1PX6A

A folding mutant of human class pi glutathione transferase, created by mutating aspartate 153 of the wild-type protein to asparagine
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
209
structure length
209
Chain Sequence
PPYTVVYFPVRGRCAALRMLLADQGQSWKEEVVTVETWQEGSLKASCLYGQLPKFQDGDLTLYQSNTILRHLGRTLGLYGKDQQEAALVDMVNDGVEDLRCKYISLIYTNYEAGKDDYVKALPGQLKPFETLLSQNQGGKTFIVGDQISFANYNLLDLLLIHEVLAPGCLDAFPLLSAYVGRLSARPKLKAFLASPEYVNLPINGNGKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glutathione S-transferase P
publication title The multi-functional role of a highly conserved aspartic acid residue in glutathione transferase P1-1
rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 82
structure length 209
sequence length 209
chains with identical sequence B
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2003-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
A PF14497 GST_C_3 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 1px6A02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1px6A01
2FWFA 1N8JA 3I43A 5CAXA 5JWOB 3D4MA 2OADA 3GX0A 4ZL9A 5HFIA 2GQKA 4IGJA 3VPQA 1AC1A 3NIVA 1JZDA 4HOJA 3MSZA 1AUCA 4D73B 2I9HA 1Y6EA 3I9V2 1DE2A 1MTCA 4IP1A 4IVFA 5AISA 4HS1A 2LRTA 4DEJA 10GSA 1O85A 4L8EA 1ML6A 5CREA 2YWIA 6GSUA 3ZMKA 4MF6A 1K0OA 4TR3A 4GQCA 3VWVA 2R3XA 3IDVA 3RPPA 4NXIA 3FR3A 1YF1A 2DJKA 4TR1A 2GTUA 2HYXA 1O6JA 2GSTA 2RM6A 2N5BA 2PMTA 4HJMA 1MDIA 2GSSA 4YQUA 5ECHB 3FHKA 5COHA 5KN3A 4POBA 4DVCA 2DSAA 2WDUA 3H79A 1X5CA 4G0LA 1NW2A 1O81A 2N5AA 3BBYA 4MJAA 2GZPA 2B1KA 1YJ6A 1XWGA 5CP1A 1DUGA 1FVKA 2GSRA 2NPBA 5KN2A 2M72A 4QL9A 4DSSB 5J4UA 3F3RA 5IQYA 2H74A 2GGTA 4TRXA 2PBJA 3Q19A 5CNWA 2NBSA 3EURA 2IN3A 1U87A 5ECSA 4V2NA 1V2AA 2JZTA 4V2LA 2PPTA 4WF5A 1GUKA 3D5JA 4WBRD 3UJ1A 5ECKB 3W8JA 2VOCA 3KP9A 3FR9A 1RK4A 4EDZA 1GULA 3TCOA 3O3TA 4J57E 5IPGA 1V57A 3UVTA 4XIHA 1K3YA 5ELAA 2RM5A 3ZIVA 1WE0A 3TOUA 4WBJA 2FUG2 2MMAA 4AF2A 2H30A 3RDWA 2VL2C 8GSSA 4JR6A 3TB2A 6GSXA 2DMLA 3DXBA 3QDNA 2ON7A 3IPZA 19GSA 5F06A 1JZRA 1E2YA 1USBA 2H1BA 3LSZA 3WYWA 3PGTA 4ECCA 3EINA 3KXOA 5JCUA 2OACA 2YOIA 2DBCA 2H0GA 4HI7A 4POKA 1GWCA 2L6CA 4HU7A 4ZXGA 3H4KA 3EU3A 16GSA 3KH9A 1F9MA 2FHEA 2PU9C 3GV1A 3CRTA 3LXZA 3QD9A 2GVPA 5KN1A 3L9UA 4KW6A 3TJJA 1THOA 2WS2A 3F63A 2V41A 4FO5A 3MAKA 4LMWA 2K8SA 4F03A 4GCIA 3IBHA 3QR6A 4J2FA 1MD4A 2GZZA 3HY2A 3IRAA 14GSA 1RQMA 4I5QA 1FB0A 1VF2A 2AJQB 2N5FA 4E8EA 1VGLA 5D9WA 2HI7A 2FA8A 3HHVA 1ZMAA 4I97A 6GSSA 2M46A 2I1UA 1G7OA 2BTOT 2KP1A 2X99A 4GLTA 1SD9A 1ABAA 2MMZA 2CVBA 4PQHA 4GSTA 3UAPA 3AY8A 2CZ2A 1KTEA 2YWMA 2CAIA 2LV3A 1QK8A 4ZL8A 3VURA 1AIUA 2H01A 3KGKA 2WFCA 4CW9A 2E2MA 13GSA 3GN3A 4K9ZA 3ZZXA 2D2ZA 3Q18A 1EOGA 1Q98A 1O8WA 2VL9A 1F6MC 3LXTA 5DAKA 4GSNA 4QL7A 1ERTA 4ISDA 1AQVA 3GSTA 3CTFA 4XCSA 4AGSA 2C1YA 1ON4A 1SKSB 4BL7A 4PXOA 3C1SA 2YZUA 4O92A 2MMOA 3FKFA 1XW5A 2F8FA 2HSMA 2H71A 3M8NA 2TRCP 3APOA 4I8BA 3M0FA 2YZHA 3ZVJD 1ILOA 4FYBA 4TKYA 1B48A 5HR2A 2FWEA 2B7KA 2DIZA 3IA1A 5IMCA 4JBBA 2LRCA 2KHPA 4K1FA 2OKAA 3CSJA 4N0ZA 4KDYA 1ZGNA 2HRKA 3R3EA 4IQ1A 4I6XA 1A8LA 1M2DA 1GNWA 2H19A 2MBSA 1S3CA 2FWGA 1CQGA 1SKWB 2B5EA 3C7MA 4PUAA 3EWLA 1A0RP 2OBKA 2VCXA 1R4WA 1G0TA 4L0UA 3M1GA 1KBNA 1H75A 2PVQA 4NPBA 2I4AA 2K8VA 2KUCA 1TK5B 3VI5A 4TXOB 5H5SA 5B8BA 1V40A 2RUEA 1MDKA 1FO5A 4K7NA 4N0VA 4JE1A 1PKWA 1QMVA 3GRXA 1Z9HA 3ZYWA 3L9VA 1ZYEA 2YWOA 2VIMA 2VCQA 4K2DA 4GWRA 2H73A 3N9JA 1WJKA 5BMUA 5HR3A 2YN1A 2KOKA 4MMMA 3W6GA 1PL2A 4NAXA 4NMUA 4EO3A 5G5EA 4ILFA 3LYPA 3IE3A 5CO3A 5IMDA 1UVZA 4KSOA 1GSUA 1M2AA 4XTSA 3DD3A 2C3TA 3HYPA 1TXXA 3A3TA 1GSEA 2H66A 1PX7A 1V58A 1JFUA 3KIJA 3CXGA 5J9BA 3GHAA 1IYHA 3FZ4A 1BEDA 2LSTA 5F05A 1OVNA 4X1UA 1X9WB 3P2AA 3CBUA 4OO4A 4ZBDA 2YCDA 4BPYA 3J7Yk 4ECJA 5D9VA 3J7Yb 5DQYA 3FZAA 3HZ8A 3WT1A 1XWAA 3RBTA 5ENUA 2RUFA 3WGEA 3FW2A 2O89A 1Z3EA 2C3QA 3VK9A 1DE1A 1U3AA 3D6IA 1K0BA 3L9SA 3FEUA 3WD6A 2LTKA 4O32A 5D96A 3ME7A 3F6DA 2C0FA 3HVSA 4XRAA 1U88A 4KNDA 5GAND 2C4JA 2VD0A 3TOTA 3ZVJA 5ID2B 3FRCA 3H93A 3QAVA 1LBKA 2OE3A 1TJDA 2EIQA 2H6XA 4XS4B 2NTOA 4BVYA 4BVXB 4MZCA 3DKSA 4G19A 4F0CA 1M9AA 1PA3A 5C04A 1O8XA 2QKEA 1PKZA 1JZWA 5JCGA 3KMNA 1CQHA 4J56E 1GSYA 3ME8A 3VPTA 4JRRA 3GTUB 1TRUA 2E2GA 3IC8A 3GKNA 4KDUA 1THXA 1ERVA 3KZQA 3VLNA 4K7OA 3A2WA 5ELGA 4MPFA 1SK2A 1GUMA 3QAWA 2ZCTA 2MYGA 3TKSE 3CSHA 3VWWA 12GSA 2CX4A 5AIVA 1T7PB 3UVHA 1BX9A 3RPNA 4OMVA 2B5XA 1ERUA 3ZREA 5GSTA 3KCMA 3V1WA 3D21A 4TR4A 1G7EA 2WJUA 4RQXA 2K18A 4OWYA 1FB6A 1BYEA 3O6TA 3UARA 1NM3A 2JADA 4KDXA 4WXTA 3FK8A 4G0KA 3ZIJA 1GLPA 4WF4A 3D0ZA 1XZOA 3P90A 2DJ3A 4DSSA 2WCIA 2AV4A 1TU8A 5CRGA 2DMMA 2LJKA 3KD0A 3BCIA 6GSWA 3APQA 4TVEA 4Q5NA 4MP4A 4KX4A 1SJIA 4PQIA 4K6XA 2EIRA 5ABRA 2IMDA 4TR0A 1GP1A 1A2LA 3JCML 2L4CA 2L6DA 5ECPB 3Q74A 5B6NA 2A2RA 2YP6A 1EV9A 2G0FA 5FHIA 3QFBC 1FW1A 2HZEA 2B7JA 3HJPA 2H1GA 2WB9A 3FZ5A 4MH2A 5ECNB 4POLA 5A4VA 2R4VA 2K9FA 2OBIA 2G2QA 2C0DA 1OC8A 3BOAA 1HNAA 1B9YC 3UEMA 2JSZA 2VCTA 2CV4A 1OC9A 1JLWA 5DALB 2PWJA 3HVVA 5G30A 3M3MA 2VO4A 3LYKA 1J0FA 4ZBAA 3DIEA 1WMJA 1XFLA 1GTIA 3TGZA 1XVQA 4K7IA 4I2UA 4LLRA 4KAEA 5DDLA 1X0RA 2VCVA 4KA0A 1QGVA 1OKDA 5IM9A 3F4TA 2C80A 1FAAA 3QPMA 1NSWA 1T4ZA 3HVXA 3IV4A 2GQMA 4QQ7A 2LJAA 4WETA 5IMVA 1Q4JA 5D93A 4LMVA 1PD21 1I9DA 2XPEA 5D8IA 3DVXA 5IO0A 2FCHA 3PPUA 2V1MA 1ZL9A 1GTBA 1TU7A 4ID0A 4KB3A 3F0IA 3E0UA 1SK1A 5H5RA 2IFQA 3EMPA 2GT6A 4RI6A 3NZNA 5JCWA 5DCHA 1FVJA 4Q5QA 1SYRA 2DIYA 2HSNB 1QUWA 6GSTA 1B4PA 4TN8A 5G31A 3LJRA 3UBKA 3EU4A 4DSRA 2H8LA 2EC4A 2VCWA 5JWQB 2O85A 3QMXA 2VD1A 2CQ9A 1OAZA 4XS1A 3IAS2 4ECIA 1SD8A 1ERWA 1ZZYA 4Q5FA 2IMEA 1TI3A 4IS0A 4RI7A 4TOPA 1YY7A 2DJ2A 1SL0B 2H6ZA 1TK0B 2E7PA 5IPHA 1ZYQB 3GYKA 5D9TA 2JZSA 5IMZA 1PX6A 5J5NA 1KNGA 3VFIA 3K8NA 2FWHA 2B5YA 1K0NA 5DAKB 1XWBA 1EGOA 3HJOA 4JEDA 4CDOA 3RHCA 2B1LA 2EIOA 4BL7B 1HQOA 1G6YA 2LNTA 1E6BA 5AGYA 2H70A 3QAGA 5KEJA 4FYUA 3TRXA 1B4QA 20GSA 2Z9SA 3ZMLA 4PGTA 3KTLA 2YPMA 2MBTA 3EVIA 1FHEA 4KH7A 1QQ2A 2V2GA 2PUKC 1AW9A 3TKSA 5H5QA 2QC7A 1XBSA 1PGTA 3CTGA 4IN0A 1C72A 4L5OA 3UIWA 5EY6A 4HDEA 3FY7A 1XPVA 1HNCA 1SL2B 4G9HA 1BJXA 1A24A 4E8HA 3IXRA 2K6VA 4ZB6A 2H0IA 1TKDB 4YQMA 1XOAA 2LNSA 4OFMA 4EXJA 1RW1A 2L57A 1WWJA 2B6MA 1T4YA 1T00A 5GSSA 4HUAA 5AIXA 1TW9A 3ZL5A 3KMOA 3EE2A 3FR6A 1GSSA 1X5EA 4OCEA 5JWRB 2HZFA 5DBQA 3KP8A 2PN8A 2WGRA 4EE0A 3VWUA 1TDIA 5CYYA 2HRFA 4PQ1A 2PVOC 4F9ZA 1XCCA 3TJGA 3QCPA 4EKZA 1GH2A 1OC3A 5GZZB 4BA7A 2H75A 3I6AA 4KE3A 5DVBA 3WGDA 1XW9A 5CRWA 1DBYA 3HXSA 4KCEA 5G1KA 3HD5A 3BJ5A 1ZCPA 5INYA 5EL8A 1K3LA 4MJEA 2FLSA 3UBLA 3OR5A 4WKWA 1TI1A 4HEA2 4NV5A 1GRXA 4OCFA 2XBIA 2HFDA 3EC3A 1GUHA 3LFLA 2V32A 4MDCA 5A4WA 2FD3A 3ZTLA 4OFNA 1X5DA 3QOUA 2YNXA 5HR0A 3G9BA 1K0DA 4NWYA 1URMA 1T8EB 3SBCA 5C00A 3F4SA 3APSA 1SJZA 5HFGA 5ECQB 1NHOA 2ON5A 2H1AA 3BCKA 4FIWA 5DCGA 1VF1A 3KTBA 1J08A 3ERGA 3M9JA 2GDRA 4IBPA 4ACSA 2LQQA 2KLXA 5E4WA 4N11A 1PN9A 1SL1B 4G2EA 1EP8A 3QFAC 2E0QA 1A0FA 1AAZA 1PMTA 1U6TA 3E3EA 5A5KA 1EWXA 1Y25A 1GLQA 2ES7A 1A23A 5ECIB 1FG4A 5E59A 2P0GA 4EVMA 1SK0A 3L0HA 5A4UA 3SWLA 5LCZA 2LQOA 4FYCA 2M80A 1VF4A 3HA9A 3TKQA 2L4QA 3IK7A 4F82A 4PURA 2CX3A 1R5AA 2YANA 1XWKA 4IP6A 4HZ2A 1A2JA 2O7KA 3C73A 3DVWA 5G5FA 3DGQA 1UA5A 2NVLA 4PNGA 4D73A 1X9MB 1QFNA 3KEBA 3LEFA 7GSSA 3HJMA 2LUSA 2TRXA 3GTUA 2LS5A 4ZBBA 3TUEA 3HCZA 3US3A 4OD7A 2DJJA 1VRSD 2JZRA 5IMFA 5DJMA 4PX1A 2YJ7A 2HNLA 1M9BA 2YJHA 2L5OA 4MABA 2JSYA 5D73A 4BVYB 2AB6A 3E9JB 1YKCA 4L5LA 4KF9A 2DC5A 2LRNA 1M7TA 2HSHA 1GTUA 3A2VA 4FH8A 3GMFA 1WOUA 4ECBA 1N2AA 5B6MA 1YDKA 4AJ8A 1TP9A 1TRVA 1EOHA 1V9WA 1XOBA 3GKMA 3BD2A 2H0HA 4GTUA 1AQXA 2VLTA 2OE1A 4TXVA 5J41A 1YKAA 1EEMA 4MPGA 2IPAA 4YAVA 2DLXA 5IOXA 4OFTA 2UZ8A 4JZQA 4USSA 4PUFC 3KH7A 4OO5A 3GKXA 1R26A 3UOMA 5G1LA 2F8AA 3GKKA 3G7JA 3RHBA 4GQFA 1J9BA 1GNEA 3UMAA 4JU5A 1HYUA 1S3DA 6GSVA 3TRQA 2V6OA 4TR1B 2AUVA 3U6VA 1T3BA 5B7CA 4MA9A 2FY6A 2YWNA 4GXZA 2O87A 2F3MA 2IMIA 2JU5A 2CZ3A 2I3YA 4V1Ag 3TKRA 2R2JA 2HRNA 4AJ7A 5CRHA 5DJLA 2X8GA 1EEJA 3D22A 2CVDA 3H1NA 3FYGA 2YV7A 1A8YA 1TK8B 1TRWA 2WZ9A 5AN1A 3IHQA 3F9UA 4L0WA 4N10A 2FA4A 2AYTA 3LWAA 5IOWA 1HNBA 1V98A 2X8CA 4LL1B 1F3BA 4GRFA 4F0BA 1LU4A 2B3SA 1DSBA 2IMFA 3PR8A 3Q6OA 3G7IA 3VWXA 3C71A 1F3AA 1G6WA 2REMA 5DALA 4HZ4A 2V6KA 4MH3A 4IJIA 1OYJA 5FT3A 4O5RA 3M9KA 2X8HA 2JL4A 1AQWA 4NV2A 3IR4A 5L71A 1M0UA 2HZEB 2MMNA 5DQSA 5IIZA 4KGIA 3ISOA 2O8VB 4KSMA 4H86A 3N5OA 2I81A 3DEXA 3TJBA 2MZCA 2XBQA 3ZFLA 4ZL7A 3TJKA 1Z7RA 4WR4A 1F2EA 1GSFA 1I5GA 1SYXA 4O7HA 3GH6A 3TRPA 1OC9B 3GNJA 11GSA 3WGXA 1B9XC 3CSIA 3IOSA 1SJ6A 1O7UA 4WR5A 5ECLB 1K0AA 1JHBA 2OE0A 1KEBA 1VF3A 4IJ3A 5HQPA 4ML6A 4X43A 5B8AA 4JR4A 2VL2A 4ZILA 3EYTA 3GIXA 2PERA 2R5GA 1O73A 2H6YA 4DSQA 1WP0A 5F07A 1ST9A 2WULA 4Q5RA 4ZB9A 4EC0A 3C1RA 1HD2A 2ZNMA 1B8XA 1GSQA 3U5RE 4HJ2A 4PNFA 2VM1A 5ECMB 2IWTA 2LKUA 4LA1A 3HZ4A 2A4VA 3GFKA 2C8UA 2BMXA 3GX8A 4NHZA 1TTZA 1K0CA 5F0GA 4IQAA 2P5RA 4V1Ap 18GSA 1U3IA 3R2QA 1H4OA 4ML1A 2F9SA 1Z5YE 1SU9A 1UC7A 4LL4B 4POMA 1AXDA 2IFQB 2R37A 1QXHA 4ULXA 1Z6NA 2RIIA 3GL5A 1TOFA 2ALBA 4IW9A 3TKSC 1OE8A 3ZLPA 5IMAA 2HSYA 4G0IA 2VUPA 3ERWA 5D9XA 2F51A 2IJYA 6GSYA 1YQ1A 1XW6A 1YZXA 1R5PA 2L5LA 5EPFA 5G2ZA 3PH9A 3IK9A 1K3OA 2CT6A 2A2SA 1EGRA 1FOVA 5LNKe 4K0NA 1EZKA 2HXKA 1A2MA 3ED3A 3LQ7A 1W89A 1MD3A 4Z7XA 1Z7PA 4RUVA 1W4VA 2GT5A 3F4RA 3L78A 1GL8A 2HSMB 2HE3A 2VLUA 3KJYA 1YEXA 1M2BA 3PINA 4IHUA 2H76A 3GURA 2NDOA 2AAWA 4I2TA 3UL3A 1Z6MA 2VL3A 2YV9A 3MWHA 4MZBA 3DYRA 4PTSA 2DJ1A 3LORA 4GF0A 4ZB8A 2IIYA 2J23A 2H1DA 2P31A 3NOFA 3LGCA 2FGXA 1YEPA 4EDYA 5IO2A 1PSQA 2GZYA 3D4TA 4XS6A 4YAPA 1MDJA 3WT2A 3HDCA 2QGVA 2IMKA 1XIYA 2HRKB 3HKRA 3KM6A 4WEYA 4TXOA 3RAZA 2TIRA 4YH2A 5J3RA 1WPIA 3F3QA 1OE7A 4MK3A 1PL1A 2GQLA 3CYNA 2RLIA 1PQNA 4MCUA 1S3AA 4EUYA 1EV4A 2HLSA 1F37A 4XRDA 4MJCA 4MF7A 4RQRA 4EL1A 1K0MA 1BAYA 3GSSA 4N30A 2C0EA 4BWSA 3O76A 4G10A 2XHFA 3CRUA 4HQSA 3VI7A 2ZUPA 5J9CA 5EVOA 4CHSA 1WIKA 2OA7A 3TDGA 1NHYA 2DJ0A 9GSSA 3IC4A 1TRSA 1GTAA 1XWCA 4EF0A 2GSQA 4NHWA 4KUNA 2VLVA 1YF0A 1SKRB 5F8BA 2LEGA 3LG6A 2R6KA 3ZRDA 2AHEA 3MNGA 2CVKA 1UN2A 3F6FA 5ECRB 5KN0A 1BG5A 4K8MA 3P7XA 3W8SA 2CAQA 4MJBA 4AJ6A 4TW5A 4F2IA 3F8UA 2VAFA 2WRTA 1PRXA 1GSDA 2HT9A 1T1VA 3A5WA 1JZOA 3S9FA 22GSA 3G7YA 3ZITA 2C3NA 4HQZA 2OJLA 1M99A 3EMXA 5LD0A 1EP7A 3FZ9A 3GUSA 3IAM2 4FQUA 3DWVA 4MLYA 3H8QA 3P8WA 2VCZA 3I69A 4KCAA 4HU9A 2HRAA 4IELA 3DMLA 2CA8A 4YQVA 1X9SB 3A2XA 3DRNA 4V2MA 2GS3A 5HFKA 4MF5A 1BQ7A 3TKPA 2H72A 4P3YB 1WRYA 4BWQA 2PGTA 5HR1A 3L4NA 1LJRA 2IL3A 1ZOFA 2L59A 4IKHA 1SENA 4MZWA 2X64A 5ECOB 2BJXA 5CRDA 1IYIA 1MEKA 2XPDA 5ID2A 1R7HA 2LJRA 2P5QA 3ERFA 2JACA 1XXUA 5GAPD 4XS4A 4GSSA 17GSA 3TJFA 4K0GA 4BVXA 2QSIA 3GH9A 4ZIJA 2GLRA 4X0XA 2C0GA 2VM2A 2XC2A 1JLVA 3ZFBA 4XHMA 1OKTA 3GA4A 1XVWA 3MDKA 2KP2A 1ACVA 2J9HA 3GL3A 5FWGA 2FNOA 3C8EA 3CMIA 2HQTA
