1PD21

Crystal structure of hematopoietic prostaglandin d synthase complex with glutathione
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
199
structure length
199
Chain Sequence
MPNYKLLYFNMRGRAEIIRYIFAYLDIKYEDHRIEQADWPKIKPTLPFGKIPVLEVEGLTLHQSLAIARYLTKNTDLAGKTELEQCQVDAVVDTLDDFMSLFPWAEENQDLKERTFNDLLTRQAPHLLKDLDTYLGDKEWFIGNYVTWADFYWDICSTTLLVLKPDLLGIYPRLVSLRNKVQAIPAISAWILKRPQTKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase
molecule keywords HEMATOPOIETIC PROSTAGLANDIN D SYNTHASE
publication title Cloning and crystal structure of hematopoietic prostaglandin D synthase.
pubmed doi rcsb
source organism Rattus norvegicus
total genus 70
structure length 199
sequence length 199
chains with identical sequence 2
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 1998-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
1 PF02798 GST_N Glutathione S-transferase, N-terminal domain
1 PF14497 GST_C_3 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 1pd2102
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1pd2101
4OMVA 4Q5RA 2IPAA 3IK7A 2OBIA 2GSTA 2C3TA 2DJKA 1K0DA 3TRXA 3APSA 3KH9A 5BMUA 2K9FA 1SL2B 2JZTA 4FH8A 5G1KA 3VI5A 2H0IA 4O5RA 3APQA 3F3QA 4EKZA 4G0IA 2WDUA 1V57A 1X5EA 3A2VA 2I9HA 3F4RA 1EWXA 3MWHA 5CRDA 1SKWB 1LU4A 2PU9C 3DXBA 2LQQA 1T4ZA 2EIOA 1ZOFA 3ZIJA 1EP8A 1T00A 1TI3A 4BL7B 4XS4B 5CP1A 3V1WA 2AV4A 3GKXA 3GX0A 2LKUA 3ZLPA 1UC7A 3HZ4A 4NV2A 3E3EA 1XBSA 2JL4A 2TRCP 2VIMA 2R3XA 1SU9A 4L0UA 5AIVA 2OBKA 2E7PA 3ZITA 2OE1A 1M0UA 1U88A 4KSMA 1R4WA 1T4YA 2X8CA 1DUGA 2ZCTA 1A2MA 1TK5B 3LSZA 1M2BA 4HS1A 4WR5A 1GLPA 2JZSA 2IFQB 4GSTA 3EE2A 4TOPA 1A23A 3KTBA 1KBNA 3KH7A 2H19A 3VLNA 1BJXA 3WD6A 1PQNA 2DJ2A 3D6IA 2B7KA 3EVIA 3TKRA 5D8IA 2VCXA 2GT5A 2YWMA 3GSSA 2IMDA 5D9WA 1PMTA 3F6DA 1Z9HA 1CQHA 4TR4A 2RUFA 1B9YC 1GSEA 3CRUA 4FYCA 4TR0A 4QQ7A 2C0EA 1IYIA 4MA9A 1X9SB 4N0VA 1SD9A 4PXOA 3O3TA 4IELA 2IMFA 3EWLA 4MCUA 5GAPD 2OACA 3GV1A 2NVLA 1GNEA 2FWGA 2JU5A 2FUG2 1VGLA 2WZ9A 1PL2A 4V2NA 19GSA 2FWFA 3CSHA 1TP9A 3TDGA 2C0DA 4OWYA 4TXOA 2XC2A 4WXTA 4MH3A 1GSDA 2V1MA 3FK8A 2MMAA 4OFTA 2B5YA 1XCCA 2O7KA 3VFIA 2B5XA 1E6BA 5CAXA 1S3AA 3UBLA 1GULA 2VM1A 4USSA 3LXZA 2FY6A 1R7HA 3UARA 2HRKB 2HSMA 1F3AA 2K18A 2C0FA 5C04A 1XOAA 5LD0A 2KHPA 4V1Ap 5F8BA 4ML6A 1WE0A 3FYGA 3W6GA 2DJ0A 4V1Ag 4YQUA 3F8UA 4YAPA 4IW9A 3D0ZA 4LL4B 4MZBA 1S3DA 5J5NA 1SL0B 3U6VA 5A4UA 2H66A 3IA1A 4K1FA 3ED3A 2H01A 3GL3A 3RPPA 1SJZA 1BQ7A 3SWLA 1ACVA 4XCSA 4TR3A 5EY6A 2VCQA 3GNJA 1FO5A 2ALBA 1Q4JA 1SJIA 2OE0A 5A5KA 4QL9A 4K7OA 1G6WA 1K0BA 3L0HA 2X8GA 2KLXA 4XHMA 2A2SA 1O81A 3BCIA 5ECIB 3F3RA 2CAQA 4OFMA 1A2LA 2WULA 2YP6A 4IN0A 5D73A 3M0FA 4PNGA 3F0IA 1PGTA 3GSTA 4EF0A 4ZBBA 4TXVA 1KTEA 3PINA 4XS4A 2WB9A 2QC7A 2MMNA 3UVHA 3TCOA 5ECHB 1THOA 3CYNA 4RUVA 1GWCA 5D9VA 2FNOA 4GCIA 2O89A 3TUEA 2LRNA 1TI1A 1K0AA 2V41A 4F9ZA 3ZYWA 2VLTA 18GSA 4J56E 1GUHA 5J4UA 1HQOA 1ZL9A 3M3MA 1M2DA 4GQFA 5ENUA 6GSTA 2C1YA 2FWHA 3IXRA 1B4PA 1YEXA 2CA8A 5B7CA 2E2MA 3APOA 4KDXA 3O76A 4JE1A 4IS0A 1Z7RA 2GLRA 2DBCA 5IM9A 4Q5QA 4ZL9A 1F6MC 3F6FA 3G7JA 5AISA 2I4AA 1QGVA 4GSNA 2AB6A 3BBYA 2YV7A 4FO5A 1FB6A 2EC4A 4ZB6A 1AIUA 3GUSA 1QQ2A 3HVSA 2E2GA 2L5LA 1FHEA 5D96A 2B7JA 2B5EA 3GX8A 4EO3A 2OJLA 5H5QA 1PKZA 1TDIA 3L4NA 1Y25A 1PD21 1NM3A 4JEDA 1N8JA 4BPYA 4EXJA 3IC8A 2LV3A 1ERWA 2VCWA 4EVMA 2LJKA 3ZTLA 2HSHA 3ZREA 1PX7A 1UA5A 1ON4A 3LGCA 4EC0A 3S9FA 4BA7A 1PA3A 2HYXA 5FHIA 4N0ZA 2F9SA 2DLXA 1B9XC 2C0GA 5HFKA 1V2AA 5F06A 4WF5A 4IQAA 4HDEA 3EINA 4K9ZA 3IDVA 3GURA 7GSSA 3C71A 3G7YA 2HSYA 3FR3A 5ECKB 2H75A 1VF1A 3QAWA 3LYPA 2FLSA 1EZKA 5EPFA 3SBCA 3GFKA 2HRKA 2CT6A 1YKCA 4KA0A 4BVXA 1ZZYA 2G2QA 4NMUA 1R5PA 4AGSA 3UVTA 4K8MA 1T1VA 5IO0A 5HR3A 1QUWA 1H4OA 1CQGA 4ZIJA 1BAYA 3DVWA 2P5QA 3FRCA 3PGTA 1WOUA 4ECJA 4HI7A 2H6XA 2LRCA 2L59A 3EURA 4RI7A 1M99A 1TRWA 2VL2A 5EVOA 2F8FA 3UBKA 5CRHA 4NWYA 1AUCA 5HR1A 4HEA2 2H6ZA 2C3NA 4ZL7A 1Z6NA 1OKTA 3WGEA 2UZ8A 5DALA 2H8LA 1F37A 4KAEA 4KH7A 3DGQA 1FAAA 1GSYA 4WF4A 1J08A 4L0WA 3ZIVA 3DMLA 4RQRA 3IRAA 1V40A 1T8EB 4MZCA 5ECMB 1NHOA 3U5RE 1GP1A 4PQIA 4L5OA 3A5WA 5IIZA 4KDUA 5ECPB 1JFUA 2CVBA 4N11A 4G0KA 1EOHA 5KN1A 3GHAA 1F2EA 1PL1A 3LFLA 3HVVA 1ML6A 1I5GA 3HY2A 3CTGA 1A8YA 4WKWA 2AHEA 3E9JB 1QFNA 3TJBA 3FY7A 1GUMA 1UN2A 2C3QA 2IIYA 3DYRA 2RUEA 3QFAC 2DIZA 3EYTA 3IAS2 9GSSA 2HRFA 3HXSA 1M7TA 1AQWA 5GAND 3CSIA 3EMPA 2YWOA 2CZ2A 1XVQA 3BCKA 3C7MA 2H1GA 1M2AA 5JCWA 2YNXA 2J9HA 2I81A 2GGTA 2GSQA 3GKNA 3HD5A 3C1RA 3QOUA 3H1NA 1K3OA 2BTOT 4J57E 4POMA 5HR0A 2PGTA 2N5AA 1F3BA 3IOSA 2GQMA 4KNDA 4IHUA 3NIVA 1XWCA 1Z7PA 4ACSA 2DSAA 1GSFA 2V2GA 4DSQA 4KCEA 3R2QA 1M9BA 2HT9A 1RW1A 3DVXA 4IQ1A 1BEDA 3VK9A 3EMXA 1W4VA 3VWXA 2YZHA 3W8JA 2HZEB 3WGXA 2J23A 5DBQA 5ID2A 3Q6OA 3H79A 3P8WA 2RIIA 1SKRB 1XIYA 3KJYA 2MMZA 4DEJA 4TKYA 1TRUA 3OR5A 2JZRA 2K8VA 4V2LA 2VL3A 3TOTA 1K0MA 2H71A 1MDKA 2P0GA 4PNFA 5F0GA 3ZFBA 5D9TA 1EV4A 2YANA 2H74A 1WIKA 1WMJA 1TOFA 2HRAA 1AC1A 2LEGA 2H6YA 3D4TA 5GSTA 1YJ6A 2KOKA 5IMDA 2LS5A 2PVQA 2K6VA 5ECNB 2GQLA 4TW5A 3GMFA 4L8EA 2IMKA 5ELGA 4LA1A 3RHBA 2GT6A 4JBBA 1MEKA 5IQYA 1GL8A 1TJDA 2F8AA 2PUKC 2DJJA 4HOJA 2L6CA 3CRTA 2AYTA 5JCUA 4MJBA 3L9UA 4MH2A 2GDRA 3TJGA 1MDIA 1K0OA 1ZGNA 1YDKA 1Z6MA 4TR1A 2GSSA 1XW9A 5ECQB 3CTFA 3WGDA 2M46A 3A3TA 4IVFA 3IE3A 2M80A 3Q19A 1MTCA 1SYXA 2LTKA 4K0NA 1IYHA 1A2JA 1HYUA 2P5RA 2G0FA 4MDCA 4KE3A 5KN0A 1OE8A 3FR6A 3J7Yb 1B48A 4F0BA 2MBTA 4HQSA 2XBQA 6GSVA 2VD1A 3C73A 4GXZA 3IBHA 