0A 4ZXGA 1OC9B 1SJ6A 4XIHA 2GQKA 4Z2RA 3VURA 1JZOA 2E2GA 3U6VA 1W89A 4EL1A 3KH7A 3F6DA 2M72A 1KTEA 3D4MA 3KTBA 1HD2A 2WW0A 2KLXA 2WB9A 2YP6A 1ZCPA 5E4WA 5G1LA 3FK8A 3LXTA 2LV3A 4L5OA 1GUMA 1O85A 1PKZA 5IQYA 1AQWA 1G0TA 4K9ZA 2JADA 1F37A 4EIPA 2RM6A 5IMCA 1RK4A 1BYEA 1OYJA 4EXJA 5F06A 1YEXA 3V1WA 3J7Yb 1EEMA 2VOCA 4X4JA 5J4UA 4N10A 1OVNA 2V32A 1WP0A 2YV9A 1LJRA 2WFCA 2YNXA 2XBQA 3F3RA 3APQA 3JCML 2B5XA 4FQUA 3DMLA 2B6MA 1OKTA 5FWGA 4GSSA 4WETA 6GSYA 3O76A 2KHPA 5C00A 4PI2C 5J4YA 1XXUA 3L9SA 4JR4A 2WVXA 3NZNA 4J2FA 1SK1A 3GH6A 2IFQB 1J0FA 1EOHA 1XOBA 4X0XA 4DSQA 1BX9A 1G6YA 3EWLA 2IMDA 3A2WA 3VI7A 2M46A 3LG6A 1QMVA 3HHVA 1ZGNA 2H19A 3ZIVA 2RM5A 3LGCA 3ZIJA 2WW2A 1UN2A 1ZYEA 3IHQA 3TJGA 5DALA 2K8VA 3HMJG 5J9BA 4KE3A 1KNGA 3I9V2 3FY7A 1WWJA 3A5WA 1Z7PA 5ECSA 4Q5NA 3FMWA 2MMNA 3UVTA 1QQ2A 5A34A 3ZMKA 5G2ZA 3HD5A 2H76A 5J9CA 2OBIA 4MA9A 5HFKA 3H93A 5CRHA 4MPGA 3PGTA 3IC4A 3KXOA 1GSEA 2CQ9A 1PRXA 1GL8A 4ICYA 2MBTA 3EURA 2HRKA 1JFUA 5G1KA 2H1DA 4YAPA 4EUYA 3TJJA 3LYKA 2IIYA 4K7NA 5KN2A 4I2UA 4MH2A 3UARA 4DEJA 3ZL5A 4ZL9A 2AJQB 5A1NB 1O73A 1WJKA 3APOA 3HVSA 4YKFA 3RHCA 4MF7A 3UVHA 3HVNA 4WXTA 3FW2A 4CY8A 1DE2A 1GSUA 4AI6A 4XRAA 2RUEA 2YWMA 2WVXB 1FB6A 3KTLA 3RPPA 2X64A 4BVYA 3APSA 2PU9C 5KEJA 4IQAA 3KEBA 3QD9A 3QCPA 2J9HA 1M9BA 3TOUA 2BTOT 3PH9A 2H6YA 3ME7A 2AUVA 1O8XA 4K1FA 3CYNA 5ELAA 3FKFA 3HZ8A 2C8UA 4DVCA 4KUNA 1SK0A 4ZB8A 5IO0A 2N5FA 1B9XC 4IBPA 3WYWA 1TRWA 3VI5A 3IOSA 4QL7A 4XRDA 4AJ8A 2F8AA 2C3NA 1SL1B 5IMFA 2CZ2A 2WULA 4IVFA 3UAPA 2GSTA 4K2DA 3DIEA 1A0FA 3ZREA 4KGIA 1AQVA 1SENA 2O89A 1K3YA 5DQSA 4F9ZA 1JZDA 1BAYA 3GA4A 1ERWA 4KDUA 2V6OA 2R3XA 2H8LA 4NV2A 1EEJA 2VIMA 1WIKA 3H1NA 1WE0A 2YCDA 2E7PA 3L0HA 4RI7A 2HRKB 2BJXA 1Z6MA 2X8HA 2H6ZA 2VLVA 1XWCA 2WZSA 4JE1A 5J3RA 4TOPA 1U3IA 3UL3A 2GQLA 2LNSA 3QMXA 1URMA 4GSNA 4K6XA 1M7TA 4MJBA 3UMAA 1B48A 5G5FA 2ES7A 5IPGA 1TU8A 1Y1UA 1OKDA 5GAPD 2NPBA 1O6JA 4K0GA 4MH3A 1NHOA 4IGJA 4OCEA 1T00A 5D96A 2KUCA 2OBKA 4MMMA 4NWYA 3ED3A 1GTUA 4TXOB 4I2TA 1FOHA 4PNFA 5HR0A 4PHZC 4BVYB 2TIRA 5IM9A 4EF0A 4G2EA 4HQZA 1K3LA 3VWVA 3N5OA 2I4AA 3ZRDA 2GDRA 4AKGA 4IW9A 3UBLA 2XHFA 4WEYA 3KP9A 1G7EA 3ZMLA 1QUWA 2R0GA 5CNWA 2K18A 4BL7A 1X5DA 5KOWA 4HU9A 2ON7A 1XW9A 2I3YA 5KN3A 1TW9A 4KW6A 5HFIA 2PBJA 5D73A 3EVIA 4TKYA 3GKXA 1PX7A 4XS4B 5D9TA 4IHUA 3A2XA 2EC4A 2IMKA 2V2GA 2MMAA 1O8WA 2IJYA 5H5RA 5ECQB 3SWLA 2HZEB 4MF5A 4ACSA 5JCWA 11GSA 2OT3A 1B8XA 2B1LA 5H5QA 1PL2A 4K7IA 3GIXA 3RGBC 3A3TA 3PINA 2RUFA 3FYGA 3TJKA 3CSIA 1GNEA 4K5SA 2VM1A 2R0PA 1X0RA 3FR6A 1G7OA 3EINA 2C3TA 4HJMA 4G10A 2ZCTA 2C0EA 1GWCA 2IMIA 3TCOA 3KGKA 1GUHA 2X8CA 4EDZA 4MDCA 1HQOA 2AB6A 2HLSA 3GTUA 3HJOA 1MDJA 1UC7A 1T1VA 4DSSA 5ABRA 3S9FA 4XTSA 4D73A 3US3A 1DBYA 3DVXA 4PQ1A 2DJJA 3ERWA 1F6MC 2H0IA 3DWVA 5ECPB 2VL9A 2B5EA 4GWRA 4Q5RA 2JZTA 2L6CA 2OE1A 2R0CA 4FXYP 1VF1A 1YVLA 4ULXA 5DAKA 5F07A 4BA7A 1OC8A 3ZVJD 5CRWA 4Z2TA 2DLXA 3F4SA 2DSAA 1B9YC 3VLNA 2FA4A 4IJ3A 3GURA 4V1Ap 6GSVA 2FLSA 3M1GA 1C72A 2JZRA 2NBSA 2JSZA 5CRGA 1K0MA 5AISA 6GSWA 1BF5A 5AIVA 3E3EA 2MZCA 5CP1A 3H79A 4GLTA 1A2MA 2H1AA 4NAXA 4FO5A 1NSWA 1TK0B 5JWRB 10GSA 2K6VA 4NPBA 1T7PB 1ACVA 1J9BA 4QL9A 3IBHA 4PX1A 1T4ZA 3KH9A 4RQXA 3L78A 3D21A 2LSTA 4TR4A 5D9WA 4D73B 1YDKA 4OD7A 4HEA2 1M2DA 4JEDA 4OO4A 2IMEA 4I6XA 5CRDA 4WKWA 1GSSA 2GLRA 3WGXA 1R4WA 1U6TA 3IPZA 2C4JA 2X8GA 4GSTA 1V9WA 1XWKA 4TR1B 1K0DA 5HR2A 1EV9A 5DAKB 3TB2A 1U3AA 2CAQA 1ZZYA 13GSA 9GSSA 4FH8A 2WS2A 3CHXC 3CQFA 1MTCA 2YZUA 4TXVA 6GSSA 1BEDA 3DKSA 3IR4A 3M8NA 4IP1A 3KZQA 4OWYA 2H30A 4MJEA 5CAXA 4WR4A 3GL3A 4NV5A 4OFMA 2CAIA 5AIXA 1V57A 3RFRC 5IMAA 3GYKA 1MD3A 4MPFA 2JL4A 1PX6A 4OFNA 3IK7A 3C7MA 4LMWA 2HSNB 1MEKA 5EVOA 4L0UA 4O92A 2LS5A 1HYUA 2VLTA 1WOUA 4N0VA 3UBKA 2CX3A 3HJPA 3A5IA 17GSA 1F9MA 2H75A 3GN3A 3AY8A 3WT1A 1A2LA 3GX0A 1FHEA 1Y25A 2L59A 1PN9A 3TKPA 1RQMA 5H5SA 4MNNA 1X5EA 3DYRA 1GSFA 3EPTA 2HSMB 1SD8A 2R2JA 1I1IP 2OKAA 3VWWA 1A23A 1M99A 1YEWC 4IS0A 5A4UA 1V2AA 3ZFLA 4ZBDA 2A4VA 2R37A 3DRNA 2YN1A 2OE3A 2YWIA 1SKRB 2F3MA 4PURA 1LBKA 2JZSA 2R4VA 1TK8B 2QKEA 4GF0A 1NW2A 2A2SA 2R5GA 4X43A 5GZZB 2GSSA 1B4PA 3RHBA 2PMTA 4Q5QA 2PUKC 6GSTA 4GQCA 3F4RA 5GSSA 3O3TA 2FHEA 1YJ6A 1A8LA 1HNCA 5IO2A 2O3EA 4OMVA 2GT5A 2P5QA 4GTUA 1S3RA 5AGYA 4CHSA 3Q19A 2PN8A 1XPVA 1F3AA 3P7XA 3A2VA 2CVKA 4JBBA 1T3BA 1AC1A 3FRCA 2VUPA 3LSZA 4BPYA 1XWGA 2PWJA 4FIWA 4H86A 5ID2A 4AKIA 1YZXA 3VFIA 3NIVA 20GSA 4V2LA 3DVWA 5B6MA 4Z2UA 3TU3B 3GRXA 2WW1A 4I8BA 4G0IA 1B4QA 3G7JA 5A5KA 2FWGA 1T8EB 4BVXA 2WCIA 2HRFA 1TI1A 1QGVA 2QC7A 1DUGA 5DQYA 1LU4A 1THOA 1SYXA 2X99A 1OC3A 3IRAA 1R26A 3VWXA 4F82A 3LWAA 5KOXA 2H66A 2O7KA 4YAVA 1M9AA 4O5QA 1SKWB 2AAWA 1FG4A 3RBTA 2CVDA 1EWXA 2VO4A 1GTBA 2B1KA 1PGTA 1XIYA 1EOGA 4POMA 2O85A 1UVZA 1AIUA 3KCMA 3QAWA 4EDYA 1TJDA 4GRFA 2HFDA 1R5AA 5ECLB 5DALB 2GQMA 2TRCP 3WGDA 3C73A 2ON5A 2GVPA 3HYPA 4O32A 2L57A 1JHBA 4AKXB 5LD0A 4O7HA 3E0UA 4E8HA 1YF1A 3ISOA 5A34B 4KCEA 3Q74A 2MYGA 2M80A 4CDOA 4YQUA 3ME8A 1VF2A 2JACA 2LNTA 3GKNA 2KOKA 2MBSA 2C0GA 3F4TA 1PD21 1EZKA 1WRYA 1N25A 2YWNA 4BIKA 3QAGA 1U87A 3RDWA 4KSOA 1TU7A 1H4OA 3IK9A 5ID2B 3GSSA 1AW9A 3IV4A 4GQFA 5DCGA 2BMXA 3F3QA 3LORA 4V2MA 2XPDA 1TTZA 1I9DA 2DIZA 3MAKA 2LTKA 4WBJA 4J57E 1BJXA 4ZBAA 12GSA 3P2AA 1A0RP 3RAZA 5ECRB 4LA1A 3MIXA 5CYYA 2H70A 3F63A 5HFGA 4KDXA 4PQIA 4MZBA 6GSUA 1PQNA 1Z5YE 5DJMA 2FA8A 1MDKA 2LUSA 4IP6A 4POKA 4HJ2A 3GSTA 1XWBA 2XBIA 2P31A 1X5CA 2PGTA 4G01A 2XC2A 4QQ7A 3IAM2 2HSHA 4N3ZA 2WVYA 1FAAA 5F05A 1FVJA 3HZ4A 2UZ8A 2H71A 3LXZA 3CBUA 5D8IA 2CT6A 1EP7A 4FYCA 5A5HA 4F0CA 3GFKA 1XWAA 5CREA 2RIIA 2A4HA 2PVQA 2LEGA 2B5YA 3BBYA 4PXOA 4KF9A 3LW9A 3G7YA 19GSA 4ISDA 4IELA 1EP8A 1OE8A 2E2MA 1SJZA 1JLVA 2LRNA 1CQHA 4ECJA 3W8JA 2FNOA 3VPQA 5B8AA 4PQHA 2DJ1A 2X49A 3BCIA 2LQQA 1GSYA 1DSBA 1R5PA 1XZOA 1JZRA 2HRAA 5L71A 4LMVA 2LQOA 4HOJA 3GHAA 3M0FA 5C04A 1TKDB 2DKHA 3KM6A 3GMFA 2MMZA 2WJUA 4KB3A 4GCIA 5ECIB 4NHZA 4LLRA 5HQPA 2VKZG 2OE0A 5EPFA 4G19A 1FVKA 1WPIA 3ZVJA 4G0KA 2VD1A 3IA1A
chains in the Genus database with same CATH topology
3FEUA 1ML6A 5J4VA 2OA7A 5HR3A 3W8SA 1USBA 2IL3A 1M2BA 1YY7A 1V40A 3QAVA 2QGVA 3BCKA 3F9UA 4BL7B 1ZL9A 4ECBA 3Q6OA 3O6TA 2JU5A 3D22A 1A8YA 3SBCA 1IYHA 4ZL8A 3TKQA 1PL1A 1N8JA 3CRTA 2JSYA 5DCHA 3EMPA 2H1LA 1XVQA 1ON4A 5IMDA 2E0QA 4MJCA 1OC9A 2NVLA 5IMVA 4ZL7A 4KX4A 2YJ7A 2GZZA 3F0IA 4PNGA 2FUG2 2KP1A 4NXIA 4G9HA 4YQVA 2H0GA 3DXBA 3FZAA 1Z6NA 5GAND 2GZYA 1R7HA 2WZ9A 1TI3A 1YQ1A 2PPTA 5IIZA 3VWUA 3GTUB 4DSSB 1YF0A 2ZUPA 1TXUA 2L5OA 2D2ZA 2H73A 5J47A 4EKZA 5JWOB 3QPMA 1ILOA 5D9XA 3MWHA 5B6NA 5IOXA 3UEMA 2YJHA 4BWSA 4F03A 3QFBC 2C80A 1GNWA 3C8EA 1ERTA 2HSYA 2K9FA 2LJKA 3TJBA 1KBNA 1MD4A 4W66A 3L9UA 2PERA 3FR9A 1VRSD 1TRSA 1TRUA 2NDOA 1Y6EA 1GLQA 2IFQA 2CVBA 3CMIA 2WGRA 3EU3A 1MDIA 2LJRA 5J41A 2GT6A 1AQXA 3KMNA 1HNBA 5ECKB 4NHWA 2VAFA 3CWGA 2O87A 4JR6A 2EIOA 1PMTA 3FZ5A 4L0WA 1K3OA 1CQGA 3EMXA 2C0FA 2CX4A 1K0CA 2QSIA 3QDNA 2HQTA 1QFNA 1Z7RA 22GSA 2R6KA 1GSDA 2H72A 4KA0A 1GULA 2YPMA 2P5RA 1A2JA 1JZWA 3BOAA 2WRTA 5BMUA 2HE3A 2F9SA 3TJFA 1GH2A 4MJAA 4TRXA 1AUCA 4N30A 1S3DA 4OO5A 1XW6A 2ALBA 1VF3A 4RUVA 2H01A 6GSXA 1BG1A 4EIQA 3W6GA 5G30A 1N2AA 2L5LA 4XS6A 2IWTA 2HYXA 1PA3A 1YEPA 3LFLA 3QOUA 4G0LA 3TKSC 5A1NA 2I9HA 4AKHA 2CA8A 2OACA 2FY6A 4HS1A 4K8MA 3ERGA 4KH7A 2KP2A 1GTAA 1FW1A 2OADA 2FD3A 3VK9A 3PR8A 2VL2C 2DJ0A 1PSQA 3HCZA 1ERUA 1XW5A 1QXHA 4AJ6A 2A2PA 1GRXA 1SVOA 4O5RA 3LYPA 1GP1A 1M2AA 3IXRA 3ZLPA 1U88A 2YZHA 2YANA 2UV8G 3I6AA 4F0BA 1W4VA 1ZYQB 2CV4A 3NOFA 1Z9HA 3C71A 1K0BA 4EE0A 4TN8A 2LRCA 3L9VA 2L4QA 3GX8A 3L4NA 18GSA 2GS3A 3CSHA 3KP8A 3M9JA 3HJMA 2YV7A 3H4KA 3F8UA 3HY2A 2NTOA 2VCTA 3J7Yk 3DEXA 2G2QA 1X9WB 3D6IA 3TUEA 5JCUA 2O8VB 5ECOB 4MP4A 1SVMA 4IKHA 3H8QA 5BMUB 4ZILA 3UJ1A 5DBQA 4K0NA 3GH9A 2VCWA 5IOWA 2K8SA 