chains in the Genus database with same CATH superfamily
2FWFA 1N8JA 3I43A 5CAXA 5JWOB 3D4MA 2OADA 3GX0A 4ZL9A 5HFIA 2GQKA 4IGJA 3VPQA 1AC1A 3NIVA 1JZDA 4HOJA 3MSZA 1AUCA 4D73B 2I9HA 1Y6EA 3I9V2 1DE2A 4O5QA 2VKZG 1MTCA 4IP1A 4IVFA 5AISA 4HS1A 2LRTA 4DEJA 10GSA 1O85A 4L8EA 1ML6A 5CREA 2YWIA 6GSUA 3RGBC 3ZMKA 4MF6A 3MIXA 1K0OA 4TR3A 4GQCA 3VWVA 2R3XA 3IDVA 3RPPA 4NXIA 3FR3A 1YF1A 2DJKA 4QMKA 4TR1A 2GTUA 2HYXA 1O6JA 2GSTA 1BF5A 2RM6A 2N5BA 2PMTA 4HJMA 1MDIA 2GSSA 4YQUA 5ECHB 3FHKA 5COHA 5KN3A 4POBA 4DVCA 2DSAA 2WDUA 3H79A 1X5CA 4G0LA 1NW2A 1O81A 2N5AA 3BBYA 4MJAA 2GZPA 2B1KA 1YJ6A 1XWGA 5CP1A 1DUGA 1FVKA 2GSRA 2NPBA 5KN2A 2M72A 4QL9A 4DSSB 5J4UA 3F3RA 5IQYA 2H74A 2GGTA 4TRXA 2PBJA 3Q19A 1BG1A 5CNWA 2NBSA 3EURA 2IN3A 1U87A 5ECSA 4V2NA 1V2AA 2JZTA 4V2LA 2PPTA 4WF5A 4HSCX 1GUKA 3D5JA 4WBRD 3UJ1A 5ECKB 3W8JA 2VOCA 3KP9A 4Z2TA 3FR9A 1RK4A 4EDZA 1GULA 3TCOA 3O3TA 4J57E 5IPGA 1FOHA 1V57A 3UVTA 4XIHA 1K3YA 5ELAA 2RM5A 3ZIVA 1WE0A 3TOUA 4WBJA 2FUG2 2MMAA 4AF2A 2H30A 3RDWA 2VL2C 8GSSA 4JR6A 3TB2A 6GSXA 2DMLA 3DXBA 3QDNA 2ON7A 3IPZA 19GSA 5F06A 4BIKA 1JZRA 1E2YA 1USBA 2H1BA 3LSZA 3WYWA 3PGTA 4ECCA 3EINA 3KXOA 5JCUA 2OACA 2YOIA 2DBCA 2H0GA 4HI7A 4POKA 1GWCA 2L6CA 4HU7A 4ZXGA 3H4KA 3EU3A 16GSA 3KH9A 1F9MA 2FHEA 3CWGA 2PU9C 3GV1A 3CRTA 3LXZA 3QD9A 2GVPA 5KN1A 3L9UA 4KW6A 3TJJA 1THOA 2WS2A 3F63A 5A1NA 2V41A 4FO5A 3MAKA 4LMWA 2K8SA 4F03A 2HSNA 4GCIA 3IBHA 3QR6A 4J2FA 1MD4A 2GZZA 3HY2A 1PFOA 3IRAA 14GSA 1RQMA 4I5QA 1FB0A 1VF2A 2AJQB 2N5FA 4E8EA 1VGLA 4ICYA 5D9WA 2HI7A 2FA8A 3HHVA 1ZMAA 2WW1A 4I97A 6GSSA 2M46A 2I1UA 1G7OA 2BTOT 2KP1A 2X99A 4GLTA 1SD9A 2MMZA 1ABAA 2CVBA 4PQHA 4GSTA 3UAPA 2OT3A 3AY8A 2CZ2A 1KTEA 2YWMA 2CAIA 2LV3A 1QK8A 4ZL8A 3VURA 1AIUA 2H01A 3KGKA 2WFCA 4CW9A 5BRTA 2E2MA 13GSA 3GN3A 4K9ZA 3ZZXA 2D2ZA 3Q18A 1EOGA 1Q98A 1O8WA 2VL9A 3TU3B 1F6MC 3LXTA 5DAKA 4GSNA 4QL7A 1ERTA 4ISDA 1AQVA 4E68A 3GSTA 3CTFA 4XCSA 2WW2A 4AGSA 2C1YA 1ON4A 1SKSB 4BL7A 4PXOA 3C1SA 2YZUA 4O92A 2MMOA 2EFEA 3FKFA 1XW5A 2F8FA 2HSMA 2H71A 5KOWA 2DKIA 3M8NA 2TRCP 3APOA 4I8BA 3M0FA 2YZHA 3ZVJD 1ILOA 4FYBA 4TKYA 1B48A 5HR2A 2FWEA 2B7KA 4CY6A 2DIZA 3IA1A 5IMCA 4JBBA 2LRCA 2KHPA 4K1FA 2OKAA 3CSJA 4O5UA 4N0ZA 4KDYA 1ZGNA 2HRKA 3R3EA 2O5VA 4IQ1A 4I6XA 1A8LA 1M2DA 1GNWA 2H19A 2MBSA 1S3CA 2FWGA 1CQGA 1SKWB 2B5EA 3C7MA 4PUAA 3EWLA 2EFDA 2WVXA 1A0RP 2OBKA 2VCXA 1R4WA 1G0TA 4L0UA 3M1GA 1KBNA 1H75A 2PVQA 4NPBA 2I4AA 4CY8A 2K8VA 2KUCA 1TK5B 3VI5A 4K5SA 4TXOB 5H5SA 5B8BA 1V40A 2RUEA 1MDKA 1FO5A 4K7NA 4N0VA 4JE1A 1PKWA 1QMVA 3GRXA 1Z9HA 3ZYWA 3L9VA 1ZYEA 2YWOA 2VIMA 2VCQA 4K2DA 4GWRA 2H73A 3N9JA 1WJKA 5BMUA 5HR3A 2YN1A 2A4HA 2KOKA 2X4AA 4MMMA 3W6GA 1PL2A 4NAXA 4NMUA 4EO3A 5G5EA 4ILFA 3LYPA 3IE3A 5CO3A 5IMDA 1UVZA 4KSOA 1GSUA 1M2AA 4XTSA 3DD3A 2C3TA 3HYPA 1TXXA 3A3TA 1GSEA 2H66A 1PX7A 1V58A 4AKXB 1JFUA 3KIJA 3CXGA 5J9BA 3GHAA 1IYHA 3FZ4A 1BEDA 3A5IA 2LSTA 1I1IP 5F05A 1OVNA 4X1UA 1X9WB 3P2AA 3CBUA 4OO4A 4ZBDA 2YCDA 4BPYA 3J7Yk 4ECJA 5D9VA 3J7Yb 5DQYA 3FZAA 3HZ8A 3WT1A 1XWAA 3RBTA 5ENUA 2RUFA 3WGEA 3FW2A 2O89A 1Z3EA 4AKHA 2C3QA 3VK9A 1DE1A 1U3AA 3D6IA 1K0BA 3L9SA 3FEUA 3WD6A 2LTKA 4O32A 5D96A 3ME7A 3F6DA 2C0FA 3HVSA 4XRAA 1U88A 4KNDA 5GAND 2C4JA 2VD0A 3TOTA 3ZVJA 5ID2B 3FRCA 3H93A 3QAVA 1LBKA 2OE3A 1TJDA 2EIQA 2H6XA 4XS4B 2NTOA 4BVYA 4BVXB 4MZCA 3DKSA 4G19A 4F0CA 1M9AA 1PA3A 5C04A 1O8XA 2QKEA 1PKZA 1JZWA 5JCGA 3KMNA 1CQHA 4J56E 1GSYA 3ME8A 3VPTA 3CQFA 4JRRA 3GTUB 1TRUA 2E2GA 3IC8A 3GKNA 4KDUA 2A2PA 1THXA 1ERVA 3KZQA 3VLNA 4K7OA 3A2WA 5ELGA 4MPFA 1SK2A 1GUMA 3QAWA 2ZCTA 2MYGA 3TKSE 3CSHA 3VWWA 12GSA 2CX4A 5AIVA 1T7PB 3UVHA 2R0PA 1TXUA 1BX9A 3RPNA 4OMVA 2B5XA 1ERUA 3ZREA 5GSTA 3KCMA 3V1WA 3D21A 4TR4A 1G7EA 2WJUA 4RQXA 4PHZC 2K18A 4OWYA 1FB6A 1BYEA 3O6TA 3UARA 1NM3A 2JADA 4KDXA 4WXTA 3FK8A 4G0KA 3ZIJA 1GLPA 4WF4A 3D0ZA 1XZOA 3P90A 2DJ3A 4DSSA 2UV8G 2WCIA 4Z2UA 2AV4A 1TU8A 2WZSA 5CRGA 2DMMA 2LJKA 3KD0A 3BCIA 6GSWA 3APQA 4TVEA 4Q5NA 4MP4A 2O3EA 4KX4A 1SJIA 4PQIA 4K6XA 2EIRA 5ABRA 2IMDA 4TR0A 1GP1A 1A2LA 3JCML 4ZB7A 2L4CA 2L6DA 5ECPB 3Q74A 5B6NA 2A2RA 2YP6A 1EV9A 2G0FA 5FHIA 3QFBC 1FW1A 2HZEA 2B7JA 3HJPA 2H1GA 2WB9A 3FZ5A 4MH2A 5ECNB 4POLA 5A4VA 2R4VA 2K9FA 2OBIA 2G2QA 2C0DA 1OC8A 3BOAA 1HNAA 1B9YC 3UEMA 2JSZA 2VCTA 2CV4A 1OC9A 1JLWA 5DALB 2PWJA 3HVVA 5G30A 3M3MA 2VO4A 3LYKA 1J0FA 4ZBAA 3DIEA 4MNNA 1WMJA 1XFLA 1GTIA 3TGZA 1XVQA 4K7IA 4I2UA 4LLRA 4KAEA 5DDLA 4EIQA 1X0RA 2VCVA 4KA0A 1QGVA 1OKDA 5IM9A 3F4TA 2WW3A 2C80A 1FAAA 3QPMA 1NSWA 1T4ZA 3HVXA 3IV4A 2GQMA 4QQ7A 5A34A 2LJAA 4WETA 3HMJG 5IMVA 1Q4JA 5D93A 4LMVA 4K5RA 1PD21 1I9DA 2XPEA 5D8IA 3DVXA 5IO0A 2FCHA 3PPUA 2V1MA 1ZL9A 1GTBA 1TU7A 4ID0A 4KB3A 3F0IA 3E0UA 1SK1A 5H5RA 5A1NB 2IFQA 3EMPA 2GT6A 4RI6A 3NZNA 5JCWA 5DCHA 1FVJA 4Q5QA 1SYRA 2DIYA 2HSNB 1QUWA 6GSTA 1B4PA 4TN8A 5G31A 3LJRA 3UBKA 3EU4A 4DSRA 2H8LA 2EC4A 2VCWA 5JWQB 2O85A 3QMXA 2VD1A 2CQ9A 1OAZA 4XS1A 3IAS2 4ECIA 1SD8A 1ERWA 1ZZYA 4Q5FA 2IMEA 1TI3A 4IS0A 4N3ZA 4RI7A 4TOPA 1YY7A 2DJ2A 1SL0B 2H6ZA 1TK0B 2E7PA 5IPHA 1ZYQB 3GYKA 5D9TA 2JZSA 2QA1A 5IMZA 1PX6A 5J5NA 1KNGA 3VFIA 3K8NA 2FWHA 2B5YA 1K0NA 5DAKB 1XWBA 1EGOA 4YKGA 3HJOA 4JEDA 4CDOA 3RHCA 2B1LA 2EIOA 3RFRC 4BL7B 1HQOA 1G6YA 2LNTA 3IHGA 1E6BA 5AGYA 2H70A 3QAGA 5KEJA 4FYUA 3TRXA 1B4QA 20GSA 3EPTA 2Z9SA 3ZMLA 4PGTA 5KOXA 3KTLA 2YPMA 2MBTA 4AI6A 3EVIA 1FHEA 2R0CA 4KH7A 1QQ2A 2V2GA 2PUKC 1AW9A 1ZYNA 3TKSA 5H5QA 2WW0A 2QC7A 1XBSA 1PGTA 3CTGA 4IN0A 2QA2A 1C72A 4L5OA 3UIWA 5EY6A 4HDEA 3FY7A 1XPVA 1HNCA 1SL2B 1S4BP 4G9HA 1BJXA 1A24A 4E8HA 3IXRA 2K6VA 4ZB6A 2H0IA 1TKDB 4YQMA 1XOAA 2LNSA 1YVLA 4OFMA 4EXJA 1RW1A 1N25A 2L57A 1WWJA 2B6MA 1T4YA 1T00A 5GSSA 4HUAA 5AIXA 1TW9A 3ZL5A 3KMOA 3EE2A 3FR6A 1GSSA 1X5EA 4OCEA 5JWRB 2HZFA 5DBQA 3KP8A 2PN8A 2WGRA 4EE0A 3VWUA 1TDIA 5CYYA 2HRFA 4PQ1A 2PVOC 4F9ZA 1XCCA 3TJGA 3QCPA 4EKZA 1GH2A 1OC3A 5GZZB 4BA7A 2H75A 3I6AA 4KE3A 3LW9A 5DVBA 3WGDA 1XW9A 5CRWA 1DBYA 3HXSA 4KCEA 5G1KA 3HD5A 3BJ5A 1ZCPA 5INYA 5EL8A 1K3LA 4MJEA 4G01A 2FLSA 3UBLA 3OR5A 4WKWA 1TI1A 4HEA2 4NV5A 1SVOA 1GRXA 4OCFA 2XBIA 2HFDA 3EC3A 1GUHA 3LFLA 2V32A 4MDCA 5A4WA 2FD3A 3ZTLA 1SVLA 2H1LA 4OFNA 5BMUB 1X5DA 3QOUA 2YNXA 5HR0A 3G9BA 1K0DA 4NWYA 1URMA 1T8EB 3SBCA 5C00A 3F4SA 3APSA 1SJZA 5HFGA 5ECQB 1NHOA 2ON5A 2H1AA 3BCKA 4FIWA 5DCGA 1VF1A 4EIPA 3KTBA 1J08A 3ERGA 3M9JA 2GDRA 4IBPA 4ACSA 2LQQA 2KLXA 5E4WA 4N11A 1PN9A 1SL1B 4G2EA 1EP8A 3QFAC 1PN0A 2E0QA 1A0FA 1AAZA 1PMTA 1U6TA 3E3EA 5A5KA 1EWXA 1Y25A 1GLQA 2ES7A 4FXYP 1A23A 5ECIB 1FG4A 5E59A 2P0GA 4EVMA 1SK0A 3L0HA 5A4UA 3SWLA 2EFHA 5LCZA 2LQOA 4FYCA 2M80A 1VF4A 3HA9A 3TKQA 4YKFA 2L4QA 3IK7A 4F82A 4PURA 2CX3A 1R5AA 5A5HB 2YANA 1XWKA 4IP6A 4HZ2A 1A2JA 2O7KA 3C73A 3DVWA 5G5FA 3DGQA 1UA5A 2NVLA 4PNGA 4D73A 1X9MB 1QFNA 3KEBA 3LEFA 7GSSA 3HJMA 2LUSA 2TRXA 3GTUA 2LS5A 4ZBBA 3TUEA 3HCZA 3US3A 4OD7A 2DJJA 1VRSD 2JZRA 5IMFA 5DJMA 4PX1A 2YJ7A 2HNLA 1M9BA 2YJHA 2L5OA 4MABA 2JSYA 5D73A 4BVYB 2AB6A 3E9JB 3FMWA 1YKCA 4L5LA 4KF9A 2DC5A 2LRNA 1M7TA 2HSHA 1GTUA 3A2VA 4FH8A 3GMFA 1WOUA 4ECBA 1N2AA 5B6MA 1YDKA 4AJ8A 1S3RA 1TP9A 1TRVA 1EOHA 1V9WA 1XOBA 3GKMA 3BD2A 2H0HA 4GTUA 1AQXA 2VLTA 3HVNA 2OE1A 4TXVA 5J41A 1YKAA 1EEMA 4MPGA 2IPAA 4YAVA 2DLXA 4AKIA 4OFTA 5IOXA 2UZ8A 4JZQA 4USSA 4PUFC 3KH7A 4OO5A 3GKXA 1R26A 4X4JA 3UOMA 5G1LA 2F8AA 3GKKA 5J40A 3G7JA 3RHBA 4GQFA 1J9BA 1GNEA 3UMAA 4JU5A 1HYUA 1S3DA 6GSVA 3TRQA 2V6OA 4TR1B 2AUVA 3U6VA 1T3BA 5B7CA 4MA9A 2FY6A 2YWNA 4GXZA 2O87A 2F3MA 2IMIA 2JU5A 2CZ3A 2I3YA 4V1Ag 3TKRA 2R2JA 2HRNA 4AJ7A 5CRHA 5DJLA 2X8GA 1EEJA 3D22A 2CVDA 3H1NA 3FYGA 2YV7A 1A8YA 1TK8B 1TRWA 2WZ9A 5AN1A 3IHQA 3F9UA 4L0WA 4N10A 2FA4A 4PI2C 2AYTA 3LWAA 5IOWA 1HNBA 1V98A 2X8CA 4LL1B 1F3BA 4GRFA 4F0BA 1LU4A 2B3SA 1DSBA 2IMFA 4A5PA 3PR8A 3Q6OA 3G7IA 3VWXA 3C71A 1F3AA 1G6WA 2REMA 5DALA 4HZ4A 2V6KA 2DKHA 4MH3A 4IJIA 1OYJA 5FT3A 4O5RA 3M9KA 2X8HA 2JL4A 1AQWA 4NV2A 3IR4A 5L71A 1M0UA 2HZEB 2MMNA 2R0GA 5DQSA 5IIZA 4KGIA 3ISOA 2O8VB 4KSMA 4H86A 3N5OA 2WVZA 2I81A 3DEXA 3TJBA 2MZCA 2XBQA 3ZFLA 4ZL7A 3TJKA 1Z7RA 4WR4A 1F2EA 5J47A 1GSFA 1I5GA 1SYXA 4O7HA 3GH6A 3TRPA 1OC9B 3GNJA 11GSA 3WGXA 1B9XC 3CSIA 3IOSA 1SJ6A 1O7UA 4WR5A 5ECLB 1K0AA 1JHBA 2OE0A 1KEBA 1VF3A 4IJ3A 5HQPA 4ML6A 4X43A 5B8AA 4JR4A 2VL2A 4ZILA 3EYTA 3GIXA 2PERA 2R5GA 1O73A 2H6YA 4DSQA 1WP0A 5F07A 5A34B 1ST9A 2WULA 4Q5RA 4ZB9A 4EC0A 3C1RA 1HD2A 2ZNMA 1B8XA 1GSQA 3U5RE 4HJ2A 4PNFA 2VM1A 5ECMB 2IWTA 2LKUA 4LA1A 3HZ4A 2A4VA 3GFKA 2C8UA 2BMXA 3GX8A 4NHZA 1TTZA 1K0CA 5F0GA 4IQAA 2P5RA 4V1Ap 18GSA 1U3IA 3R2QA 1H4OA 4ML1A 2F9SA 1Z5YE 1SU9A 1UC7A 4LL4B 4POMA 1AXDA 4PI0C 2IFQB 2R37A 1QXHA 4ULXA 