4I6XA 4EE0A 4X0XA 2GSRA 2MBSA 3PR8A 1ZCPA 2B3SA 3TRPA 1U3IA 2C4JA 4JRRA 1EP7A 3EU4A 4NPBA 3QPMA 2TIRA 2HE3A 5DAKB 5B6NA 4ZB9A 1GTUA 1GUKA 3LJRA 3ME7A 5G5EA 2LNSA 2KUCA 4GLTA 3LWAA 4KB3A 1AQXA 3FZ5A 6GSWA 1TRVA 1JZOA 3C8EA 2H76A 3ZL5A 3TKSC 2C8UA 5B8BA 4XS6A 1WRYA 5KN3A 1OKDA 5E59A 1B8XA 5EL8A 2B1KA 3VWVA 1Z5YE 3TRQA 1B4QA 2AAWA 4LLRA 5L71A 3D5JA 4EDYA 1NHYA 3I43A 4IGJA 2FCHA 4KUNA 3TJFA 3TJJA 5IMFA 5G30A 3D21A 2PBJA 3ZRDA 3M9KA 1SL1B 4BL7A 1DBYA 1R5AA 2A2RA 1USBA 3O6TA 4IJIA 4ECCA 2IL3A 3I69A 1XFLA 1PRXA 11GSA 3VURA 3TKSA 3UL3A 5IPHA 1T3BA 2V6KA 2N5FA 1DE1A 4TRXA 5CO3A 2IN3A 4OO4A 4F82A 2VLUA 4YQMA 2WJUA 2VL9A 1RK4A 2HZEA 4O7HA 3QDNA 2A4VA 4POLA 2GVPA 3M8NA 1OYJA 4MLYA 4NHZA 2IFQA 2VOCA 3NOFA 3BOAA 3HJMA 3BD2A 5H5SA 5DCHA 2GS3A 4HU7A 5D9XA 4KSOA 4ZBAA 3TKQA 3GA4A 5ECOB 3GKKA 5HQPA 5IOXA 2KP1A 1YZXA 5C00A 4BVYB 1SK2A 1XW5A 1TTZA 5G31A 3DIEA 1BYEA 2IWTA 3HHVA 3LORA 4K0GA 5DVBA 3KIJA 4EDZA 4WBJA 3ERFA 22GSA 1I9DA 1G7EA 5J9BA 1OAZA 3RDWA 4HUAA 3QFBC 3HJPA 4D73B 4IJ3A 2YPMA 4F0CA 4KDYA 1VF3A 5D93A 3GYKA 4AJ7A 1Q98A 4G19A 4OCEA 3KTLA 4I2UA 2PVOC 3N9JA 3VPQA 3QD9A 2GTUA 5HFGA 4ZBDA 4NV5A 1TK8B 3R3EA 1ERTA 4GSSA 3HJOA 3I6AA 2YWIA 3NZNA 3H8QA 2RLIA 3IAM2 2VCZA 2R6KA 5LCZA 1FB0A 3WYWA 2VL2C 4TN8A 2NBSA 4YAVA 3KP8A 2HSNB 2CQ9A 2AUVA 5DDLA 3UOMA 3D4MA 1YY7A 4X43A 1EV9A 5AGYA 1R26A 2H0HA 4F2IA 5IO2A 4MABA 4N10A 3ME8A 1ZYQB 4ULXA 4LMVA 3HDCA 3LQ7A 3KEBA 4PUAA 3GH9A 1TW9A 1K3LA 5JCGA 3DWVA 2FD3A 4MP4A 4JR6A 2DJ3A 3EC3A 3WT1A 5DAKA 1GLQA 4MZWA 1K0NA 1U6TA 1JZRA 1VRSD 1BX9A 3CSJA 3UAPA 4X1UA 1J9BA 5GSSA 3KCMA 5IOWA 3G7IA 1W89A 3TGZA 6GSXA 2H1AA 4HZ4A 2YN1A 1SD8A 2JADA 2CAIA 5A4WA 3F63A 3GH6A 2PWJA 1AAZA 5B8AA 2FA4A 1GTAA 3N5OA 4KF9A 4WETA 4TVEA 5GZZB 1K3YA 4NAXA 3F9UA 1WPIA 3IC4A 4Z7XA 5DJLA 3HVXA 1VF2A 2L4QA 1HNBA 3DD3A 2H30A 1SJ6A 2VM2A 5J41A 1EGOA 2HZFA 1J0FA 2P31A 4MJCA 4GQCA 2H0GA 4L5LA 5AIXA 4ZILA 2IJYA 3HYPA 2M72A 1EEJA 4OO5A 1ERUA 2L4CA 1X9WB 3M1GA 4KX4A 3IR4A 3GKMA 2X8HA 13GSA 3FZ4A 2GZPA 3F4SA 1MD4A 5CRGA 1KNGA 4J2FA 17GSA 2HRNA 1EGRA 1BG5A 2K8SA 3P2AA 5ABRA 5KEJA 4DSRA 3L9SA 4ZXGA 4LMWA 1AXDA 2DMLA 2GQKA 3VWWA 2OADA 4DSSB 1A0FA 2FHEA 4BVYA 1XWGA 2F51A 1VF4A 2HNLA 1N2AA 4PQHA 3FHKA 5IMCA 2HFDA 2VO4A 1NSWA 3KD0A 4YH2A 4GTUA 2FWEA 1PSQA 2HXKA 2WS2A 5AN1A 2MYGA 4ECIA 4JZQA 2QSIA 4V2MA 4K7IA 2YWNA 2NDOA 4POBA 1LBKA 4POKA 5A4VA 5DQSA 1TU7A 4K6XA 4AJ8A 1X5CA 5ECLB 3AY8A 4WEYA 2IMIA 4Q5NA 3MNGA 4AJ6A 5G2ZA 4D73A 1LJRA 1OC8A 2LJAA 3RAZA 3KM6A 4MJAA 4DVCA 5F05A 3LXTA 2H73A 3VWUA 3KGKA 3DRNA 4MF7A 1S3CA 4H86A 3UEMA 1PX6A 1DSBA 4HJ2A 2R5GA 3MDKA 5ECRB 4MMMA 3F4TA 4HQZA 6GSUA 3W8SA 4LL1B 1TK0B 2I1UA 3E0UA 1V9WA 3FKFA 4FYBA 5HFIA 2V32A 3K8NA 2TRXA 2YV9A 5G5FA 3ERWA 2KP2A 6GSSA 3HKRA 4ID0A 2VLVA 2HLSA 8GSSA 2DC5A 3GRXA 4GF0A 3J7Yk 4XRAA 3Q74A 1WJKA 12GSA 1WP0A 1XOBA 4O32A 3EU3A 1DE2A 2WRTA 3UIWA 1FW1A 1TKDB 3GTUB 2NPBA 2R2JA 1V98A 3CBUA 3ZVJA 2FGXA 1GRXA 4G0LA 1GH2A 1O73A 3KXOA 2VAFA 2AJQB 1Y6EA 4RI6A 1XPVA 2D2ZA 3QR6A 5CYYA 4HJMA 1XZOA 2LSTA 2RM6A 3PH9A 4PUFC 1ERVA 4MJEA 2OE3A 1ABAA 2YJHA 4N30A 3KMNA 3FZ9A 4PURA 2YCDA 4XTSA 4P3YB 3IPZA 3TJKA 2F3MA 1XW6A 4NXIA 4K2DA 1GSSA 3FEUA 2Z9SA 2ON7A 2X64A 4MK3A 2REMA 5ELAA 4PQ1A 3RPNA 1MD3A 2I3YA 4BVXB 2ES7A 4PTSA 3ZVJD 1YQ1A 4QL7A 1XVWA 1SENA 4AF2A 1AQVA 6GSYA 1JLVA 4G9HA 3L9VA 3P7XA 3FW2A 2VD0A 1OC9B 3GN3A 4FIWA 3A2WA 4RQXA 4MF6A 2LRTA 1O85A 4K7NA 5JWOB 5KN2A 1H75A 1XWKA 5INYA 1XWBA 3FR9A 1OC3A 5DALB 2EIQA 4DSSA 3TOUA 4E8EA 2IMEA 5E4WA 2E0QA 2O85A 5B6MA 3CMIA 5J9CA 3VPTA 4BWSA 1G6YA 3I9V2 1THXA 2H72A 5FT3A 4G10A 2N5BA 16GSA 5CREA 1X9MB 4JR4A 1ST9A 3TKSE 1F9MA 5CRWA 1XXUA 5DJMA 1ZYEA 4GRFA 2GZZA 4CHSA 1JZDA 1X0RA 5IMZA 1UVZA 1A24A 3HZ8A 3KP9A 5IMAA 4EUYA 1FOVA 1A0RP 5J3RA 4O92A 3L78A 4OCFA 2R37A 4FQUA 3FZAA 4MF5A 3D22A 3ISOA 4MPGA 3CXGA 2VCTA 2B1LA 3M9JA 1HD2A 2YZUA 2LNTA 2JSZA 2ZNMA 1U87A 4XS1A 3PPUA 1FVJA 3DEXA 4ECBA 3GTUA 4IP6A 1QXHA 2LQOA 2CVDA 4CW9A 2X99A 5LNKe 2FA8A 2V6OA 3UJ1A 1JLWA 1E2YA 1O7UA 5DCGA 1OE7A 3LG6A 2ON5A 5IMVA 2PPTA 1SK0A 2HI7A 2L5OA 3H93A 2WGRA 2VCVA 1SYRA 4IP1A 4ML1A 10GSA 1K0CA 1O6JA 4F03A 1YKAA 2BMXA 2XPDA 1YF0A 5G1LA 2C80A 3GIXA 2JSYA 2H1BA 3ZZXA 1YF1A 3P90A 1URMA 1HNCA 2DJ1A 2CVKA 3ZMKA 4HZ2A 3ZFLA 2QGVA 4YQVA 4ISDA 1SK1A 1U3AA 1V58A 2YJ7A 1A8LA 3LEFA 5ID2B 3HCZA 1EEMA 4CDOA 2PN8A 4OD7A 5IPGA 1GTBA 4I97A 2WCIA 3MSZA 2LJRA 2HQTA 3G9BA 3Q18A 2JACA 2MZCA 3H4KA 4I2TA 4I8BA 3RBTA 1TU8A 3UMAA 4KW6A 3US3A 2H1DA 5H5RA 1M9AA 4PGTA 2DIYA 3WT2A 4JU5A 2RM5A 2CZ3A 1YEPA 1GTIA 3RHCA 3A2XA 4KGIA 1O8XA 1T7PB 3QAGA 2VUPA 1PKWA 4Q5FA 1HNAA 3LYKA 2H70A 5COHA 1G0TA 3VI7A 1QK8A 3IK9A 1OC9A 3HA9A 5JWRB 2QKEA 3C1SA 3ERGA 1GSUA 4G2EA 3KZQA 1JHBA 1O8WA 3TB2A 1JZWA 5F07A 2ZUPA 4TXOB 3GL5A 1EOGA 5FWGA 5DQYA 2L6DA 1SKSB 4MPFA 3IHQA 2GZYA 4BWQA 2CX3A 1XWAA 5JWQB 4I5QA 3DKSA 4TR1B 1QMVA 2CV4A 2XBIA 1PN9A 4WR4A 1TXXA 4EL1A 2R4VA 2EIRA 4ZB8A 4ILFA 1NW2A 2NTOA 2B6MA 4XIHA 2L57A 3IV4A 1KEBA 1TRSA 2DMMA 3QMXA 2OA7A 4HU9A 1MDJA 5CNWA 4KCAA 1GSQA 5ECSA 2XHFA 2PMTA 4WBRD 4PX1A 2XPEA 2MMOA 2PERA 2HSMB 1RQMA 4IKHA 1ZMAA 1GNWA 3ZMLA 1FG4A 4ZL8A 4E8HA 3BJ5A 3TKPA 4NHWA 3KMOA 4OFNA 2LUSA 1Z3EA 4XRDA 1AW9A 1FVKA 2OKAA 14GSA 1X5DA 1ILOA 3QCPA 1OVNA 1C72A 1WWJA 2O8VB 20GSA 1G7OA 4IBPA 2BJXA 3JCML 4GWRA 2CX4A 3MAKA 3QAVA 2YOIA 4FYUA 2O87A 5HR2A 2WFCA
chains in the Genus database with same CATH superfamily