3M9KA 2VCQA 3D5JA 2DMMA 3FZ4A 4MCUA 1XOAA 4JZQA 3R2QA 1ST9A 3VPTA 2GZPA 1PKWA 1NM3A 2EFDA 2XPEA 2LJAA 2F8FA 3WT2A 4OFTA 2HNLA 2H1BA 1THXA 4V1Ag 3ERFA 2H6XA 1S3CA 3IAS2 4CY6A 2I81A 4QMKA 2I1UA 2J23A 1E2YA 3TRQA 2A2RA 2DC5A 4MF6A 2C0DA 1SK2A 2Z9SA 4KNDA 3G7IA 1DE1A 3GKKA 3ZYWA 1EV4A 5EL8A 1IYIA 1K0OA 2OJLA 1G6WA 5INYA 4TXOA 3TDGA 4TVEA 4KDYA 2ZNMA 3ZZXA 4L5LA 4POLA 3TKRA 4RQRA 4YH2A 1FOVA 4BWQA 3HXSA 4IJIA 2V41A 3KD0A 4ML6A 3UOMA 5A4VA 1SYRA 3C1RA 3DGQA 3PPUA 4XCSA 2G0FA 3I69A 1I5GA 4ILFA 4ECCA 1BG5A 5A4WA 4FYBA 1M0UA 4HQSA 4GXZA 3CSJA 2REMA 3N9JA 2F51A 3ZFBA 4TR0A 4XS4A 8GSSA 4E8EA 3IDVA 3M3MA 3HDCA 4K5RA 1QK8A 2GSQA 2HZEA 4N11A 1RW1A 4HZ2A 3OR5A 4KSMA 4MZWA 5FHIA 1T4YA 4LL4B 1F2EA 5EY6A 5KN1A 1GTIA 3KJYA 1OE7A 4OCFA 1SL2B 1V58A 3LEFA 5IPHA 1TRVA 1NHYA 2TRXA 3P90A 3HVVA 4XS1A 1GLPA 4EC0A 2H0HA 4KCAA 1E6BA 4IQ1A 5LNKe 1ZMAA 4BVXB 4WF5A 1UA5A 3HKRA 1Q98A 2FWFA 1VGLA 1YKAA 5J5NA 3CXGA 4AGSA 3RPNA 2V1MA 3CTFA 4HUAA 2EFEA 3TOTA 2AYTA 5LCZA 1XBSA 1SVLA 1F3BA 2VL3A 4MK3A 3FHKA 1EGRA 3UIWA 3EU4A 1TDIA 2AHEA 4A5PA 3IC8A 3BD2A 5D93A 1SU9A 1K0AA 3TKSE 3TKSA 2LKUA 3F6FA 3TRPA 5JCGA 3CRUA 3KMOA 2YOIA 4IN0A 1KEBA 2EIRA 4WBRD 1A24A 3MSZA 4MABA 4YKGA 5ECNB 1ZYPA 2HRNA 2RLIA 1ZOFA 2VL2A 2DJ3A 5B7CA 5GSTA 4HU7A 4ZB7A 3KIJA 1FB0A 3EE2A 1O81A 4ZIJA 1XVWA 1TK5B 3R3EA 5ELGA 3CTGA 4V2NA 3Q18A 1SD9A 1FO5A 1SL0B 5IMZA 3FZ9A 2GTUA 2V6KA 4AF2A 2GGTA 2IN3A 5F8BA 1YKCA 3BJ5A 2P0GA 4ECIA 2HXKA 2IMFA 4USSA 2C3QA 2L4CA 4P3YB 5ECHB 4PUAA 2MMOA 5FT3A 1VF4A 2H1GA 4Z7XA 1AXDA 3MNGA 4HZ4A 1S3AA 5JWQB 2QA1A 1X9MB 2QA2A 4MZCA 4ZBBA 1OAZA 3LQ7A 1GUKA 4X1UA 1EGOA 3D0ZA 1XCCA 4FYUA 1SKSB 2EFHA 5J40A 1HNAA 5ECMB 16GSA 1TOFA 2VM2A 5DJLA 1V98A 4HI7A 1GSQA 1AAZA 4DSRA 3WD6A 5G5EA 2FWHA 2YWOA 3WGEA 4N0ZA 3MDKA 2HT9A 4RI6A 2EIQA 1JLWA 4PGTA 2PVOC 5CO3A 4O5UA 3GV1A 3D4TA 3EYTA 4TR1A 2EFCA 1TXXA 2C1YA 2DKIA 4WF4A 3DD3A 4JU5A 5A5HB 4L8EA 3GNJA 2L6DA 1ABAA 2AV4A 14GSA 4TW5A 3QFAC 5BRTA 4K2XA 4ML1A 4CW9A 4EVMA 7GSSA 4PTSA 1J08A 4F2IA 4YQMA 4ID0A 4LL1B 3LJRA 3HVXA 4PUFC 2HI7A 3EC3A 1SJIA 3ZITA 2DJ2A 5D9VA 1K0NA 2HSNA 3GUSA 1Z3EA 4ZB9A 5DDLA 3QR6A 1XFLA 3K8NA 2GSRA 4POBA 4WR5A 2O5VA 2VD0A 2VLUA 4Q5FA 5DVBA 4I97A 3C1SA 1ZYNA 3E9JB 3MYDA 1ERVA 2VCVA 2FWEA 3TRXA 1Q4JA 2CZ3A 2DJKA 2X4AA 2LRTA 2IPAA 3ZTLA 4TR3A 5AN1A 3IHGA 4K7OA 2DMLA 5B8BA 3HA9A 4XHMA 2DBCA 4ZB6A 2HSMA 4I5QA 4AJ7A 2H74A 4HDEA 2FCHA 1TP9A 5F0GA 4GDFA 4KAEA 2B7JA 1O7UA 2N5AA 3G9BA 5G31A 1H75A 3GL5A 2FGXA 2B7KA 5ENUA 3U5RE 3FR3A 3P8WA 2WDUA 3I43A 4NMUA 2VCXA 1BQ7A 4JRRA 1PN0A 1X9SB 1WMJA 5HR1A 4E68A 2B3SA 5E59A 4J56E 2DIYA 2HZFA 4EO3A 2N5BA 3IE3A 3TGZA 5COHA 3GKMA 2VCZA 4MLYA 5KN0A 4ZXGA 1OC9B 1SJ6A 4XIHA 2GQKA 4Z2RA 3VURA 1JZOA 2E2GA 3U6VA 1W89A 4EL1A 3KH7A 3F6DA 2M72A 1KTEA 3D4MA 3KTBA 1HD2A 2KLXA 2WB9A 2YP6A 1ZCPA 5E4WA 5G1LA 3FK8A 3LXTA 2LV3A 4L5OA 1GUMA 1O85A 1PKZA 5IQYA 1AQWA 1G0TA 4K9ZA 2JADA 1F37A 4EIPA 2RM6A 5IMCA 1RK4A 1BYEA 1OYJA 4EXJA 5F06A 1YEXA 3V1WA 3J7Yb 1EEMA 2VOCA 4X4JA 5J4UA 4N10A 1OVNA 2V32A 1WP0A 2YV9A 1LJRA 2WFCA 2YNXA 2XBQA 3F3RA 3APQA 3JCML 2B5XA 4FQUA 3DMLA 2B6MA 1OKTA 5FWGA 4GSSA 4WETA 6GSYA 3O76A 2KHPA 5C00A 5J4YA 1XXUA 3L9SA 4JR4A 3NZNA 4J2FA 1SK1A 3GH6A 2IFQB 1J0FA 1EOHA 1XOBA 4X0XA 4DSQA 1BX9A 1G6YA 3EWLA 2IMDA 3A2WA 3VI7A 2M46A 3LG6A 1QMVA 3HHVA 1ZGNA 2H19A 3ZIVA 2RM5A 3LGCA 3ZIJA 1UN2A 1ZYEA 3IHQA 3TJGA 5DALA 2K8VA 3HMJG 5J9BA 4KE3A 1KNGA 3I9V2 3FY7A 1WWJA 3A5WA 1Z7PA 5ECSA 4Q5NA 3FMWA 2MMNA 3UVTA 1QQ2A 5A34A 3ZMKA 5G2ZA 3HD5A 2H76A 5J9CA 2OBIA 4MA9A 5HFKA 3H93A 5CRHA 4MPGA 3PGTA 3IC4A 3KXOA 1GSEA 2CQ9A 1PRXA 1GL8A 4ICYA 2MBTA 3EURA 2HRKA 1JFUA 5G1KA 2H1DA 4YAPA 4EUYA 3TJJA 3LYKA 2IIYA 4K7NA 5KN2A 4I2UA 4MH2A 3UARA 4DEJA 3ZL5A 4ZL9A 2AJQB 5A1NB 1O73A 1WJKA 3APOA 3HVSA 4YKFA 3RHCA 4MF7A 3UVHA 4WXTA 3FW2A 4CY8A 1DE2A 1GSUA 4AI6A 4XRAA 2RUEA 2YWMA 1FB6A 3KTLA 3RPPA 2X64A 4BVYA 3APSA 2PU9C 5KEJA 4IQAA 3KEBA 3QD9A 3QCPA 2J9HA 1M9BA 3TOUA 2BTOT 3PH9A 2H6YA 3ME7A 2AUVA 1O8XA 4K1FA 3CYNA 5ELAA 3FKFA 3HZ8A 2C8UA 4DVCA 4KUNA 1SK0A 4ZB8A 5IO0A 2N5FA 1B9XC 4IBPA 3WYWA 1TRWA 3VI5A 3IOSA 4QL7A 4XRDA 4AJ8A 2F8AA 2C3NA 1SL1B 5IMFA 2CZ2A 2WULA 4IVFA 3UAPA 2GSTA 4K2DA 3DIEA 1A0FA 3ZREA 4KGIA 1AQVA 1SENA 2O89A 1K3YA 5DQSA 4F9ZA 1JZDA 1BAYA 3GA4A 1ERWA 4KDUA 2V6OA 2R3XA 2H8LA 4NV2A 1EEJA 2VIMA 1WIKA 3H1NA 1WE0A 2YCDA 2E7PA 3L0HA 4RI7A 2HRKB 2BJXA 1Z6MA 2X8HA 2H6ZA 2VLVA 1XWCA 4JE1A 5J3RA 4TOPA 1U3IA 3UL3A 2GQLA 2LNSA 3QMXA 1URMA 4GSNA 4K6XA 1M7TA 4MJBA 3UMAA 1B48A 5G5FA 2ES7A 5IPGA 1TU8A 1Y1UA 1OKDA 5GAPD 2NPBA 1O6JA 4K0GA 4MH3A 1NHOA 4IGJA 4OCEA 1T00A 5D96A 2KUCA 2OBKA 4MMMA 4NWYA 3ED3A 1GTUA 4TXOB 4I2TA 1FOHA 4PNFA 5HR0A 4BVYB 2TIRA 5IM9A 4EF0A 4G2EA 4HQZA 1K3LA 3VWVA 3N5OA 2I4AA 3ZRDA 2GDRA 4AKGA 4IW9A 3UBLA 2XHFA 4WEYA 3KP9A 1G7EA 3ZMLA 1QUWA 2R0GA 5CNWA 2K18A 4BL7A 1X5DA 5KOWA 4HU9A 2ON7A 1XW9A 2I3YA 5KN3A 1TW9A 4KW6A 5HFIA 2PBJA 5D73A 3EVIA 4TKYA 3GKXA 1PX7A 4XS4B 5D9TA 4IHUA 3A2XA 2EC4A 2IMKA 2V2GA 2MMAA 1O8WA 2IJYA 5H5RA 5ECQB 3SWLA 2HZEB 4MF5A 4ACSA 5JCWA 11GSA 2OT3A 1B8XA 2B1LA 5H5QA 1PL2A 4K7IA 3GIXA 3A3TA 3PINA 2RUFA 3FYGA 3TJKA 3CSIA 1GNEA 4K5SA 2VM1A 2R0PA 1X0RA 3FR6A 1G7OA 3EINA 2C3TA 4HJMA 4G10A 2ZCTA 2C0EA 1GWCA 2IMIA 3TCOA 3KGKA 1GUHA 2X8CA 4EDZA 4MDCA 1HQOA 2AB6A 2HLSA 3GTUA 3HJOA 1MDJA 1UC7A 1T1VA 4DSSA 5ABRA 3S9FA 4XTSA 4D73A 3US3A 1DBYA 3DVXA 4PQ1A 2DJJA 3ERWA 1F6MC 2H0IA 3DWVA 5ECPB 2VL9A 2B5EA 4GWRA 4Q5RA 2JZTA 2L6CA 2OE1A 2R0CA 1VF1A 1YVLA 4ULXA 5DAKA 5F07A 4BA7A 1OC8A 3ZVJD 5CRWA 4Z2TA 2DLXA 3F4SA 2DSAA 1B9YC 3VLNA 2FA4A 4IJ3A 3GURA 4V1Ap 6GSVA 3M1GA 2FLSA 1C72A 2JZRA 2NBSA 2JSZA 5CRGA 1K0MA 5AISA 6GSWA 1BF5A 5AIVA 3E3EA 2MZCA 5CP1A 3H79A 4GLTA 1A2MA 2H1AA 4NAXA 4FO5A 1NSWA 1TK0B 5JWRB 10GSA 2K6VA 4NPBA 1T7PB 1ACVA 1J9BA 4QL9A 3IBHA 4PX1A 1T4ZA 3KH9A 4RQXA 3L78A 3D21A 2LSTA 4TR4A 5D9WA 4D73B 1YDKA 4OD7A 4HEA2 1M2DA 4JEDA 4OO4A 2IMEA 4I6XA 5CRDA 4WKWA 1GSSA 2GLRA 3WGXA 1R4WA 1U6TA 3IPZA 2C4JA 2X8GA 4GSTA 1V9WA 1XWKA 4TR1B 1K0DA 5HR2A 1EV9A 5DAKB 3TB2A 1U3AA 2CAQA 1ZZYA 13GSA 9GSSA 4FH8A 2WS2A 1MTCA 2YZUA 4TXVA 6GSSA 1BEDA 3DKSA 3IR4A 3M8NA 4IP1A 3KZQA 4OWYA 2H30A 4MJEA 5CAXA 4WR4A 3GL3A 4NV5A 4OFMA 2CAIA 5AIXA 1V57A 5IMAA 3GYKA 1MD3A 4MPFA 2JL4A 1PX6A 4OFNA 3IK7A 3C7MA 4LMWA 2HSNB 1MEKA 5EVOA 4L0UA 4O92A 2LS5A 1HYUA 2VLTA 1WOUA 4N0VA 3UBKA 2CX3A 3HJPA 3A5IA 17GSA 1F9MA 2H75A 3GN3A 3AY8A 3WT1A 1A2LA 3GX0A 1FHEA 1Y25A 2L59A 1PN9A 3TKPA 1RQMA 5H5SA 4MNNA 1X5EA 3DYRA 1GSFA 3EPTA 2HSMB 1SD8A 2R2JA 2OKAA 3VWWA 1A23A 1M99A 4IS0A 5A4UA 1V2AA 3ZFLA 4ZBDA 2A4VA 2R37A 3DRNA 2YN1A 2OE3A 2YWIA 1SKRB 2F3MA 4PURA 1LBKA 2JZSA 2R4VA 1TK8B 2QKEA 4GF0A 1NW2A 2A2SA 2R5GA 4X43A 5GZZB 2GSSA 1B4PA 3RHBA 2PMTA 4Q5QA 2PUKC 6GSTA 4GQCA 3F4RA 5GSSA 3O3TA 2FHEA 1YJ6A 1A8LA 1HNCA 5IO2A 4OMVA 2GT5A 2P5QA 4GTUA 5AGYA 4CHSA 3Q19A 2PN8A 1XPVA 1F3AA 3P7XA 3A2VA 2CVKA 4JBBA 1T3BA 1AC1A 3FRCA 2VUPA 3LSZA 4BPYA 1XWGA 2PWJA 4FIWA 4H86A 5ID2A 4AKIA 1YZXA 3VFIA 3NIVA 20GSA 4V2LA 3DVWA 5B6MA 4Z2UA 3TU3B 3GRXA 4I8BA 4G0IA 1B4QA 3G7JA 5A5KA 2FWGA 1T8EB 4BVXA 2WCIA 2HRFA 1TI1A 1QGVA 2QC7A 1DUGA 5DQYA 1LU4A 1THOA 1SYXA 2X99A 1OC3A 3IRAA 1R26A 3VWXA 4F82A 3LWAA 5KOXA 2H66A 2O7KA 4YAVA 1M9AA 4O5QA 1SKWB 2AAWA 1FG4A 3RBTA 2CVDA 1EWXA 2VO4A 1GTBA 2B1KA 1PGTA 1XIYA 1EOGA 4POMA 2O85A 1UVZA 1AIUA 3KCMA 3QAWA 4EDYA 1TJDA 4GRFA 2HFDA 1R5AA 5ECLB 5DALB 2GQMA 2TRCP 3WGDA 3C73A 2ON5A 2GVPA 3HYPA 4O32A 2L57A 1JHBA 4AKXB 5LD0A 4O7HA 3E0UA 4E8HA 1YF1A 3ISOA 5A34B 4KCEA 3Q74A 2MYGA 2M80A 4CDOA 4YQUA 3ME8A 1VF2A 2JACA 2LNTA 3GKNA 2KOKA 2MBSA 2C0GA 3F4TA 1PD21 1EZKA 1WRYA 1N25A 2YWNA 3QAGA 1U87A 3RDWA 4KSOA 1TU7A 1H4OA 3IK9A 5ID2B 3GSSA 1AW9A 3IV4A 4GQFA 5DCGA 2BMXA 3F3QA 3LORA 4V2MA 2XPDA 1TTZA 1I9DA 2DIZA 3MAKA 2LTKA 4WBJA 4J57E 