1Z6NA 2RIIA 3GL5A 4W66A 1TOFA 2ALBA 4IW9A 3TKSC 1OE8A 3ZLPA 5IMAA 2HSYA 4G0IA 2VUPA 3ERWA 5D9XA 2F51A 2IJYA 6GSYA 1YQ1A 1XW6A 1YZXA 1R5PA 2L5LA 5EPFA 3CHXC 3MYDA 5G2ZA 3PH9A 3IK9A 1K3OA 2CT6A 2A2SA 1EGRA 1FOVA 5LNKe 4K0NA 1EZKA 2HXKA 1A2MA 3ED3A 3LQ7A 1W89A 1MD3A 4Z7XA 1Z7PA 4RUVA 1W4VA 2GT5A 3F4RA 3L78A 1GL8A 2HSMB 2HE3A 2VLUA 3KJYA 1YEXA 1M2BA 3PINA 4IHUA 2H76A 3GURA 2NDOA 2AAWA 4I2TA 3UL3A 1Z6MA 2VL3A 2YV9A 3MWHA 4MZBA 3DYRA 4PTSA 2DJ1A 3LORA 4GF0A 4ZB8A 2IIYA 2J23A 2H1DA 2X49A 2P31A 3NOFA 3LGCA 2FGXA 1YEPA 4EDYA 5IO2A 1PSQA 2GZYA 3D4TA 4XS6A 4YAPA 1MDJA 3WT2A 3HDCA 2QGVA 2IMKA 1XIYA 2HRKB 2O36A 3HKRA 3KM6A 5J4YA 4WEYA 4TXOA 3RAZA 2TIRA 4YH2A 1ZYPA 5J3RA 1WPIA 3F3QA 1OE7A 4MK3A 2EFCA 2WVXB 1PL1A 2GQLA 3CYNA 2RLIA 1PQNA 4MCUA 1S3AA 4EUYA 1EV4A 2HLSA 1F37A 4XRDA 4MJCA 4MF7A 5J4VA 4RQRA 4EL1A 1K0MA 1BAYA 3GSSA 4N30A 2C0EA 4BWSA 3O76A 4G10A 2XHFA 3CRUA 4HQSA 3VI7A 2ZUPA 5J9CA 5EVOA 4CHSA 1WIKA 2OA7A 3TDGA 1NHYA 2DJ0A 9GSSA 3IC4A 1TRSA 1GTAA 1XWCA 4EF0A 2GSQA 4NHWA 4KUNA 2VLVA 1YF0A 1SKRB 5F8BA 2LEGA 3LG6A 2R6KA 3ZRDA 2AHEA 3MNGA 2CVKA 1SVMA 4K2XA 1UN2A 3F6FA 5ECRB 5KN0A 1BG5A 4K8MA 3P7XA 3W8SA 2CAQA 4MJBA 4AJ6A 4TW5A 4F2IA 3F8UA 2VAFA 4GDFA 2WRTA 2WVYA 1PRXA 1GSDA 2HT9A 1T1VA 3A5WA 4Z2RA 1JZOA 3S9FA 22GSA 3G7YA 3ZITA 1M3IA 2C3NA 4HQZA 2OJLA 1M99A 3EMXA 5LD0A 1EP7A 3FZ9A 3GUSA 3IAM2 4FQUA 3DWVA 4MLYA 3H8QA 3P8WA 2VCZA 3I69A 4KCAA 4HU9A 2HRAA 4IELA 3DMLA 2CA8A 4YQVA 1X9SB 3A2XA 3DRNA 4V2MA 2GS3A 5HFKA 4MF5A 1BQ7A 3TKPA 2H72A 4P3YB 1WRYA 4BWQA 2PGTA 5HR1A 3L4NA 1LJRA 2IL3A 1ZOFA 2L59A 4IKHA 1SENA 4MZWA 2X64A 5ECOB 2BJXA 5CRDA 1IYIA 1MEKA 2XPDA 5ID2A 1R7HA 2LJRA 2P5QA 3ERFA 2JACA 5A5HA 1XXUA 4AKGA 5GAPD 4XS4A 4GSSA 1XG8A 17GSA 3TJFA 4K0GA 4BVXA 2QSIA 3GH9A 1M3JA 4ZIJA 2GLRA 4X0XA 2C0GA 2VM2A 1YEWC 2XC2A 1JLVA 1Y1UA 3ZFBA 4XHMA 1OKTA 3GA4A 1XVWA 3MDKA 2KP2A 1ACVA 2J9HA 3GL3A 5FWGA 2FNOA 3C8EA 3CMIA 2HQTA
chains in the Genus database with same CATH topology
2FWFA 1N8JA 3I43A 5CAXA 5JWOB 3D4MA 2OADA 3GX0A 4ZL9A 5HFIA 2GQKA 4IGJA 3VPQA 1AC1A 3NIVA 1JZDA 4HOJA 3MSZA 1AUCA 4D73B 2I9HA 1Y6EA 3I9V2 1DE2A 4O5QA 2VKZG 1MTCA 4IP1A 4IVFA 5AISA 4HS1A 2LRTA 4DEJA 10GSA 1O85A 4L8EA 1ML6A 5CREA 2YWIA 6GSUA 3ZMKA 4MF6A 3MIXA 1K0OA 4TR3A 4GQCA 3VWVA 2R3XA 3IDVA 3RPPA 4NXIA 3FR3A 1YF1A 2DJKA 4QMKA 4TR1A 2GTUA 2HYXA 1O6JA 2GSTA 1BF5A 2RM6A 2N5BA 2PMTA 4HJMA 1MDIA 2GSSA 4YQUA 5ECHB 3FHKA 5COHA 5KN3A 4POBA 4DVCA 2DSAA 2WDUA 3H79A 1X5CA 4G0LA 1NW2A 1O81A 2N5AA 3BBYA 4MJAA 2GZPA 2B1KA 1YJ6A 1XWGA 5CP1A 1DUGA 1FVKA 2GSRA 2NPBA 5KN2A 2M72A 4QL9A 4DSSB 5J4UA 3F3RA 5IQYA 2H74A 2GGTA 4TRXA 2PBJA 3Q19A 1BG1A 5CNWA 2NBSA 3EURA 2IN3A 1U87A 5ECSA 4V2NA 1V2AA 2JZTA 4V2LA 2PPTA 4WF5A 1GUKA 3D5JA 4WBRD 3UJ1A 5ECKB 3W8JA 2VOCA 3KP9A 4Z2TA 3FR9A 1RK4A 4EDZA 1GULA 3TCOA 3O3TA 4J57E 5IPGA 1FOHA 1V57A 3UVTA 4XIHA 1K3YA 5ELAA 2RM5A 3ZIVA 1WE0A 3TOUA 4WBJA 2FUG2 2MMAA 4AF2A 2H30A 3RDWA 2VL2C 8GSSA 4JR6A 3TB2A 6GSXA 2DMLA 3DXBA 3QDNA 2ON7A 3IPZA 19GSA 5F06A 1JZRA 1E2YA 1USBA 2H1BA 3LSZA 3WYWA 3PGTA 4ECCA 3EINA 3KXOA 5JCUA 2OACA 2YOIA 2DBCA 2H0GA 4HI7A 4POKA 1GWCA 2L6CA 4HU7A 4ZXGA 3H4KA 3EU3A 16GSA 3KH9A 1F9MA 2FHEA 3CWGA 2PU9C 3GV1A 3CRTA 3LXZA 3QD9A 2GVPA 5KN1A 3L9UA 4KW6A 3TJJA 1THOA 2WS2A 3F63A 5A1NA 2V41A 4FO5A 3MAKA 4LMWA 2K8SA 4F03A 2HSNA 4GCIA 3IBHA 3QR6A 4J2FA 1MD4A 2GZZA 3HY2A 3IRAA 14GSA 1RQMA 4I5QA 1FB0A 1VF2A 2AJQB 2N5FA 4E8EA 1VGLA 4ICYA 5D9WA 2HI7A 2FA8A 3HHVA 1ZMAA 4I97A 6GSSA 2M46A 2I1UA 1G7OA 2BTOT 2KP1A 2X99A 4GLTA 1SD9A 2MMZA 1ABAA 2CVBA 4PQHA 4GSTA 3UAPA 2OT3A 3AY8A 2CZ2A 1KTEA 2YWMA 2CAIA 2LV3A 1QK8A 4ZL8A 3VURA 1AIUA 2H01A 3KGKA 2WFCA 4CW9A 5BRTA 2E2MA 13GSA 3GN3A 4K9ZA 3ZZXA 2D2ZA 3Q18A 1EOGA 1Q98A 1O8WA 2VL9A 3TU3B 1F6MC 3LXTA 5DAKA 4GSNA 4QL7A 1ERTA 4ISDA 1AQVA 4E68A 3GSTA 3CTFA 4XCSA 4AGSA 2C1YA 1ON4A 1SKSB 4BL7A 4PXOA 3C1SA 2YZUA 4O92A 2MMOA 2EFEA 3FKFA 1XW5A 2F8FA 2HSMA 2H71A 5KOWA 2DKIA 3M8NA 2TRCP 3APOA 4I8BA 3M0FA 2YZHA 3ZVJD 1ILOA 4FYBA 4TKYA 1B48A 5HR2A 2FWEA 2B7KA 4CY6A 2DIZA 3IA1A 5IMCA 4JBBA 2LRCA 2KHPA 4K1FA 2OKAA 3CSJA 4O5UA 4N0ZA 4KDYA 1ZGNA 2HRKA 3R3EA 2O5VA 4IQ1A 4I6XA 1A8LA 1M2DA 1GNWA 2H19A 2MBSA 1S3CA 2FWGA 1CQGA 1SKWB 2B5EA 3C7MA 4PUAA 3EWLA 2EFDA 1A0RP 2OBKA 2VCXA 1R4WA 1G0TA 4L0UA 3M1GA 1KBNA 1H75A 2PVQA 4NPBA 2I4AA 4CY8A 2K8VA 2KUCA 1TK5B 3VI5A 4K5SA 4TXOB 5H5SA 5B8BA 1V40A 2RUEA 1MDKA 1FO5A 4K7NA 4N0VA 4JE1A 1PKWA 1QMVA 3GRXA 1Z9HA 3ZYWA 3L9VA 1ZYEA 2YWOA 2VIMA 2VCQA 4K2DA 4GWRA 2H73A 3N9JA 1WJKA 5BMUA 5HR3A 2YN1A 2A4HA 2KOKA 2X4AA 4MMMA 3W6GA 1PL2A 4NAXA 4NMUA 4EO3A 5G5EA 4ILFA 3LYPA 3IE3A 5CO3A 5IMDA 1UVZA 4KSOA 1GSUA 1M2AA 4XTSA 3DD3A 2C3TA 3HYPA 1TXXA 3A3TA 1GSEA 2H66A 1PX7A 1V58A 4AKXB 1JFUA 3KIJA 3CXGA 5J9BA 3GHAA 1IYHA 3FZ4A 1BEDA 3A5IA 2LSTA 5F05A 1OVNA 4X1UA 1X9WB 3P2AA 3CBUA 4OO4A 4ZBDA 2YCDA 4BPYA 3J7Yk 4ECJA 5D9VA 3J7Yb 5DQYA 3FZAA 3HZ8A 3WT1A 1XWAA 3RBTA 5ENUA 2RUFA 3WGEA 3FW2A 2O89A 1Z3EA 4AKHA 2C3QA 3VK9A 1DE1A 1U3AA 3D6IA 1K0BA 3L9SA 3FEUA 3WD6A 2LTKA 4O32A 5D96A 3ME7A 3F6DA 2C0FA 3HVSA 4XRAA 1U88A 4KNDA 5GAND 2C4JA 2VD0A 3TOTA 3ZVJA 5ID2B 3FRCA 3H93A 3QAVA 1LBKA 2OE3A 1TJDA 2EIQA 2H6XA 4XS4B 2NTOA 4BVYA 4BVXB 4MZCA 3DKSA 4G19A 4F0CA 1M9AA 1PA3A 5C04A 1O8XA 2QKEA 1PKZA 1JZWA 5JCGA 3KMNA 1CQHA 4J56E 1GSYA 3ME8A 3VPTA 4JRRA 3GTUB 1TRUA 2E2GA 3IC8A 3GKNA 4KDUA 2A2PA 1THXA 1ERVA 3KZQA 3VLNA 4K7OA 3A2WA 5ELGA 4MPFA 1SK2A 1GUMA 3QAWA 2ZCTA 2MYGA 3TKSE 3CSHA 3VWWA 12GSA 2CX4A 5AIVA 1T7PB 3UVHA 2R0PA 1TXUA 1BX9A 3RPNA 4OMVA 2B5XA 1ERUA 3ZREA 5GSTA 3KCMA 3V1WA 3D21A 4TR4A 1G7EA 2WJUA 4RQXA 2K18A 4OWYA 1FB6A 1BYEA 3O6TA 3UARA 1NM3A 2JADA 4KDXA 4WXTA 3FK8A 4G0KA 3ZIJA 1GLPA 4WF4A 3D0ZA 1XZOA 3P90A 2DJ3A 4DSSA 2UV8G 2WCIA 4Z2UA 2AV4A 1TU8A 5CRGA 2DMMA 2LJKA 3KD0A 3BCIA 6GSWA 3APQA 4TVEA 4Q5NA 4MP4A 4KX4A 1SJIA 4PQIA 4K6XA 2EIRA 5ABRA 2IMDA 4TR0A 1GP1A 1A2LA 3JCML 4ZB7A 2L4CA 2L6DA 5ECPB 3Q74A 5B6NA 2A2RA 2YP6A 1EV9A 2G0FA 5FHIA 3QFBC 1FW1A 2HZEA 2B7JA 3HJPA 2H1GA 2WB9A 3FZ5A 4MH2A 5ECNB 4POLA 5A4VA 2R4VA 2K9FA 2OBIA 2G2QA 2C0DA 1OC8A 3BOAA 1HNAA 1B9YC 3UEMA 2JSZA 2VCTA 2CV4A 1OC9A 1JLWA 5DALB 2PWJA 3HVVA 5G30A 3M3MA 2VO4A 3LYKA 1J0FA 4ZBAA 3DIEA 4MNNA 1WMJA 1XFLA 1GTIA 3TGZA 1XVQA 4K7IA 4I2UA 4LLRA 4KAEA 5DDLA 4EIQA 1X0RA 2VCVA 4KA0A 1QGVA 1OKDA 5IM9A 3F4TA 2C80A 1FAAA 3QPMA 1NSWA 1T4ZA 3HVXA 3IV4A 2GQMA 4QQ7A 5A34A 2LJAA 4WETA 3HMJG 5IMVA 1Q4JA 5D93A 4LMVA 4K5RA 1PD21 1I9DA 2XPEA 5D8IA 3DVXA 5IO0A 2FCHA 3PPUA 2V1MA 1ZL9A 1GTBA 1TU7A 4ID0A 4KB3A 3F0IA 3E0UA 1SK1A 5H5RA 5A1NB 2IFQA 3EMPA 2GT6A 4RI6A 3NZNA 5JCWA 5DCHA 1FVJA 4Q5QA 1SYRA 2DIYA 2HSNB 1QUWA 6GSTA 1B4PA 4TN8A 5G31A 3LJRA 3UBKA 3EU4A 4DSRA 2H8LA 2EC4A 2VCWA 5JWQB 2O85A 3QMXA 2VD1A 2CQ9A 1OAZA 4XS1A 3IAS2 4ECIA 1SD8A 1ERWA 1ZZYA 4Q5FA 2IMEA 1TI3A 4IS0A 4N3ZA 4RI7A 4TOPA 1YY7A 2DJ2A 1SL0B 2H6ZA 1TK0B 2E7PA 5IPHA 1ZYQB 3GYKA 5D9TA 2JZSA 2QA1A 5IMZA 1PX6A 5J5NA 1KNGA 3VFIA 3K8NA 2FWHA 2B5YA 1K0NA 5DAKB 1XWBA 1EGOA 4YKGA 3HJOA 4JEDA 4CDOA 3RHCA 2B1LA 2EIOA 4BL7B 1HQOA 1G6YA 2LNTA 3IHGA 1E6BA 5AGYA 2H70A 3QAGA 5KEJA 4FYUA 3TRXA 1B4QA 20GSA 3EPTA 2Z9SA 3ZMLA 4PGTA 5KOXA 3KTLA 2YPMA 2MBTA 4AI6A 3EVIA 1FHEA 2R0CA 4KH7A 1QQ2A 2V2GA 2PUKC 1AW9A 1ZYNA 3TKSA 5H5QA 2QC7A 1XBSA 1PGTA 3CTGA 4IN0A 2QA2A 1C72A 4L5OA 3UIWA 5EY6A 4HDEA 3FY7A 1XPVA 1HNCA 1SL2B 4G9HA 1BJXA 1A24A 4E8HA 3IXRA 2K6VA 4ZB6A 2H0IA 1TKDB 4YQMA 1XOAA 2LNSA 1YVLA 4OFMA 4EXJA 1RW1A 1N25A 2L57A 1WWJA 2B6MA 1T4YA 1T00A 5GSSA 4HUAA 5AIXA 1TW9A 3ZL5A 3KMOA 3EE2A 3FR6A 1GSSA 1X5EA 4OCEA 5JWRB 2HZFA 5DBQA 3KP8A 2PN8A 2WGRA 4EE0A 3VWUA 1TDIA 5CYYA 2HRFA 4PQ1A 2PVOC 4F9ZA 1XCCA 3TJGA 3QCPA 4EKZA 1GH2A 1OC3A 5GZZB 4BA7A 2H75A 3I6AA 4KE3A 3LW9A 5DVBA 3WGDA 1XW9A 5CRWA 1DBYA 3HXSA 4KCEA 5G1KA 3HD5A 3BJ5A 1ZCPA 5INYA 5EL8A 1K3LA 4MJEA 4G01A 2FLSA 3UBLA 3OR5A 4WKWA 1TI1A 4HEA2 4NV5A 1SVOA 1GRXA 4OCFA 2XBIA 2HFDA 3EC3A 1GUHA 3LFLA 2V32A 4MDCA 5A4WA 2FD3A 3ZTLA 1SVLA 2H1LA 4OFNA 5BMUB 1X5DA 3QOUA 2YNXA 5HR0A 3G9BA 1K0DA 4NWYA 1URMA 1T8EB 3SBCA 5C00A 3F4SA 3APSA 1SJZA 5HFGA 5ECQB 1NHOA 2ON5A 2H1AA 3BCKA 4FIWA 5DCGA 1VF1A 4EIPA 3KTBA 1J08A 3ERGA 3M9JA 2GDRA 4IBPA 4ACSA 2LQQA 2KLXA 5E4WA 4N11A 1PN9A 1SL1B 4G2EA 1EP8A 3QFAC 1PN0A 2E0QA 1A0FA 1AAZA 1PMTA 1U6TA 3E3EA 5A5KA 1EWXA 1Y25A 1GLQA 2ES7A 1A23A 5ECIB 1FG4A 5E59A 2P0GA 4EVMA 1SK0A 3L0HA 5A4UA 3SWLA 2EFHA 5LCZA 2LQOA 4FYCA 2M80A 1VF4A 3HA9A 3TKQA 4YKFA 2L4QA 3IK7A 4F82A 4PURA 2CX3A 1R5AA 5A5HB 2YANA 1XWKA 4IP6A 4HZ2A 1A2JA 2O7KA 3C73A 3DVWA 5G5FA 3DGQA 1UA5A 2NVLA 4PNGA 4D73A 1X9MB 1QFNA 3KEBA 3LEFA 7GSSA 3HJMA 2LUSA 2TRXA 3GTUA 2LS5A 4ZBBA 3TUEA 3HCZA 3US3A 4OD7A 2DJJA 1VRSD 2JZRA 5IMFA 5DJMA 4PX1A 2YJ7A 2HNLA 1M9BA 2YJHA 2L5OA 4MABA 2JSYA 5D73A 4BVYB 2AB6A 3E9JB 3FMWA 1YKCA 4L5LA 4KF9A 2DC5A 2LRNA 1M7TA 2HSHA 1GTUA 3A2VA 4FH8A 3GMFA 1WOUA 4ECBA 1N2AA 5B6MA 1YDKA 4AJ8A 1TP9A 1TRVA 1EOHA 1V9WA 1XOBA 3GKMA 3BD2A 2H0HA 4GTUA 1AQXA 2VLTA 2OE1A 4TXVA 5J41A 1YKAA 1EEMA 4MPGA 2IPAA 4YAVA 2DLXA 4AKIA 4OFTA 5IOXA 2UZ8A 4JZQA 4USSA 4PUFC 3KH7A 4OO5A 3GKXA 1R26A 4X4JA 3UOMA 5G1LA 2F8AA 3GKKA 5J40A 3G7JA 3RHBA 4GQFA 1J9BA 1GNEA 3UMAA 4JU5A 1HYUA 1S3DA 6GSVA 3TRQA 2V6OA 4TR1B 2AUVA 3U6VA 1T3BA 5B7CA 4MA9A 2FY6A 2YWNA 4GXZA 2O87A 2F3MA 2IMIA 2JU5A 2CZ3A 2I3YA 4V1Ag 3TKRA 2R2JA 2HRNA 4AJ7A 5CRHA 5DJLA 2X8GA 1EEJA 3D22A 2CVDA 3H1NA 3FYGA 2YV7A 1A8YA 1TK8B 1TRWA 2WZ9A 5AN1A 3IHQA 3F9UA 4L0WA 4N10A 2FA4A 2AYTA 3LWAA 5IOWA 1HNBA 1V98A 2X8CA 4LL1B 1F3BA 4GRFA 4F0BA 1LU4A 2B3SA 1DSBA 2IMFA 4A5PA 3PR8A 3Q6OA 3G7IA 3VWXA 3C71A 1F3AA 1G6WA 2REMA 5DALA 4HZ4A 2V6KA 2DKHA 4MH3A 4IJIA 1OYJA 5FT3A 4O5RA 3M9KA 2X8HA 2JL4A 1AQWA 4NV2A 3IR4A 5L71A 1M0UA 2HZEB 2MMNA 