4OMVA 4Q5RA 2IPAA 3IK7A 2OBIA 2GSTA 2C3TA 2DJKA 1K0DA 3TRXA 3APSA 1ZYPA 3KH9A 5BMUA 2K9FA 1SL2B 2JZTA 4FH8A 5G1KA 3VI5A 2H0IA 4O5RA 3APQA 3F3QA 4EKZA 4G0IA 2WDUA 1V57A 1X5EA 3A2VA 2I9HA 3F4RA 1EWXA 3MWHA 5CRDA 1SKWB 5A1NA 1LU4A 2PU9C 3DXBA 2LQQA 1T4ZA 2EIOA 1ZOFA 3ZIJA 1EP8A 1T00A 1TI3A 4BL7B 4XS4B 5CP1A 3V1WA 2AV4A 3GKXA 3GX0A 2LKUA 3ZLPA 1UC7A 3HZ4A 4NV2A 3E3EA 1XBSA 2JL4A 2TRCP 2VIMA 2R3XA 1SU9A 4L0UA 5AIVA 2OBKA 2WW2A 2E7PA 3ZITA 2OE1A 1M0UA 1U88A 4KSMA 1R4WA 1T4YA 2X8CA 1DUGA 2HSNA 2ZCTA 1A2MA 1TK5B 3LSZA 1M2BA 1BG1A 4HS1A 4WR5A 1GLPA 2JZSA 2IFQB 4GSTA 3EE2A 4TOPA 1A23A 3KTBA 4K5RA 1KBNA 3KH7A 2H19A 3VLNA 1BJXA 3WD6A 1PQNA 2DJ2A 3D6IA 2B7KA 3EVIA 3TKRA 5D8IA 2VCXA 4MNNA 2GT5A 2YWMA 3GSSA 2IMDA 5D9WA 1PMTA 3F6DA 1Z9HA 1CQHA 4TR4A 2RUFA 1B9YC 1GSEA 3CRUA 4FYCA 4TR0A 4QQ7A 2C0EA 1IYIA 4MA9A 1X9SB 4N0VA 1SD9A 4PXOA 2DKIA 3O3TA 4IELA 2IMFA 3EWLA 4MCUA 1SVLA 5GAPD 2OACA 3GV1A 2NVLA 1GNEA 1PFOA 4PI0C 2FWGA 2JU5A 2FUG2 1VGLA 2WZ9A 1PL2A 4PHZC 4V2NA 19GSA 2FWFA 3CSHA 1TP9A 3TDGA 2C0DA 4OWYA 4TXOA 2XC2A 4WXTA 4MH3A 1GSDA 2V1MA 3FK8A 2MMAA 4OFTA 2B5YA 1XCCA 2O7KA 3VFIA 2B5XA 1E6BA 2A2PA 5CAXA 1S3AA 3UBLA 1GULA 2VM1A 2WVXA 4USSA 3LXZA 2FY6A 1R7HA 3UARA 2WVYA 4X4JA 1PN0A 2HRKB 2HSMA 1F3AA 2K18A 2C0FA 5C04A 2X49A 4G01A 1XOAA 5LD0A 2KHPA 4V1Ap 5F8BA 4ML6A 1WE0A 3FYGA 3W6GA 2DJ0A 4V1Ag 4YQUA 3F8UA 4YAPA 4IW9A 3D0ZA 1I1IP 4LL4B 4MZBA 1S3DA 5J5NA 1SL0B 3U6VA 5A4UA 2QA1A 2H66A 3IA1A 4K1FA 3ED3A 2H01A 3GL3A 3RPPA 1SJZA 1BQ7A 3SWLA 1ACVA 4XCSA 2EFEA 4TR3A 5EY6A 2VCQA 1TXUA 3GNJA 1FO5A 1BF5A 2ALBA 1Q4JA 1SJIA 2OE0A 5A5KA 4QL9A 1G6WA 1K0BA 3L0HA 2X8GA 4K7OA 2KLXA 4XHMA 2A2SA 1O81A 3BCIA 5ECIB 3F3RA 2CAQA 4OFMA 1A2LA 2WULA 2YP6A 4IN0A 5D73A 3M0FA 4PNGA 3F0IA 1PGTA 2QA2A 3GSTA 4EF0A 4ZBBA 4TXVA 1KTEA 3PINA 4XS4A 2WB9A 2QC7A 4BIKA 2MMNA 3UVHA 3TCOA 5ECHB 1THOA 3CYNA 4RUVA 1GWCA 5D9VA 2FNOA 4GCIA 2O89A 3TUEA 2LRNA 1TI1A 1K0AA 2V41A 4F9ZA 2R0PA 3ZYWA 2VLTA 18GSA 1GUHA 4J56E 5J4UA 1HQOA 1ZL9A 3M3MA 1M2DA 4GQFA 5ENUA 6GSTA 2C1YA 2FWHA 3IXRA 1B4PA 1YEXA 3EPTA 2CA8A 5B7CA 2E2MA 3APOA 4KDXA 3O76A 4JE1A 4IS0A 1Z7RA 2GLRA 2DBCA 5IM9A 4Q5QA 4ZL9A 1F6MC 3F6FA 3G7JA 5AISA 2I4AA 1QGVA 4GSNA 2AB6A 3BBYA 2YV7A 4FO5A 4YKGA 1FB6A 2EC4A 4ZB6A 1AIUA 3GUSA 1QQ2A 3HVSA 2E2GA 2L5LA 1FHEA 5D96A 2B7JA 2B5EA 3GX8A 4EO3A 2OJLA 5H5QA 1PKZA 1TDIA 3L4NA 1Y25A 1PD21 1NM3A 4JEDA 1N8JA 4BPYA 4EXJA 3IC8A 2LV3A 1ERWA 2VCWA 4EVMA 2LJKA 3ZTLA 2HSHA 3ZREA 1PX7A 1UA5A 1ON4A 3LGCA 4EC0A 3S9FA 4BA7A 1PA3A 2O3EA 2HYXA 1S4BP 5FHIA 4N0ZA 2F9SA 2DLXA 1B9XC 2C0GA 5HFKA 1V2AA 5F06A 4WF5A 4IQAA 4HDEA 3EINA 4K9ZA 3IDVA 3GURA 7GSSA 3C71A 3G7YA 2HSYA 3FR3A 5ECKB 2H75A 1VF1A 3QAWA 3LYPA 2FLSA 1EZKA 5EPFA 3SBCA 3GFKA 2HRKA 2CT6A 1YKCA 4KA0A 4BVXA 1ZZYA 2G2QA 2WZSA 4NMUA 1R5PA 4AGSA 3UVTA 4AKGA 4K8MA 1T1VA 5IO0A 5HR3A 1QUWA 1H4OA 1CQGA 4ZIJA 3CQFA 2UV8G 1BAYA 3DVWA 2P5QA 3FRCA 3PGTA 1WOUA 4ECJA 4HI7A 2H6XA 2LRCA 2L59A 3EURA 4RI7A 1M99A 3HMJG 1TRWA 2VL2A 5EVOA 2F8FA 3UBKA 5CRHA 4NWYA 1AUCA 5HR1A 4HEA2 2H6ZA 2C3NA 4ZL7A 1Z6NA 1OKTA 3WGEA 2UZ8A 5DALA 2H8LA 1F37A 4KAEA 4KH7A 3DGQA 2DKHA 1FAAA 1GSYA 4WF4A 1J08A 4L0WA 3ZIVA 3DMLA 4RQRA 3IRAA 1V40A 5KOWA 1T8EB 4MZCA 5ECMB 5J4YA 1NHOA 3U5RE 1YEWC 1GP1A 4PQIA 4AKXB 4L5OA 3A5WA 5IIZA 4KDUA 5ECPB 1JFUA 2CVBA 4N11A 4G0KA 1EOHA 5KN1A 3GHAA 1F2EA 1PL1A 3LFLA 3HVVA 5A34B 1ML6A 1I5GA 3HY2A 3CTGA 3A5IA 1A8YA 4WKWA 2AHEA 3E9JB 1QFNA 3TJBA 3FY7A 1GUMA 1UN2A 2C3QA 2IIYA 3DYRA 2RUEA 3QFAC 2DIZA 3EYTA 3IAS2 9GSSA 2HRFA 3HXSA 1M7TA 1AQWA 5GAND 3CSIA 3EMPA 2YWOA 2CZ2A 1XVQA 2OT3A 3BCKA 3C7MA 4QMKA 2H1GA 1M2AA 5JCWA 2YNXA 2J9HA 2I81A 2GGTA 2GSQA 3GKNA 3HD5A 3C1RA 3QOUA 3H1NA 1K3OA 2BTOT 4J57E 4POMA 5HR0A 2PGTA 2N5AA 1F3BA 3IOSA 2GQMA 4KNDA 4IHUA 3NIVA 1XWCA 1Z7PA 4ACSA 2DSAA 1GSFA 2V2GA 4DSQA 4KCEA 3R2QA 1M9BA 2HT9A 1RW1A 3DVXA 4IQ1A 1BEDA 3VK9A 3EMXA 1W4VA 3VWXA 2YZHA 3W8JA 2HZEB 3WGXA 2J23A 5DBQA 5ID2A 3Q6OA 3H79A 3P8WA 2RIIA 1SKRB 1XIYA 3KJYA 2MMZA 4DEJA 4TKYA 4CY6A 1TRUA 3OR5A 2JZRA 2K8VA 4V2LA 2VL3A 3TOTA 1K0MA 2EFDA 2H71A 1MDKA 3CHXC 2P0GA 4PNFA 5F0GA 3ZFBA 5D9TA 1EV4A 2EFHA 2WVZA 2YANA 2H74A 1WIKA 1WMJA 1TOFA 2HRAA 1AC1A 2LEGA 2H6YA 3D4TA 5GSTA 1YJ6A 2KOKA 5IMDA 2LS5A 2PVQA 2K6VA 5ECNB 2GQLA 4TW5A 5J4VA 4L8EA 2IMKA 3GMFA 5ELGA 4LA1A 4GDFA 3RHBA 2GT6A 4JBBA 1MEKA 5IQYA 1GL8A 3LW9A 1TJDA 2F8AA 2PUKC 2DJJA 4HOJA 2L6CA 3CRTA 2AYTA 5JCUA 4MJBA 3L9UA 4MH2A 2GDRA 3TJGA 1MDIA 1K0OA 1ZGNA 1YDKA 1Z6MA 3TU3B 4TR1A 2GSSA 1XW9A 5ECQB 3CTFA 3WGDA 2M46A 3A3TA 4IVFA 4E68A 3IE3A 2M80A 3Q19A 1MTCA 1SYXA 2LTKA 4K0NA 1IYHA 1A2JA 1HYUA 2P5RA 2G0FA 4MDCA 4KE3A 5KN0A 1OE8A 3FR6A 3J7Yb 1B48A 4F0BA 2MBTA 4HQSA 2XBQA 6GSVA 2VD1A 3C73A 4GXZA 3IBHA 4I6XA 4EE0A 4X0XA 2GSRA 2MBSA 3PR8A 1ZCPA 4HSCX 2B3SA 3TRPA 1U3IA 2C4JA 4JRRA 1EP7A 3EU4A 4NPBA 3QPMA 2TIRA 2HE3A 5DAKB 5B6NA 4ZB9A 1GTUA 1GUKA 3LJRA 3ME7A 5G5EA 2LNSA 2KUCA 4GLTA 3LWAA 4KB3A 1AQXA 3FZ5A 6GSWA 1TRVA 1JZOA 3C8EA 2H76A 5J47A 3ZL5A 3TKSC 2C8UA 5B8BA 4XS6A 1WRYA 5KN3A 1OKDA 5E59A 1B8XA 5EL8A 2B1KA 3VWVA 1Z5YE 3TRQA 1B4QA 2AAWA 4LLRA 5BRTA 5L71A 3D5JA 4EDYA 1NHYA 3I43A 4IGJA 2FCHA 4KUNA 3TJFA 3TJJA 5IMFA 5G30A 3D21A 4K2XA 2PBJA 3ZRDA 3M9KA 1SL1B 4BL7A 1DBYA 1R5AA 2A2RA 1USBA 3O6TA 4IJIA 4ECCA 2IL3A 3I69A 1XFLA 1PRXA 11GSA 3VURA 3TKSA 3UL3A 5IPHA 1T3BA 2V6KA 3FMWA 2N5FA 1DE1A 4TRXA 5CO3A 2IN3A 4OO4A 4F82A 2VLUA 4YQMA 2WJUA 2VL9A 1RK4A 2HZEA 4O7HA 3QDNA 2A4VA 4POLA 5A5HB 2GVPA 3M8NA 1OYJA 4MLYA 4NHZA 2R0GA 2IFQA 2VOCA 3NOFA 3BOAA 3HJMA 3BD2A 5H5SA 5DCHA 2GS3A 4HU7A 