1BJXA 4ZBAA 12GSA 3P2AA 1A0RP 3RAZA 5ECRB 4LA1A 3MIXA 5CYYA 2H70A 3F63A 5HFGA 4KDXA 4PQIA 4MZBA 6GSUA 1PQNA 1Z5YE 5DJMA 2FA8A 1MDKA 2LUSA 4IP6A 4POKA 4HJ2A 3GSTA 1XWBA 2XBIA 2P31A 1X5CA 2PGTA 4G01A 2XC2A 4QQ7A 3IAM2 2HSHA 4N3ZA 1FAAA 5F05A 1FVJA 3HZ4A 2UZ8A 2H71A 3LXZA 3CBUA 5D8IA 2CT6A 1EP7A 4FYCA 5A5HA 4F0CA 3GFKA 1XWAA 5CREA 2RIIA 2A4HA 2PVQA 2LEGA 2B5YA 3BBYA 4PXOA 4KF9A 3LW9A 3G7YA 19GSA 4ISDA 4IELA 1EP8A 1OE8A 2E2MA 1SJZA 1JLVA 2LRNA 1CQHA 4ECJA 3W8JA 2FNOA 3VPQA 5B8AA 4PQHA 2DJ1A 2X49A 3BCIA 2LQQA 1GSYA 1DSBA 1R5PA 1XZOA 1JZRA 2HRAA 5L71A 4LMVA 2LQOA 4HOJA 3GHAA 3M0FA 5C04A 1TKDB 2DKHA 3KM6A 3GMFA 2MMZA 2WJUA 4KB3A 4GCIA 5ECIB 4NHZA 4LLRA 5HQPA 2VKZG 2OE0A 5EPFA 4G19A 1FVKA 1WPIA 3ZVJA 4G0KA 2VD1A 3IA1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FEU A;  1ML6 A;  2OA7 A;  5HR3 A;  3W8S A;  1USB A;  2IL3 A;  1M2B A;  1YY7 A;  1V40 A;  3QAV A;  2QGV A;  3BCK A;  3F9U A;  4BL7 B;  1ZL9 A;  4ECB A;  3Q6O A;  3O6T A;  2JU5 A;  3D22 A;  1A8Y A;  3SBC A;  1IYH A;  4ZL8 A;  3TKQ A;  1PL1 A;  1N8J A;  3CRT A;  2JSY A;  5DCH A;  3EMP A;  1XVQ A;  1ON4 A;  5IMD A;  2E0Q A;  4MJC A;  1OC9 A;  2NVL A;  5IMV A;  4ZL7 A;  4KX4 A;  2YJ7 A;  2GZZ A;  3F0I A;  4PNG A;  2FUG 2;  2KP1 A;  4NXI A;  4G9H A;  4YQV A;  2H0G A;  3DXB A;  3FZA A;  1Z6N A;  5GAN D;  2GZY A;  1R7H A;  2WZ9 A;  1TI3 A;  1YQ1 A;  2PPT A;  5IIZ A;  3VWU A;  3GTU B;  4DSS B;  1YF0 A;  2ZUP A;  2L5O A;  2D2Z A;  2H73 A;  4EKZ A;  5JWO B;  3QPM A;  1ILO A;  5D9X A;  3MWH A;  5B6N A;  5IOX A;  3UEM A;  2YJH A;  4BWS A;  4F03 A;  3QFB C;  2C80 A;  1GNW A;  3C8E A;  1ERT A;  2HSY A;  2K9F A;  2LJK A;  3TJB A;  1KBN A;  1MD4 A;  3L9U A;  2PER A;  3FR9 A;  1VRS D;  1TRS A;  1TRU A;  2NDO A;  1Y6E A;  1GLQ A;  2IFQ A;  2CVB A;  3CMI A;  2WGR A;  3EU3 A;  1MDI A;  2LJR A;  5J41 A;  2GT6 A;  1AQX A;  3KMN A;  1HNB A;  5ECK B;  4NHW A;  2VAF A;  2O87 A;  4JR6 A;  2EIO A;  1PMT A;  3FZ5 A;  4L0W A;  1K3O A;  1CQG A;  3EMX A;  2C0F A;  2CX4 A;  1K0C A;  2QSI A;  3QDN A;  2HQT A;  1QFN A;  1Z7R A;  22GS A;  2R6K A;  1GSD A;  2H72 A;  4KA0 A;  1GUL A;  2YPM A;  2P5R A;  1A2J A;  1JZW A;  3BOA A;  2WRT A;  5BMU A;  2HE3 A;  2F9S A;  3TJF A;  1GH2 A;  4MJA A;  4TRX A;  1AUC A;  4N30 A;  1S3D A;  4OO5 A;  1XW6 A;  2ALB A;  1VF3 A;  4RUV A;  2H01 A;  6GSX A;  3W6G A;  5G30 A;  1N2A A;  2L5L A;  4XS6 A;  2IWT A;  2HYX A;  1PA3 A;  1YEP A;  3LFL A;  3QOU A;  4G0L A;  3TKS C;  2I9H A;  2CA8 A;  2OAC A;  2FY6 A;  4HS1 A;  4K8M A;  3ERG A;  4KH7 A;  2KP2 A;  1GTA A;  1FW1 A;  2OAD A;  2FD3 A;  3VK9 A;  3PR8 A;  2VL2 C;  2DJ0 A;  1PSQ A;  3HCZ A;  1ERU A;  1XW5 A;  1QXH A;  4AJ6 A;  1GRX A;  4O5R A;  3LYP A;  1GP1 A;  1M2A A;  3IXR A;  3ZLP A;  1U88 A;  2YZH A;  2YAN A;  3I6A A;  4F0B A;  1W4V A;  1ZYQ B;  2CV4 A;  3NOF A;  1Z9H A;  3C71 A;  1K0B A;  4EE0 A;  4TN8 A;  2LRC A;  3L9V A;  2L4Q A;  3GX8 A;  3L4N A;  18GS A;  2GS3 A;  3CSH A;  3KP8 A;  3M9J A;  3HJM A;  2YV7 A;  3H4K A;  3F8U A;  3HY2 A;  2NTO A;  2VCT A;  3J7Y k;  3DEX A;  2G2Q A;  1X9W B;  3D6I A;  3TUE A;  5JCU A;  2O8V B;  5ECO B;  4MP4 A;  4IKH A;  3H8Q A;  4ZIL A;  3UJ1 A;  5DBQ A;  4K0N A;  3GH9 A;  2VCW A;  5IOW A;  2K8S A;  3M9K A;  2VCQ A;  3D5J A;  2DMM A;  3FZ4 A;  4MCU A;  1XOA A;  4JZQ A;  3R2Q A;  1ST9 A;  3VPT A;  2GZP A;  1PKW A;  1NM3 A;  2XPE A;  2LJA A;  2F8F A;  3WT2 A;  4OFT A;  2HNL A;  2H1B A;  1THX A;  4V1A g;  3ERF A;  2H6X A;  1S3C A;  3IAS 2;  2I81 A;  2I1U A;  2J23 A;  1E2Y A;  3TRQ A;  2A2R A;  2DC5 A;  4MF6 A;  2C0D A;  1SK2 A;  2Z9S A;  4KND A;  3G7I A;  1DE1 A;  3GKK A;  3ZYW A;  1EV4 A;  5EL8 A;  1IYI A;  1K0O A;  2OJL A;  1G6W A;  5INY A;  4TXO A;  3TDG A;  4TVE A;  4KDY A;  2ZNM A;  3ZZX A;  4L5L A;  4POL A;  3TKR A;  4RQR A;  4YH2 A;  1FOV A;  4BWQ A;  3HXS A;  4IJI A;  2V41 A;  3KD0 A;  4ML6 A;  3UOM A;  5A4V A;  1SYR A;  3C1R A;  3DGQ A;  3PPU A;  4XCS A;  2G0F A;  3I69 A;  1I5G A;  4ILF A;  4ECC A;  1BG5 A;  5A4W A;  4FYB A;  1M0U A;  4HQS A;  4GXZ A;  3CSJ A;  2REM A;  3N9J A;  2F51 A;  3ZFB A;  4TR0 A;  4XS4 A;  8GSS A;  4E8E A;  3IDV A;  3M3M A;  3HDC A;  1QK8 A;  2GSQ A;  2HZE A;  4N11 A;  1RW1 A;  4HZ2 A;  3OR5 A;  4KSM A;  4MZW A;  5FHI A;  1T4Y A;  4LL4 B;  1F2E A;  5EY6 A;  5KN1 A;  1GTI A;  3KJY A;  1OE7 A;  4OCF A;  1SL2 B;  1V58 A;  3LEF A;  5IPH A;  1TRV A;  1NHY A;  2TRX A;  3P90 A;  3HVV A;  4XS1 A;  1GLP A;  4EC0 A;  2H0H A;  4KCA A;  1E6B A;  4IQ1 A;  5LNK e;  1ZMA A;  4BVX B;  4WF5 A;  1UA5 A;  3HKR A;  1Q98 A;  2FWF A;  1VGL A;  1YKA A;  5J5N A;  3CXG A;  4AGS A;  3RPN A;  2V1M A;  3CTF A;  4HUA A;  3TOT A;  2AYT A;  5LCZ A;  1XBS A;  1F3B A;  2VL3 A;  4MK3 A;  3FHK A;  1EGR A;  3UIW A;  3EU4 A;  1TDI A;  2AHE A;  3IC8 A;  3BD2 A;  5D93 A;  1SU9 A;  1K0A A;  3TKS E;  3TKS A;  2LKU A;  3F6F A;  3TRP A;  5JCG A;  3CRU A;  3KMO A;  2YOI A;  4IN0 A;  1KEB A;  2EIR A;  4WBR D;  1A24 A;  3MSZ A;  4MAB A;  5ECN B;  2HRN A;  2RLI A;  1ZOF A;  2VL2 A;  2DJ3 A;  5B7C A;  5GST A;  4HU7 A;  3KIJ A;  1FB0 A;  3EE2 A;  1O81 A;  4ZIJ A;  1XVW A;  1TK5 B;  3R3E A;  5ELG A;  3CTG A;  4V2N A;  3Q18 A;  1SD9 A;  1FO5 A;  1SL0 B;  5IMZ A;  3FZ9 A;  2GTU A;  2V6K A;  4AF2 A;  2GGT A;  2IN3 A;  5F8B A;  1YKC A;  3BJ5 A;  2P0G A;  4ECI A;  2HXK A;  2IMF A;  4USS A;  2C3Q A;  2L4C A;  4P3Y B;  5ECH B;  4PUA A;  2MMO A;  5FT3 A;  1VF4 A;  2H1G A;  4Z7X A;  1AXD A;  3MNG A;  4HZ4 A;  1S3A A;  5JWQ B;  1X9M B;  4MZC A;  4ZBB A;  1OAZ A;  3LQ7 A;  1GUK A;  4X1U A;  1EGO A;  3D0Z A;  1XCC A;  4FYU A;  1SKS B;  1HNA A;  5ECM B;  16GS A;  1TOF A;  2VM2 A;  5DJL A;  1V98 A;  4HI7 A;  1GSQ A;  1AAZ A;  4DSR A;  3WD6 A;  5G5E A;  2FWH A;  2YWO A;  3WGE A;  4N0Z A;  3MDK A;  2HT9 A;  4RI6 A;  2EIQ A;  1JLW A;  4PGT A;  2PVO C;  5CO3 A;  3GV1 A;  3D4T A;  3EYT A;  4TR1 A;  1TXX A;  2C1Y A;  4WF4 A;  3DD3 A;  4JU5 A;  4L8E A;  3GNJ A;  2L6D A;  1ABA A;  2AV4 A;  14GS A;  4TW5 A;  3QFA C;  4ML1 A;  4CW9 A;  4EVM A;  7GSS A;  4PTS A;  1J08 A;  4F2I A;  4YQM A;  4ID0 A;  4LL1 B;  3LJR A;  3HVX A;  4PUF C;  2HI7 A;  3EC3 A;  1SJI A;  3ZIT A;  2DJ2 A;  5D9V A;  1K0N A;  3GUS A;  1Z3E A;  4ZB9 A;  5DDL A;  3QR6 A;  1XFL A;  3K8N A;  2GSR A;  4POB A;  4WR5 A;  2VD0 A;  2VLU A;  5DVB A;  4Q5F A;  4I97 A;  3C1S A;  3E9J B;  1ERV A;  2VCV A;  2FWE A;  3TRX A;  1Q4J A;  2CZ3 A;  2DJK A;  2LRT A;  2IPA A;  3ZTL A;  4TR3 A;  5AN1 A;  5B8B A;  4K7O A;  2DML A;  3HA9 A;  4XHM A;  2DBC A;  4ZB6 A;  2HSM A;  4I5Q A;  4AJ7 A;  2H74 A;  4HDE A;  2FCH A;  1TP9 A;  5F0G A;  4KAE A;  2B7J A;  1O7U A;  2N5A A;  3G9B A;  5G31 A;  1H75 A;  3GL5 A;  2FGX A;  2B7K A;  5ENU A;  3U5R E;  3FR3 A;  3P8W A;  2WDU A;  3I43 A;  4NMU A;  2VCX A;  1BQ7 A;  4JRR A;  1X9S B;  1WMJ A;  5HR1 A;  2B3S A;  5E59 A;  4J56 E;  2DIY A;  2HZF A;  4EO3 A;  2N5B A;  3IE3 A;  3TGZ A;  5COH A;  3GKM A;  2VCZ A;  4MLY A;  5KN0 A;  4ZXG A;  1OC9 B;  1SJ6 A;  4XIH A;  2GQK A;  3VUR A;  1JZO A;  2E2G A;  3U6V A;  1W89 A;  4EL1 A;  3KH7 A;  3F6D A;  2M72 A;  1KTE A;  3D4M A;  3KTB A;  1HD2 A;  2KLX A;  2WB9 A;  2YP6 A;  1ZCP A;  5E4W A;  5G1L A;  3FK8 A;  3LXT A;  2LV3 A;  4L5O A;  1GUM A;  1O85 A;  1PKZ A;  5IQY A;  1AQW A;  1G0T A;  4K9Z A;  2JAD A;  1F37 A;  2RM6 A;  5IMC A;  1RK4 A;  1BYE A;  1OYJ A;  4EXJ A;  5F06 A;  1YEX A;  3V1W A;  3J7Y b;  1EEM A;  2VOC A;  5J4U A;  4N10 A;  1OVN A;  2V32 A;  1WP0 A;  2YV9 A;  1LJR A;  2WFC A;  2YNX A;  2XBQ A;  3F3R A;  3APQ A;  3JCM L;  2B5X A;  4FQU A;  3DML A;  2B6M A;  1OKT A;  5FWG A;  4GSS A;  4WET A;  6GSY A;  3O76 A;  2KHP A;  5C00 A;  1XXU A;  3L9S A;  4JR4 A;  3NZN A;  4J2F A;  1SK1 