2R0GA 5DQSA 5IIZA 4KGIA 3ISOA 2O8VB 4KSMA 4H86A 3N5OA 2I81A 3DEXA 3TJBA 2MZCA 2XBQA 3ZFLA 4ZL7A 3TJKA 1Z7RA 4WR4A 1F2EA 5J47A 1GSFA 1I5GA 1SYXA 4O7HA 3GH6A 3TRPA 1OC9B 3GNJA 11GSA 3WGXA 1B9XC 3CSIA 3IOSA 1SJ6A 1O7UA 4WR5A 5ECLB 1K0AA 1JHBA 2OE0A 1KEBA 1VF3A 4IJ3A 5HQPA 4ML6A 4X43A 5B8AA 4JR4A 2VL2A 4ZILA 3EYTA 3GIXA 2PERA 2R5GA 1O73A 2H6YA 4DSQA 1WP0A 5F07A 5A34B 1ST9A 2WULA 4Q5RA 4ZB9A 4EC0A 3C1RA 1HD2A 2ZNMA 1B8XA 1GSQA 3U5RE 4HJ2A 4PNFA 2VM1A 5ECMB 2IWTA 2LKUA 4LA1A 3HZ4A 2A4VA 3GFKA 2C8UA 2BMXA 3GX8A 4NHZA 1TTZA 1K0CA 5F0GA 4IQAA 2P5RA 4V1Ap 18GSA 1U3IA 3R2QA 1H4OA 4ML1A 2F9SA 1Z5YE 1SU9A 1UC7A 4LL4B 4POMA 1AXDA 2IFQB 2R37A 1QXHA 4ULXA 1Z6NA 2RIIA 3GL5A 4W66A 1TOFA 2ALBA 4IW9A 3TKSC 1OE8A 3ZLPA 5IMAA 2HSYA 4G0IA 2VUPA 3ERWA 5D9XA 2F51A 2IJYA 6GSYA 1YQ1A 1XW6A 1YZXA 1R5PA 2L5LA 5EPFA 3MYDA 5G2ZA 3PH9A 3IK9A 1K3OA 2CT6A 2A2SA 1EGRA 1FOVA 5LNKe 4K0NA 1EZKA 2HXKA 1A2MA 3ED3A 3LQ7A 1W89A 1MD3A 4Z7XA 1Z7PA 4RUVA 1W4VA 2GT5A 3F4RA 3L78A 1GL8A 2HSMB 2HE3A 2VLUA 3KJYA 1YEXA 1M2BA 3PINA 4IHUA 2H76A 3GURA 2NDOA 2AAWA 4I2TA 3UL3A 1Z6MA 2VL3A 2YV9A 3MWHA 4MZBA 3DYRA 4PTSA 2DJ1A 3LORA 4GF0A 4ZB8A 2IIYA 2J23A 2H1DA 2X49A 2P31A 3NOFA 3LGCA 2FGXA 1YEPA 4EDYA 5IO2A 1PSQA 2GZYA 3D4TA 4XS6A 4YAPA 1MDJA 3WT2A 3HDCA 2QGVA 2IMKA 1XIYA 2HRKB 3HKRA 3KM6A 5J4YA 4WEYA 4TXOA 3RAZA 2TIRA 4YH2A 1ZYPA 5J3RA 1WPIA 3F3QA 1OE7A 4MK3A 2EFCA 1PL1A 2GQLA 3CYNA 2RLIA 1PQNA 4MCUA 1S3AA 4EUYA 1EV4A 2HLSA 1F37A 4XRDA 4MJCA 4MF7A 5J4VA 4RQRA 4EL1A 1K0MA 1BAYA 3GSSA 4N30A 2C0EA 4BWSA 3O76A 4G10A 2XHFA 3CRUA 4HQSA 3VI7A 2ZUPA 5J9CA 5EVOA 4CHSA 1WIKA 2OA7A 3TDGA 1NHYA 2DJ0A 9GSSA 3IC4A 1TRSA 1GTAA 1XWCA 4EF0A 2GSQA 4NHWA 4KUNA 2VLVA 1YF0A 1SKRB 5F8BA 2LEGA 3LG6A 2R6KA 3ZRDA 2AHEA 3MNGA 2CVKA 1SVMA 4K2XA 1UN2A 3F6FA 5ECRB 5KN0A 1BG5A 4K8MA 3P7XA 3W8SA 2CAQA 4MJBA 4AJ6A 4TW5A 4F2IA 3F8UA 2VAFA 4GDFA 2WRTA 1PRXA 1GSDA 2HT9A 1T1VA 3A5WA 4Z2RA 1JZOA 3S9FA 22GSA 3G7YA 3ZITA 2C3NA 4HQZA 2OJLA 1M99A 3EMXA 5LD0A 1EP7A 3FZ9A 3GUSA 3IAM2 4FQUA 3DWVA 4MLYA 3H8QA 3P8WA 2VCZA 3I69A 4KCAA 4HU9A 2HRAA 4IELA 3DMLA 2CA8A 4YQVA 1X9SB 3A2XA 3DRNA 4V2MA 2GS3A 5HFKA 4MF5A 1BQ7A 3TKPA 2H72A 4P3YB 1WRYA 4BWQA 2PGTA 5HR1A 3L4NA 1LJRA 2IL3A 1ZOFA 2L59A 4IKHA 1SENA 4MZWA 2X64A 5ECOB 2BJXA 5CRDA 1IYIA 1MEKA 2XPDA 5ID2A 1R7HA 2LJRA 2P5QA 3ERFA 2JACA 5A5HA 1XXUA 4AKGA 5GAPD 4XS4A 4GSSA 17GSA 3TJFA 4K0GA 4BVXA 2QSIA 3GH9A 4ZIJA 2GLRA 4X0XA 2C0GA 2VM2A 2XC2A 1JLVA 1Y1UA 3ZFBA 4XHMA 1OKTA 3GA4A 1XVWA 3MDKA 2KP2A 1ACVA 2J9HA 3GL3A 5FWGA 2FNOA 3C8EA 3CMIA 2HQTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FWF A;  1N8J A;  3I43 A;  5CAX A;  5JWO B;  3D4M A;  2OAD A;  3GX0 A;  4ZL9 A;  5HFI A;  2GQK A;  4IGJ A;  3VPQ A;  1AC1 A;  3NIV A;  1JZD A;  4HOJ A;  3MSZ A;  1AUC A;  4D73 B;  2I9H A;  1Y6E A;  3I9V 2;  1DE2 A;  1MTC A;  4IP1 A;  4IVF A;  5AIS A;  4HS1 A;  2LRT A;  4DEJ A;  10GS A;  1O85 A;  4L8E A;  1ML6 A;  5CRE A;  2YWI A;  6GSU A;  3ZMK A;  4MF6 A;  1K0O A;  4TR3 A;  4GQC A;  3VWV A;  2R3X A;  3IDV A;  3RPP A;  4NXI A;  3FR3 A;  1YF1 A;  2DJK A;  4TR1 A;  2GTU A;  2HYX A;  1O6J A;  2GST A;  2RM6 A;  2N5B A;  2PMT A;  4HJM A;  1MDI A;  2GSS A;  4YQU A;  5ECH B;  3FHK A;  5COH A;  5KN3 A;  4POB A;  4DVC A;  2DSA A;  2WDU A;  3H79 A;  1X5C A;  4G0L A;  1NW2 A;  1O81 A;  2N5A A;  3BBY A;  4MJA A;  2GZP A;  2B1K A;  1YJ6 A;  1XWG A;  5CP1 A;  1DUG A;  1FVK A;  2GSR A;  2NPB A;  5KN2 A;  2M72 A;  4QL9 A;  4DSS B;  5J4U A;  3F3R A;  5IQY A;  2H74 A;  2GGT A;  4TRX A;  2PBJ A;  3Q19 A;  5CNW A;  2NBS A;  3EUR A;  2IN3 A;  1U87 A;  5ECS A;  4V2N A;  1V2A A;  2JZT A;  4V2L A;  2PPT A;  4WF5 A;  1GUK A;  3D5J A;  4WBR D;  3UJ1 A;  5ECK B;  3W8J A;  2VOC A;  3KP9 A;  3FR9 A;  1RK4 A;  4EDZ A;  1GUL A;  3TCO A;  3O3T A;  4J57 E;  5IPG A;  1V57 A;  3UVT A;  4XIH A;  1K3Y A;  5ELA A;  2RM5 A;  3ZIV A;  1WE0 A;  3TOU A;  4WBJ A;  2FUG 2;  2MMA A;  4AF2 A;  2H30 A;  3RDW A;  2VL2 C;  8GSS A;  4JR6 A;  3TB2 A;  6GSX A;  2DML A;  3DXB A;  3QDN A;  2ON7 A;  3IPZ A;  19GS A;  5F06 A;  1JZR A;  1E2Y A;  1USB A;  2H1B A;  3LSZ A;  3WYW A;  3PGT A;  4ECC A;  3EIN A;  3KXO A;  5JCU A;  2OAC A;  2YOI A;  2DBC A;  2H0G A;  4HI7 A;  4POK A;  1GWC A;  2L6C A;  4HU7 A;  4ZXG A;  3H4K A;  3EU3 A;  16GS A;  3KH9 A;  1F9M A;  2FHE A;  2PU9 C;  3GV1 A;  3CRT A;  3LXZ A;  3QD9 A;  2GVP A;  5KN1 A;  3L9U A;  4KW6 A;  3TJJ A;  1THO A;  2WS2 A;  3F63 A;  2V41 A;  4FO5 A;  3MAK A;  4LMW A;  2K8S A;  4F03 A;  4GCI A;  3IBH A;  3QR6 A;  4J2F A;  1MD4 A;  2GZZ A;  3HY2 A;  3IRA A;  14GS A;  1RQM A;  4I5Q A;  1FB0 A;  1VF2 A;  2AJQ B;  2N5F A;  4E8E A;  1VGL A;  5D9W A;  2HI7 A;  2FA8 A;  3HHV A;  1ZMA A;  4I97 A;  6GSS A;  2M46 A;  2I1U A;  1G7O A;  2BTO T;  2KP1 A;  2X99 A;  4GLT A;  1SD9 A;  1ABA A;  2MMZ A;  2CVB A;  4PQH A;  4GST A;  3UAP A;  3AY8 A;  2CZ2 A;  1KTE A;  2YWM A;  2CAI A;  2LV3 A;  1QK8 A;  4ZL8 A;  3VUR A;  1AIU A;  2H01 A;  3KGK A;  2WFC A;  4CW9 A;  2E2M A;  13GS A;  3GN3 A;  4K9Z A;  3ZZX A;  2D2Z A;  3Q18 A;  1EOG A;  1Q98 A;  1O8W A;  2VL9 A;  1F6M C;  3LXT A;  5DAK A;  4GSN A;  4QL7 A;  1ERT A;  4ISD A;  1AQV A;  3GST A;  3CTF A;  4XCS A;  4AGS A;  2C1Y A;  1ON4 A;  1SKS B;  4BL7 A;  4PXO A;  3C1S A;  2YZU A;  4O92 A;  2MMO A;  3FKF A;  1XW5 A;  2F8F A;  2HSM A;  2H71 A;  3M8N A;  2TRC P;  3APO A;  4I8B A;  3M0F A;  2YZH A;  3ZVJ D;  1ILO A;  4FYB A;  4TKY A;  1B48 A;  5HR2 A;  2FWE A;  2B7K A;  2DIZ A;  3IA1 A;  5IMC A;  4JBB A;  2LRC A;  2KHP A;  4K1F A;  2OKA A;  3CSJ A;  4N0Z A;  4KDY A;  1ZGN A;  2HRK A;  3R3E A;  4IQ1 A;  4I6X A;  1A8L A;  1M2D A;  1GNW A;  2H19 A;  2MBS A;  1S3C A;  2FWG A;  1CQG A;  1SKW B;  2B5E A;  3C7M A;  4PUA A;  3EWL A;  1A0R P;  2OBK A;  2VCX A;  1R4W A;  1G0T A;  4L0U A;  3M1G A;  1KBN A;  1H75 A;  2PVQ A;  4NPB A;  2I4A A;  2K8V A;  2KUC A;  1TK5 B;  3VI5 A;  4TXO B;  5H5S A;  5B8B A;  1V40 A;  2RUE A;  1MDK A;  1FO5 A;  4K7N A;  4N0V A;  4JE1 A;  1PKW A;  1QMV A;  3GRX A;  1Z9H A;  3ZYW A;  3L9V A;  1ZYE A;  2YWO A;  2VIM A;  2VCQ A;  4K2D A;  4GWR A;  2H73 A;  3N9J A;  1WJK A;  5BMU A;  5HR3 A;  2YN1 A;  2KOK A;  4MMM A;  3W6G A;  1PL2 A;  4NAX A;  4NMU A;  4EO3 A;  5G5E A;  4ILF A;  3LYP A;  3IE3 A;  5CO3 A;  5IMD A;  1UVZ A;  4KSO A;  1GSU A;  1M2A A;  4XTS A;  3DD3 A;  2C3T A;  3HYP A;  1TXX A;  3A3T A;  1GSE A;  2H66 A;  1PX7 A;  1V58 A;  1JFU A;  3KIJ A;  3CXG A;  5J9B A;  3GHA A;  1IYH A;  3FZ4 A;  1BED A;  2LST A;  5F05 A;  1OVN A;  4X1U A;  1X9W B;  3P2A A;  3CBU A;  4OO4 A;  4ZBD A;  2YCD A;  4BPY A;  3J7Y k;  4ECJ A;  5D9V A;  3J7Y b;  5DQY A;  3FZA A;  3HZ8 A;  3WT1 A;  1XWA A;  3RBT A;  5ENU A;  2RUF A;  3WGE A;  3FW2 A;  2O89 A;  1Z3E A;  2C3Q A;  3VK9 A;  1DE1 A;  1U3A A;  3D6I A;  1K0B A;  3L9S A;  3FEU A;  3WD6 A;  2LTK A;  4O32 A;  5D96 A;  3ME7 A;  3F6D A;  2C0F A;  3HVS A;  4XRA A;  1U88 A;  4KND A;  5GAN D;  2C4J A;  2VD0 A;  3TOT A;  3ZVJ A;  5ID2 B;  3FRC A;  3H93 A;  3QAV A;  1LBK A;  2OE3 A;  1TJD A;  2EIQ A;  2H6X A;  4XS4 B;  2NTO A;  4BVY A;  4BVX B;  4MZC A;  3DKS A;  4G19 A;  4F0C A;  1M9A A;  1PA3 A;  5C04 A;  1O8X A;  2QKE A;  1PKZ A;  1JZW A;  5JCG A;  3KMN A;  1CQH A;  4J56 E;  1GSY A;  3ME8 A;  3VPT A;  4JRR A;  3GTU B;  1TRU A;  2E2G A;  3IC8 A;  3GKN A;  4KDU A;  1THX A;  1ERV A;  3KZQ A;  3VLN A;  4K7O A;  3A2W A;  5ELG A;  4MPF A;  1SK2 A;  1GUM A;  3QAW A;  2ZCT A;  2MYG A;  3TKS E;  3CSH A;  3VWW A;  12GS A;  2CX4 A;  5AIV A;  1T7P B;  3UVH A;  1BX9 A;  3RPN A;  4OMV A;  2B5X A;  1ERU A;  3ZRE A;  5GST A;  3KCM A;  3V1W A;  3D21 A;  4TR4 A;  1G7E A;  2WJU A;  4RQX A;  2K18 A;  4OWY A;  1FB6 A;  1BYE A;  3O6T A;  3UAR A;  1NM3 A;  2JAD A;  4KDX A;  4WXT A;  3FK8 A;  4G0K A;  3ZIJ A;  1GLP A;  4WF4 A;  3D0Z A;  1XZO A;  3P90 A;  2DJ3 A;  4DSS A;  2WCI A;  2AV4 A;  1TU8 A;  5CRG A;  2DMM A;  2LJK A;  3KD0 A;  3BCI A;  6GSW A;  3APQ A;  4TVE A;  4Q5N A;  4MP4 A;  4KX4 A;  1SJI A;  4PQI A;  4K6X A;  2EIR A;  5ABR A;  2IMD A;  4TR0 A;  1GP1 A;  1A2L A;  3JCM L;  2L4C A;  2L6D A;  5ECP B;  3Q74 A;  5B6N A;  2A2R A;  2YP6 A;  1EV9 A;  2G0F A;  5FHI A;  3QFB C;  1FW1 A;  2HZE A;  2B7J A;  3HJP A;  2H1G A;  2WB9 A;  3FZ5 A;  4MH2 A;  5ECN B;  4POL A;  5A4V A;  2R4V A;  2K9F A;  2OBI A;  2G2Q A;  2C0D A;  1OC8 A;  3BOA A;  1HNA A;  1B9Y C;  3UEM A;  2JSZ A;  2VCT A;  2CV4 A;  1OC9 A;  1JLW A;  5DAL B;  2PWJ A;  3HVV A;  5G30 A;  3M3M A;  2VO4 A;  3LYK A;  1J0F A;  4ZBA A;  3DIE A;  1WMJ A;  1XFL A;  1GTI A;  3TGZ A;  1XVQ A;  4K7I A;  4I2U A;  4LLR A;  4KAE A;  5DDL A;  1X0R A;  2VCV A;  4KA0 A;  1QGV A;  1OKD A;  5IM9 A;  3F4T A;  2C80 A;  1FAA A;  3QPM A;  1NSW A;  1T4Z A;  3HVX A;  3IV4 A;  2GQM A;  4QQ7 A;  2LJA A;  4WET A;  5IMV A;  1Q4J A;  5D93 A;  4LMV A;  1PD2 1;  1I9D A;  2XPE A;  5D8I A;  3DVX A;  5IO0 A;  2FCH A;  3PPU A;  2V1M A;  1ZL9 A;  1GTB A;  1TU7 A;  4ID0 A;  4KB3 A;  3F0I A;  3E0U A;  1SK1 A;  5H5R A;  2IFQ A;  3EMP A;  2GT6 A;  4RI6 A;  3NZN A;  5JCW A;  5DCH A;  1FVJ A;  4Q5Q A;  1SYR A;  2DIY A;  2HSN B;  1QUW A;  6GST A;  1B4P A;  4TN8 A;  5G31 A;  3LJR A;  3UBK A;  3EU4 A;  4DSR A;  2H8L A;  2EC4 A;  2VCW A;  5JWQ B;  2O85 A;  3QMX A;  2VD1 A;  2CQ9 A;  1OAZ A;  4XS1 A;  3IAS 2;  4ECI A;  1SD8 A;  1ERW A;  1ZZY A;  4Q5F A;  2IME A;  1TI3 A;  4IS0 A;  4RI7 A;  4TOP A;  1YY7 A;  2DJ2 A;  1SL0 B;  2H6Z A;  1TK0 B;  2E7P A;  5IPH A;  1ZYQ B;  3GYK A;  5D9T A;  2JZS A;  5IMZ A;  1PX6 A;  5J5N A;  1KNG A;  3VFI A;  3K8N A;  2FWH A;  2B5Y A;  1K0N A;  5DAK B;  1XWB A;  1EGO A;  3HJO