5D9XA 4KSOA 4ZBAA 3TKQA 3GA4A 5ECOB 3GKKA 5HQPA 5IOXA 2KP1A 1YZXA 5C00A 4BVYB 1SK2A 2A4HA 5BMUB 1XW5A 1TTZA 5G31A 3DIEA 1BYEA 2IWTA 3HHVA 3LORA 4K0GA 5DVBA 3KIJA 4EDZA 4WBJA 3ERFA 22GSA 1I9DA 1G7EA 5J9BA 1OAZA 3RDWA 4HUAA 3QFBC 3HJPA 4D73B 4IJ3A 3RFRC 2YPMA 4F0CA 4KDYA 1VF3A 5D93A 3GYKA 4AJ7A 1Q98A 4G19A 4OCEA 3KTLA 4I2UA 2PVOC 3N9JA 3VPQA 3QD9A 2GTUA 5HFGA 4ZBDA 4NV5A 1TK8B 4ICYA 3R3EA 1ERTA 4GSSA 3HJOA 3I6AA 2YWIA 3NZNA 3H8QA 2RLIA 3IAM2 2VCZA 2R6KA 5LCZA 1FB0A 3WYWA 2VL2C 4TN8A 2NBSA 4YAVA 3KP8A 2HSNB 2CQ9A 2AUVA 5DDLA 3UOMA 3D4MA 1YY7A 4X43A 1EV9A 5AGYA 1R26A 2H0HA 4F2IA 5IO2A 4MABA 4N10A 2H1LA 3ME8A 1ZYQB 4ULXA 4W66A 4LMVA 3HDCA 3LQ7A 3KEBA 4PUAA 3GH9A 1TW9A 4Z2TA 1K3LA 5JCGA 3DWVA 2FD3A 4MP4A 4JR6A 2DJ3A 3EC3A 3WT1A 5DAKA 1GLQA 4MZWA 1K0NA 1U6TA 1JZRA 1VRSD 4FXYP 1BX9A 3CSJA 3UAPA 4X1UA 1J9BA 5GSSA 3KCMA 5IOWA 3G7IA 1W89A 3TGZA 6GSXA 2H1AA 4HZ4A 4PI2C 2YN1A 1SD8A 2JADA 2CAIA 5A4WA 3F63A 3GH6A 2PWJA 1AAZA 5B8AA 2FA4A 1GTAA 3N5OA 4KF9A 4WETA 4TVEA 4AKHA 5GZZB 1K3YA 4NAXA 3F9UA 3MIXA 1WPIA 3IC4A 3IHGA 4Z7XA 5DJLA 4EIPA 3HVXA 5KOXA 1VF2A 2L4QA 1HNBA 3DD3A 2H30A 1SJ6A 2VM2A 5J41A 1EGOA 2HZFA 1J0FA 2P31A 4MJCA 4GQCA 2H0GA 4A5PA 4L5LA 5AIXA 4ZILA 2IJYA 3HYPA 2M72A 1EEJA 4OO5A 1ERUA 2L4CA 5A5HA 1X9WB 2R0CA 3M1GA 4KX4A 3IR4A 3GKMA 2X8HA 4K5SA 13GSA 2X4AA 2GZPA 3F4SA 3FZ4A 1MD4A 5CRGA 1KNGA 4J2FA 17GSA 2HRNA 3MYDA 1EGRA 1BG5A 2K8SA 3P2AA 5J40A 4N3ZA 5ABRA 5KEJA 4DSRA 3L9SA 4ZXGA 4LMWA 1AXDA 2WW3A 2DMLA 2GQKA 3VWWA 2OADA 4DSSB 1A0FA 2FHEA 1YVLA 4BVYA 1XWGA 2F51A 1VF4A 2HNLA 1N2AA 4PQHA 3FHKA 5IMCA 2HFDA 2VO4A 1NSWA 3KD0A 4YH2A 4GTUA 2FWEA 1PSQA 2HXKA 2WS2A 5AN1A 2MYGA 4ECIA 4JZQA 2QSIA 4V2MA 4K7IA 2YWNA 2NDOA 4POBA 1LBKA 4POKA 5A4VA 5DQSA 1TU7A 4K6XA 4AJ8A 1X5CA 5ECLB 3AY8A 4WEYA 2IMIA 4Z2UA 4Q5NA 3MNGA 4AJ6A 5G2ZA 4D73A 1LJRA 1OC8A 1XG8A 2LJAA 3RAZA 3KM6A 4MJAA 4DVCA 5F05A 3LXTA 2H73A 3VWUA 3KGKA 3DRNA 4YKFA 4MF7A 1S3CA 4H86A 3UEMA 1PX6A 1DSBA 4HJ2A 2R5GA 1M3IA 3MDKA 5ECRB 4MMMA 3F4TA 1N25A 4HQZA 6GSUA 3W8SA 4LL1B 1TK0B 2I1UA 3E0UA 1V9WA 3FKFA 4FYBA 5HFIA 2V32A 3K8NA 2TRXA 2YV9A 5G5FA 3ERWA 2KP2A 6GSSA 3HKRA 4ID0A 2VLVA 2HLSA 8GSSA 2DC5A 3GRXA 4GF0A 3J7Yk 4XRAA 3Q74A 1WJKA 12GSA 1WP0A 1XOBA 4O32A 3EU3A 1DE2A 2WRTA 3UIWA 1FW1A 1TKDB 3GTUB 2NPBA 2R2JA 1V98A 3CBUA 3ZVJA 2FGXA 1GRXA 4G0LA 1GH2A 1O73A 3KXOA 2VAFA 2AJQB 1Y6EA 4RI6A 1XPVA 4EIQA 2D2ZA 3QR6A 5CYYA 2EFCA 4HJMA 4CY8A 1S3RA 1XZOA 2LSTA 2RM6A 3PH9A 4PUFC 1ERVA 4MJEA 2OE3A 1ABAA 2YJHA 4N30A 3KMNA 3FZ9A 4PURA 2YCDA 4XTSA 4P3YB 3HVNA 3IPZA 3TJKA 2F3MA 1XW6A 4NXIA 4K2DA 1GSSA 3FEUA 2Z9SA 2ON7A 5A34A 2X64A 4MK3A 2REMA 5ELAA 4PQ1A 3RPNA 1MD3A 2VKZG 4AI6A 2I3YA 4BVXB 2ES7A 4PTSA 3ZVJD 1YQ1A 4QL7A 1XVWA 1SENA 4AF2A 1AQVA 6GSYA 2WW1A 1JLVA 4G9HA 3L9VA 3P7XA 3FW2A 1Y1UA 2VD0A 1OC9B 3GN3A 4FIWA 3A2WA 4RQXA 4MF6A 2LRTA 1O85A 2WW0A 4K7NA 5JWOB 5KN2A 1H75A 1XWKA 5INYA 1XWBA 3FR9A 1FOHA 1OC3A 5DALB 2EIQA 4DSSA 2O5VA 3TOUA 4E8EA 4ZB7A 2IMEA 5E4WA 2E0QA 2O85A 5B6MA 3CMIA 5J9CA 3VPTA 4BWSA 1G6YA 3I9V2 1THXA 2H72A 5FT3A 4G10A 2N5BA 16GSA 5CREA 1X9MB 4JR4A 1ST9A 3TKSE 1F9MA 5CRWA 1XXUA 5DJMA 1ZYEA 4GRFA 2GZZA 4CHSA 1JZDA 1X0RA 5IMZA 1UVZA 1A24A 3HZ8A 3KP9A 5IMAA 4EUYA 1FOVA 1A0RP 5J3RA 4O92A 3L78A 4OCFA 2R37A 4FQUA 3FZAA 4MF5A 3D22A 3ISOA 4MPGA 2O36A 3CXGA 2VCTA 2B1LA 3M9JA 1HD2A 2YZUA 2LNTA 2JSZA 2ZNMA 4O5QA 1U87A 4XS1A 3PPUA 1FVJA 3DEXA 4ECBA 3GTUA 4IP6A 1QXHA 2LQOA 2CVDA 4CW9A 2X99A 5LNKe 5A1NB 2FA8A 2V6OA 3UJ1A 1JLWA 1E2YA 1O7UA 5DCGA 1OE7A 3LG6A 2ON5A 5IMVA 2PPTA 1SK0A 2HI7A 2L5OA 3H93A 2WGRA 2VCVA 1SYRA 4IP1A 4ML1A 1SVMA 10GSA 1K0CA 1O6JA 4F03A 1YKAA 2BMXA 2XPDA 1YF0A 5G1LA 2C80A 1ZYNA 3GIXA 2JSYA 2H1BA 3ZZXA 1YF1A 3P90A 1URMA 1HNCA 2DJ1A 4Z2RA 2CVKA 3ZMKA 4HZ2A 3ZFLA 2QGVA 4YQVA 4ISDA 1SK1A 1U3AA 1V58A 2YJ7A 3CWGA 1A8LA 3LEFA 5ID2B 3HCZA 1EEMA 4CDOA 2PN8A 4AKIA 4OD7A 1SVOA 5IPGA 1GTBA 4I97A 2WCIA 3MSZA 1M3JA 2LJRA 2HQTA 3G9BA 3Q18A 2JACA 2MZCA 3H4KA 4I2TA 4I8BA 3RBTA 1TU8A 3UMAA 4KW6A 3US3A 2H1DA 5H5RA 1M9AA 4PGTA 2DIYA 3WT2A 4JU5A 2RM5A 2CZ3A 1YEPA 1GTIA 3RHCA 3A2XA 4KGIA 1O8XA 1T7PB 3QAGA 2VUPA 1PKWA 4Q5FA 1HNAA 3LYKA 2H70A 5COHA 1G0TA 3VI7A 1QK8A 3IK9A 1OC9A 3HA9A 5JWRB 2QKEA 3C1SA 3ERGA 1GSUA 4G2EA 3KZQA 1JHBA 1O8WA 3TB2A 1JZWA 5F07A 2ZUPA 4TXOB 3GL5A 1EOGA 5FWGA 5DQYA 2L6DA 1SKSB 4MPFA 3IHQA 2GZYA 4BWQA 2CX3A 1XWAA 5JWQB 4I5QA 3DKSA 4TR1B 1QMVA 2CV4A 2XBIA 1PN9A 4WR4A 1TXXA 4EL1A 2R4VA 2EIRA 4ZB8A 4ILFA 1NW2A 2NTOA 2B6MA 4XIHA 2WVXB 3IV4A 2L57A 1KEBA 1TRSA 2DMMA 3QMXA 2OA7A 4HU9A 1MDJA 5CNWA 4KCAA 1GSQA 5ECSA 2XHFA 2PMTA 4WBRD 4PX1A 2XPEA 2MMOA 2PERA 2HSMB 1RQMA 4IKHA 1ZMAA 1GNWA 3ZMLA 1FG4A 4ZL8A 4E8HA 3BJ5A 3TKPA 4NHWA 3KMOA 4OFNA 2LUSA 1Z3EA 4XRDA 1AW9A 3RGBC 1FVKA 2OKAA 14GSA 1X5DA 1ILOA 3QCPA 1OVNA 4O5UA 1C72A 1WWJA 2O8VB 20GSA 1G7OA 4IBPA 2BJXA 3JCML 4GWRA 2CX4A 3MAKA 3QAVA 2YOIA 4FYUA 2O87A 5HR2A 2WFCA
chains in the Genus database with same CATH topology