A;  3GH6 A;  2IFQ B;  1J0F A;  1EOH A;  1XOB A;  4X0X A;  4DSQ A;  1BX9 A;  1G6Y A;  3EWL A;  2IMD A;  3A2W A;  3VI7 A;  2M46 A;  3LG6 A;  1QMV A;  3HHV A;  1ZGN A;  2H19 A;  3ZIV A;  2RM5 A;  3LGC A;  3ZIJ A;  1UN2 A;  1ZYE A;  3IHQ A;  3TJG A;  5DAL A;  2K8V A;  5J9B A;  4KE3 A;  1KNG A;  3I9V 2;  3FY7 A;  1WWJ A;  3A5W A;  1Z7P A;  5ECS A;  4Q5N A;  3UVT A;  2MMN A;  1QQ2 A;  3ZMK A;  5G2Z A;  3HD5 A;  2H76 A;  5J9C A;  2OBI A;  4MA9 A;  5HFK A;  3H93 A;  5CRH A;  4MPG A;  3PGT A;  3IC4 A;  3KXO A;  1GSE A;  2CQ9 A;  1PRX A;  1GL8 A;  2MBT A;  3EUR A;  2HRK A;  1JFU A;  5G1K A;  2H1D A;  4YAP A;  4EUY A;  3TJJ A;  3LYK A;  2IIY A;  4K7N A;  5KN2 A;  4I2U A;  4MH2 A;  3UAR A;  4DEJ A;  3ZL5 A;  4ZL9 A;  2AJQ B;  1O73 A;  1WJK A;  3APO A;  3HVS A;  3RHC A;  4MF7 A;  3UVH A;  4WXT A;  3FW2 A;  1DE2 A;  1GSU A;  4XRA A;  2RUE A;  2YWM A;  1FB6 A;  3KTL A;  3RPP A;  2X64 A;  4BVY A;  3APS A;  2PU9 C;  5KEJ A;  4IQA A;  3KEB A;  3QD9 A;  3QCP A;  2J9H A;  1M9B A;  3TOU A;  2BTO T;  3PH9 A;  2H6Y A;  3ME7 A;  2AUV A;  1O8X A;  4K1F A;  3CYN A;  5ELA A;  3FKF A;  3HZ8 A;  2C8U A;  4DVC A;  4KUN A;  1SK0 A;  4ZB8 A;  5IO0 A;  2N5F A;  1B9X C;  4IBP A;  3WYW A;  1TRW A;  3VI5 A;  3IOS A;  4QL7 A;  4XRD A;  4AJ8 A;  2F8A A;  2C3N A;  1SL1 B;  5IMF A;  2CZ2 A;  2WUL A;  4IVF A;  3UAP A;  2GST A;  4K2D A;  3DIE A;  1A0F A;  3ZRE A;  4KGI A;  1AQV A;  1SEN A;  2O89 A;  1K3Y A;  5DQS A;  4F9Z A;  1JZD A;  1BAY A;  3GA4 A;  1ERW A;  4KDU A;  2V6O A;  2R3X A;  2H8L A;  4NV2 A;  1EEJ A;  2VIM A;  1WIK A;  3H1N A;  1WE0 A;  2YCD A;  2E7P A;  3L0H A;  4RI7 A;  2HRK B;  2BJX A;  1Z6M A;  2X8H A;  2H6Z A;  2VLV A;  1XWC A;  4JE1 A;  5J3R A;  4TOP A;  1U3I A;  3UL3 A;  2GQL A;  2LNS A;  3QMX A;  1URM A;  4GSN A;  4K6X A;  1M7T A;  4MJB A;  3UMA A;  1B48 A;  5G5F A;  2ES7 A;  5IPG A;  1TU8 A;  1OKD A;  5GAP D;  2NPB A;  1O6J A;  4K0G A;  4MH3 A;  1NHO A;  4IGJ A;  4OCE A;  1T00 A;  5D96 A;  2KUC A;  2OBK A;  4MMM A;  4NWY A;  3ED3 A;  1GTU A;  4TXO B;  4I2T A;  4PNF A;  5HR0 A;  4BVY B;  2TIR A;  5IM9 A;  4EF0 A;  4G2E A;  4HQZ A;  1K3L A;  3VWV A;  3N5O A;  2I4A A;  3ZRD A;  2GDR A;  4IW9 A;  3UBL A;  2XHF A;  4WEY A;  3KP9 A;  1G7E A;  3ZML A;  1QUW A;  5CNW A;  2K18 A;  4BL7 A;  1X5D A;  4HU9 A;  2ON7 A;  1XW9 A;  2I3Y A;  5KN3 A;  1TW9 A;  4KW6 A;  5HFI A;  2PBJ A;  5D73 A;  3EVI A;  4TKY A;  3GKX A;  1PX7 A;  4XS4 B;  5D9T A;  4IHU A;  3A2X A;  2EC4 A;  2IMK A;  2V2G A;  2MMA A;  1O8W A;  2IJY A;  5H5R A;  5ECQ B;  3SWL A;  2HZE B;  4MF5 A;  4ACS A;  5JCW A;  11GS A;  1B8X A;  2B1L A;  5H5Q A;  1PL2 A;  4K7I A;  3GIX A;  3A3T A;  3PIN A;  2RUF A;  3FYG A;  3TJK A;  3CSI A;  1GNE A;  2VM1 A;  1X0R A;  3FR6 A;  1G7O A;  3EIN A;  2C3T A;  4HJM A;  4G10 A;  2ZCT A;  2C0E A;  1GWC A;  2IMI A;  3TCO A;  3KGK A;  1GUH A;  2X8C A;  4EDZ A;  4MDC A;  1HQO A;  2AB6 A;  2HLS A;  3GTU A;  3HJO A;  1MDJ A;  1UC7 A;  1T1V A;  4DSS A;  5ABR A;  3S9F A;  4XTS A;  4D73 A;  3US3 A;  1DBY A;  3DVX A;  4PQ1 A;  2DJJ A;  3ERW A;  1F6M C;  2H0I A;  3DWV A;  5ECP B;  2VL9 A;  2B5E A;  4GWR A;  4Q5R A;  2JZT A;  2L6C A;  2OE1 A;  1VF1 A;  4ULX A;  5DAK A;  5F07 A;  4BA7 A;  1OC8 A;  3ZVJ D;  5CRW A;  2DLX A;  3F4S A;  2DSA A;  1B9Y C;  3VLN A;  2FA4 A;  4IJ3 A;  3GUR A;  4V1A p;  6GSV A;  3M1G A;  2FLS A;  1C72 A;  2JZR A;  2NBS A;  2JSZ A;  5CRG A;  1K0M A;  5AIS A;  6GSW A;  5AIV A;  3E3E A;  2MZC A;  5CP1 A;  3H79 A;  4GLT A;  1A2M A;  2H1A A;  4NAX A;  4FO5 A;  1NSW A;  1TK0 B;  5JWR B;  10GS A;  2K6V A;  4NPB A;  1T7P B;  1ACV A;  1J9B A;  4QL9 A;  3IBH A;  4PX1 A;  1T4Z A;  3KH9 A;  4RQX A;  3L78 A;  3D21 A;  2LST A;  4TR4 A;  5D9W A;  4D73 B;  1YDK A;  4OD7 A;  4HEA 2;  1M2D A;  4JED A;  4OO4 A;  2IME A;  4I6X A;  5CRD A;  4WKW A;  1GSS A;  2GLR A;  3WGX A;  1R4W A;  1U6T A;  3IPZ A;  2C4J A;  2X8G A;  4GST A;  1V9W A;  1XWK A;  4TR1 B;  1K0D A;  5HR2 A;  1EV9 A;  5DAK B;  3TB2 A;  1U3A A;  2CAQ A;  1ZZY A;  13GS A;  9GSS A;  4FH8 A;  2WS2 A;  1MTC A;  2YZU A;  4TXV A;  6GSS A;  1BED A;  3DKS A;  3IR4 A;  3M8N A;  4IP1 A;  3KZQ A;  4OWY A;  2H30 A;  4MJE A;  5CAX A;  4WR4 A;  3GL3 A;  4NV5 A;  4OFM A;  2CAI A;  5AIX A;  1V57 A;  5IMA A;  3GYK A;  1MD3 A;  4MPF A;  2JL4 A;  1PX6 A;  4OFN A;  3IK7 A;  3C7M A;  4LMW A;  2HSN B;  1MEK A;  5EVO A;  4L0U A;  4O92 A;  2LS5 A;  1HYU A;  2VLT A;  1WOU A;  4N0V A;  3UBK A;  2CX3 A;  3HJP A;  17GS A;  1F9M A;  2H75 A;  3GN3 A;  3AY8 A;  3WT1 A;  1A2L A;  3GX0 A;  1FHE A;  1Y25 A;  2L59 A;  1PN9 A;  3TKP A;  1RQM A;  5H5S A;  1X5E A;  3DYR A;  1GSF A;  2HSM B;  1SD8 A;  2R2J A;  2OKA A;  3VWW A;  1A23 A;  1M99 A;  4IS0 A;  5A4U A;  1V2A A;  3ZFL A;  4ZBD A;  2A4V A;  2R37 A;  3DRN A;  2YN1 A;  2OE3 A;  2YWI A;  1SKR B;  2F3M A;  4PUR A;  1LBK A;  2JZS A;  2R4V A;  1TK8 B;  2QKE A;  4GF0 A;  1NW2 A;  2A2S A;  2R5G A;  4X43 A;  5GZZ B;  2GSS A;  1B4P A;  3RHB A;  2PMT A;  4Q5Q A;  2PUK C;  6GST A;  4GQC A;  3F4R A;  5GSS A;  3O3T A;  2FHE A;  1YJ6 A;  1A8L A;  1HNC A;  5IO2 A;  4OMV A;  2GT5 A;  2P5Q A;  4GTU A;  5AGY A;  4CHS A;  3Q19 A;  2PN8 A;  1XPV A;  1F3A A;  3P7X A;  3A2V A;  2CVK A;  4JBB A;  1T3B A;  1AC1 A;  3FRC A;  2VUP A;  3LSZ A;  4BPY A;  1XWG A;  2PWJ A;  4FIW A;  4H86 A;  5ID2 A;  1YZX A;  3VFI A;  3NIV A;  20GS A;  4V2L A;  3DVW A;  5B6M A;  3GRX A;  4I8B A;  4G0I A;  1B4Q A;  3G7J A;  5A5K A;  2FWG A;  1T8E B;  4BVX A;  2WCI A;  2HRF A;  1TI1 A;  1QGV A;  2QC7 A;  1DUG A;  5DQY A;  1LU4 A;  1THO A;  1SYX A;  2X99 A;  1OC3 A;  3IRA A;  1R26 A;  3VWX A;  4F82 A;  3LWA A;  2H66 A;  2O7K A;  4YAV A;  1M9A A;  1SKW B;  2AAW A;  1FG4 A;  3RBT A;  2CVD A;  1EWX A;  2VO4 A;  1GTB A;  2B1K A;  1PGT A;  1XIY A;  1EOG A;  4POM A;  2O85 A;  1UVZ A;  1AIU A;  3KCM A;  3QAW A;  4EDY A;  1TJD A;  4GRF A;  2HFD A;  1R5A A;  5ECL B;  5DAL B;  2GQM A;  2TRC P;  3WGD A;  3C73 A;  2ON5 A;  2GVP A;  3HYP A;  4O32 A;  2L57 A;  1JHB A;  5LD0 A;  4O7H A;  3E0U A;  4E8H A;  1YF1 A;  3ISO A;  4KCE A;  3Q74 A;  2MYG A;  2M80 A;  4CDO A;  4YQU A;  3ME8 A;  1VF2 A;  2JAC A;  2LNT A;  3GKN A;  2KOK A;  2MBS A;  2C0G A;  3F4T A;  1PD2 1;  1EZK A;  1WRY A;  2YWN A;  3QAG A;  1U87 A;  3RDW A;  4KSO A;  1TU7 A;  1H4O A;  3IK9 A;  5ID2 B;  3GSS A;  1AW9 A;  3IV4 A;  4GQF A;  5DCG A;  2BMX A;  3F3Q A;  3LOR A;  4V2M A;  2XPD A;  1TTZ A;  1I9D A;  2DIZ A;  3MAK A;  2LTK A;  4WBJ A;  4J57 E;  1BJX A;  4ZBA A;  12GS A;  3P2A A;  1A0R P;  3RAZ A;  5ECR B;  4LA1 A;  5CYY A;  2H70 A;  3F63 A;  5HFG A;  4KDX A;  4PQI A;  4MZB A;  6GSU A;  1PQN A;  1Z5Y E;  5DJM A;  2FA8 A;  1MDK A;  2LUS A;  4IP6 A;  4POK A;  4HJ2 A;  3GST A;  1XWB A;  2XBI A;  2P31 A;  1X5C A;  2PGT A;  2XC2 A;  4QQ7 A;  3IAM 2;  2HSH A;  1FAA A;  5F05 A;  1FVJ A;  3HZ4 A;  2UZ8 A;  2H71 A;  3LXZ A;  3CBU A;  5D8I A;  2CT6 A;  1EP7 A;  4FYC A;  4F0C A;  3GFK A;  1XWA A;  5CRE A;  2RII A;  2PVQ A;  2LEG A;  2B5Y A;  3BBY A;  4PXO A;  4KF9 A;  3G7Y A;  19GS A;  4ISD A;  4IEL A;  1EP8 A;  1OE8 A;  2E2M A;  1SJZ A;  1JLV A;  2LRN A;  1CQH A;  4ECJ A;  3W8J A;  2FNO A;  3VPQ A;  5B8A A;  4PQH A;  2DJ1 A;  3BCI A;  2LQQ A;  1GSY A;  1DSB A;  1R5P A;  1XZO A;  1JZR A;  2HRA A;  5L71 A;  4LMV A;  2LQO A;  4HOJ A;  3GHA A;  3M0F A;  5C04 A;  1TKD B;  3KM6 A;  3GMF A;  2MMZ A;  2WJU A;  4KB3 A;  4GCI A;  5ECI B;  4NHZ A;  4LLR A;  5HQP A;  2OE0 A;  5EPF A;  4G19 A;  1FVK A;  1WPI A;  3ZVJ A;  4G0K A;  2VD1 A;  3IA1 A; 
#chains in the Genus database with same CATH topology