A;  4JED A;  4CDO A;  3RHC A;  2B1L A;  2EIO A;  4BL7 B;  1HQO A;  1G6Y A;  2LNT A;  1E6B A;  5AGY A;  2H70 A;  3QAG A;  5KEJ A;  4FYU A;  3TRX A;  1B4Q A;  20GS A;  2Z9S A;  3ZML A;  4PGT A;  3KTL A;  2YPM A;  2MBT A;  3EVI A;  1FHE A;  4KH7 A;  1QQ2 A;  2V2G A;  2PUK C;  1AW9 A;  3TKS A;  5H5Q A;  2QC7 A;  1XBS A;  1PGT A;  3CTG A;  4IN0 A;  1C72 A;  4L5O A;  3UIW A;  5EY6 A;  4HDE A;  3FY7 A;  1XPV A;  1HNC A;  1SL2 B;  4G9H A;  1BJX A;  1A24 A;  4E8H A;  3IXR A;  2K6V A;  4ZB6 A;  2H0I A;  1TKD B;  4YQM A;  1XOA A;  2LNS A;  4OFM A;  4EXJ A;  1RW1 A;  2L57 A;  1WWJ A;  2B6M A;  1T4Y A;  1T00 A;  5GSS A;  4HUA A;  5AIX A;  1TW9 A;  3ZL5 A;  3KMO A;  3EE2 A;  3FR6 A;  1GSS A;  1X5E A;  4OCE A;  5JWR B;  2HZF A;  5DBQ A;  3KP8 A;  2PN8 A;  2WGR A;  4EE0 A;  3VWU A;  1TDI A;  5CYY A;  2HRF A;  4PQ1 A;  2PVO C;  4F9Z A;  1XCC A;  3TJG A;  3QCP A;  4EKZ A;  1GH2 A;  1OC3 A;  5GZZ B;  4BA7 A;  2H75 A;  3I6A A;  4KE3 A;  5DVB A;  3WGD A;  1XW9 A;  5CRW A;  1DBY A;  3HXS A;  4KCE A;  5G1K A;  3HD5 A;  3BJ5 A;  1ZCP A;  5INY A;  5EL8 A;  1K3L A;  4MJE A;  2FLS A;  3UBL A;  3OR5 A;  4WKW A;  1TI1 A;  4HEA 2;  4NV5 A;  1GRX A;  4OCF A;  2XBI A;  2HFD A;  3EC3 A;  1GUH A;  3LFL A;  2V32 A;  4MDC A;  5A4W A;  2FD3 A;  3ZTL A;  4OFN A;  1X5D A;  3QOU A;  2YNX A;  5HR0 A;  3G9B A;  1K0D A;  4NWY A;  1URM A;  1T8E B;  3SBC A;  5C00 A;  3F4S A;  3APS A;  1SJZ A;  5HFG A;  5ECQ B;  1NHO A;  2ON5 A;  2H1A A;  3BCK A;  4FIW A;  5DCG A;  1VF1 A;  3KTB A;  1J08 A;  3ERG A;  3M9J A;  2GDR A;  4IBP A;  4ACS A;  2LQQ A;  2KLX A;  5E4W A;  4N11 A;  1PN9 A;  1SL1 B;  4G2E A;  1EP8 A;  3QFA C;  2E0Q A;  1A0F A;  1AAZ A;  1PMT A;  1U6T A;  3E3E A;  5A5K A;  1EWX A;  1Y25 A;  1GLQ A;  2ES7 A;  1A23 A;  5ECI B;  1FG4 A;  5E59 A;  2P0G A;  4EVM A;  1SK0 A;  3L0H A;  5A4U A;  3SWL A;  5LCZ A;  2LQO A;  4FYC A;  2M80 A;  1VF4 A;  3HA9 A;  3TKQ A;  2L4Q A;  3IK7 A;  4F82 A;  4PUR A;  2CX3 A;  1R5A A;  2YAN A;  1XWK A;  4IP6 A;  4HZ2 A;  1A2J A;  2O7K A;  3C73 A;  3DVW A;  5G5F A;  3DGQ A;  1UA5 A;  2NVL A;  4PNG A;  4D73 A;  1X9M B;  1QFN A;  3KEB A;  3LEF A;  7GSS A;  3HJM A;  2LUS A;  2TRX A;  3GTU A;  2LS5 A;  4ZBB A;  3TUE A;  3HCZ A;  3US3 A;  4OD7 A;  2DJJ A;  1VRS D;  2JZR A;  5IMF A;  5DJM A;  4PX1 A;  2YJ7 A;  2HNL A;  1M9B A;  2YJH A;  2L5O A;  4MAB A;  2JSY A;  5D73 A;  4BVY B;  2AB6 A;  3E9J B;  1YKC A;  4L5L A;  4KF9 A;  2DC5 A;  2LRN A;  1M7T A;  2HSH A;  1GTU A;  3A2V A;  4FH8 A;  3GMF A;  1WOU A;  4ECB A;  1N2A A;  5B6M A;  1YDK A;  4AJ8 A;  1TP9 A;  1TRV A;  1EOH A;  1V9W A;  1XOB A;  3GKM A;  3BD2 A;  2H0H A;  4GTU A;  1AQX A;  2VLT A;  2OE1 A;  4TXV A;  5J41 A;  1YKA A;  1EEM A;  4MPG A;  2IPA A;  4YAV A;  2DLX A;  5IOX A;  4OFT A;  2UZ8 A;  4JZQ A;  4USS A;  4PUF C;  3KH7 A;  4OO5 A;  3GKX A;  1R26 A;  3UOM A;  5G1L A;  2F8A A;  3GKK A;  3G7J A;  3RHB A;  4GQF A;  1J9B A;  1GNE A;  3UMA A;  4JU5 A;  1HYU A;  1S3D A;  6GSV A;  3TRQ A;  2V6O A;  4TR1 B;  2AUV A;  3U6V A;  1T3B A;  5B7C A;  4MA9 A;  2FY6 A;  2YWN A;  4GXZ A;  2O87 A;  2F3M A;  2IMI A;  2JU5 A;  2CZ3 A;  2I3Y A;  4V1A g;  3TKR A;  2R2J A;  2HRN A;  4AJ7 A;  5CRH A;  5DJL A;  2X8G A;  1EEJ A;  3D22 A;  2CVD A;  3H1N A;  3FYG A;  2YV7 A;  1A8Y A;  1TK8 B;  1TRW A;  2WZ9 A;  5AN1 A;  3IHQ A;  3F9U A;  4L0W A;  4N10 A;  2FA4 A;  2AYT A;  3LWA A;  5IOW A;  1HNB A;  1V98 A;  2X8C A;  4LL1 B;  1F3B A;  4GRF A;  4F0B A;  1LU4 A;  2B3S A;  1DSB A;  2IMF A;  3PR8 A;  3Q6O A;  3G7I A;  3VWX A;  3C71 A;  1F3A A;  1G6W A;  2REM A;  5DAL A;  4HZ4 A;  2V6K A;  4MH3 A;  4IJI A;  1OYJ A;  5FT3 A;  4O5R A;  3M9K A;  2X8H A;  2JL4 A;  1AQW A;  4NV2 A;  3IR4 A;  5L71 A;  1M0U A;  2HZE B;  2MMN A;  5DQS A;  5IIZ A;  4KGI A;  3ISO A;  2O8V B;  4KSM A;  4H86 A;  3N5O A;  2I81 A;  3DEX A;  3TJB A;  2MZC A;  2XBQ A;  3ZFL A;  4ZL7 A;  3TJK A;  1Z7R A;  4WR4 A;  1F2E A;  1GSF A;  1I5G A;  1SYX A;  4O7H A;  3GH6 A;  3TRP A;  1OC9 B;  3GNJ A;  11GS A;  3WGX A;  1B9X C;  3CSI A;  3IOS A;  1SJ6 A;  1O7U A;  4WR5 A;  5ECL B;  1K0A A;  1JHB A;  2OE0 A;  1KEB A;  1VF3 A;  4IJ3 A;  5HQP A;  4ML6 A;  4X43 A;  5B8A A;  4JR4 A;  2VL2 A;  4ZIL A;  3EYT A;  3GIX A;  2PER A;  2R5G A;  1O73 A;  2H6Y A;  4DSQ A;  1WP0 A;  5F07 A;  1ST9 A;  2WUL A;  4Q5R A;  4ZB9 A;  4EC0 A;  3C1R A;  1HD2 A;  2ZNM A;  1B8X A;  1GSQ A;  3U5R E;  4HJ2 A;  4PNF A;  2VM1 A;  5ECM B;  2IWT A;  2LKU A;  4LA1 A;  3HZ4 A;  2A4V A;  3GFK A;  2C8U A;  2BMX A;  3GX8 A;  4NHZ A;  1TTZ A;  1K0C A;  5F0G A;  4IQA A;  2P5R A;  4V1A p;  18GS A;  1U3I A;  3R2Q A;  1H4O A;  4ML1 A;  2F9S A;  1Z5Y E;  1SU9 A;  1UC7 A;  4LL4 B;  4POM A;  1AXD A;  2IFQ B;  2R37 A;  1QXH A;  4ULX A;  1Z6N A;  2RII A;  3GL5 A;  1TOF A;  2ALB A;  4IW9 A;  3TKS C;  1OE8 A;  3ZLP A;  5IMA A;  2HSY A;  4G0I A;  2VUP A;  3ERW A;  5D9X A;  2F51 A;  2IJY A;  6GSY A;  1YQ1 A;  1XW6 A;  1YZX A;  1R5P A;  2L5L A;  5EPF A;  5G2Z A;  3PH9 A;  3IK9 A;  1K3O A;  2CT6 A;  2A2S A;  1EGR A;  1FOV A;  5LNK e;  4K0N A;  1EZK A;  2HXK A;  1A2M A;  3ED3 A;  3LQ7 A;  1W89 A;  1MD3 A;  4Z7X A;  1Z7P A;  4RUV A;  1W4V A;  2GT5 A;  3F4R A;  3L78 A;  1GL8 A;  2HSM B;  2HE3 A;  2VLU A;  3KJY A;  1YEX A;  1M2B A;  3PIN A;  4IHU A;  2H76 A;  3GUR A;  2NDO A;  2AAW A;  4I2T A;  3UL3 A;  1Z6M A;  2VL3 A;  2YV9 A;  3MWH A;  4MZB A;  3DYR A;  4PTS A;  2DJ1 A;  3LOR A;  4GF0 A;  4ZB8 A;  2IIY A;  2J23 A;  2H1D A;  2P31 A;  3NOF A;  3LGC A;  2FGX A;  1YEP A;  4EDY A;  5IO2 A;  1PSQ A;  2GZY A;  3D4T A;  4XS6 A;  4YAP A;  1MDJ A;  3WT2 A;  3HDC A;  2QGV A;  2IMK A;  1XIY A;  2HRK B;  3HKR A;  3KM6 A;  4WEY A;  4TXO A;  3RAZ A;  2TIR A;  4YH2 A;  5J3R A;  1WPI A;  3F3Q A;  1OE7 A;  4MK3 A;  1PL1 A;  2GQL A;  3CYN A;  2RLI A;  1PQN A;  4MCU A;  1S3A A;  4EUY A;  1EV4 A;  2HLS A;  1F37 A;  4XRD A;  4MJC A;  4MF7 A;  4RQR A;  4EL1 A;  1K0M A;  1BAY A;  3GSS A;  4N30 A;  2C0E A;  4BWS A;  3O76 A;  4G10 A;  2XHF A;  3CRU A;  4HQS A;  3VI7 A;  2ZUP A;  5J9C A;  5EVO A;  4CHS A;  1WIK A;  2OA7 A;  3TDG A;  1NHY A;  2DJ0 A;  9GSS A;  3IC4 A;  1TRS A;  1GTA A;  1XWC A;  4EF0 A;  2GSQ A;  4NHW A;  4KUN A;  2VLV A;  1YF0 A;  1SKR B;  5F8B A;  2LEG A;  3LG6 A;  2R6K A;  3ZRD A;  2AHE A;  3MNG A;  2CVK A;  1UN2 A;  3F6F A;  5ECR B;  5KN0 A;  1BG5 A;  4K8M A;  3P7X A;  3W8S A;  2CAQ A;  4MJB A;  4AJ6 A;  4TW5 A;  4F2I A;  3F8U A;  2VAF A;  2WRT A;  1PRX A;  1GSD A;  2HT9 A;  1T1V A;  3A5W A;  1JZO A;  3S9F A;  22GS A;  3G7Y A;  3ZIT A;  2C3N A;  4HQZ A;  2OJL A;  1M99 A;  3EMX A;  5LD0 A;  1EP7 A;  3FZ9 A;  3GUS A;  3IAM 2;  4FQU A;  3DWV A;  4MLY A;  3H8Q A;  3P8W A;  2VCZ A;  3I69 A;  4KCA A;  4HU9 A;  2HRA A;  4IEL A;  3DML A;  2CA8 A;  4YQV A;  1X9S B;  3A2X A;  3DRN A;  4V2M A;  2GS3 A;  5HFK A;  4MF5 A;  1BQ7 A;  3TKP A;  2H72 A;  4P3Y B;  1WRY A;  4BWQ A;  2PGT A;  5HR1 A;  3L4N A;  1LJR A;  2IL3 A;  1ZOF A;  2L59 A;  4IKH A;  1SEN A;  4MZW A;  2X64 A;  5ECO B;  2BJX A;  5CRD A;  1IYI A;  1MEK A;  2XPD A;  5ID2 A;  1R7H A;  2LJR A;  2P5Q A;  3ERF A;  2JAC A;  1XXU A;  5GAP D;  4XS4 A;  4GSS A;  17GS A;  3TJF A;  4K0G A;  4BVX A;  2QSI A;  3GH9 A;  4ZIJ A;  2GLR A;  4X0X A;  2C0G A;  2VM2 A;  2XC2 A;  1JLV A;  3ZFB A;  4XHM A;  1OKT A;  3GA4 A;  1XVW A;  3MDK A;  2KP2 A;  1ACV A;  2J9H A;  3GL3 A;  5FWG A;  2FNO A;  3C8E A;  3CMI A;  2HQT A; 
#chains in the Genus database with same CATH topology
 2FWF A;  1N8J A;  3I43 A;  5CAX A;  5JWO B;  3D4M A;  2OAD A;  3GX0 A;  4ZL9 A;  5HFI A;  2GQK A;  4IGJ A;  3VPQ A;  1AC1 A;  3NIV A;  1JZD A;  4HOJ A;  3MSZ A;  1AUC A;  4D73 B;  2I9H A;  1Y6E A;  3I9V 2;  1DE2 A;  4O5Q A;  2VKZ G;  1MTC A;  4IP1 A;  4IVF A;  5AIS A;  4HS1 A;  2LRT A;  4DEJ A;  10GS A;  1O85 A;  4L8E A;  1ML6 A;  5CRE A;  2YWI A;  6GSU A;  3RGB C;  3ZMK A;  4MF6 A;  3MIX A;  1K0O A;  4TR3 A;  4GQC A;  3VWV A;  2R3X A;  3IDV A;  3RPP A;  4NXI A;  3FR3 A;  1YF1 A;  2DJK A;  4QMK A;  4TR1 A;  2GTU A;  2HYX A;  1O6J A;  2GST A;  1BF5 A;  2RM6 A;  2N5B A;  2PMT A;  4HJM A;  1MDI A;  2GSS A;  4YQU A;  5ECH B;  3FHK A;  5COH A;  5KN3 A;  4POB A;  4DVC A;  2DSA A;  2WDU A;  3H79 A;  1X5C A;  4G0L A;  1NW2 A;  1O81 A;  2N5A A;  3BBY A;  4MJA A;  2GZP A;  2B1K A;  1YJ6 A;  1XWG A;  5CP1 A;  1DUG A;  1FVK A;  2GSR A;  2NPB A;  5KN2 A;  2M72 A;  4QL9 A;  4DSS B;  5J4U A;  3F3R A;  5IQY A;  2H74 A;  2GGT A;  4TRX A;  2PBJ A;  3Q19 A;  1BG1 A;  5CNW A;  2NBS A;  3EUR A;  2IN3 A;  1U87 A;  5ECS A;  4V2N A;  1V2A A;  2JZT A;  4V2L A;  2PPT A;  4WF5 A;  4HSC X;  1GUK A;  3D5J A;  4WBR D;  3UJ1 A;  5ECK B;  3W8J A;  2VOC A;  3KP9 A;  4Z2T A;  3FR9 A;  1RK4 A;  4EDZ A;  1GUL A;  3TCO A;  3O3T A;  4J57 E;  5IPG A;  1FOH A;  1V57 A;  3UVT A;  4XIH A;  1K3Y A;  5ELA A;  2RM5 A;  3ZIV A;  1WE0 A;  3TOU A;  4WBJ A;  2FUG 2;  2MMA A;  4AF2 A;  2H30 A;  3RDW A;  2VL2 C;  8GSS A;  4JR6 A;  3TB2 A;  6GSX A;  2DML A;  3DXB A;  3QDN A;  2ON7 A;  3IPZ A;  19GS A;  5F06 A;  4BIK A;  1JZR A;  1E2Y A;  1USB A;  2H1B A;  3LSZ A;  3WYW A;  3PGT A;  4ECC A;  3EIN A;  3KXO A;  5JCU A;  2OAC A;  2YOI A;  2DBC A;  2H0G A;  4HI7 A;  4POK A;  1GWC A;  2L6C A;  4HU7 A;  4ZXG A;  3H4K A;  3EU3 A;  16GS A;  3KH9 A;  1F9M A;  2FHE A;  3CWG A;  2PU9 C;  3GV1 A;  3CRT A;  3LXZ A;  3QD9 A;  2GVP A;  5KN1 A;  3L9U A;  4KW6 A;  3TJJ A;  1THO A;  2WS2 A;  3F63 A;  5A1N A;  2V41 A;  4FO5 A;  3MAK A;  4LMW A;  2K8S A;  4F03 A;  2HSN A;  4GCI A;  3IBH A;  3QR6 A;  4J2F A;  1MD4 A;  2GZZ A;  3HY2 A;  1PFO A;  3IRA A;  