4OMVA 4Q5RA 2IPAA 3IK7A 2OBIA 2GSTA 2C3TA 2DJKA 1K0DA 3TRXA 3APSA 1ZYPA 3KH9A 5BMUA 2K9FA 1SL2B 2JZTA 4FH8A 5G1KA 3VI5A 2H0IA 4O5RA 3APQA 3F3QA 4EKZA 4G0IA 2WDUA 1V57A 1X5EA 3A2VA 2I9HA 3F4RA 1EWXA 3MWHA 5CRDA 1SKWB 5A1NA 1LU4A 2PU9C 3DXBA 2LQQA 1T4ZA 2EIOA 1ZOFA 3ZIJA 1EP8A 1T00A 1TI3A 4BL7B 4XS4B 5CP1A 3V1WA 2AV4A 3GKXA 3GX0A 2LKUA 3ZLPA 1UC7A 3HZ4A 4NV2A 3E3EA 1XBSA 2JL4A 2TRCP 2VIMA 2R3XA 1SU9A 4L0UA 5AIVA 2OBKA 2E7PA 3ZITA 2OE1A 1M0UA 1U88A 4KSMA 1R4WA 1T4YA 2X8CA 1DUGA 2HSNA 2ZCTA 1A2MA 1TK5B 3LSZA 1M2BA 1BG1A 4HS1A 4WR5A 1GLPA 2JZSA 2IFQB 4GSTA 3EE2A 4TOPA 1A23A 3KTBA 4K5RA 1KBNA 3KH7A 2H19A 3VLNA 1BJXA 3WD6A 1PQNA 2DJ2A 3D6IA 2B7KA 3EVIA 3TKRA 5D8IA 2VCXA 4MNNA 2GT5A 2YWMA 3GSSA 2IMDA 5D9WA 1PMTA 3F6DA 1Z9HA 1CQHA 4TR4A 2RUFA 1B9YC 1GSEA 3CRUA 4FYCA 4TR0A 4QQ7A 2C0EA 1IYIA 4MA9A 1X9SB 4N0VA 1SD9A 4PXOA 2DKIA 3O3TA 4IELA 2IMFA 3EWLA 4MCUA 1SVLA 5GAPD 2OACA 3GV1A 2NVLA 1GNEA 2FWGA 2JU5A 2FUG2 1VGLA 2WZ9A 1PL2A 4V2NA 19GSA 2FWFA 3CSHA 1TP9A 3TDGA 2C0DA 4OWYA 4TXOA 2XC2A 4WXTA 4MH3A 1GSDA 2V1MA 3FK8A 2MMAA 4OFTA 2B5YA 1XCCA 2O7KA 3VFIA 2B5XA 1E6BA 2A2PA 5CAXA 1S3AA 3UBLA 1GULA 2VM1A 4USSA 3LXZA 2FY6A 1R7HA 3UARA 4X4JA 1PN0A 2HRKB 2HSMA 1F3AA 2K18A 2C0FA 5C04A 2X49A 4G01A 1XOAA 5LD0A 2KHPA 4V1Ap 5F8BA 4ML6A 1WE0A 3FYGA 3W6GA 2DJ0A 4V1Ag 4YQUA 3F8UA 4YAPA 4IW9A 3D0ZA 4LL4B 4MZBA 1S3DA 5J5NA 1SL0B 3U6VA 5A4UA 2QA1A 2H66A 3IA1A 4K1FA 3ED3A 2H01A 3GL3A 3RPPA 1SJZA 1BQ7A 3SWLA 1ACVA 4XCSA 2EFEA 4TR3A 5EY6A 2VCQA 1TXUA 3GNJA 1FO5A 1BF5A 2ALBA 1Q4JA 1SJIA 2OE0A 5A5KA 4QL9A 1G6WA 1K0BA 3L0HA 2X8GA 4K7OA 2KLXA 4XHMA 2A2SA 1O81A 3BCIA 5ECIB 3F3RA 2CAQA 4OFMA 1A2LA 2WULA 2YP6A 4IN0A 5D73A 3M0FA 4PNGA 3F0IA 1PGTA 2QA2A 3GSTA 4EF0A 4ZBBA 4TXVA 1KTEA 3PINA 4XS4A 2WB9A 2QC7A 2MMNA 3UVHA 3TCOA 5ECHB 1THOA 3CYNA 4RUVA 1GWCA 5D9VA 2FNOA 4GCIA 2O89A 3TUEA 2LRNA 1TI1A 1K0AA 2V41A 4F9ZA 2R0PA 3ZYWA 2VLTA 18GSA 1GUHA 4J56E 5J4UA 1HQOA 1ZL9A 3M3MA 1M2DA 4GQFA 5ENUA 6GSTA 2C1YA 2FWHA 3IXRA 1B4PA 1YEXA 3EPTA 2CA8A 5B7CA 2E2MA 3APOA 4KDXA 3O76A 4JE1A 4IS0A 1Z7RA 2GLRA 2DBCA 5IM9A 4Q5QA 4ZL9A 1F6MC 3F6FA 3G7JA 5AISA 2I4AA 1QGVA 4GSNA 2AB6A 3BBYA 2YV7A 4FO5A 4YKGA 1FB6A 2EC4A 4ZB6A 1AIUA 3GUSA 1QQ2A 3HVSA 2E2GA 2L5LA 1FHEA 5D96A 2B7JA 2B5EA 3GX8A 4EO3A 2OJLA 5H5QA 1PKZA 1TDIA 3L4NA 1Y25A 1PD21 1NM3A 4JEDA 1N8JA 4BPYA 4EXJA 3IC8A 2LV3A 1ERWA 2VCWA 4EVMA 2LJKA 3ZTLA 2HSHA 3ZREA 1PX7A 1UA5A 1ON4A 3LGCA 4EC0A 3S9FA 4BA7A 1PA3A 2HYXA 5FHIA 4N0ZA 2F9SA 2DLXA 1B9XC 2C0GA 5HFKA 1V2AA 5F06A 4WF5A 4IQAA 4HDEA 3EINA 4K9ZA 3IDVA 3GURA 7GSSA 3C71A 3G7YA 2HSYA 3FR3A 5ECKB 2H75A 1VF1A 3QAWA 3LYPA 2FLSA 1EZKA 5EPFA 3SBCA 3GFKA 2HRKA 2CT6A 1YKCA 4KA0A 4BVXA 1ZZYA 2G2QA 4NMUA 1R5PA 4AGSA 3UVTA 4AKGA 4K8MA 1T1VA 5IO0A 5HR3A 1QUWA 1H4OA 1CQGA 4ZIJA 2UV8G 1BAYA 3DVWA 2P5QA 3FRCA 3PGTA 1WOUA 4ECJA 4HI7A 2H6XA 2LRCA 2L59A 3EURA 4RI7A 1M99A 3HMJG 1TRWA 2VL2A 5EVOA 2F8FA 3UBKA 5CRHA 4NWYA 1AUCA 5HR1A 4HEA2 2H6ZA 2C3NA 4ZL7A 1Z6NA 1OKTA 3WGEA 2UZ8A 5DALA 2H8LA 1F37A 4KAEA 4KH7A 3DGQA 2DKHA 1FAAA 1GSYA 4WF4A 1J08A 4L0WA 3ZIVA 3DMLA 4RQRA 3IRAA 1V40A 5KOWA 1T8EB 4MZCA 5ECMB 5J4YA 1NHOA 3U5RE 1GP1A 4PQIA 4AKXB 4L5OA 3A5WA 5IIZA 4KDUA 5ECPB 1JFUA 2CVBA 4N11A 4G0KA 1EOHA 5KN1A 3GHAA 1F2EA 1PL1A 3LFLA 3HVVA 5A34B 1ML6A 1I5GA 3HY2A 3CTGA 3A5IA 1A8YA 4WKWA 2AHEA 3E9JB 1QFNA 3TJBA 3FY7A 1GUMA 1UN2A 2C3QA 2IIYA 3DYRA 2RUEA 3QFAC 2DIZA 3EYTA 3IAS2 9GSSA 2HRFA 3HXSA 1M7TA 1AQWA 5GAND 3CSIA 3EMPA 2YWOA 2CZ2A 1XVQA 2OT3A 3BCKA 3C7MA 4QMKA 2H1GA 1M2AA 5JCWA 2YNXA 2J9HA 2I81A 2GGTA 2GSQA 3GKNA 3HD5A 3C1RA 3QOUA 3H1NA 1K3OA 2BTOT 4J57E 4POMA 5HR0A 2PGTA 2N5AA 1F3BA 3IOSA 2GQMA 4KNDA 4IHUA 3NIVA 1XWCA 1Z7PA 4ACSA 2DSAA 1GSFA 2V2GA 4DSQA 4KCEA 3R2QA 1M9BA 2HT9A 1RW1A 3DVXA 4IQ1A 1BEDA 3VK9A 3EMXA 1W4VA 3VWXA 2YZHA 3W8JA 2HZEB 3WGXA 2J23A 5DBQA 5ID2A 3Q6OA 3H79A 3P8WA 2RIIA 1SKRB 1XIYA 3KJYA 2MMZA 4DEJA 4TKYA 4CY6A 1TRUA 3OR5A 2JZRA 2K8VA 4V2LA 2VL3A 3TOTA 1K0MA 2EFDA 2H71A 1MDKA 2P0GA 4PNFA 5F0GA 3ZFBA 5D9TA 1EV4A 2EFHA 2YANA 2H74A 1WIKA 1WMJA 1TOFA 2HRAA 1AC1A 2LEGA 2H6YA 3D4TA 5GSTA 1YJ6A 2KOKA 5IMDA 2LS5A 2PVQA 2K6VA 5ECNB 2GQLA 4TW5A 5J4VA 4L8EA 2IMKA 3GMFA 5ELGA 4LA1A 4GDFA 3RHBA 2GT6A 4JBBA 1MEKA 5IQYA 1GL8A 3LW9A 1TJDA 2F8AA 2PUKC 2DJJA 4HOJA 2L6CA 3CRTA 2AYTA 5JCUA 4MJBA 3L9UA 4MH2A 2GDRA 3TJGA 1MDIA 1K0OA 1ZGNA 1YDKA 1Z6MA 3TU3B 4TR1A 2GSSA 1XW9A 5ECQB 3CTFA 3WGDA 2M46A 3A3TA 4IVFA 4E68A 3IE3A 2M80A 3Q19A 1MTCA 1SYXA 2LTKA 4K0NA 1IYHA 1A2JA 1HYUA 2P5RA 2G0FA 4MDCA 4KE3A 5KN0A 1OE8A 3FR6A 3J7Yb 1B48A 4F0BA 2MBTA 4HQSA 2XBQA 6GSVA 2VD1A 3C73A 4GXZA 3IBHA 4I6XA 4EE0A 4X0XA 2GSRA 2MBSA 3PR8A 1ZCPA 2B3SA 3TRPA 1U3IA 2C4JA 4JRRA 1EP7A 3EU4A 4NPBA 3QPMA 2TIRA 2HE3A 5DAKB 5B6NA 4ZB9A 1GTUA 1GUKA 3LJRA 3ME7A 5G5EA 2LNSA 2KUCA 4GLTA 3LWAA 4KB3A 1AQXA 3FZ5A 6GSWA 1TRVA 1JZOA 3C8EA 2H76A 5J47A 3ZL5A 3TKSC 2C8UA 5B8BA 4XS6A 1WRYA 5KN3A 1OKDA 5E59A 1B8XA 5EL8A 2B1KA 3VWVA 1Z5YE 3TRQA 1B4QA 2AAWA 4LLRA 5BRTA 5L71A 3D5JA 4EDYA 1NHYA 3I43A 4IGJA 2FCHA 4KUNA 3TJFA 3TJJA 5IMFA 5G30A 3D21A 4K2XA 2PBJA 3ZRDA 3M9KA 1SL1B 4BL7A 1DBYA 1R5AA 2A2RA 1USBA 3O6TA 4IJIA 4ECCA 2IL3A 3I69A 1XFLA 1PRXA 11GSA 3VURA 3TKSA 3UL3A 5IPHA 1T3BA 2V6KA 3FMWA 2N5FA 1DE1A 4TRXA 5CO3A 2IN3A 4OO4A 4F82A 2VLUA 4YQMA 2WJUA 2VL9A 1RK4A 2HZEA 4O7HA 3QDNA 2A4VA 4POLA 5A5HB 2GVPA 3M8NA 1OYJA 4MLYA 4NHZA 2R0GA 2IFQA 2VOCA 3NOFA 3BOAA 3HJMA 3BD2A 5H5SA 5DCHA 2GS3A 4HU7A 5D9XA 4KSOA 4ZBAA 3TKQA 3GA4A 5ECOB 3GKKA 5HQPA 5IOXA 2KP1A 1YZXA 5C00A 4BVYB 1SK2A 2A4HA 5BMUB 1XW5A 1TTZA 5G31A 3DIEA 1BYEA 2IWTA 3HHVA 3LORA 4K0GA 5DVBA 3KIJA 4EDZA 4WBJA 3ERFA 22GSA 1I9DA 1G7EA 5J9BA 1OAZA 3RDWA 4HUAA 3QFBC 3HJPA 4D73B 4IJ3A 2YPMA 4F0CA 4KDYA 1VF3A 5D93A 3GYKA 4AJ7A 1Q98A 4G19A 4OCEA 3KTLA 4I2UA 2PVOC 3N9JA 3VPQA 3QD9A 2GTUA 5HFGA 4ZBDA 4NV5A 1TK8B 4ICYA 3R3EA 1ERTA 4GSSA 3HJOA 3I6AA 2YWIA 3NZNA 3H8QA 2RLIA 3IAM2 2VCZA 2R6KA 5LCZA 1FB0A 3WYWA 2VL2C 4TN8A 2NBSA 4YAVA 3KP8A 2HSNB 2CQ9A 