 3FEU A;  1ML6 A;  5J4V A;  2OA7 A;  5HR3 A;  3W8S A;  1USB A;  2IL3 A;  1M2B A;  1YY7 A;  1V40 A;  3QAV A;  2QGV A;  3BCK A;  3F9U A;  4BL7 B;  1ZL9 A;  4ECB A;  3Q6O A;  3O6T A;  2JU5 A;  3D22 A;  1A8Y A;  3SBC A;  1IYH A;  4ZL8 A;  3TKQ A;  1PL1 A;  1N8J A;  3CRT A;  2JSY A;  5DCH A;  3EMP A;  2H1L A;  1XVQ A;  1ON4 A;  5IMD A;  2E0Q A;  4MJC A;  1OC9 A;  2NVL A;  5IMV A;  4ZL7 A;  4KX4 A;  2YJ7 A;  2GZZ A;  3F0I A;  4PNG A;  2FUG 2;  2KP1 A;  4NXI A;  4G9H A;  4YQV A;  2H0G A;  3DXB A;  3FZA A;  1Z6N A;  5GAN D;  2GZY A;  1R7H A;  2WZ9 A;  1TI3 A;  1YQ1 A;  2PPT A;  5IIZ A;  3VWU A;  3GTU B;  4DSS B;  1YF0 A;  2ZUP A;  1TXU A;  2L5O A;  2D2Z A;  2H73 A;  5J47 A;  4EKZ A;  5JWO B;  3QPM A;  1ILO A;  5D9X A;  3MWH A;  5B6N A;  5IOX A;  3UEM A;  2YJH A;  4BWS A;  4F03 A;  3QFB C;  2C80 A;  1GNW A;  3C8E A;  1ERT A;  2HSY A;  2K9F A;  2LJK A;  3TJB A;  1KBN A;  1MD4 A;  4W66 A;  3L9U A;  2PER A;  3FR9 A;  1VRS D;  1TRS A;  1TRU A;  2NDO A;  1Y6E A;  1GLQ A;  2IFQ A;  2CVB A;  3CMI A;  2WGR A;  3EU3 A;  1MDI A;  2LJR A;  5J41 A;  2GT6 A;  1AQX A;  3KMN A;  1HNB A;  5ECK B;  4NHW A;  2VAF A;  3CWG A;  2O87 A;  4JR6 A;  2EIO A;  1PMT A;  3FZ5 A;  4L0W A;  1K3O A;  1CQG A;  3EMX A;  2C0F A;  2CX4 A;  1K0C A;  2QSI A;  3QDN A;  2HQT A;  1QFN A;  1Z7R A;  22GS A;  2R6K A;  1GSD A;  2H72 A;  4KA0 A;  1GUL A;  2YPM A;  2P5R A;  1A2J A;  1JZW A;  3BOA A;  2WRT A;  5BMU A;  2HE3 A;  2F9S A;  3TJF A;  1GH2 A;  4MJA A;  4TRX A;  1AUC A;  4N30 A;  1S3D A;  4OO5 A;  1XW6 A;  2ALB A;  1VF3 A;  4RUV A;  2H01 A;  6GSX A;  1BG1 A;  4EIQ A;  3W6G A;  5G30 A;  1N2A A;  2L5L A;  4XS6 A;  2IWT A;  2HYX A;  1PA3 A;  1YEP A;  3LFL A;  3QOU A;  4G0L A;  3TKS C;  5A1N A;  2I9H A;  4AKH A;  2CA8 A;  2OAC A;  2FY6 A;  4HS1 A;  4K8M A;  3ERG A;  4KH7 A;  2KP2 A;  1GTA A;  1FW1 A;  2OAD A;  2FD3 A;  3VK9 A;  3PR8 A;  2VL2 C;  2DJ0 A;  1PSQ A;  3HCZ A;  1ERU A;  1XW5 A;  1QXH A;  4AJ6 A;  2A2P A;  1GRX A;  1SVO A;  4O5R A;  3LYP A;  1GP1 A;  1M2A A;  3IXR A;  3ZLP A;  1U88 A;  2YZH A;  2YAN A;  2UV8 G;  3I6A A;  4F0B A;  1W4V A;  1ZYQ B;  2CV4 A;  3NOF A;  1Z9H A;  3C71 A;  1K0B A;  4EE0 A;  4TN8 A;  2LRC A;  3L9V A;  2L4Q A;  3GX8 A;  3L4N A;  18GS A;  2GS3 A;  3CSH A;  3KP8 A;  3M9J A;  3HJM A;  2YV7 A;  3H4K A;  3F8U A;  3HY2 A;  2NTO A;  2VCT A;  3J7Y k;  3DEX A;  2G2Q A;  1X9W B;  3D6I A;  3TUE A;  5JCU A;  2O8V B;  5ECO B;  4MP4 A;  1SVM A;  4IKH A;  3H8Q A;  5BMU B;  4ZIL A;  3UJ1 A;  5DBQ A;  4K0N A;  3GH9 A;  2VCW A;  5IOW A;  2K8S A;  3M9K A;  2VCQ A;  3D5J A;  2DMM A;  3FZ4 A;  4MCU A;  1XOA A;  4JZQ A;  3R2Q A;  1ST9 A;  3VPT A;  2GZP A;  1PKW A;  1NM3 A;  2EFD A;  2XPE A;  2LJA A;  2F8F A;  3WT2 A;  4OFT A;  2HNL A;  2H1B A;  1THX A;  4V1A g;  3ERF A;  2H6X A;  1S3C A;  3IAS 2;  4CY6 A;  2I81 A;  4QMK A;  2I1U A;  2J23 A;  1E2Y A;  3TRQ A;  2A2R A;  2DC5 A;  4MF6 A;  2WVZ A;  2C0D A;  1SK2 A;  2Z9S A;  4KND A;  3G7I A;  1DE1 A;  3GKK A;  3ZYW A;  1EV4 A;  5EL8 A;  1IYI A;  1K0O A;  2OJL A;  1G6W A;  5INY A;  4TXO A;  3TDG A;  4TVE A;  4KDY A;  2ZNM A;  3ZZX A;  4L5L A;  4POL A;  3TKR A;  4RQR A;  4YH2 A;  1FOV A;  4BWQ A;  3HXS A;  4IJI A;  2V41 A;  3KD0 A;  4ML6 A;  3UOM A;  5A4V A;  1SYR A;  3C1R A;  3DGQ A;  3PPU A;  4XCS A;  2G0F A;  3I69 A;  1I5G A;  4ILF A;  4ECC A;  1BG5 A;  5A4W A;  4FYB A;  1M0U A;  4HQS A;  4GXZ A;  3CSJ A;  2REM A;  3N9J A;  2F51 A;  3ZFB A;  4TR0 A;  4XS4 A;  8GSS A;  4E8E A;  3IDV A;  3M3M A;  3HDC A;  4K5R A;  1QK8 A;  2GSQ A;  2HZE A;  4N11 A;  1RW1 A;  4HZ2 A;  3OR5 A;  4KSM A;  4MZW A;  5FHI A;  1T4Y A;  4LL4 B;  1F2E A;  5EY6 A;  5KN1 A;  1GTI A;  3KJY A;  1OE7 A;  4OCF A;  1SL2 B;  1V58 A;  3LEF A;  5IPH A;  1TRV A;  1NHY A;  2TRX A;  3P90 A;  3HVV A;  4XS1 A;  1GLP A;  4EC0 A;  2H0H A;  4KCA A;  1E6B A;  4IQ1 A;  5LNK e;  1ZMA A;  4BVX B;  4WF5 A;  1UA5 A;  3HKR A;  1Q98 A;  2FWF A;  1VGL A;  1YKA A;  5J5N A;  3CXG A;  4AGS A;  3RPN A;  2V1M A;  3CTF A;  4HUA A;  2EFE A;  3TOT A;  2AYT A;  5LCZ A;  1XBS A;  1SVL A;  1F3B A;  2VL3 A;  4MK3 A;  3FHK A;  1EGR A;  3UIW A;  3EU4 A;  1TDI A;  2AHE A;  4A5P A;  3IC8 A;  3BD2 A;  5D93 A;  1SU9 A;  1K0A A;  3TKS E;  3TKS A;  2LKU A;  3F6F A;  3TRP A;  5JCG A;  3CRU A;  3KMO A;  2YOI A;  4IN0 A;  1KEB A;  2EIR A;  4WBR D;  1A24 A;  3MSZ A;  4MAB A;  4YKG A;  5ECN B;  1ZYP A;  2HRN A;  2RLI A;  1ZOF A;  2VL2 A;  2DJ3 A;  5B7C A;  5GST A;  4HU7 A;  4ZB7 A;  3KIJ A;  1FB0 A;  3EE2 A;  1O81 A;  4ZIJ A;  1XVW A;  1TK5 B;  3R3E A;  5ELG A;  3CTG A;  4V2N A;  3Q18 A;  1SD9 A;  1FO5 A;  1SL0 B;  5IMZ A;  3FZ9 A;  2GTU A;  2V6K A;  4AF2 A;  2GGT A;  2IN3 A;  5F8B A;  1YKC A;  3BJ5 A;  2P0G A;  4ECI A;  2HXK A;  2IMF A;  4USS A;  2C3Q A;  2L4C A;  4P3Y B;  5ECH B;  4PUA A;  2MMO A;  5FT3 A;  1VF4 A;  2H1G A;  4Z7X A;  1AXD A;  3MNG A;  4HZ4 A;  1S3A A;  5JWQ B;  2QA1 A;  1X9M B;  2QA2 A;  4MZC A;  4ZBB A;  1OAZ A;  3LQ7 A;  1GUK A;  4HSC X;  4X1U A;  1EGO A;  3D0Z A;  1XCC A;  4FYU A;  1SKS B;  2EFH A;  5J40 A;  1HNA A;  1S4B P;  5ECM B;  16GS A;  1TOF A;  2VM2 A;  5DJL A;  1V98 A;  4HI7 A;  1GSQ A;  1AAZ A;  4DSR A;  3WD6 A;  5G5E A;  2FWH A;  2YWO A;  3WGE A;  1M3J A;  4N0Z A;  3MDK A;  2HT9 A;  4RI6 A;  2EIQ A;  1JLW A;  4PGT A;  2PVO C;  5CO3 A;  4O5U A;  3GV1 A;  3D4T A;  3EYT A;  4TR1 A;  2EFC A;  1TXX A;  2C1Y A;  2DKI A;  4WF4 A;  3DD3 A;  4JU5 A;  5A5H B;  4L8E A;  3GNJ A;  2L6D A;  1ABA A;  2O36 A;  2AV4 A;  14GS A;  4TW5 A;  3QFA C;  5BRT A;  4K2X A;  4ML1 A;  4CW9 A;  4EVM A;  7GSS A;  4PTS A;  1J08 A;  4F2I A;  4YQM A;  4ID0 A;  4LL1 B;  4PI0 C;  3LJR A;  3HVX A;  4PUF C;  2HI7 A;  3EC3 A;  1SJI A;  3ZIT A;  2DJ2 A;  5D9V A;  1K0N A;  2HSN A;  3GUS A;  1Z3E A;  4ZB9 A;  5DDL A;  3QR6 A;  1XFL A;  3K8N A;  2GSR A;  4POB A;  4WR5 A;  2O5V A;  2VD0 A;  2VLU A;  4Q5F A;  5DVB A;  4I97 A;  3C1S A;  1ZYN A;  3E9J B;  3MYD A;  1ERV A;  2VCV A;  2FWE A;  3TRX A;  1Q4J A;  2CZ3 A;  2DJK A;  2X4A A;  2LRT A;  2IPA A;  3ZTL A;  1PFO A;  5AN1 A;  4TR3 A;  3IHG A;  4K7O A;  2DML A;  5B8B A;  3HA9 A;  4XHM A;  2DBC A;  4ZB6 A;  1XG8 A;  2HSM A;  4I5Q A;  4AJ7 A;  2H74 A;  4HDE A;  2FCH A;  1TP9 A;  5F0G A;  4GDF A;  4KAE A;  2B7J A;  1O7U A;  2N5A A;  3G9B A;  5G31 A;  1H75 A;  3GL5 A;  2FGX A;  2B7K A;  5ENU A;  3U5R E;  3FR3 A;  3P8W A;  2WDU A;  3I43 A;  4NMU A;  2VCX A;  1BQ7 A;  4JRR A;  1PN0 A;  1X9S B;  1WMJ A;  5HR1 A;  4E68 A;  2B3S A;  5E59 A;  4J56 E;  2DIY A;  2HZF A;  4EO3 A;  2WW3 A;  1M3I A;  2N5B A;  3IE3 A;  3TGZ A;  5COH A;  3GKM A;  2VCZ A;  4MLY A;  5KN0 A;  4ZXG A;  1OC9 B;  1SJ6 A;  4XIH A;  2GQK A;  4Z2R A;  3VUR A;  1JZO A;  2E2G A;  3U6V A;  1W89 A;  4EL1 A;  3KH7 A;  3F6D A;  2M72 A;  1KTE A;  3D4M A;  3KTB A;  1HD2 A;  2WW0 A;  2KLX A;  2WB9 A;  2YP6 A;  1ZCP A;  5E4W A;  5G1L A;  3FK8 A;  3LXT A;  2LV3 A;  4L5O A;  1GUM A;  1O85 A;  1PKZ A;  5IQY A;  1AQW A;  1G0T A;  4K9Z A;  2JAD A;  1F37 A;  4EIP A;  2RM6 A;  5IMC A;  1RK4 A;  1BYE A;  1OYJ A;  4EXJ A;  5F06 A;  1YEX A;  3V1W A;  3J7Y b;  1EEM A;  2VOC A;  4X4J A;  5J4U A;  4N10 A;  1OVN A;  2V32 A;  1WP0 A;  2YV9 A;  1LJR A;  2WFC A;  2YNX A;  2XBQ A;  3F3R A;  3APQ A;  3JCM L;  2B5X A;  4FQU A;  3DML A;  2B6M A;  1OKT A;  5FWG A;  4GSS A;  4WET A;  6GSY A;  3O76 A;  2KHP A;  5C00 A;  4PI2 C;  5J4Y A;  1XXU A;  3L9S A;  4JR4 A;  2WVX A;  3NZN A;  4J2F A;  1SK1 A;  3GH6 A;  2IFQ B;  1J0F A;  1EOH A;  1XOB A;  4X0X A;  4DSQ A;  1BX9 A;  1G6Y A;  3EWL A;  2IMD A;  3A2W A;  3VI7 A;  2M46 A;  3LG6 A;  1QMV A;  3HHV A;  1ZGN A;  2H19 A;  3ZIV A;  2RM5 A;  3LGC A;  3ZIJ A;  2WW2 A;  1UN2 A;  1ZYE A;  3IHQ A;  3TJG A;  5DAL A;  2K8V A;  3HMJ G;  5J9B A;  4KE3 A;  1KNG A;  3I9V 2;  3FY7 A;  