14GS A;  1RQM A;  4I5Q A;  1FB0 A;  1VF2 A;  2AJQ B;  2N5F A;  4E8E A;  1VGL A;  4ICY A;  5D9W A;  2HI7 A;  2FA8 A;  3HHV A;  1ZMA A;  2WW1 A;  4I97 A;  6GSS A;  2M46 A;  2I1U A;  1G7O A;  2BTO T;  2KP1 A;  2X99 A;  4GLT A;  1SD9 A;  2MMZ A;  1ABA A;  2CVB A;  4PQH A;  4GST A;  3UAP A;  2OT3 A;  3AY8 A;  2CZ2 A;  1KTE A;  2YWM A;  2CAI A;  2LV3 A;  1QK8 A;  4ZL8 A;  3VUR A;  1AIU A;  2H01 A;  3KGK A;  2WFC A;  4CW9 A;  5BRT A;  2E2M A;  13GS A;  3GN3 A;  4K9Z A;  3ZZX A;  2D2Z A;  3Q18 A;  1EOG A;  1Q98 A;  1O8W A;  2VL9 A;  3TU3 B;  1F6M C;  3LXT A;  5DAK A;  4GSN A;  4QL7 A;  1ERT A;  4ISD A;  1AQV A;  4E68 A;  3GST A;  3CTF A;  4XCS A;  2WW2 A;  4AGS A;  2C1Y A;  1ON4 A;  1SKS B;  4BL7 A;  4PXO A;  3C1S A;  2YZU A;  4O92 A;  2MMO A;  2EFE A;  3FKF A;  1XW5 A;  2F8F A;  2HSM A;  2H71 A;  5KOW A;  2DKI A;  3M8N A;  2TRC P;  3APO A;  4I8B A;  3M0F A;  2YZH A;  3ZVJ D;  1ILO A;  4FYB A;  4TKY A;  1B48 A;  5HR2 A;  2FWE A;  2B7K A;  4CY6 A;  2DIZ A;  3IA1 A;  5IMC A;  4JBB A;  2LRC A;  2KHP A;  4K1F A;  2OKA A;  3CSJ A;  4O5U A;  4N0Z A;  4KDY A;  1ZGN A;  2HRK A;  3R3E A;  2O5V A;  4IQ1 A;  4I6X A;  1A8L A;  1M2D A;  1GNW A;  2H19 A;  2MBS A;  1S3C A;  2FWG A;  1CQG A;  1SKW B;  2B5E A;  3C7M A;  4PUA A;  3EWL A;  2EFD A;  2WVX A;  1A0R P;  2OBK A;  2VCX A;  1R4W A;  1G0T A;  4L0U A;  3M1G A;  1KBN A;  1H75 A;  2PVQ A;  4NPB A;  2I4A A;  4CY8 A;  2K8V A;  2KUC A;  1TK5 B;  3VI5 A;  4K5S A;  4TXO B;  5H5S A;  5B8B A;  1V40 A;  2RUE A;  1MDK A;  1FO5 A;  4K7N A;  4N0V A;  4JE1 A;  1PKW A;  1QMV A;  3GRX A;  1Z9H A;  3ZYW A;  3L9V A;  1ZYE A;  2YWO A;  2VIM A;  2VCQ A;  4K2D A;  4GWR A;  2H73 A;  3N9J A;  1WJK A;  5BMU A;  5HR3 A;  2YN1 A;  2A4H A;  2KOK A;  2X4A A;  4MMM A;  3W6G A;  1PL2 A;  4NAX A;  4NMU A;  4EO3 A;  5G5E A;  4ILF A;  3LYP A;  3IE3 A;  5CO3 A;  5IMD A;  1UVZ A;  4KSO A;  1GSU A;  1M2A A;  4XTS A;  3DD3 A;  2C3T A;  3HYP A;  1TXX A;  3A3T A;  1GSE A;  2H66 A;  1PX7 A;  1V58 A;  4AKX B;  1JFU A;  3KIJ A;  3CXG A;  5J9B A;  3GHA A;  1IYH A;  3FZ4 A;  1BED A;  3A5I A;  2LST A;  1I1I P;  5F05 A;  1OVN A;  4X1U A;  1X9W B;  3P2A A;  3CBU A;  4OO4 A;  4ZBD A;  2YCD A;  4BPY A;  3J7Y k;  4ECJ A;  5D9V A;  3J7Y b;  5DQY A;  3FZA A;  3HZ8 A;  3WT1 A;  1XWA A;  3RBT A;  5ENU A;  2RUF A;  3WGE A;  3FW2 A;  2O89 A;  1Z3E A;  4AKH A;  2C3Q A;  3VK9 A;  1DE1 A;  1U3A A;  3D6I A;  1K0B A;  3L9S A;  3FEU A;  3WD6 A;  2LTK A;  4O32 A;  5D96 A;  3ME7 A;  3F6D A;  2C0F A;  3HVS A;  4XRA A;  1U88 A;  4KND A;  5GAN D;  2C4J A;  2VD0 A;  3TOT A;  3ZVJ A;  5ID2 B;  3FRC A;  3H93 A;  3QAV A;  1LBK A;  2OE3 A;  1TJD A;  2EIQ A;  2H6X A;  4XS4 B;  2NTO A;  4BVY A;  4BVX B;  4MZC A;  3DKS A;  4G19 A;  4F0C A;  1M9A A;  1PA3 A;  5C04 A;  1O8X A;  2QKE A;  1PKZ A;  1JZW A;  5JCG A;  3KMN A;  1CQH A;  4J56 E;  1GSY A;  3ME8 A;  3VPT A;  3CQF A;  4JRR A;  3GTU B;  1TRU A;  2E2G A;  3IC8 A;  3GKN A;  4KDU A;  2A2P A;  1THX A;  1ERV A;  3KZQ A;  3VLN A;  4K7O A;  3A2W A;  5ELG A;  4MPF A;  1SK2 A;  1GUM A;  3QAW A;  2ZCT A;  2MYG A;  3TKS E;  3CSH A;  3VWW A;  12GS A;  2CX4 A;  5AIV A;  1T7P B;  3UVH A;  2R0P A;  1TXU A;  1BX9 A;  3RPN A;  4OMV A;  2B5X A;  1ERU A;  3ZRE A;  5GST A;  3KCM A;  3V1W A;  3D21 A;  4TR4 A;  1G7E A;  2WJU A;  4RQX A;  4PHZ C;  2K18 A;  4OWY A;  1FB6 A;  1BYE A;  3O6T A;  3UAR A;  1NM3 A;  2JAD A;  4KDX A;  4WXT A;  3FK8 A;  4G0K A;  3ZIJ A;  1GLP A;  4WF4 A;  3D0Z A;  1XZO A;  3P90 A;  2DJ3 A;  4DSS A;  2UV8 G;  2WCI A;  4Z2U A;  2AV4 A;  1TU8 A;  2WZS A;  5CRG A;  2DMM A;  2LJK A;  3KD0 A;  3BCI A;  6GSW A;  3APQ A;  4TVE A;  4Q5N A;  4MP4 A;  2O3E A;  4KX4 A;  1SJI A;  4PQI A;  4K6X A;  2EIR A;  5ABR A;  2IMD A;  4TR0 A;  1GP1 A;  1A2L A;  3JCM L;  4ZB7 A;  2L4C A;  2L6D A;  5ECP B;  3Q74 A;  5B6N A;  2A2R A;  2YP6 A;  1EV9 A;  2G0F A;  5FHI A;  3QFB C;  1FW1 A;  2HZE A;  2B7J A;  3HJP A;  2H1G A;  2WB9 A;  3FZ5 A;  4MH2 A;  5ECN B;  4POL A;  5A4V A;  2R4V A;  2K9F A;  2OBI A;  2G2Q A;  2C0D A;  1OC8 A;  3BOA A;  1HNA A;  1B9Y C;  3UEM A;  2JSZ A;  2VCT A;  2CV4 A;  1OC9 A;  1JLW A;  5DAL B;  2PWJ A;  3HVV A;  5G30 A;  3M3M A;  2VO4 A;  3LYK A;  1J0F A;  4ZBA A;  3DIE A;  4MNN A;  1WMJ A;  1XFL A;  1GTI A;  3TGZ A;  1XVQ A;  4K7I A;  4I2U A;  4LLR A;  4KAE A;  5DDL A;  4EIQ A;  1X0R A;  2VCV A;  4KA0 A;  1QGV A;  1OKD A;  5IM9 A;  3F4T A;  2WW3 A;  2C80 A;  1FAA A;  3QPM A;  1NSW A;  1T4Z A;  3HVX A;  3IV4 A;  2GQM A;  4QQ7 A;  5A34 A;  2LJA A;  4WET A;  3HMJ G;  5IMV A;  1Q4J A;  5D93 A;  4LMV A;  4K5R A;  1PD2 1;  1I9D A;  2XPE A;  5D8I A;  3DVX A;  5IO0 A;  2FCH A;  3PPU A;  2V1M A;  1ZL9 A;  1GTB A;  1TU7 A;  4ID0 A;  4KB3 A;  3F0I A;  3E0U A;  1SK1 A;  5H5R A;  5A1N B;  2IFQ A;  3EMP A;  2GT6 A;  4RI6 A;  3NZN A;  5JCW A;  5DCH A;  1FVJ A;  4Q5Q A;  1SYR A;  2DIY A;  2HSN B;  1QUW A;  6GST A;  1B4P A;  4TN8 A;  5G31 A;  3LJR A;  3UBK A;  3EU4 A;  4DSR A;  2H8L A;  2EC4 A;  2VCW A;  5JWQ B;  2O85 A;  3QMX A;  2VD1 A;  2CQ9 A;  1OAZ A;  4XS1 A;  3IAS 2;  4ECI A;  1SD8 A;  1ERW A;  1ZZY A;  4Q5F A;  2IME A;  1TI3 A;  4IS0 A;  4N3Z A;  4RI7 A;  4TOP A;  1YY7 A;  2DJ2 A;  1SL0 B;  2H6Z A;  1TK0 B;  2E7P A;  5IPH A;  1ZYQ B;  3GYK A;  5D9T A;  2JZS A;  2QA1 A;  5IMZ A;  1PX6 A;  5J5N A;  1KNG A;  3VFI A;  3K8N A;  2FWH A;  2B5Y A;  1K0N A;  5DAK B;  1XWB A;  1EGO A;  4YKG A;  3HJO A;  4JED A;  4CDO A;  3RHC A;  2B1L A;  2EIO A;  3RFR C;  4BL7 B;  1HQO A;  1G6Y A;  2LNT A;  3IHG A;  1E6B A;  5AGY A;  2H70 A;  3QAG A;  5KEJ A;  4FYU A;  3TRX A;  1B4Q A;  20GS A;  3EPT A;  2Z9S A;  3ZML A;  4PGT A;  5KOX A;  3KTL A;  2YPM A;  2MBT A;  4AI6 A;  3EVI A;  1FHE A;  2R0C A;  4KH7 A;  1QQ2 A;  2V2G A;  2PUK C;  1AW9 A;  1ZYN A;  3TKS A;  5H5Q A;  2WW0 A;  2QC7 A;  1XBS A;  1PGT A;  3CTG A;  4IN0 A;  2QA2 A;  1C72 A;  4L5O A;  3UIW A;  5EY6 A;  4HDE A;  3FY7 A;  1XPV A;  1HNC A;  1SL2 B;  1S4B P;  4G9H A;  1BJX A;  1A24 A;  4E8H A;  3IXR A;  2K6V A;  4ZB6 A;  2H0I A;  1TKD B;  4YQM A;  1XOA A;  2LNS A;  1YVL A;  4OFM A;  4EXJ A;  1RW1 A;  1N25 A;  2L57 A;  1WWJ A;  2B6M A;  1T4Y A;  1T00 A;  5GSS A;  4HUA A;  5AIX A;  1TW9 A;  3ZL5 A;  3KMO A;  3EE2 A;  3FR6 A;  1GSS A;  1X5E A;  4OCE A;  5JWR B;  2HZF A;  5DBQ A;  3KP8 A;  2PN8 A;  2WGR A;  4EE0 A;  3VWU A;  1TDI A;  5CYY A;  2HRF A;  4PQ1 A;  2PVO C;  4F9Z A;  1XCC A;  3TJG A;  3QCP A;  4EKZ A;  1GH2 A;  1OC3 A;  5GZZ B;  4BA7 A;  2H75 A;  3I6A A;  4KE3 A;  3LW9 A;  5DVB A;  3WGD A;  1XW9 A;  5CRW A;  1DBY A;  3HXS A;  4KCE A;  5G1K A;  3HD5 A;  3BJ5 A;  1ZCP A;  5INY A;  5EL8 A;  1K3L A;  4MJE A;  4G01 A;  2FLS A;  3UBL A;  3OR5 A;  4WKW A;  1TI1 A;  4HEA 2;  4NV5 A;  1SVO A;  1GRX A;  4OCF A;  2XBI A;  2HFD A;  3EC3 A;  1GUH A;  3LFL A;  2V32 A;  4MDC A;  5A4W A;  2FD3 A;  3ZTL A;  1SVL A;  2H1L A;  4OFN A;  5BMU B;  1X5D A;  3QOU A;  2YNX A;  5HR0 A;  3G9B A;  1K0D A;  4NWY A;  1URM A;  1T8E B;  3SBC A;  5C00 A;  3F4S A;  3APS A;  1SJZ A;  5HFG A;  5ECQ B;  1NHO A;  2ON5 A;  2H1A A;  3BCK A;  4FIW A;  5DCG A;  1VF1 A;  4EIP A;  3KTB A;  1J08 A;  3ERG A;  3M9J A;  2GDR A;  4IBP A;  4ACS A;  2LQQ A;  2KLX A;  5E4W A;  4N11 A;  1PN9 A;  1SL1 B;  4G2E A;  1EP8 A;  3QFA C;  1PN0 A;  2E0Q A;  1A0F A;  1AAZ A;  1PMT A;  1U6T A;  3E3E A;  5A5K A;  1EWX A;  1Y25 A;  1GLQ A;  2ES7 A;  4FXY P;  1A23 A;  5ECI B;  1FG4 A;  5E59 A;  2P0G A;  4EVM A;  1SK0 A;  3L0H A;  5A4U A;  3SWL A;  2EFH A;  5LCZ A;  2LQO A;  4FYC A;  2M80 A;  1VF4 A;  3HA9 A;  3TKQ A;  4YKF A;  2L4Q A;  3IK7 A;  4F82 A;  4PUR A;  2CX3 A;  1R5A A;  5A5H B;  2YAN A;  1XWK A;  4IP6 A;  4HZ2 A;  1A2J A;  2O7K A;  3C73 A;  3DVW A;  5G5F A;  3DGQ A;  1UA5 A;  2NVL A;  4PNG A;  4D73 A;  1X9M B;  1QFN A;  3KEB A;  3LEF A;  7GSS A;  3HJM A;  2LUS A;  2TRX A;  3GTU A;  2LS5 A;  4ZBB A;  3TUE A;  3HCZ A;  3US3 A;  4OD7 A;  2DJJ A;  1VRS D;  2JZR A;  5IMF A;  5DJM A;  4PX1 A;  2YJ7 A;  2HNL A;  1M9B A;  2YJH A;  2L5O A;  4MAB A;  2JSY A;  5D73 A;  4BVY B;  2AB6 A;  3E9J B;  3FMW A;  1YKC A;  4L5L A;  4KF9 A;  2DC5 A;  2LRN A;  1M7T A;  2HSH A;  1GTU A;  3A2V A;  4FH8 A;  3GMF A;  1WOU A;  4ECB A;  1N2A A;  5B6M A;  1YDK A;  4AJ8 A;  1S3R A;  1TP9 A;  1TRV A;  1EOH A;  1V9W A;  1XOB A;  3GKM A;  3BD2 A;  2H0H A;  4GTU A;  1AQX A;  2VLT A;  3HVN A;  2OE1 A;  4TXV A;  5J41 A;  1YKA A;  1EEM A;  4MPG A;  2IPA A;  4YAV A;  2DLX A;  4AKI A;  4OFT A;  5IOX A;  2UZ8 A;  4JZQ A;  4USS A;  4PUF C;  3KH7 A;  4OO5 A;  3GKX A;  1R26 A;  4X4J A;  3UOM A;  5G1L A;  2F8A A;  3GKK A;  5J40 A;  3G7J A;  3RHB A;  4GQF A;  1J9B A;  1GNE A;  3UMA A;  4JU5 A;  1HYU A;  1S3D A;  6GSV A;  3TRQ A;  2V6O A;  4TR1 B;  2AUV A;  3U6V A;  1T3B A;  5B7C A;  4MA9 A;  2FY6 A;  2YWN A;  4GXZ A;  2O87 A;  2F3M A;  2IMI A;  2JU5 A;  2CZ3 A;  2I3Y A;  4V1A g;  3TKR A;  2R2J A;  2HRN A;  4AJ7 A;  5CRH A;  5DJL A;  2X8G A;  1EEJ A;  3D22 A;  2CVD A;  3H1N A;  3FYG A;  2YV7 A;  1A8Y A;  1TK8 B;  1TRW A;  2WZ9 A;  5AN1 A;  3IHQ A;  3F9U A;  4L0W A;  4N10 A;  2FA4 A;  4PI2 C;  2AYT A;  3LWA A;  5IOW A;  1HNB A;  1V98 A;  2X8C A;  4LL1 B;  1F3B A;  4GRF A;  4F0B A;  1LU4 A;  2B3S A;  1DSB A;  2IMF A;  4A5P A;  3PR8 A;  3Q6O A;  3G7I A;  3VWX A;  3C71 A;  1F3A A;  1G6W A;  2REM A;  5DAL A;  4HZ4 A;  2V6K A;  2DKH A;  4MH3 A;  4IJI A;  1OYJ A;  5FT3 A;  4O5R A;  3M9K A;  2X8H A;  2JL4 A;  1AQW A;  4NV2 A;  3IR4 A;  5L71 A;  1M0U A;  2HZE B;  2MMN A;  2R0G A;  5DQS A;  5IIZ A;  4KGI A;  3ISO A;  2O8V B;  4KSM A;  4H86 A;  3N5O A;  