2AUVA 5DDLA 3UOMA 3D4MA 1YY7A 4X43A 1EV9A 5AGYA 1R26A 2H0HA 4F2IA 5IO2A 4MABA 4N10A 2H1LA 3ME8A 1ZYQB 4ULXA 4W66A 4LMVA 3HDCA 3LQ7A 3KEBA 4PUAA 3GH9A 1TW9A 4Z2TA 1K3LA 5JCGA 3DWVA 2FD3A 4MP4A 4JR6A 2DJ3A 3EC3A 3WT1A 5DAKA 1GLQA 4MZWA 1K0NA 1U6TA 1JZRA 1VRSD 1BX9A 3CSJA 3UAPA 4X1UA 1J9BA 5GSSA 3KCMA 5IOWA 3G7IA 1W89A 3TGZA 6GSXA 2H1AA 4HZ4A 2YN1A 1SD8A 2JADA 2CAIA 5A4WA 3F63A 3GH6A 2PWJA 1AAZA 5B8AA 2FA4A 1GTAA 3N5OA 4KF9A 4WETA 4TVEA 4AKHA 5GZZB 1K3YA 4NAXA 3F9UA 3MIXA 1WPIA 3IC4A 3IHGA 4Z7XA 5DJLA 4EIPA 3HVXA 5KOXA 1VF2A 2L4QA 1HNBA 3DD3A 2H30A 1SJ6A 2VM2A 5J41A 1EGOA 2HZFA 1J0FA 2P31A 4MJCA 4GQCA 2H0GA 4A5PA 4L5LA 5AIXA 4ZILA 2IJYA 3HYPA 2M72A 1EEJA 4OO5A 1ERUA 2L4CA 5A5HA 1X9WB 2R0CA 3M1GA 4KX4A 3IR4A 3GKMA 2X8HA 4K5SA 13GSA 2X4AA 2GZPA 3F4SA 3FZ4A 1MD4A 5CRGA 1KNGA 4J2FA 17GSA 2HRNA 3MYDA 1EGRA 1BG5A 2K8SA 3P2AA 5J40A 4N3ZA 5ABRA 5KEJA 4DSRA 3L9SA 4ZXGA 4LMWA 1AXDA 2DMLA 2GQKA 3VWWA 2OADA 4DSSB 1A0FA 2FHEA 1YVLA 4BVYA 1XWGA 2F51A 1VF4A 2HNLA 1N2AA 4PQHA 3FHKA 5IMCA 2HFDA 2VO4A 1NSWA 3KD0A 4YH2A 4GTUA 2FWEA 1PSQA 2HXKA 2WS2A 5AN1A 2MYGA 4ECIA 4JZQA 2QSIA 4V2MA 4K7IA 2YWNA 2NDOA 4POBA 1LBKA 4POKA 5A4VA 5DQSA 1TU7A 4K6XA 4AJ8A 1X5CA 5ECLB 3AY8A 4WEYA 2IMIA 4Z2UA 4Q5NA 3MNGA 4AJ6A 5G2ZA 4D73A 1LJRA 1OC8A 2LJAA 3RAZA 3KM6A 4MJAA 4DVCA 5F05A 3LXTA 2H73A 3VWUA 3KGKA 3DRNA 4YKFA 4MF7A 1S3CA 4H86A 3UEMA 1PX6A 1DSBA 4HJ2A 2R5GA 3MDKA 5ECRB 4MMMA 3F4TA 1N25A 4HQZA 6GSUA 3W8SA 4LL1B 1TK0B 2I1UA 3E0UA 1V9WA 3FKFA 4FYBA 5HFIA 2V32A 3K8NA 2TRXA 2YV9A 5G5FA 3ERWA 2KP2A 6GSSA 3HKRA 4ID0A 2VLVA 2HLSA 8GSSA 2DC5A 3GRXA 4GF0A 3J7Yk 4XRAA 3Q74A 1WJKA 12GSA 1WP0A 1XOBA 4O32A 3EU3A 1DE2A 2WRTA 3UIWA 1FW1A 1TKDB 3GTUB 2NPBA 2R2JA 1V98A 3CBUA 3ZVJA 2FGXA 1GRXA 4G0LA 1GH2A 1O73A 3KXOA 2VAFA 2AJQB 1Y6EA 4RI6A 1XPVA 4EIQA 2D2ZA 3QR6A 5CYYA 2EFCA 4HJMA 4CY8A 1XZOA 2LSTA 2RM6A 3PH9A 4PUFC 1ERVA 4MJEA 2OE3A 1ABAA 2YJHA 4N30A 3KMNA 3FZ9A 4PURA 2YCDA 4XTSA 4P3YB 3IPZA 3TJKA 2F3MA 1XW6A 4NXIA 4K2DA 1GSSA 3FEUA 2Z9SA 2ON7A 5A34A 2X64A 4MK3A 2REMA 5ELAA 4PQ1A 3RPNA 1MD3A 2VKZG 4AI6A 2I3YA 4BVXB 2ES7A 4PTSA 3ZVJD 1YQ1A 4QL7A 1XVWA 1SENA 4AF2A 1AQVA 6GSYA 1JLVA 4G9HA 3L9VA 3P7XA 3FW2A 1Y1UA 2VD0A 1OC9B 3GN3A 4FIWA 3A2WA 4RQXA 4MF6A 2LRTA 1O85A 4K7NA 5JWOB 5KN2A 1H75A 1XWKA 5INYA 1XWBA 3FR9A 1FOHA 1OC3A 5DALB 2EIQA 4DSSA 2O5VA 3TOUA 4E8EA 4ZB7A 2IMEA 5E4WA 2E0QA 2O85A 5B6MA 3CMIA 5J9CA 3VPTA 4BWSA 1G6YA 3I9V2 1THXA 2H72A 5FT3A 4G10A 2N5BA 16GSA 5CREA 1X9MB 4JR4A 1ST9A 3TKSE 1F9MA 5CRWA 1XXUA 5DJMA 1ZYEA 4GRFA 2GZZA 4CHSA 1JZDA 1X0RA 5IMZA 1UVZA 1A24A 3HZ8A 3KP9A 5IMAA 4EUYA 1FOVA 1A0RP 5J3RA 4O92A 3L78A 4OCFA 2R37A 4FQUA 3FZAA 4MF5A 3D22A 3ISOA 4MPGA 3CXGA 2VCTA 2B1LA 3M9JA 1HD2A 2YZUA 2LNTA 2JSZA 2ZNMA 4O5QA 1U87A 4XS1A 3PPUA 1FVJA 3DEXA 4ECBA 3GTUA 4IP6A 1QXHA 2LQOA 2CVDA 4CW9A 2X99A 5LNKe 5A1NB 2FA8A 2V6OA 3UJ1A 1JLWA 1E2YA 1O7UA 5DCGA 1OE7A 3LG6A 2ON5A 5IMVA 2PPTA 1SK0A 2HI7A 2L5OA 3H93A 2WGRA 2VCVA 1SYRA 4IP1A 4ML1A 1SVMA 10GSA 1K0CA 1O6JA 4F03A 1YKAA 2BMXA 2XPDA 1YF0A 5G1LA 2C80A 1ZYNA 3GIXA 2JSYA 2H1BA 3ZZXA 1YF1A 3P90A 1URMA 1HNCA 2DJ1A 4Z2RA 2CVKA 3ZMKA 4HZ2A 3ZFLA 2QGVA 4YQVA 4ISDA 1SK1A 1U3AA 1V58A 2YJ7A 3CWGA 1A8LA 3LEFA 5ID2B 3HCZA 1EEMA 4CDOA 2PN8A 4AKIA 4OD7A 1SVOA 5IPGA 1GTBA 4I97A 2WCIA 3MSZA 2LJRA 2HQTA 3G9BA 3Q18A 2JACA 2MZCA 3H4KA 4I2TA 4I8BA 3RBTA 1TU8A 3UMAA 4KW6A 3US3A 2H1DA 5H5RA 1M9AA 4PGTA 2DIYA 3WT2A 4JU5A 2RM5A 2CZ3A 1YEPA 1GTIA 3RHCA 3A2XA 4KGIA 1O8XA 1T7PB 3QAGA 2VUPA 1PKWA 4Q5FA 1HNAA 3LYKA 2H70A 5COHA 1G0TA 3VI7A 1QK8A 3IK9A 1OC9A 3HA9A 5JWRB 2QKEA 3C1SA 3ERGA 1GSUA 4G2EA 3KZQA 1JHBA 1O8WA 3TB2A 1JZWA 5F07A 2ZUPA 4TXOB 3GL5A 1EOGA 5FWGA 5DQYA 2L6DA 1SKSB 4MPFA 3IHQA 2GZYA 4BWQA 2CX3A 1XWAA 5JWQB 4I5QA 3DKSA 4TR1B 1QMVA 2CV4A 2XBIA 1PN9A 4WR4A 1TXXA 4EL1A 2R4VA 2EIRA 4ZB8A 4ILFA 1NW2A 2NTOA 2B6MA 4XIHA 2L57A 3IV4A 1KEBA 1TRSA 2DMMA 3QMXA 2OA7A 4HU9A 1MDJA 5CNWA 4KCAA 1GSQA 5ECSA 2XHFA 2PMTA 4WBRD 4PX1A 2XPEA 2MMOA 2PERA 2HSMB 1RQMA 4IKHA 1ZMAA 1GNWA 3ZMLA 1FG4A 4ZL8A 4E8HA 3BJ5A 3TKPA 4NHWA 3KMOA 4OFNA 2LUSA 1Z3EA 4XRDA 1AW9A 1FVKA 2OKAA 14GSA 1X5DA 1ILOA 3QCPA 1OVNA 4O5UA 1C72A 1WWJA 2O8VB 20GSA 1G7OA 4IBPA 2BJXA 3JCML 4GWRA 2CX4A 3MAKA 3QAVA 2YOIA 4FYUA 2O87A 5HR2A 2WFCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OMV A;  4Q5R A;  2IPA A;  3IK7 A;  2OBI A;  2GST A;  2C3T A;  2DJK A;  1K0D A;  3TRX A;  3APS A;  3KH9 A;  5BMU A;  2K9F A;  1SL2 B;  2JZT A;  4FH8 A;  5G1K A;  3VI5 A;  2H0I A;  4O5R A;  3APQ A;  3F3Q A;  4EKZ A;  4G0I A;  2WDU A;  1V57 A;  1X5E A;  3A2V A;  2I9H A;  3F4R A;  1EWX A;  3MWH A;  5CRD A;  1SKW B;  1LU4 A;  2PU9 C;  3DXB A;  2LQQ A;  1T4Z A;  2EIO A;  1ZOF A;  3ZIJ A;  1EP8 A;  1T00 A;  1TI3 A;  4BL7 B;  4XS4 B;  5CP1 A;  3V1W A;  2AV4 A;  3GKX A;  3GX0 A;  2LKU A;  3ZLP A;  1UC7 A;  3HZ4 A;  4NV2 A;  3E3E A;  1XBS A;  2JL4 A;  2TRC P;  2VIM A;  2R3X A;  1SU9 A;  4L0U A;  5AIV A;  2OBK A;  2E7P A;  3ZIT A;  2OE1 A;  1M0U A;  1U88 A;  4KSM A;  1R4W A;  1T4Y A;  2X8C A;  1DUG A;  2ZCT A;  1A2M A;  1TK5 B;  3LSZ A;  1M2B A;  4HS1 A;  4WR5 A;  1GLP A;  2JZS A;  2IFQ B;  4GST A;  3EE2 A;  4TOP A;  1A23 A;  3KTB A;  1KBN A;  3KH7 A;  2H19 A;  3VLN A;  1BJX A;  3WD6 A;  1PQN A;  2DJ2 A;  3D6I A;  2B7K A;  3EVI A;  3TKR A;  5D8I A;  2VCX A;  2GT5 A;  2YWM A;  3GSS A;  2IMD A;  5D9W A;  1PMT A;  3F6D A;  1Z9H A;  1CQH A;  4TR4 A;  2RUF A;  1B9Y C;  1GSE A;  3CRU