1WWJ A;  3A5W A;  1Z7P A;  5ECS A;  4Q5N A;  3FMW A;  2MMN A;  3UVT A;  1QQ2 A;  5A34 A;  3ZMK A;  5G2Z A;  3HD5 A;  2H76 A;  5J9C A;  2OBI A;  4MA9 A;  5HFK A;  3H93 A;  5CRH A;  4MPG A;  3PGT A;  3IC4 A;  3KXO A;  1GSE A;  2CQ9 A;  1PRX A;  1GL8 A;  4ICY A;  2MBT A;  3EUR A;  2HRK A;  1JFU A;  5G1K A;  2H1D A;  4YAP A;  4EUY A;  3TJJ A;  3LYK A;  2IIY A;  4K7N A;  5KN2 A;  4I2U A;  4MH2 A;  3UAR A;  4DEJ A;  3ZL5 A;  4ZL9 A;  2AJQ B;  5A1N B;  1O73 A;  1WJK A;  3APO A;  3HVS A;  4YKF A;  3RHC A;  4MF7 A;  3UVH A;  3HVN A;  4WXT A;  3FW2 A;  4CY8 A;  1DE2 A;  1GSU A;  4AI6 A;  4XRA A;  2RUE A;  2YWM A;  2WVX B;  1FB6 A;  3KTL A;  3RPP A;  2X64 A;  4BVY A;  3APS A;  2PU9 C;  5KEJ A;  4IQA A;  3KEB A;  3QD9 A;  3QCP A;  2J9H A;  1M9B A;  3TOU A;  2BTO T;  3PH9 A;  2H6Y A;  3ME7 A;  2AUV A;  1O8X A;  4K1F A;  3CYN A;  5ELA A;  3FKF A;  3HZ8 A;  2C8U A;  4DVC A;  4KUN A;  1SK0 A;  4ZB8 A;  5IO0 A;  2N5F A;  1B9X C;  4IBP A;  3WYW A;  1TRW A;  3VI5 A;  3IOS A;  4QL7 A;  4XRD A;  4AJ8 A;  2F8A A;  2C3N A;  1SL1 B;  5IMF A;  2CZ2 A;  2WUL A;  4IVF A;  3UAP A;  2GST A;  4K2D A;  3DIE A;  1A0F A;  3ZRE A;  4KGI A;  1AQV A;  1SEN A;  2O89 A;  1K3Y A;  5DQS A;  4F9Z A;  1JZD A;  1BAY A;  3GA4 A;  1ERW A;  4KDU A;  2V6O A;  2R3X A;  2H8L A;  4NV2 A;  1EEJ A;  2VIM A;  1WIK A;  3H1N A;  1WE0 A;  2YCD A;  2E7P A;  3L0H A;  4RI7 A;  2HRK B;  2BJX A;  1Z6M A;  2X8H A;  2H6Z A;  2VLV A;  1XWC A;  2WZS A;  4JE1 A;  5J3R A;  4TOP A;  1U3I A;  3UL3 A;  2GQL A;  2LNS A;  3QMX A;  1URM A;  4GSN A;  4K6X A;  1M7T A;  4MJB A;  3UMA A;  1B48 A;  5G5F A;  2ES7 A;  5IPG A;  1TU8 A;  1Y1U A;  1OKD A;  5GAP D;  2NPB A;  1O6J A;  4K0G A;  4MH3 A;  1NHO A;  4IGJ A;  4OCE A;  1T00 A;  5D96 A;  2KUC A;  2OBK A;  4MMM A;  4NWY A;  3ED3 A;  1GTU A;  4TXO B;  4I2T A;  1FOH A;  4PNF A;  5HR0 A;  4PHZ C;  4BVY B;  2TIR A;  5IM9 A;  4EF0 A;  4G2E A;  4HQZ A;  1K3L A;  3VWV A;  3N5O A;  2I4A A;  3ZRD A;  2GDR A;  4AKG A;  4IW9 A;  3UBL A;  2XHF A;  4WEY A;  3KP9 A;  1G7E A;  3ZML A;  1QUW A;  2R0G A;  5CNW A;  2K18 A;  4BL7 A;  1X5D A;  5KOW A;  4HU9 A;  2ON7 A;  1XW9 A;  2I3Y A;  5KN3 A;  1TW9 A;  4KW6 A;  5HFI A;  2PBJ A;  5D73 A;  3EVI A;  4TKY A;  3GKX A;  1PX7 A;  4XS4 B;  5D9T A;  4IHU A;  3A2X A;  2EC4 A;  2IMK A;  2V2G A;  2MMA A;  1O8W A;  2IJY A;  5H5R A;  5ECQ B;  3SWL A;  2HZE B;  4MF5 A;  4ACS A;  5JCW A;  11GS A;  2OT3 A;  1B8X A;  2B1L A;  5H5Q A;  1PL2 A;  4K7I A;  3GIX A;  3RGB C;  3A3T A;  3PIN A;  2RUF A;  3FYG A;  3TJK A;  3CSI A;  1GNE A;  4K5S A;  2VM1 A;  2R0P A;  1X0R A;  3FR6 A;  1G7O A;  3EIN A;  2C3T A;  4HJM A;  4G10 A;  2ZCT A;  2C0E A;  1GWC A;  2IMI A;  3TCO A;  3KGK A;  1GUH A;  2X8C A;  4EDZ A;  4MDC A;  1HQO A;  2AB6 A;  2HLS A;  3GTU A;  3HJO A;  1MDJ A;  1UC7 A;  1T1V A;  4DSS A;  5ABR A;  3S9F A;  4XTS A;  4D73 A;  3US3 A;  1DBY A;  3DVX A;  4PQ1 A;  2DJJ A;  3ERW A;  1F6M C;  2H0I A;  3DWV A;  5ECP B;  2VL9 A;  2B5E A;  4GWR A;  4Q5R A;  2JZT A;  2L6C A;  2OE1 A;  2R0C A;  4FXY P;  1VF1 A;  1YVL A;  4ULX A;  5DAK A;  5F07 A;  4BA7 A;  1OC8 A;  3ZVJ D;  5CRW A;  4Z2T A;  2DLX A;  3F4S A;  2DSA A;  1B9Y C;  3VLN A;  2FA4 A;  4IJ3 A;  3GUR A;  4V1A p;  6GSV A;  2FLS A;  3M1G A;  1C72 A;  2JZR A;  2NBS A;  2JSZ A;  5CRG A;  1K0M A;  5AIS A;  6GSW A;  1BF5 A;  5AIV A;  3E3E A;  2MZC A;  5CP1 A;  3H79 A;  4GLT A;  1A2M A;  2H1A A;  4NAX A;  4FO5 A;  1NSW A;  1TK0 B;  5JWR B;  10GS A;  2K6V A;  4NPB A;  1T7P B;  1ACV A;  1J9B A;  4QL9 A;  3IBH A;  4PX1 A;  1T4Z A;  3KH9 A;  4RQX A;  3L78 A;  3D21 A;  2LST A;  4TR4 A;  5D9W A;  4D73 B;  1YDK A;  4OD7 A;  4HEA 2;  1M2D A;  4JED A;  4OO4 A;  2IME A;  4I6X A;  5CRD A;  4WKW A;  1GSS A;  2GLR A;  3WGX A;  1R4W A;  1U6T A;  3IPZ A;  2C4J A;  2X8G A;  4GST A;  1V9W A;  1XWK A;  4TR1 B;  1K0D A;  5HR2 A;  1EV9 A;  5DAK B;  3TB2 A;  1U3A A;  2CAQ A;  1ZZY A;  13GS A;  9GSS A;  4FH8 A;  2WS2 A;  3CHX C;  3CQF A;  1MTC A;  2YZU A;  4TXV A;  6GSS A;  1BED A;  3DKS A;  3IR4 A;  3M8N A;  4IP1 A;  3KZQ A;  4OWY A;  2H30 A;  4MJE A;  5CAX A;  4WR4 A;  3GL3 A;  4NV5 A;  4OFM A;  2CAI A;  5AIX A;  1V57 A;  3RFR C;  5IMA A;  3GYK A;  1MD3 A;  4MPF A;  2JL4 A;  1PX6 A;  4OFN A;  3IK7 A;  3C7M A;  4LMW A;  2HSN B;  1MEK A;  5EVO A;  4L0U A;  4O92 A;  2LS5 A;  1HYU A;  2VLT A;  1WOU A;  4N0V A;  3UBK A;  2CX3 A;  3HJP A;  3A5I A;  17GS A;  1F9M A;  2H75 A;  3GN3 A;  3AY8 A;  3WT1 A;  1A2L A;  3GX0 A;  1FHE A;  1Y25 A;  2L59 A;  1PN9 A;  3TKP A;  1RQM A;  5H5S A;  4MNN A;  1X5E A;  3DYR A;  1GSF A;  3EPT A;  2HSM B;  1SD8 A;  2R2J A;  1I1I P;  2OKA A;  3VWW A;  1A23 A;  1M99 A;  1YEW C;  4IS0 A;  5A4U A;  1V2A A;  3ZFL A;  4ZBD A;  2A4V A;  2R37 A;  3DRN A;  2YN1 A;  2OE3 A;  2YWI A;  1SKR B;  2F3M A;  4PUR A;  1LBK A;  2JZS A;  2R4V A;  1TK8 B;  2QKE A;  4GF0 A;  1NW2 A;  2A2S A;  2R5G A;  4X43 A;  5GZZ B;  2GSS A;  1B4P A;  3RHB A;  2PMT A;  4Q5Q A;  2PUK C;  6GST A;  4GQC A;  3F4R A;  5GSS A;  3O3T A;  2FHE A;  1YJ6 A;  1A8L A;  1HNC A;  5IO2 A;  2O3E A;  4OMV A;  2GT5 A;  2P5Q A;  4GTU A;  1S3R A;  5AGY A;  4CHS A;  3Q19 A;  2PN8 A;  1XPV A;  1F3A A;  3P7X A;  3A2V A;  2CVK A;  4JBB A;  1T3B A;  1AC1 A;  3FRC A;  2VUP A;  3LSZ A;  4BPY A;  1XWG A;  2PWJ A;  4FIW A;  4H86 A;  5ID2 A;  4AKI A;  1YZX A;  3VFI A;  3NIV A;  20GS A;  4V2L A;  3DVW A;  5B6M A;  4Z2U A;  3TU3 B;  3GRX A;  2WW1 A;  4I8B A;  4G0I A;  1B4Q A;  3G7J A;  5A5K A;  2FWG A;  1T8E B;  4BVX A;  2WCI A;  2HRF A;  1TI1 A;  1QGV A;  2QC7 A;  1DUG A;  5DQY A;  1LU4 A;  1THO A;  1SYX A;  2X99 A;  1OC3 A;  3IRA A;  1R26 A;  3VWX A;  4F82 A;  3LWA A;  5KOX A;  2H66 A;  2O7K A;  4YAV A;  1M9A A;  4O5Q A;  1SKW B;  2AAW A;  1FG4 A;  3RBT A;  2CVD A;  1EWX A;  2VO4 A;  1GTB A;  2B1K A;  1PGT A;  1XIY A;  1EOG A;  4POM A;  2O85 A;  1UVZ A;  1AIU A;  3KCM A;  3QAW A;  4EDY A;  1TJD A;  4GRF A;  2HFD A;  1R5A A;  5ECL B;  5DAL B;  2GQM A;  2TRC P;  3WGD A;  3C73 A;  2ON5 A;  2GVP A;  3HYP A;  4O32 A;  2L57 A;  1JHB A;  4AKX B;  5LD0 A;  4O7H A;  3E0U A;  4E8H A;  1YF1 A;  3ISO A;  5A34 B;  4KCE A;  3Q74 A;  2MYG A;  2M80 A;  4CDO A;  4YQU A;  3ME8 A;  1VF2 A;  2JAC A;  2LNT A;  3GKN A;  2KOK A;  2MBS A;  2C0G A;  3F4T A;  1PD2 1;  1EZK A;  1WRY A;  1N25 A;  2YWN A;  4BIK A;  3QAG A;  1U87 A;  3RDW A;  4KSO A;  1TU7 A;  1H4O A;  3IK9 A;  5ID2 B;  3GSS A;  1AW9 A;  3IV4 A;  4GQF A;  5DCG A;  2BMX A;  3F3Q A;  3LOR A;  4V2M A;  2XPD A;  1TTZ A;  1I9D A;  2DIZ A;  3MAK A;  2LTK A;  4WBJ A;  4J57 E;  1BJX A;  4ZBA A;  12GS A;  3P2A A;  1A0R P;  3RAZ A;  5ECR B;  4LA1 A;  3MIX A;  5CYY A;  2H70 A;  3F63 A;  5HFG A;  4KDX A;  4PQI A;  4MZB A;  6GSU A;  1PQN A;  1Z5Y E;  5DJM A;  2FA8 A;  1MDK A;  2LUS A;  4IP6 A;  4POK A;  4HJ2 A;  3GST A;  1XWB A;  2XBI A;  2P31 A;  1X5C A;  2PGT A;  4G01 A;  2XC2 A;  4QQ7 A;  3IAM 2;  2HSH A;  4N3Z A;  2WVY A;  1FAA A;  5F05 A;  1FVJ A;  3HZ4 A;  2UZ8 A;  2H71 A;  3LXZ A;  3CBU A;  5D8I A;  2CT6 A;  1EP7 A;  4FYC A;  5A5H A;  4F0C A;  3GFK A;  1XWA A;  5CRE A;  2RII A;  2A4H A;  2PVQ A;  2LEG A;  2B5Y A;  3BBY A;  4PXO A;  4KF9 A;  3LW9 A;  3G7Y A;  19GS A;  4ISD A;  4IEL A;  1EP8 A;  1OE8 A;  2E2M A;  1SJZ A;  1JLV A;  2LRN A;  1CQH A;  4ECJ A;  3W8J A;  2FNO A;  3VPQ A;  5B8A A;  4PQH A;  2DJ1 A;  2X49 A;  3BCI A;  2LQQ A;  1GSY A;  1DSB A;  1R5P A;  1XZO A;  1JZR A;  2HRA A;  5L71 A;  4LMV A;  2LQO A;  4HOJ A;  3GHA A;  3M0F A;  5C04 A;  1TKD B;  2DKH A;  3KM6 A;  3GMF A;  2MMZ A;  2WJU A;  4KB3 A;  4GCI A;  5ECI B;  4NHZ A;  4LLR A;  5HQP A;  2VKZ G;  2OE0 A;  5EPF A;  4G19 A;  1FVK A;  1WPI A;  3ZVJ A;  4G0K A;  2VD1 A;  3IA1 A; 