2WVZ A;  2I81 A;  3DEX A;  3TJB A;  2MZC A;  2XBQ A;  3ZFL A;  4ZL7 A;  3TJK A;  1Z7R A;  4WR4 A;  1F2E A;  5J47 A;  1GSF A;  1I5G A;  1SYX A;  4O7H A;  3GH6 A;  3TRP A;  1OC9 B;  3GNJ A;  11GS A;  3WGX A;  1B9X C;  3CSI A;  3IOS A;  1SJ6 A;  1O7U A;  4WR5 A;  5ECL B;  1K0A A;  1JHB A;  2OE0 A;  1KEB A;  1VF3 A;  4IJ3 A;  5HQP A;  4ML6 A;  4X43 A;  5B8A A;  4JR4 A;  2VL2 A;  4ZIL A;  3EYT A;  3GIX A;  2PER A;  2R5G A;  1O73 A;  2H6Y A;  4DSQ A;  1WP0 A;  5F07 A;  5A34 B;  1ST9 A;  2WUL A;  4Q5R A;  4ZB9 A;  4EC0 A;  3C1R A;  1HD2 A;  2ZNM A;  1B8X A;  1GSQ A;  3U5R E;  4HJ2 A;  4PNF A;  2VM1 A;  5ECM B;  2IWT A;  2LKU A;  4LA1 A;  3HZ4 A;  2A4V A;  3GFK A;  2C8U A;  2BMX A;  3GX8 A;  4NHZ A;  1TTZ A;  1K0C A;  5F0G A;  4IQA A;  2P5R A;  4V1A p;  18GS A;  1U3I A;  3R2Q A;  1H4O A;  4ML1 A;  2F9S A;  1Z5Y E;  1SU9 A;  1UC7 A;  4LL4 B;  4POM A;  1AXD A;  4PI0 C;  2IFQ B;  2R37 A;  1QXH A;  4ULX A;  1Z6N A;  2RII A;  3GL5 A;  4W66 A;  1TOF A;  2ALB A;  4IW9 A;  3TKS C;  1OE8 A;  3ZLP A;  5IMA A;  2HSY A;  4G0I A;  2VUP A;  3ERW A;  5D9X A;  2F51 A;  2IJY A;  6GSY A;  1YQ1 A;  1XW6 A;  1YZX A;  1R5P A;  2L5L A;  5EPF A;  3CHX C;  3MYD A;  5G2Z A;  3PH9 A;  3IK9 A;  1K3O A;  2CT6 A;  2A2S A;  1EGR A;  1FOV A;  5LNK e;  4K0N A;  1EZK A;  2HXK A;  1A2M A;  3ED3 A;  3LQ7 A;  1W89 A;  1MD3 A;  4Z7X A;  1Z7P A;  4RUV A;  1W4V A;  2GT5 A;  3F4R A;  3L78 A;  1GL8 A;  2HSM B;  2HE3 A;  2VLU A;  3KJY A;  1YEX A;  1M2B A;  3PIN A;  4IHU A;  2H76 A;  3GUR A;  2NDO A;  2AAW A;  4I2T A;  3UL3 A;  1Z6M A;  2VL3 A;  2YV9 A;  3MWH A;  4MZB A;  3DYR A;  4PTS A;  2DJ1 A;  3LOR A;  4GF0 A;  4ZB8 A;  2IIY A;  2J23 A;  2H1D A;  2X49 A;  2P31 A;  3NOF A;  3LGC A;  2FGX A;  1YEP A;  4EDY A;  5IO2 A;  1PSQ A;  2GZY A;  3D4T A;  4XS6 A;  4YAP A;  1MDJ A;  3WT2 A;  3HDC A;  2QGV A;  2IMK A;  1XIY A;  2HRK B;  2O36 A;  3HKR A;  3KM6 A;  5J4Y A;  4WEY A;  4TXO A;  3RAZ A;  2TIR A;  4YH2 A;  1ZYP A;  5J3R A;  1WPI A;  3F3Q A;  1OE7 A;  4MK3 A;  2EFC A;  2WVX B;  1PL1 A;  2GQL A;  3CYN A;  2RLI A;  1PQN A;  4MCU A;  1S3A A;  4EUY A;  1EV4 A;  2HLS A;  1F37 A;  4XRD A;  4MJC A;  4MF7 A;  5J4V A;  4RQR A;  4EL1 A;  1K0M A;  1BAY A;  3GSS A;  4N30 A;  2C0E A;  4BWS A;  3O76 A;  4G10 A;  2XHF A;  3CRU A;  4HQS A;  3VI7 A;  2ZUP A;  5J9C A;  5EVO A;  4CHS A;  1WIK A;  2OA7 A;  3TDG A;  1NHY A;  2DJ0 A;  9GSS A;  3IC4 A;  1TRS A;  1GTA A;  1XWC A;  4EF0 A;  2GSQ A;  4NHW A;  4KUN A;  2VLV A;  1YF0 A;  1SKR B;  5F8B A;  2LEG A;  3LG6 A;  2R6K A;  3ZRD A;  2AHE A;  3MNG A;  2CVK A;  1SVM A;  4K2X A;  1UN2 A;  3F6F A;  5ECR B;  5KN0 A;  1BG5 A;  4K8M A;  3P7X A;  3W8S A;  2CAQ A;  4MJB A;  4AJ6 A;  4TW5 A;  4F2I A;  3F8U A;  2VAF A;  4GDF A;  2WRT A;  2WVY A;  1PRX A;  1GSD A;  2HT9 A;  1T1V A;  3A5W A;  4Z2R A;  1JZO A;  3S9F A;  22GS A;  3G7Y A;  3ZIT A;  1M3I A;  2C3N A;  4HQZ A;  2OJL A;  1M99 A;  3EMX A;  5LD0 A;  1EP7 A;  3FZ9 A;  3GUS A;  3IAM 2;  4FQU A;  3DWV A;  4MLY A;  3H8Q A;  3P8W A;  2VCZ A;  3I69 A;  4KCA A;  4HU9 A;  2HRA A;  4IEL A;  3DML A;  2CA8 A;  4YQV A;  1X9S B;  3A2X A;  3DRN A;  4V2M A;  2GS3 A;  5HFK A;  4MF5 A;  1BQ7 A;  3TKP A;  2H72 A;  4P3Y B;  1WRY A;  4BWQ A;  2PGT A;  5HR1 A;  3L4N A;  1LJR A;  2IL3 A;  1ZOF A;  2L59 A;  4IKH A;  1SEN A;  4MZW A;  2X64 A;  5ECO B;  2BJX A;  5CRD A;  1IYI A;  1MEK A;  2XPD A;  5ID2 A;  1R7H A;  2LJR A;  2P5Q A;  3ERF A;  2JAC A;  5A5H A;  1XXU A;  4AKG A;  5GAP D;  4XS4 A;  4GSS A;  1XG8 A;  17GS A;  3TJF A;  4K0G A;  4BVX A;  2QSI A;  3GH9 A;  1M3J A;  4ZIJ A;  2GLR A;  4X0X A;  2C0G A;  2VM2 A;  1YEW C;  2XC2 A;  1JLV A;  1Y1U A;  3ZFB A;  4XHM A;  1OKT A;  3GA4 A;  1XVW A;  3MDK A;  2KP2 A;  1ACV A;  2J9H A;  3GL3 A;  5FWG A;  2FNO A;  3C8E A;  3CMI A;  2HQT A; 
#chains in the Genus database with same CATH homology
 2FWF A;  1N8J A;  3I43 A;  5CAX A;  5JWO B;  3D4M A;  2OAD A;  3GX0 A;  4ZL9 A;  5HFI A;  2GQK A;  4IGJ A;  3VPQ A;  1AC1 A;  3NIV A;  1JZD A;  4HOJ A;  3MSZ A;  1AUC A;  4D73 B;  2I9H A;  1Y6E A;  3I9V 2;  1DE2 A;  4O5Q A;  2VKZ G;  1MTC A;  4IP1 A;  4IVF A;  5AIS A;  4HS1 A;  2LRT A;  4DEJ A;  10GS A;  1O85 A;  4L8E A;  1ML6 A;  5CRE A;  2YWI A;  6GSU A;  3ZMK A;  4MF6 A;  3MIX A;  1K0O A;  4TR3 A;  4GQC A;  3VWV A;  2R3X A;  3IDV A;  3RPP A;  4NXI A;  3FR3 A;  1YF1 A;  2DJK A;  4QMK A;  4TR1 A;  2GTU A;  2HYX A;  1O6J A;  2GST A;  1BF5 A;  2RM6 A;  2N5B A;  2PMT A;  4HJM A;  1MDI A;  2GSS A;  4YQU A;  5ECH B;  3FHK A;  5COH A;  5KN3 A;  4POB A;  4DVC A;  2DSA A;  2WDU A;  3H79 A;  1X5C A;  4G0L A;  1NW2 A;  1O81 A;  2N5A A;  3BBY A;  4MJA A;  2GZP A;  2B1K A;  1YJ6 A;  1XWG A;  5CP1 A;  1DUG A;  1FVK A;  2GSR A;  2NPB A;  5KN2 A;  2M72 A;  4QL9 A;  4DSS B;  5J4U A;  3F3R A;  5IQY A;  2H74 A;  2GGT A;  4TRX A;  2PBJ A;  3Q19 A;  1BG1 A;  5CNW A;  2NBS A;  3EUR A;  2IN3 A;  1U87 A;  5ECS A;  4V2N A;  1V2A A;  2JZT A;  4V2L A;  2PPT A;  4WF5 A;  1GUK A;  3D5J A;  4WBR D;  3UJ1 A;  5ECK B;  3W8J A;  2VOC A;  3KP9 A;  4Z2T A;  3FR9 A;  1RK4 A;  4EDZ A;  1GUL A;  3TCO A;  3O3T A;  4J57 E;  5IPG A;  1FOH A;  1V57 A;  3UVT A;  4XIH A;  1K3Y A;  5ELA A;  2RM5 A;  3ZIV A;  1WE0 A;  3TOU A;  4WBJ A;  2FUG 2;  2MMA A;  4AF2 A;  2H30 A;  3RDW A;  2VL2 C;  8GSS A;  4JR6 A;  3TB2 A;  6GSX A;  2DML A;  3DXB A;  3QDN A;  2ON7 A;  3IPZ A;  19GS A;  5F06 A;  1JZR A;  1E2Y A;  1USB A;  2H1B A;  3LSZ A;  3WYW A;  3PGT A;  4ECC A;  3EIN A;  3KXO A;  5JCU A;  2OAC A;  2YOI A;  2DBC A;  2H0G A;  4HI7 A;  4POK A;  1GWC A;  2L6C A;  4HU7 A;  4ZXG A;  3H4K A;  3EU3 A;  16GS A;  3KH9 A;  1F9M A;  2FHE A;  3CWG A;  2PU9 C;  3GV1 A;  3CRT A;  3LXZ A;  3QD9 A;  2GVP A;  5KN1 A;  3L9U A;  4KW6 A;  3TJJ A;  1THO A;  2WS2 A;  3F63 A;  5A1N A;  2V41 A;  4FO5 A;  3MAK A;  4LMW A;  2K8S A;  4F03 A;  2HSN A;  4GCI A;  3IBH A;  3QR6 A;  4J2F A;  1MD4 A;  2GZZ A;  3HY2 A;  3IRA A;  14GS A;  1RQM A;  4I5Q A;  1FB0 A;  1VF2 A;  2AJQ B;  2N5F A;  4E8E A;  1VGL A;  4ICY A;  5D9W A;  2HI7 A;  2FA8 A;  3HHV A;  1ZMA A;  4I97 A;  6GSS A;  2M46 A;  2I1U A;  1G7O A;  2BTO T;  2KP1 A;  2X99 A;  4GLT A;  1SD9 A;  2MMZ A;  1ABA A;  2CVB A;  4PQH A;  4GST A;  3UAP A;  2OT3 A;  3AY8 A;  2CZ2 A;  1KTE A;  2YWM A;  2CAI A;  2LV3 A;  1QK8 A;  4ZL8 A;  3VUR A;  1AIU A;  2H01 A;  3KGK A;  2WFC A;  4CW9 A;  5BRT A;  2E2M A;  13GS A;  3GN3 A;  4K9Z A;  3ZZX A;  2D2Z A;  3Q18 A;  1EOG A;  1Q98 A;  1O8W A;  2VL9 A;  3TU3 B;  1F6M C;  3LXT A;  5DAK A;  4GSN A;  4QL7 A;  1ERT A;  4ISD A;  1AQV A;  4E68 A;  3GST A;  3CTF A;  4XCS A;  4AGS A;  2C1Y A;  1ON4 A;  1SKS B;  4BL7 A;  4PXO A;  3C1S A;  2YZU A;  4O92 A;  2MMO A;  2EFE A;  3FKF A;  1XW5 A;  2F8F A;  2HSM A;  2H71 A;  5KOW A;  2DKI A;  3M8N A;  2TRC P;  3APO A;  4I8B A;  3M0F A;  2YZH A;  3ZVJ D;  1ILO A;  4FYB A;  4TKY A;  1B48 A;  5HR2 A;  2FWE A;  2B7K A;  4CY6 A;  2DIZ A;  3IA1 A;  5IMC A;  4JBB A;  2LRC A;  2KHP A;  4K1F A;  2OKA A;  3CSJ A;  4O5U A;  4N0Z A;  4KDY A;  1ZGN A;  2HRK A;  3R3E A;  2O5V A;  4IQ1 A;  4I6X A;  1A8L A;  1M2D A;  1GNW A;  2H19 A;  2MBS A;  1S3C A;  2FWG A;  1CQG A;  1SKW B;  2B5E A;  3C7M A;  4PUA A;  3EWL A;  2EFD A;  1A0R P;  2OBK A;  2VCX A;  1R4W A;  1G0T A;  4L0U A;  3M1G A;  1KBN A;  1H75 A;  2PVQ A;  4NPB A;  2I4A A;  4CY8 A;  2K8V A;  2KUC A;  1TK5 B;  3VI5 A;  4K5S A;  4TXO B;  5H5S A;  5B8B A;  1V40 A;  2RUE A;  1MDK A;  1FO5 A;  4K7N A;  4N0V A;  4JE1 A;  1PKW A;  1QMV A;  3GRX A;  1Z9H A;  3ZYW A;  3L9V A;  1ZYE A;  2YWO A;  2VIM A;  2VCQ A;  4K2D A;  4GWR A;  2H73 A;  3N9J A;  1WJK A;  5BMU A;  5HR3 A;  2YN1 A;  2A4H A;  2KOK A;  2X4A A;  4MMM A;  3W6G A;  1PL2 A;  4NAX A;  4NMU A;  4EO3 A;  5G5E A;  4ILF A;  3LYP A;  3IE3 A;  5CO3 A;  5IMD A;  1UVZ A;  4KSO A;  1GSU A;  1M2A A;  4XTS A;  3DD3 A;  2C3T A;  3HYP A;  1TXX A;  3A3T A;  1GSE A;  2H66 A;  1PX7 A;  1V58 A;  4AKX B;  1JFU A;  3KIJ A;  3CXG A;  5J9B A;  3GHA A;  1IYH A;  3FZ4 A;  1BED A;  3A5I A;  2LST A;  5F05 A;  1OVN A;  4X1U A;  1X9W B;  3P2A A;  3CBU A;  4OO4 A;  4ZBD A;  2YCD A;  4BPY A;  3J7Y k;  4ECJ A;  5D9V A;  3J7Y b;  5DQY A;  3FZA A;  3HZ8 A;  3WT1 A;  1XWA A;  3RBT A;  5ENU A;  2RUF A;  3WGE A;  3FW2 A;  2O89 A;  1Z3E A;  4AKH A;  2C3Q A;  3VK9 A;  1DE1 A;  1U3A A;  3D6I A;  1K0B A;  3L9S A;  3FEU A;  3WD6 A;  2LTK A;  4O32 A;  5D96 A;  3ME7 A;  3F6D A;  2C0F A;  3HVS A;  4XRA A;  1U88 A;  4KND A;  5GAN D;  2C4J A;  2VD0 A;  3TOT A;  3ZVJ A;  5ID2 B;  3FRC A;  3H93 A;  3QAV A;  1LBK A;  2OE3 A;  1TJD A;  2EIQ A;  2H6X A;  4XS4 B;  2NTO A;  4BVY A;  4BVX B;  4MZC A;  3DKS A;  4G19 A;  4F0C A;  1M9A A;  1PA3 A;  5C04 A;  1O8X A;  2QKE A;  1PKZ A;  1JZW A;  5JCG A;  3KMN A;  1CQH A;  4J56 E;  1GSY A;  3ME8 A;  3VPT A;  4JRR A;  3GTU B;  1TRU A;  2E2G A;  3IC8 A;  3GKN A;  4KDU A;  2A2P A;  1THX A;  1ERV A;  3KZQ A;  3VLN A;  4K7O A;  3A2W A;  5ELG A;  4MPF A;  1SK2 A;  1GUM A;  3QAW A;  2ZCT A;  2MYG A;  3TKS E;  3CSH A;  3VWW A;  12GS A;  2CX4 A;  5AIV A;  1T7P B;  3UVH A;  2R0P A;  1TXU A;  1BX9 A;  3RPN A;  4OMV A;  2B5X A;  1ERU A;  3ZRE A;  5GST A;  3KCM A;  3V1W A;  3D21 A;  4TR4 A;  1G7E A;  2WJU A;  4RQX A;  2K18 A;  4OWY A;  1FB6 A;  1BYE A;  3O6T A;  3UAR A;  1NM3 A;  2JAD A;  4KDX A;  4WXT A;  3FK8 A;  4G0K A;  3ZIJ A;  1GLP A;  4WF4 A;  3D0Z A;  1XZO A;  3P90 A;  2DJ3 A;  4DSS A;  2UV8 G;  2WCI A;  4Z2U A;  2AV4 A;  1TU8 A;  5CRG A;  2DMM A;  2LJK A;  3KD0 A;  3BCI A;  6GSW A;  3APQ A;  4TVE A;  4Q5N A;  4MP4 A;  4KX4 A;  1SJI A;  