A;  4FYC A;  4TR0 A;  4QQ7 A;  2C0E A;  1IYI A;  4MA9 A;  1X9S B;  4N0V A;  1SD9 A;  4PXO A;  3O3T A;  4IEL A;  2IMF A;  3EWL A;  4MCU A;  5GAP D;  2OAC A;  3GV1 A;  2NVL A;  1GNE A;  2FWG A;  2JU5 A;  2FUG 2;  1VGL A;  2WZ9 A;  1PL2 A;  4V2N A;  19GS A;  2FWF A;  3CSH A;  1TP9 A;  3TDG A;  2C0D A;  4OWY A;  4TXO A;  2XC2 A;  4WXT A;  4MH3 A;  1GSD A;  2V1M A;  3FK8 A;  2MMA A;  4OFT A;  2B5Y A;  1XCC A;  2O7K A;  3VFI A;  2B5X A;  1E6B A;  5CAX A;  1S3A A;  3UBL A;  1GUL A;  2VM1 A;  4USS A;  3LXZ A;  2FY6 A;  1R7H A;  3UAR A;  2HRK B;  2HSM A;  1F3A A;  2K18 A;  2C0F A;  5C04 A;  1XOA A;  5LD0 A;  2KHP A;  4V1A p;  5F8B A;  4ML6 A;  1WE0 A;  3FYG A;  3W6G A;  2DJ0 A;  4V1A g;  4YQU A;  3F8U A;  4YAP A;  4IW9 A;  3D0Z A;  4LL4 B;  4MZB A;  1S3D A;  5J5N A;  1SL0 B;  3U6V A;  5A4U A;  2H66 A;  3IA1 A;  4K1F A;  3ED3 A;  2H01 A;  3GL3 A;  3RPP A;  1SJZ A;  1BQ7 A;  3SWL A;  1ACV A;  4XCS A;  4TR3 A;  5EY6 A;  2VCQ A;  3GNJ A;  1FO5 A;  2ALB A;  1Q4J A;  1SJI A;  2OE0 A;  5A5K A;  4QL9 A;  4K7O A;  1G6W A;  1K0B A;  3L0H A;  2X8G A;  2KLX A;  4XHM A;  2A2S A;  1O81 A;  3BCI A;  5ECI B;  3F3R A;  2CAQ A;  4OFM A;  1A2L A;  2WUL A;  2YP6 A;  4IN0 A;  5D73 A;  3M0F A;  4PNG A;  3F0I A;  1PGT A;  3GST A;  4EF0 A;  4ZBB A;  4TXV A;  1KTE A;  3PIN A;  4XS4 A;  2WB9 A;  2QC7 A;  2MMN A;  3UVH A;  3TCO A;  5ECH B;  1THO A;  3CYN A;  4RUV A;  1GWC A;  5D9V A;  2FNO A;  4GCI A;  2O89 A;  3TUE A;  2LRN A;  1TI1 A;  1K0A A;  2V41 A;  4F9Z A;  3ZYW A;  2VLT A;  18GS A;  4J56 E;  1GUH A;  5J4U A;  1HQO A;  1ZL9 A;  3M3M A;  1M2D A;  4GQF A;  5ENU A;  6GST A;  2C1Y A;  2FWH A;  3IXR A;  1B4P A;  1YEX A;  2CA8 A;  5B7C A;  2E2M A;  3APO A;  4KDX A;  3O76 A;  4JE1 A;  4IS0 A;  1Z7R A;  2GLR A;  2DBC A;  5IM9 A;  4Q5Q A;  4ZL9 A;  1F6M C;  3F6F A;  3G7J A;  5AIS A;  2I4A A;  1QGV A;  4GSN A;  2AB6 A;  3BBY A;  2YV7 A;  4FO5 A;  1FB6 A;  2EC4 A;  4ZB6 A;  1AIU A;  3GUS A;  1QQ2 A;  3HVS A;  2E2G A;  2L5L A;  1FHE A;  5D96 A;  2B7J A;  2B5E A;  3GX8 A;  4EO3 A;  2OJL A;  5H5Q A;  1PKZ A;  1TDI A;  3L4N A;  1Y25 A;  1PD2 1;  1NM3 A;  4JED A;  1N8J A;  4BPY A;  4EXJ A;  3IC8 A;  2LV3 A;  1ERW A;  2VCW A;  4EVM A;  2LJK A;  3ZTL A;  2HSH A;  3ZRE A;  1PX7 A;  1UA5 A;  1ON4 A;  3LGC A;  4EC0 A;  3S9F A;  4BA7 A;  1PA3 A;  2HYX A;  5FHI A;  4N0Z A;  2F9S A;  2DLX A;  1B9X C;  2C0G A;  5HFK A;  1V2A A;  5F06 A;  4WF5 A;  4IQA A;  4HDE A;  3EIN A;  4K9Z A;  3IDV A;  3GUR A;  7GSS A;  3C71 A;  3G7Y A;  2HSY A;  3FR3 A;  5ECK B;  2H75 A;  1VF1 A;  3QAW A;  3LYP A;  2FLS A;  1EZK A;  5EPF A;  3SBC A;  3GFK A;  2HRK A;  2CT6 A;  1YKC A;  4KA0 A;  4BVX A;  1ZZY A;  2G2Q A;  4NMU A;  1R5P A;  4AGS A;  3UVT A;  4K8M A;  1T1V A;  5IO0 A;  5HR3 A;  1QUW A;  1H4O A;  1CQG A;  4ZIJ A;  1BAY A;  3DVW A;  2P5Q A;  3FRC A;  3PGT A;  1WOU A;  4ECJ A;  4HI7 A;  2H6X A;  2LRC A;  2L59 A;  3EUR A;  4RI7 A;  1M99 A;  1TRW A;  2VL2 A;  5EVO A;  2F8F A;  3UBK A;  5CRH A;  4NWY A;  1AUC A;  5HR1 A;  4HEA 2;  2H6Z A;  2C3N A;  4ZL7 A;  1Z6N A;  1OKT A;  3WGE A;  2UZ8 A;  5DAL A;  2H8L A;  1F37 A;  4KAE A;  4KH7 A;  3DGQ A;  1FAA A;  1GSY A;  4WF4 A;  1J08 A;  4L0W A;  3ZIV A;  3DML A;  4RQR A;  3IRA A;  1V40 A;  1T8E B;  4MZC A;  5ECM B;  1NHO A;  3U5R E;  1GP1 A;  4PQI A;  4L5O A;  3A5W A;  5IIZ A;  4KDU A;  5ECP B;  1JFU A;  2CVB A;  4N11 A;  4G0K A;  1EOH A;  5KN1 A;  3GHA A;  1F2E A;  1PL1 A;  3LFL A;  3HVV A;  1ML6 A;  1I5G A;  3HY2 A;  3CTG A;  1A8Y A;  4WKW A;  2AHE A;  3E9J B;  1QFN A;  3TJB A;  3FY7 A;  1GUM A;  1UN2 A;  2C3Q A;  2IIY A;  3DYR A;  2RUE A;  3QFA C;  2DIZ A;  3EYT A;  3IAS 2;  9GSS A;  2HRF A;  3HXS A;  1M7T A;  1AQW A;  5GAN D;  3CSI A;  3EMP A;  2YWO A;  2CZ2 A;  1XVQ A;  3BCK A;  3C7M A;  2H1G A;  1M2A A;  5JCW A;  2YNX A;  2J9H A;  2I81 A;  2GGT A;  2GSQ A;  3GKN A;  3HD5 A;  3C1R A;  3QOU A;  3H1N A;  1K3O A;  2BTO T;  4J57 E;  4POM A;  5HR0 A;  2PGT A;  2N5A A;  1F3B A;  3IOS A;  2GQM A;  4KND A;  4IHU A;  3NIV A;  1XWC A;  1Z7P A;  4ACS A;  2DSA A;  1GSF A;  2V2G A;  4DSQ A;  4KCE A;  3R2Q A;  1M9B A;  2HT9 A;  1RW1 A;  3DVX A;  4IQ1 A;  1BED A;  3VK9 A;  3EMX A;  1W4V A;  3VWX A;  2YZH A;  3W8J A;  2HZE B;  3WGX A;  2J23 A;  5DBQ A;  5ID2 A;  3Q6O A;  3H79 A;  3P8W A;  2RII A;  1SKR B;  1XIY A;  3KJY A;  2MMZ A;  4DEJ A;  4TKY A;  1TRU A;  3OR5 A;  2JZR A;  2K8V A;  4V2L A;  2VL3 A;  3TOT A;  1K0M A;  2H71 A;  1MDK A;  2P0G A;  4PNF A;  5F0G A;  3ZFB A;  5D9T A;  1EV4 A;  2YAN A;  2H74 A;  1WIK A;  1WMJ A;  1TOF A;  2HRA A;  1AC1 A;  2LEG A;  2H6Y A;  3D4T A;  5GST A;  1YJ6 A;  2KOK A;  5IMD A;  2LS5 A;  2PVQ A;  2K6V A;  5ECN B;  2GQL A;  4TW5 A;  3GMF A;  4L8E A;  2IMK A;  5ELG A;  4LA1 A;  3RHB A;  2GT6 A;  4JBB A;  1MEK A;  5IQY A;  1GL8 A;  1TJD A;  2F8A A;  2PUK C;  2DJJ A;  4HOJ A;  2L6C A;  3CRT A;  2AYT A;  5JCU A;  4MJB A;  3L9U A;  4MH2 A;  2GDR A;  3TJG A;  1MDI A;  1K0O A;  1ZGN A;  1YDK A;  1Z6M A;  4TR1 A;  2GSS A;  1XW9 A;  5ECQ B;  3CTF A;  3WGD A;  2M46 A;  3A3T A;  4IVF A;  3IE3 A;  2M80 A;  3Q19 A;  1MTC A;  1SYX A;  2LTK A;  4K0N A;  1IYH A;  1A2J A;  1HYU A;  2P5R A;  2G0F A;  4MDC A;  4KE3 A;  5KN0 A;  1OE8 A;  3FR6 A;  3J7Y b;  1B48 A;  4F0B A;  2MBT A;  4HQS A;  2XBQ A;  6GSV A;  2VD1 A;  3C73 A;  4GXZ A;  3IBH A;  4I6X A;  4EE0 A;  4X0X A;  2GSR A;  2MBS A;  3PR8 A;  1ZCP