#chains in the Genus database with same CATH homology
 3FEU A;  1ML6 A;  5J4V A;  2OA7 A;  5HR3 A;  3W8S A;  1USB A;  2IL3 A;  1M2B A;  1YY7 A;  1V40 A;  3QAV A;  2QGV A;  3BCK A;  3F9U A;  4BL7 B;  1ZL9 A;  4ECB A;  3Q6O A;  3O6T A;  2JU5 A;  3D22 A;  1A8Y A;  3SBC A;  1IYH A;  4ZL8 A;  3TKQ A;  1PL1 A;  1N8J A;  3CRT A;  2JSY A;  5DCH A;  3EMP A;  2H1L A;  1XVQ A;  1ON4 A;  5IMD A;  2E0Q A;  4MJC A;  1OC9 A;  2NVL A;  5IMV A;  4ZL7 A;  4KX4 A;  2YJ7 A;  2GZZ A;  3F0I A;  4PNG A;  2FUG 2;  2KP1 A;  4NXI A;  4G9H A;  4YQV A;  2H0G A;  3DXB A;  3FZA A;  1Z6N A;  5GAN D;  2GZY A;  1R7H A;  2WZ9 A;  1TI3 A;  1YQ1 A;  2PPT A;  5IIZ A;  3VWU A;  3GTU B;  4DSS B;  1YF0 A;  2ZUP A;  1TXU A;  2L5O A;  2D2Z A;  2H73 A;  5J47 A;  4EKZ A;  5JWO B;  3QPM A;  1ILO A;  5D9X A;  3MWH A;  5B6N A;  5IOX A;  3UEM A;  2YJH A;  4BWS A;  4F03 A;  3QFB C;  2C80 A;  1GNW A;  3C8E A;  1ERT A;  2HSY A;  2K9F A;  2LJK A;  3TJB A;  1KBN A;  1MD4 A;  4W66 A;  3L9U A;  2PER A;  3FR9 A;  1VRS D;  1TRS A;  1TRU A;  2NDO A;  1Y6E A;  1GLQ A;  2IFQ A;  2CVB A;  3CMI A;  2WGR A;  3EU3 A;  1MDI A;  2LJR A;  5J41 A;  2GT6 A;  1AQX A;  3KMN A;  1HNB A;  5ECK B;  4NHW A;  2VAF A;  3CWG A;  2O87 A;  4JR6 A;  2EIO A;  1PMT A;  3FZ5 A;  4L0W A;  1K3O A;  1CQG A;  3EMX A;  2C0F A;  2CX4 A;  1K0C A;  2QSI A;  3QDN A;  2HQT A;  1QFN A;  1Z7R A;  22GS A;  2R6K A;  1GSD A;  2H72 A;  4KA0 A;  1GUL A;  2YPM A;  2P5R A;  1A2J A;  1JZW A;  3BOA A;  2WRT A;  5BMU A;  2HE3 A;  2F9S A;  3TJF A;  1GH2 A;  4MJA A;  4TRX A;  1AUC A;  4N30 A;  1S3D A;  4OO5 A;  1XW6 A;  2ALB A;  1VF3 A;  4RUV A;  2H01 A;  6GSX A;  1BG1 A;  4EIQ A;  3W6G A;  5G30 A;  1N2A A;  2L5L A;  4XS6 A;  2IWT A;  2HYX A;  1PA3 A;  1YEP A;  3LFL A;  3QOU A;  4G0L A;  3TKS C;  5A1N A;  2I9H A;  4AKH A;  2CA8 A;  2OAC A;  2FY6 A;  4HS1 A;  4K8M A;  3ERG A;  4KH7 A;  2KP2 A;  1GTA A;  1FW1 A;  2OAD A;  2FD3 A;  3VK9 A;  3PR8 A;  2VL2 C;  2DJ0 A;  1PSQ A;  3HCZ A;  1ERU A;  1XW5 A;  1QXH A;  4AJ6 A;  2A2P A;  1GRX A;  1SVO A;  4O5R A;  3LYP A;  1GP1 A;  1M2A A;  3IXR A;  3ZLP A;  1U88 A;  2YZH A;  2YAN A;  2UV8 G;  3I6A A;  4F0B A;  1W4V A;  1ZYQ B;  2CV4 A;  3NOF A;  1Z9H A;  3C71 A;  1K0B A;  4EE0 A;  4TN8 A;  2LRC A;  3L9V A;  2L4Q A;  3GX8 A;  3L4N A;  18GS A;  2GS3 A;  3CSH A;  3KP8 A;  3M9J A;  3HJM A;  2YV7 A;  3H4K A;  3F8U A;  3HY2 A;  2NTO A;  2VCT A;  3J7Y k;  3DEX A;  2G2Q A;  1X9W B;  3D6I A;  3TUE A;  5JCU A;  2O8V B;  5ECO B;  4MP4 A;  1SVM A;  4IKH A;  3H8Q A;  5BMU B;  4ZIL A;  3UJ1 A;  5DBQ A;  4K0N A;  3GH9 A;  2VCW A;  5IOW A;  2K8S A;  3M9K A;  2VCQ A;  3D5J A;  2DMM A;  3FZ4 A;  4MCU A;  1XOA A;  4JZQ A;  3R2Q A;  1ST9 A;  3VPT A;  2GZP A;  1PKW A;  1NM3 A;  2EFD A;  2XPE A;  2LJA A;  2F8F A;  3WT2 A;  4OFT A;  2HNL A;  2H1B A;  1THX A;  4V1A g;  3ERF A;  2H6X A;  1S3C A;  3IAS 2;  4CY6 A;  2I81 A;  4QMK A;  2I1U A;  2J23 A;  1E2Y A;  3TRQ A;  2A2R A;  2DC5 A;  4MF6 A;  2C0D A;  1SK2 A;  2Z9S A;  4KND A;  3G7I A;  1DE1 A;  3GKK A;  3ZYW A;  1EV4 A;  5EL8 A;  1IYI A;  1K0O A;  2OJL A;  1G6W A;  5INY A;  4TXO A;  3TDG A;  4TVE A;  4KDY A;  2ZNM A;  3ZZX A;  4L5L A;  4POL A;  3TKR A;  4RQR A;  4YH2 A;  1FOV A;  4BWQ A;  3HXS A;  4IJI A;  2V41 A;  3KD0 A;  4ML6 A;  3UOM A;  5A4V A;  1SYR A;  3C1R A;  3DGQ A;  3PPU A;  4XCS A;  2G0F A;  3I69 A;  1I5G A;  4ILF A;  4ECC A;  1BG5 A;  5A4W A;  4FYB A;  1M0U A;  4HQS A;  4GXZ A;  3CSJ A;  2REM A;  3N9J A;  2F51 A;  3ZFB A;  4TR0 A;  4XS4 A;  8GSS A;  4E8E A;  3IDV A;  3M3M A;  3HDC A;  4K5R A;  1QK8 A;  2GSQ A;  2HZE A;  4N11 A;  1RW1 A;  4HZ2 A;  3OR5 A;  4KSM A;  4MZW A;  5FHI A;  1T4Y A;  4LL4 B;  1F2E A;  5EY6 A;  5KN1 A;  1GTI A;  3KJY A;  1OE7 A;  4OCF A;  1SL2 B;  1V58 A;  3LEF A;  5IPH A;  1TRV A;  1NHY A;  2TRX A;  3P90 A;  3HVV A;  4XS1 A;  1GLP A;  4EC0 A;  2H0H A;  4KCA A;  1E6B A;  4IQ1 A;  5LNK e;  1ZMA A;  4BVX B;  4WF5 A;  1UA5 A;  3HKR A;  1Q98 A;  2FWF A;  1VGL A;  1YKA A;  5J5N A;  3CXG A;  4AGS A;  3RPN A;  2V1M A;  3CTF A;  4HUA A;  2EFE A;  3TOT A;  2AYT A;  5LCZ A;  1XBS A;  1SVL A;  1F3B A;  2VL3 A;  4MK3 A;  3FHK A;  1EGR A;  3UIW A;  3EU4 A;  1TDI A;  2AHE A;  4A5P A;  3IC8 A;  3BD2 A;  5D93 A;  1SU9 A;  1K0A A;  3TKS E;  3TKS A;  2LKU A;  3F6F A;  3TRP A;  5JCG A;  3CRU A;  3KMO A;  2YOI A;  4IN0 A;  1KEB A;  2EIR A;  4WBR D;  1A24 A;  3MSZ A;  4MAB A;  4YKG A;  5ECN B;  1ZYP A;  2HRN A;  2RLI A;  1ZOF A;  2VL2 A;  2DJ3 A;  5B7C A;  5GST A;  4HU7 A;  4ZB7 A;  3KIJ A;  1FB0 A;  3EE2 A;  1O81 A;  4ZIJ A;  1XVW A;  1TK5 B;  3R3E A;  5ELG A;  3CTG A;  4V2N A;  3Q18 A;  1SD9 A;  1FO5 A;  1SL0 B;  5IMZ A;  3FZ9 A;  2GTU A;  2V6K A;  4AF2 A;  2GGT A;  2IN3 A;  5F8B A;  1YKC A;  3BJ5 A;  2P0G A;  4ECI A;  2HXK A;  2IMF A;  4USS A;  2C3Q A;  2L4C A;  4P3Y B;  5ECH B;  4PUA A;  2MMO A;  5FT3 A;  1VF4 A;  2H1G A;  4Z7X A;  1AXD A;  3MNG A;  4HZ4 A;  1S3A A;  5JWQ B;  2QA1 A;  1X9M B;  2QA2 A;  4MZC A;  4ZBB A;  1OAZ A;  3LQ7 A;  1GUK A;  4X1U A;  1EGO A;  3D0Z A;  1XCC A;  4FYU A;  1SKS B;  2EFH A;  5J40 A;  1HNA A;  5ECM B;  16GS A;  1TOF A;  2VM2 A;  5DJL A;  1V98 A;  4HI7 A;  1GSQ A;  1AAZ A;  4DSR A;  3WD6 A;  5G5E A;  2FWH A;  2YWO A;  3WGE A;  4N0Z A;  3MDK A;  2HT9 A;  4RI6 A;  2EIQ A;  1JLW A;  4PGT A;  2PVO C;  5CO3 A;  4O5U A;  3GV1 A;  3D4T A;  3EYT A;  4TR1 A;  2EFC A;  1TXX A;  2C1Y A;  2DKI A;  4WF4 A;  3DD3 A;  4JU5 A;  5A5H B;  4L8E A;  3GNJ A;  2L6D A;  1ABA A;  2AV4 A;  14GS A;  4TW5 A;  3QFA C;  5BRT A;  4K2X A;  4ML1 A;  4CW9 A;  4EVM A;  7GSS A;  4PTS A;  1J08 A;  4F2I A;  4YQM A;  4ID0 A;  4LL1 B;  3LJR A;  3HVX A;  4PUF C;  2HI7 A;  3EC3 A;  1SJI A;  3ZIT A;  2DJ2 A;  5D9V A;  1K0N A;  2HSN A;  3GUS A;  1Z3E A;  4ZB9 A;  5DDL A;  3QR6 A;  1XFL A;  3K8N A;  2GSR A;  4POB A;  4WR5 A;  2O5V A;  2VD0 A;  2VLU A;  4Q5F A;  5DVB A;  4I97 A;  3C1S A;  1ZYN A;  3E9J B;  3MYD A;  1ERV A;  2VCV A;  2FWE A;  3TRX A;  1Q4J A;  2CZ3 A;  2DJK A;  2X4A A;  2LRT A;  2IPA A;  3ZTL A;  4TR3 A;  5AN1 A;  3IHG A;  4K7O A;  2DML A;  5B8B A;  3HA9 A;  4XHM A;  2DBC A;  4ZB6 A;  2HSM A;  4I5Q A;  4AJ7 A;  2H74 A;  4HDE A;  2FCH A;  1TP9 A;  5F0G A;  4GDF A;  4KAE A;  2B7J A;  1O7U A;  2N5A A;  3G9B A;  5G31 A;  1H75 A;  3GL5 A;  2FGX A;  2B7K A;  5ENU A;  3U5R E;  3FR3 A;  3P8W A;  2WDU A;  3I43 A;  4NMU A;  2VCX A;  1BQ7 A;  4JRR A;  1PN0 A;  1X9S B;  1WMJ A;  5HR1 A;  4E68 A;  2B3S A;  5E59 A;  4J56 E;  2DIY A;  2HZF A;  4EO3 A;  2N5B A;  3IE3 A;  3TGZ A;  5COH A;  3GKM A;  2VCZ A;  4MLY A;  5KN0 A;  4ZXG A;  1OC9 B;  1SJ6 A;  4XIH A;  2GQK A;  4Z2R A;  3VUR A;  1JZO A;  2E2G A;  3U6V A;  1W89 A;  4EL1 A;  3KH7 A;  3F6D A;  2M72 A;  1KTE A;  3D4M A;  3KTB A;  1HD2 A;  2KLX A;  2WB9 A;  2YP6 A;  1ZCP A;  5E4W A;  5G1L A;  3FK8 A;  3LXT A;  2LV3 A;  4L5O A;  1GUM A;  1O85 A;  1PKZ A;  5IQY A;  1AQW A;  1G0T A;  4K9Z A;  2JAD A;  1F37 A;  4EIP A;  2RM6 A;  5IMC A;  1RK4 A;  1BYE A;  1OYJ A;  4EXJ A;  5F06 A;  1YEX A;  3V1W A;  3J7Y b;  1EEM A;  2VOC A;  4X4J A;  5J4U A;  4N10 A;  1OVN A;  2V32 A;  1WP0 A;  2YV9 A;  1LJR A;  2WFC A;  2YNX A;  2XBQ A;  3F3R A;  3APQ A;  3JCM L;  2B5X A;  4FQU A;  3DML A;  2B6M A;  1OKT A;  5FWG A;  4GSS A;  4WET A;  6GSY A;  3O76 A;  2KHP A;  5C00 A;  5J4Y A;  1XXU A;  3L9S A;  4JR4 A;  3NZN A;  4J2F A;  1SK1 A;  3GH6 A;  2IFQ B;  1J0F A;  1EOH A;  1XOB A;  4X0X A;  4DSQ A;  1BX9 A;  1G6Y A;  3EWL A;  2IMD A;  3A2W A;  3VI7 A;  2M46 A;  3LG6 A;  1QMV A;  3HHV A;  1ZGN A;  2H19 A;  3ZIV A;  2RM5 A;  3LGC A;  3ZIJ A;  1UN2 A;  1ZYE A;  3IHQ A;  3TJG A;  5DAL A;  