4PQI A;  4K6X A;  2EIR A;  5ABR A;  2IMD A;  4TR0 A;  1GP1 A;  1A2L A;  3JCM L;  4ZB7 A;  2L4C A;  2L6D A;  5ECP B;  3Q74 A;  5B6N A;  2A2R A;  2YP6 A;  1EV9 A;  2G0F A;  5FHI A;  3QFB C;  1FW1 A;  2HZE A;  2B7J A;  3HJP A;  2H1G A;  2WB9 A;  3FZ5 A;  4MH2 A;  5ECN B;  4POL A;  5A4V A;  2R4V A;  2K9F A;  2OBI A;  2G2Q A;  2C0D A;  1OC8 A;  3BOA A;  1HNA A;  1B9Y C;  3UEM A;  2JSZ A;  2VCT A;  2CV4 A;  1OC9 A;  1JLW A;  5DAL B;  2PWJ A;  3HVV A;  5G30 A;  3M3M A;  2VO4 A;  3LYK A;  1J0F A;  4ZBA A;  3DIE A;  4MNN A;  1WMJ A;  1XFL A;  1GTI A;  3TGZ A;  1XVQ A;  4K7I A;  4I2U A;  4LLR A;  4KAE A;  5DDL A;  4EIQ A;  1X0R A;  2VCV A;  4KA0 A;  1QGV A;  1OKD A;  5IM9 A;  3F4T A;  2C80 A;  1FAA A;  3QPM A;  1NSW A;  1T4Z A;  3HVX A;  3IV4 A;  2GQM A;  4QQ7 A;  5A34 A;  2LJA A;  4WET A;  3HMJ G;  5IMV A;  1Q4J A;  5D93 A;  4LMV A;  4K5R A;  1PD2 1;  1I9D A;  2XPE A;  5D8I A;  3DVX A;  5IO0 A;  2FCH A;  3PPU A;  2V1M A;  1ZL9 A;  1GTB A;  1TU7 A;  4ID0 A;  4KB3 A;  3F0I A;  3E0U A;  1SK1 A;  5H5R A;  5A1N B;  2IFQ A;  3EMP A;  2GT6 A;  4RI6 A;  3NZN A;  5JCW A;  5DCH A;  1FVJ A;  4Q5Q A;  1SYR A;  2DIY A;  2HSN B;  1QUW A;  6GST A;  1B4P A;  4TN8 A;  5G31 A;  3LJR A;  3UBK A;  3EU4 A;  4DSR A;  2H8L A;  2EC4 A;  2VCW A;  5JWQ B;  2O85 A;  3QMX A;  2VD1 A;  2CQ9 A;  1OAZ A;  4XS1 A;  3IAS 2;  4ECI A;  1SD8 A;  1ERW A;  1ZZY A;  4Q5F A;  2IME A;  1TI3 A;  4IS0 A;  4N3Z A;  4RI7 A;  4TOP A;  1YY7 A;  2DJ2 A;  1SL0 B;  2H6Z A;  1TK0 B;  2E7P A;  5IPH A;  1ZYQ B;  3GYK A;  5D9T A;  2JZS A;  2QA1 A;  5IMZ A;  1PX6 A;  5J5N A;  1KNG A;  3VFI A;  3K8N A;  2FWH A;  2B5Y A;  1K0N A;  5DAK B;  1XWB A;  1EGO A;  4YKG A;  3HJO A;  4JED A;  4CDO A;  3RHC A;  2B1L A;  2EIO A;  4BL7 B;  1HQO A;  1G6Y A;  2LNT A;  3IHG A;  1E6B A;  5AGY A;  2H70 A;  3QAG A;  5KEJ A;  4FYU A;  3TRX A;  1B4Q A;  20GS A;  3EPT A;  2Z9S A;  3ZML A;  4PGT A;  5KOX A;  3KTL A;  2YPM A;  2MBT A;  4AI6 A;  3EVI A;  1FHE A;  2R0C A;  4KH7 A;  1QQ2 A;  2V2G A;  2PUK C;  1AW9 A;  1ZYN A;  3TKS A;  5H5Q A;  2QC7 A;  1XBS A;  1PGT A;  3CTG A;  4IN0 A;  2QA2 A;  1C72 A;  4L5O A;  3UIW A;  5EY6 A;  4HDE A;  3FY7 A;  1XPV A;  1HNC A;  1SL2 B;  4G9H A;  1BJX A;  1A24 A;  4E8H A;  3IXR A;  2K6V A;  4ZB6 A;  2H0I A;  1TKD B;  4YQM A;  1XOA A;  2LNS A;  1YVL A;  4OFM A;  4EXJ A;  1RW1 A;  1N25 A;  2L57 A;  1WWJ A;  2B6M A;  1T4Y A;  1T00 A;  5GSS A;  4HUA A;  5AIX A;  1TW9 A;  3ZL5 A;  3KMO A;  3EE2 A;  3FR6 A;  1GSS A;  1X5E A;  4OCE A;  5JWR B;  2HZF A;  5DBQ A;  3KP8 A;  2PN8 A;  2WGR A;  4EE0 A;  3VWU A;  1TDI A;  5CYY A;  2HRF A;  4PQ1 A;  2PVO C;  4F9Z A;  1XCC A;  3TJG A;  3QCP A;  4EKZ A;  1GH2 A;  1OC3 A;  5GZZ B;  4BA7 A;  2H75 A;  3I6A A;  4KE3 A;  3LW9 A;  5DVB A;  3WGD A;  1XW9 A;  5CRW A;  1DBY A;  3HXS A;  4KCE A;  5G1K A;  3HD5 A;  3BJ5 A;  1ZCP A;  5INY A;  5EL8 A;  1K3L A;  4MJE A;  4G01 A;  2FLS A;  3UBL A;  3OR5 A;  4WKW A;  1TI1 A;  4HEA 2;  4NV5 A;  1SVO A;  1GRX A;  4OCF A;  2XBI A;  2HFD A;  3EC3 A;  1GUH A;  3LFL A;  2V32 A;  4MDC A;  5A4W A;  2FD3 A;  3ZTL A;  1SVL A;  2H1L A;  4OFN A;  5BMU B;  1X5D A;  3QOU A;  2YNX A;  5HR0 A;  3G9B A;  1K0D A;  4NWY A;  1URM A;  1T8E B;  3SBC A;  5C00 A;  3F4S A;  3APS A;  1SJZ A;  5HFG A;  5ECQ B;  1NHO A;  2ON5 A;  2H1A A;  3BCK A;  4FIW A;  5DCG A;  1VF1 A;  4EIP A;  3KTB A;  1J08 A;  3ERG A;  3M9J A;  2GDR A;  4IBP A;  4ACS A;  2LQQ A;  2KLX A;  5E4W A;  4N11 A;  1PN9 A;  1SL1 B;  4G2E A;  1EP8 A;  3QFA C;  1PN0 A;  2E0Q A;  1A0F A;  1AAZ A;  1PMT A;  1U6T A;  3E3E A;  5A5K A;  1EWX A;  1Y25 A;  1GLQ A;  2ES7 A;  1A23 A;  5ECI B;  1FG4 A;  5E59 A;  2P0G A;  4EVM A;  1SK0 A;  3L0H A;  5A4U A;  3SWL A;  2EFH A;  5LCZ A;  2LQO A;  4FYC A;  2M80 A;  1VF4 A;  3HA9 A;  3TKQ A;  4YKF A;  2L4Q A;  3IK7 A;  4F82 A;  4PUR A;  2CX3 A;  1R5A A;  5A5H B;  2YAN A;  1XWK A;  4IP6 A;  4HZ2 A;  1A2J A;  2O7K A;  3C73 A;  3DVW A;  5G5F A;  3DGQ A;  1UA5 A;  2NVL A;  4PNG A;  4D73 A;  1X9M B;  1QFN A;  3KEB A;  3LEF A;  7GSS A;  3HJM A;  2LUS A;  2TRX A;  3GTU A;  2LS5 A;  4ZBB A;  3TUE A;  3HCZ A;  3US3 A;  4OD7 A;  2DJJ A;  1VRS D;  2JZR A;  5IMF A;  5DJM A;  4PX1 A;  2YJ7 A;  2HNL A;  1M9B A;  2YJH A;  2L5O A;  4MAB A;  2JSY A;  5D73 A;  4BVY B;  2AB6 A;  3E9J B;  3FMW A;  1YKC A;  4L5L A;  4KF9 A;  2DC5 A;  2LRN A;  1M7T A;  2HSH A;  1GTU A;  3A2V A;  4FH8 A;  3GMF A;  1WOU A;  4ECB A;  1N2A A;  5B6M A;  1YDK A;  4AJ8 A;  1TP9 A;  1TRV A;  1EOH A;  1V9W A;  1XOB A;  3GKM A;  3BD2 A;  2H0H A;  4GTU A;  1AQX A;  2VLT A;  2OE1 A;  4TXV A;  5J41 A;  1YKA A;  1EEM A;  4MPG A;  2IPA A;  4YAV A;  2DLX A;  4AKI A;  4OFT A;  5IOX A;  2UZ8 A;  4JZQ A;  4USS A;  4PUF C;  3KH7 A;  4OO5 A;  3GKX A;  1R26 A;  4X4J A;  3UOM A;  5G1L A;  2F8A A;  3GKK A;  5J40 A;  3G7J A;  3RHB A;  4GQF A;  1J9B A;  1GNE A;  3UMA A;  4JU5 A;  1HYU A;  1S3D A;  6GSV A;  3TRQ A;  2V6O A;  4TR1 B;  2AUV A;  3U6V A;  1T3B A;  5B7C A;  4MA9 A;  2FY6 A;  2YWN A;  4GXZ A;  2O87 A;  2F3M A;  2IMI A;  2JU5 A;  2CZ3 A;  2I3Y A;  4V1A g;  3TKR A;  2R2J A;  2HRN A;  4AJ7 A;  5CRH A;  5DJL A;  2X8G A;  1EEJ A;  3D22 A;  2CVD A;  3H1N A;  3FYG A;  2YV7 A;  1A8Y A;  1TK8 B;  1TRW A;  2WZ9 A;  5AN1 A;  3IHQ A;  3F9U A;  4L0W A;  4N10 A;  2FA4 A;  2AYT A;  3LWA A;  5IOW A;  1HNB A;  1V98 A;  2X8C A;  4LL1 B;  1F3B A;  4GRF A;  4F0B A;  1LU4 A;  2B3S A;  1DSB A;  2IMF A;  4A5P A;  3PR8 A;  3Q6O A;  3G7I A;  3VWX A;  3C71 A;  1F3A A;  1G6W A;  2REM A;  5DAL A;  4HZ4 A;  2V6K A;  2DKH A;  4MH3 A;  4IJI A;  1OYJ A;  5FT3 A;  4O5R A;  3M9K A;  2X8H A;  2JL4 A;  1AQW A;  4NV2 A;  3IR4 A;  5L71 A;  1M0U A;  2HZE B;  2MMN A;  2R0G A;  5DQS A;  5IIZ A;  4KGI A;  3ISO A;  2O8V B;  4KSM A;  4H86 A;  3N5O A;  2I81 A;  3DEX A;  3TJB A;  2MZC A;  2XBQ A;  3ZFL A;  4ZL7 A;  3TJK A;  1Z7R A;  4WR4 A;  1F2E A;  5J47 A;  1GSF A;  1I5G A;  1SYX A;  4O7H A;  3GH6 A;  3TRP A;  1OC9 B;  3GNJ A;  11GS A;  3WGX A;  1B9X C;  3CSI A;  3IOS A;  1SJ6 A;  1O7U A;  4WR5 A;  5ECL B;  1K0A A;  1JHB A;  2OE0 A;  1KEB A;  1VF3 A;  4IJ3 A;  5HQP A;  4ML6 A;  4X43 A;  5B8A A;  4JR4 A;  2VL2 A;  4ZIL A;  3EYT A;  3GIX A;  2PER A;  2R5G A;  1O73 A;  2H6Y A;  4DSQ A;  1WP0 A;  5F07 A;  5A34 B;  1ST9 A;  2WUL A;  4Q5R A;  4ZB9 A;  4EC0 A;  3C1R A;  1HD2 A;  2ZNM A;  1B8X A;  1GSQ A;  3U5R E;  4HJ2 A;  4PNF A;  2VM1 A;  5ECM B;  2IWT A;  2LKU A;  4LA1 A;  3HZ4 A;  2A4V A;  3GFK A;  2C8U A;  2BMX A;  3GX8 A;  4NHZ A;  1TTZ A;  1K0C A;  5F0G A;  4IQA A;  2P5R A;  4V1A p;  18GS A;  1U3I A;  3R2Q A;  1H4O A;  4ML1 A;  2F9S A;  1Z5Y E;  1SU9 A;  1UC7 A;  4LL4 B;  4POM A;  1AXD A;  2IFQ B;  2R37 A;  1QXH A;  4ULX A;  1Z6N A;  2RII A;  3GL5 A;  4W66 A;  1TOF A;  2ALB A;  4IW9 A;  3TKS C;  1OE8 A;  3ZLP A;  5IMA A;  2HSY A;  4G0I A;  2VUP A;  3ERW A;  5D9X A;  2F51 A;  2IJY A;  6GSY A;  1YQ1 A;  1XW6 A;  1YZX A;  1R5P A;  2L5L A;  5EPF A;  3MYD A;  5G2Z A;  3PH9 A;  3IK9 A;  1K3O A;  2CT6 A;  2A2S A;  1EGR A;  1FOV A;  5LNK e;  4K0N A;  1EZK A;  2HXK A;  1A2M A;  3ED3 A;  3LQ7 A;  1W89 A;  1MD3 A;  4Z7X A;  1Z7P A;  4RUV A;  1W4V A;  2GT5 A;  3F4R A;  3L78 A;  1GL8 A;  2HSM B;  2HE3 A;  2VLU A;  3KJY A;  1YEX A;  1M2B A;  3PIN A;  4IHU A;  2H76 A;  3GUR A;  2NDO A;  2AAW A;  4I2T A;  3UL3 A;  1Z6M A;  2VL3 A;  2YV9 A;  3MWH A;  4MZB A;  3DYR A;  4PTS A;  2DJ1 A;  3LOR A;  4GF0 A;  4ZB8 A;  2IIY A;  2J23 A;  2H1D A;  2X49 A;  2P31 A;  3NOF A;  3LGC A;  2FGX A;  1YEP A;  4EDY A;  5IO2 A;  1PSQ A;  2GZY A;  3D4T A;  4XS6 A;  4YAP A;  1MDJ A;  3WT2 A;  3HDC A;  2QGV A;  2IMK A;  1XIY A;  2HRK B;  3HKR A;  3KM6 A;  5J4Y A;  4WEY A;  4TXO A;  3RAZ A;  2TIR A;  4YH2 A;  1ZYP A;  5J3R A;  1WPI A;  3F3Q A;  1OE7 A;  4MK3 A;  2EFC A;  1PL1 A;  2GQL A;  3CYN A;  2RLI A;  1PQN A;  4MCU A;  1S3A A;  4EUY A;  1EV4 A;  2HLS A;  1F37 A;  4XRD A;  4MJC A;  4MF7 A;  5J4V A;  4RQR A;  4EL1 A;  1K0M A;  1BAY A;  3GSS A;  4N30 A;  2C0E A;  4BWS A;  3O76 A;  4G10 A;  2XHF A;  3CRU A;  4HQS A;  3VI7 A;  2ZUP A;  5J9C A;  5EVO A;  4CHS A;  1WIK A;  2OA7 A;  3TDG A;  1NHY A;  2DJ0 A;  9GSS A;  3IC4 A;  1TRS A;  1GTA A;  1XWC A;  4EF0 A;  2GSQ A;  4NHW A;  4KUN A;  2VLV A;  1YF0 A;  1SKR B;  5F8B A;  2LEG A;  3LG6 A;  2R6K A;  3ZRD A;  2AHE A;  3MNG A;  2CVK A;  1SVM A;  4K2X A;  1UN2 A;  3F6F A;  5ECR B;  5KN0 A;  1BG5 A;  4K8M A;  3P7X A;  3W8S A;  2CAQ A;  4MJB A;  4AJ6 A;  4TW5 A;  4F2I A;  3F8U A;  2VAF A;  4GDF A;  2WRT A;  1PRX A;  1GSD A;  2HT9 A;  1T1V A;  3A5W A;  4Z2R A;  1JZO A;  3S9F A;  22GS A;  3G7Y A;  3ZIT A;  2C3N A;  4HQZ A;  2OJL A;  1M99 A;  3EMX A;  5LD0 A;  1EP7 A;  3FZ9 A;  3GUS A;  3IAM 2;  4FQU A;  3DWV A;  4MLY A;  3H8Q A;  3P8W A;  2VCZ A;  3I69 A;  4KCA A;  4HU9 A;  2HRA A;  4IEL A;  3DML A;  2CA8 A;  4YQV A;  1X9S B;  3A2X A;  3DRN A;  4V2M A;  2GS3 A;  5HFK A;  4MF5 A;  1BQ7 A;  3TKP A;  2H72 A;  4P3Y B;  1WRY A;  4BWQ A;  2PGT A;  5HR1 A;  3L4N A;  1LJR A;  2IL3 A;  1ZOF A;  2L59 A;  4IKH A;  1SEN A;  4MZW A;  2X64 A;  5ECO B;  2BJX A;  5CRD A;  1IYI A;  1MEK A;  2XPD A;  5ID2 A;  1R7H A;  2LJR A;  2P5Q A;  3ERF A;  2JAC A;  5A5H A;  1XXU A;  4AKG A;  5GAP D;  4XS4 A;  4GSS A;  17GS A;  3TJF A;  4K0G A;  4BVX A;  2QSI A;  3GH9 A;  4ZIJ A;  2GLR A;  4X0X A;  2C0G A;  2VM2 A;  2XC2 A;  1JLV A;  1Y1U A;  3ZFB A;  4XHM A;  1OKT A;  3GA4 A;  1XVW A;  3MDK A;  2KP2 A;  1ACV A;  2J9H A;  3GL3 A;  5FWG A;  2FNO A;  3C8E A;  3CMI A;  2HQT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...