2K8V A;  3HMJ G;  5J9B A;  4KE3 A;  1KNG A;  3I9V 2;  3FY7 A;  1WWJ A;  3A5W A;  1Z7P A;  5ECS A;  4Q5N A;  3FMW A;  2MMN A;  3UVT A;  1QQ2 A;  5A34 A;  3ZMK A;  5G2Z A;  3HD5 A;  2H76 A;  5J9C A;  2OBI A;  4MA9 A;  5HFK A;  3H93 A;  5CRH A;  4MPG A;  3PGT A;  3IC4 A;  3KXO A;  1GSE A;  2CQ9 A;  1PRX A;  1GL8 A;  4ICY A;  2MBT A;  3EUR A;  2HRK A;  1JFU A;  5G1K A;  2H1D A;  4YAP A;  4EUY A;  3TJJ A;  3LYK A;  2IIY A;  4K7N A;  5KN2 A;  4I2U A;  4MH2 A;  3UAR A;  4DEJ A;  3ZL5 A;  4ZL9 A;  2AJQ B;  5A1N B;  1O73 A;  1WJK A;  3APO A;  3HVS A;  4YKF A;  3RHC A;  4MF7 A;  3UVH A;  4WXT A;  3FW2 A;  4CY8 A;  1DE2 A;  1GSU A;  4AI6 A;  4XRA A;  2RUE A;  2YWM A;  1FB6 A;  3KTL A;  3RPP A;  2X64 A;  4BVY A;  3APS A;  2PU9 C;  5KEJ A;  4IQA A;  3KEB A;  3QD9 A;  3QCP A;  2J9H A;  1M9B A;  3TOU A;  2BTO T;  3PH9 A;  2H6Y A;  3ME7 A;  2AUV A;  1O8X A;  4K1F A;  3CYN A;  5ELA A;  3FKF A;  3HZ8 A;  2C8U A;  4DVC A;  4KUN A;  1SK0 A;  4ZB8 A;  5IO0 A;  2N5F A;  1B9X C;  4IBP A;  3WYW A;  1TRW A;  3VI5 A;  3IOS A;  4QL7 A;  4XRD A;  4AJ8 A;  2F8A A;  2C3N A;  1SL1 B;  5IMF A;  2CZ2 A;  2WUL A;  4IVF A;  3UAP A;  2GST A;  4K2D A;  3DIE A;  1A0F A;  3ZRE A;  4KGI A;  1AQV A;  1SEN A;  2O89 A;  1K3Y A;  5DQS A;  4F9Z A;  1JZD A;  1BAY A;  3GA4 A;  1ERW A;  4KDU A;  2V6O A;  2R3X A;  2H8L A;  4NV2 A;  1EEJ A;  2VIM A;  1WIK A;  3H1N A;  1WE0 A;  2YCD A;  2E7P A;  3L0H A;  4RI7 A;  2HRK B;  2BJX A;  1Z6M A;  2X8H A;  2H6Z A;  2VLV A;  1XWC A;  4JE1 A;  5J3R A;  4TOP A;  1U3I A;  3UL3 A;  2GQL A;  2LNS A;  3QMX A;  1URM A;  4GSN A;  4K6X A;  1M7T A;  4MJB A;  3UMA A;  1B48 A;  5G5F A;  2ES7 A;  5IPG A;  1TU8 A;  1Y1U A;  1OKD A;  5GAP D;  2NPB A;  1O6J A;  4K0G A;  4MH3 A;  1NHO A;  4IGJ A;  4OCE A;  1T00 A;  5D96 A;  2KUC A;  2OBK A;  4MMM A;  4NWY A;  3ED3 A;  1GTU A;  4TXO B;  4I2T A;  1FOH A;  4PNF A;  5HR0 A;  4BVY B;  2TIR A;  5IM9 A;  4EF0 A;  4G2E A;  4HQZ A;  1K3L A;  3VWV A;  3N5O A;  2I4A A;  3ZRD A;  2GDR A;  4AKG A;  4IW9 A;  3UBL A;  2XHF A;  4WEY A;  3KP9 A;  1G7E A;  3ZML A;  1QUW A;  2R0G A;  5CNW A;  2K18 A;  4BL7 A;  1X5D A;  5KOW A;  4HU9 A;  2ON7 A;  1XW9 A;  2I3Y A;  5KN3 A;  1TW9 A;  4KW6 A;  5HFI A;  2PBJ A;  5D73 A;  3EVI A;  4TKY A;  3GKX A;  1PX7 A;  4XS4 B;  5D9T A;  4IHU A;  3A2X A;  2EC4 A;  2IMK A;  2V2G A;  2MMA A;  1O8W A;  2IJY A;  5H5R A;  5ECQ B;  3SWL A;  2HZE B;  4MF5 A;  4ACS A;  5JCW A;  11GS A;  2OT3 A;  1B8X A;  2B1L A;  5H5Q A;  1PL2 A;  4K7I A;  3GIX A;  3A3T A;  3PIN A;  2RUF A;  3FYG A;  3TJK A;  3CSI A;  1GNE A;  4K5S A;  2VM1 A;  2R0P A;  1X0R A;  3FR6 A;  1G7O A;  3EIN A;  2C3T A;  4HJM A;  4G10 A;  2ZCT A;  2C0E A;  1GWC A;  2IMI A;  3TCO A;  3KGK A;  1GUH A;  2X8C A;  4EDZ A;  4MDC A;  1HQO A;  2AB6 A;  2HLS A;  3GTU A;  3HJO A;  1MDJ A;  1UC7 A;  1T1V A;  4DSS A;  5ABR A;  3S9F A;  4XTS A;  4D73 A;  3US3 A;  1DBY A;  3DVX A;  4PQ1 A;  2DJJ A;  3ERW A;  1F6M C;  2H0I A;  3DWV A;  5ECP B;  2VL9 A;  2B5E A;  4GWR A;  4Q5R A;  2JZT A;  2L6C A;  2OE1 A;  2R0C A;  1VF1 A;  1YVL A;  4ULX A;  5DAK A;  5F07 A;  4BA7 A;  1OC8 A;  3ZVJ D;  5CRW A;  4Z2T A;  2DLX A;  3F4S A;  2DSA A;  1B9Y C;  3VLN A;  2FA4 A;  4IJ3 A;  3GUR A;  4V1A p;  6GSV A;  3M1G A;  2FLS A;  1C72 A;  2JZR A;  2NBS A;  2JSZ A;  5CRG A;  1K0M A;  5AIS A;  6GSW A;  1BF5 A;  5AIV A;  3E3E A;  2MZC A;  5CP1 A;  3H79 A;  4GLT A;  1A2M A;  2H1A A;  4NAX A;  4FO5 A;  1NSW A;  1TK0 B;  5JWR B;  10GS A;  2K6V A;  4NPB A;  1T7P B;  1ACV A;  1J9B A;  4QL9 A;  3IBH A;  4PX1 A;  1T4Z A;  3KH9 A;  4RQX A;  3L78 A;  3D21 A;  2LST A;  4TR4 A;  5D9W A;  4D73 B;  1YDK A;  4OD7 A;  4HEA 2;  1M2D A;  4JED A;  4OO4 A;  2IME A;  4I6X A;  5CRD A;  4WKW A;  1GSS A;  2GLR A;  3WGX A;  1R4W A;  1U6T A;  3IPZ A;  2C4J A;  2X8G A;  4GST A;  1V9W A;  1XWK A;  4TR1 B;  1K0D A;  5HR2 A;  1EV9 A;  5DAK B;  3TB2 A;  1U3A A;  2CAQ A;  1ZZY A;  13GS A;  9GSS A;  4FH8 A;  2WS2 A;  1MTC A;  2YZU A;  4TXV A;  6GSS A;  1BED A;  3DKS A;  3IR4 A;  3M8N A;  4IP1 A;  3KZQ A;  4OWY A;  2H30 A;  4MJE A;  5CAX A;  4WR4 A;  3GL3 A;  4NV5 A;  4OFM A;  2CAI A;  5AIX A;  1V57 A;  5IMA A;  3GYK A;  1MD3 A;  4MPF A;  2JL4 A;  1PX6 A;  4OFN A;  3IK7 A;  3C7M A;  4LMW A;  2HSN B;  1MEK A;  5EVO A;  4L0U A;  4O92 A;  2LS5 A;  1HYU A;  2VLT A;  1WOU A;  4N0V A;  3UBK A;  2CX3 A;  3HJP A;  3A5I A;  17GS A;  1F9M A;  2H75 A;  3GN3 A;  3AY8 A;  3WT1 A;  1A2L A;  3GX0 A;  1FHE A;  1Y25 A;  2L59 A;  1PN9 A;  3TKP A;  1RQM A;  5H5S A;  4MNN A;  1X5E A;  3DYR A;  1GSF A;  3EPT A;  2HSM B;  1SD8 A;  2R2J A;  2OKA A;  3VWW A;  1A23 A;  1M99 A;  4IS0 A;  5A4U A;  1V2A A;  3ZFL A;  4ZBD A;  2A4V A;  2R37 A;  3DRN A;  2YN1 A;  2OE3 A;  2YWI A;  1SKR B;  2F3M A;  4PUR A;  1LBK A;  2JZS A;  2R4V A;  1TK8 B;  2QKE A;  4GF0 A;  1NW2 A;  2A2S A;  2R5G A;  4X43 A;  5GZZ B;  2GSS A;  1B4P A;  3RHB A;  2PMT A;  4Q5Q A;  2PUK C;  6GST A;  4GQC A;  3F4R A;  5GSS A;  3O3T A;  2FHE A;  1YJ6 A;  1A8L A;  1HNC A;  5IO2 A;  4OMV A;  2GT5 A;  2P5Q A;  4GTU A;  5AGY A;  4CHS A;  3Q19 A;  2PN8 A;  1XPV A;  1F3A A;  3P7X A;  3A2V A;  2CVK A;  4JBB A;  1T3B A;  1AC1 A;  3FRC A;  2VUP A;  3LSZ A;  4BPY A;  1XWG A;  2PWJ A;  4FIW A;  4H86 A;  5ID2 A;  4AKI A;  1YZX A;  3VFI A;  3NIV A;  20GS A;  4V2L A;  3DVW A;  5B6M A;  4Z2U A;  3TU3 B;  3GRX A;  4I8B A;  4G0I A;  1B4Q A;  3G7J A;  5A5K A;  2FWG A;  1T8E B;  4BVX A;  2WCI A;  2HRF A;  1TI1 A;  1QGV A;  2QC7 A;  1DUG A;  5DQY A;  1LU4 A;  1THO A;  1SYX A;  2X99 A;  1OC3 A;  3IRA A;  1R26 A;  3VWX A;  4F82 A;  3LWA A;  5KOX A;  2H66 A;  2O7K A;  4YAV A;  1M9A A;  4O5Q A;  1SKW B;  2AAW A;  1FG4 A;  3RBT A;  2CVD A;  1EWX A;  2VO4 A;  1GTB A;  2B1K A;  1PGT A;  1XIY A;  1EOG A;  4POM A;  2O85 A;  1UVZ A;  1AIU A;  3KCM A;  3QAW A;  4EDY A;  1TJD A;  4GRF A;  2HFD A;  1R5A A;  5ECL B;  5DAL B;  2GQM A;  2TRC P;  3WGD A;  3C73 A;  2ON5 A;  2GVP A;  3HYP A;  4O32 A;  2L57 A;  1JHB A;  4AKX B;  5LD0 A;  4O7H A;  3E0U A;  4E8H A;  1YF1 A;  3ISO A;  5A34 B;  4KCE A;  3Q74 A;  2MYG A;  2M80 A;  4CDO A;  4YQU A;  3ME8 A;  1VF2 A;  2JAC A;  2LNT A;  3GKN A;  2KOK A;  2MBS A;  2C0G A;  3F4T A;  1PD2 1;  1EZK A;  1WRY A;  1N25 A;  2YWN A;  3QAG A;  1U87 A;  3RDW A;  4KSO A;  1TU7 A;  1H4O A;  3IK9 A;  5ID2 B;  3GSS A;  1AW9 A;  3IV4 A;  4GQF A;  5DCG A;  2BMX A;  3F3Q A;  3LOR A;  4V2M A;  2XPD A;  1TTZ A;  1I9D A;  2DIZ A;  3MAK A;  2LTK A;  4WBJ A;  4J57 E;  1BJX A;  4ZBA A;  12GS A;  3P2A A;  1A0R P;  3RAZ A;  5ECR B;  4LA1 A;  3MIX A;  5CYY A;  2H70 A;  3F63 A;  5HFG A;  4KDX A;  4PQI A;  4MZB A;  6GSU A;  1PQN A;  1Z5Y E;  5DJM A;  2FA8 A;  1MDK A;  2LUS A;  4IP6 A;  4POK A;  4HJ2 A;  3GST A;  1XWB A;  2XBI A;  2P31 A;  1X5C A;  2PGT A;  4G01 A;  2XC2 A;  4QQ7 A;  3IAM 2;  2HSH A;  4N3Z A;  1FAA A;  5F05 A;  1FVJ A;  3HZ4 A;  2UZ8 A;  2H71 A;  3LXZ A;  3CBU A;  5D8I A;  2CT6 A;  1EP7 A;  4FYC A;  5A5H A;  4F0C A;  3GFK A;  1XWA A;  5CRE A;  2RII A;  2A4H A;  2PVQ A;  2LEG A;  2B5Y A;  3BBY A;  4PXO A;  4KF9 A;  3LW9 A;  3G7Y A;  19GS A;  4ISD A;  4IEL A;  1EP8 A;  1OE8 A;  2E2M A;  1SJZ A;  1JLV A;  2LRN A;  1CQH A;  4ECJ A;  3W8J A;  2FNO A;  3VPQ A;  5B8A A;  4PQH A;  2DJ1 A;  2X49 A;  3BCI A;  2LQQ A;  1GSY A;  1DSB A;  1R5P A;  1XZO A;  1JZR A;  2HRA A;  5L71 A;  4LMV A;  2LQO A;  4HOJ A;  3GHA A;  3M0F A;  5C04 A;  1TKD B;  2DKH A;  3KM6 A;  3GMF A;  2MMZ A;  2WJU A;  4KB3 A;  4GCI A;  5ECI B;  4NHZ A;  4LLR A;  5HQP A;  2VKZ G;  2OE0 A;  5EPF A;  4G19 A;  1FVK A;  1WPI A;  3ZVJ A;  4G0K A;  2VD1 A;  3IA1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...