A;  2B3S A;  3TRP A;  1U3I A;  2C4J A;  4JRR A;  1EP7 A;  3EU4 A;  4NPB A;  3QPM A;  2TIR A;  2HE3 A;  5DAK B;  5B6N A;  4ZB9 A;  1GTU A;  1GUK A;  3LJR A;  3ME7 A;  5G5E A;  2LNS A;  2KUC A;  4GLT A;  3LWA A;  4KB3 A;  1AQX A;  3FZ5 A;  6GSW A;  1TRV A;  1JZO A;  3C8E A;  2H76 A;  3ZL5 A;  3TKS C;  2C8U A;  5B8B A;  4XS6 A;  1WRY A;  5KN3 A;  1OKD A;  5E59 A;  1B8X A;  5EL8 A;  2B1K A;  3VWV A;  1Z5Y E;  3TRQ A;  1B4Q A;  2AAW A;  4LLR A;  5L71 A;  3D5J A;  4EDY A;  1NHY A;  3I43 A;  4IGJ A;  2FCH A;  4KUN A;  3TJF A;  3TJJ A;  5IMF A;  5G30 A;  3D21 A;  2PBJ A;  3ZRD A;  3M9K A;  1SL1 B;  4BL7 A;  1DBY A;  1R5A A;  2A2R A;  1USB A;  3O6T A;  4IJI A;  4ECC A;  2IL3 A;  3I69 A;  1XFL A;  1PRX A;  11GS A;  3VUR A;  3TKS A;  3UL3 A;  5IPH A;  1T3B A;  2V6K A;  2N5F A;  1DE1 A;  4TRX A;  5CO3 A;  2IN3 A;  4OO4 A;  4F82 A;  2VLU A;  4YQM A;  2WJU A;  2VL9 A;  1RK4 A;  2HZE A;  4O7H A;  3QDN A;  2A4V A;  4POL A;  2GVP A;  3M8N A;  1OYJ A;  4MLY A;  4NHZ A;  2IFQ A;  2VOC A;  3NOF A;  3BOA A;  3HJM A;  3BD2 A;  5H5S A;  5DCH A;  2GS3 A;  4HU7 A;  5D9X A;  4KSO A;  4ZBA A;  3TKQ A;  3GA4 A;  5ECO B;  3GKK A;  5HQP A;  5IOX A;  2KP1 A;  1YZX A;  5C00 A;  4BVY B;  1SK2 A;  1XW5 A;  1TTZ A;  5G31 A;  3DIE A;  1BYE A;  2IWT A;  3HHV A;  3LOR A;  4K0G A;  5DVB A;  3KIJ A;  4EDZ A;  4WBJ A;  3ERF A;  22GS A;  1I9D A;  1G7E A;  5J9B A;  1OAZ A;  3RDW A;  4HUA A;  3QFB C;  3HJP A;  4D73 B;  4IJ3 A;  2YPM A;  4F0C A;  4KDY A;  1VF3 A;  5D93 A;  3GYK A;  4AJ7 A;  1Q98 A;  4G19 A;  4OCE A;  3KTL A;  4I2U A;  2PVO C;  3N9J A;  3VPQ A;  3QD9 A;  2GTU A;  5HFG A;  4ZBD A;  4NV5 A;  1TK8 B;  3R3E A;  1ERT A;  4GSS A;  3HJO A;  3I6A A;  2YWI A;  3NZN A;  3H8Q A;  2RLI A;  3IAM 2;  2VCZ A;  2R6K A;  5LCZ A;  1FB0 A;  3WYW A;  2VL2 C;  4TN8 A;  2NBS A;  4YAV A;  3KP8 A;  2HSN B;  2CQ9 A;  2AUV A;  5DDL A;  3UOM A;  3D4M A;  1YY7 A;  4X43 A;  1EV9 A;  5AGY A;  1R26 A;  2H0H A;  4F2I A;  5IO2 A;  4MAB A;  4N10 A;  3ME8 A;  1ZYQ B;  4ULX A;  4LMV A;  3HDC A;  3LQ7 A;  3KEB A;  4PUA A;  3GH9 A;  1TW9 A;  1K3L A;  5JCG A;  3DWV A;  2FD3 A;  4MP4 A;  4JR6 A;  2DJ3 A;  3EC3 A;  3WT1 A;  5DAK A;  1GLQ A;  4MZW A;  1K0N A;  1U6T A;  1JZR A;  1VRS D;  1BX9 A;  3CSJ A;  3UAP A;  4X1U A;  1J9B A;  5GSS A;  3KCM A;  5IOW A;  3G7I A;  1W89 A;  3TGZ A;  6GSX A;  2H1A A;  4HZ4 A;  2YN1 A;  1SD8 A;  2JAD A;  2CAI A;  5A4W A;  3F63 A;  3GH6 A;  2PWJ A;  1AAZ A;  5B8A A;  2FA4 A;  1GTA A;  3N5O A;  4KF9 A;  4WET A;  4TVE A;  5GZZ B;  1K3Y A;  4NAX A;  3F9U A;  1WPI A;  3IC4 A;  4Z7X A;  5DJL A;  3HVX A;  1VF2 A;  2L4Q A;  1HNB A;  3DD3 A;  2H30 A;  1SJ6 A;  2VM2 A;  5J41 A;  1EGO A;  2HZF A;  1J0F A;  2P31 A;  4MJC A;  4GQC A;  2H0G A;  4L5L A;  5AIX A;  4ZIL A;  2IJY A;  3HYP A;  2M72 A;  1EEJ A;  4OO5 A;  1ERU A;  2L4C A;  1X9W B;  3M1G A;  4KX4 A;  3IR4 A;  3GKM A;  2X8H A;  13GS A;  3FZ4 A;  2GZP A;  3F4S A;  1MD4 A;  5CRG A;  1KNG A;  4J2F A;  17GS A;  2HRN A;  1EGR A;  1BG5 A;  2K8S A;  3P2A A;  5ABR A;  5KEJ A;  4DSR A;  3L9S A;  4ZXG A;  4LMW A;  1AXD A;  2DML A;  2GQK A;  3VWW A;  2OAD A;  4DSS B;  1A0F A;  2FHE A;  4BVY A;  1XWG A;  2F51 A;  1VF4 A;  2HNL A;  1N2A A;  4PQH A;  3FHK A;  5IMC A;  2HFD A;  2VO4 A;  1NSW A;  3KD0 A;  4YH2 A;  4GTU A;  2FWE A;  1PSQ A;  2HXK A;  2WS2 A;  5AN1 A;  2MYG A;  4ECI A;  4JZQ A;  2QSI A;  4V2M A;  4K7I A;  2YWN A;  2NDO A;  4POB A;  1LBK A;  4POK A;  5A4V A;  5DQS A;  1TU7 A;  4K6X A;  4AJ8 A;  1X5C A;  5ECL B;  3AY8 A;  4WEY A;  2IMI A;  4Q5N A;  3MNG A;  4AJ6 A;  5G2Z A;  4D73 A;  1LJR A;  1OC8 A;  2LJA A;  3RAZ A;  3KM6 A;  4MJA A;  4DVC A;  5F05 A;  3LXT A;  2H73 A;  3VWU A;  3KGK A;  3DRN A;  4MF7 A;  1S3C A;  4H86 A;  3UEM A;  1PX6 A;  1DSB A;  4HJ2 A;  2R5G A;  3MDK A;  5ECR B;  4MMM A;  3F4T A;  4HQZ A;  6GSU A;  3W8S A;  4LL1 B;  1TK0 B;  2I1U A;  3E0U A;  1V9W A;  3FKF A;  4FYB A;  5HFI A;  2V32 A;  3K8N A;  2TRX A;  2YV9 A;  5G5F A;  3ERW A;  2KP2 A;  6GSS A;  3HKR A;  4ID0 A;  2VLV A;  2HLS A;  8GSS A;  2DC5 A;  3GRX A;  4GF0 A;  3J7Y k;  4XRA A;  3Q74 A;  1WJK A;  12GS A;  1WP0 A;  1XOB A;  4O32 A;  3EU3 A;  1DE2 A;  2WRT A;  3UIW A;  1FW1 A;  1TKD B;  3GTU B;  2NPB A;  2R2J A;  1V98 A;  3CBU A;  3ZVJ A;  2FGX A;  1GRX A;  4G0L A;  1GH2 A;  1O73 A;  3KXO A;  2VAF A;  2AJQ B;  1Y6E A;  4RI6 A;  1XPV A;  2D2Z A;  3QR6 A;  5CYY A;  4HJM A;  1XZO A;  2LST A;  2RM6 A;  3PH9 A;  4PUF C;  1ERV A;  4MJE A;  2OE3 A;  1ABA A;  2YJH A;  4N30 A;  3KMN A;  3FZ9 A;  4PUR A;  2YCD A;  4XTS A;  4P3Y B;  3IPZ A;  3TJK A;  2F3M A;  1XW6 A;  4NXI A;  4K2D A;  1GSS A;  3FEU A;  2Z9S A;  2ON7 A;  2X64 A;  4MK3 A;  2REM A;  5ELA A;  4PQ1 A;  3RPN A;  1MD3 A;  2I3Y A;  4BVX B;  2ES7 A;  4PTS A;  3ZVJ D;  1YQ1 A;  4QL7 A;  1XVW A;  1SEN A;  4AF2 A;  1AQV A;  6GSY A;  1JLV A;  4G9H A;  3L9V A;  3P7X A;  3FW2 A;  2VD0 A;  1OC9 B;  3GN3 A;  4FIW A;  3A2W A;  4RQX A;  4MF6 A;  2LRT A;  1O85 A;  4K7N A;  5JWO B;  5KN2 A;  1H75 A;  1XWK A;  5INY A;  1XWB A;  3FR9 A;  1OC3 A;  5DAL B;  2EIQ A;  4DSS A;  3TOU A;  4E8E A;  2IME A;  5E4W A;  2E0Q A;  2O85 A;  5B6M A;  3CMI A;  5J9C A;  3VPT A;  4BWS A;  1G6Y A;  3I9V 2;  1THX A;  2H72 A;  5FT3 A;  4G10 A;  2N5B A;  16GS A;  5CRE A;  1X9M B;  4JR4 A;  1ST9 A;  3TKS E;  1F9M A;  5CRW A;  1XXU A;  5DJM A;  1ZYE A;  4GRF A;  2GZZ A;  4CHS A;  1JZD A;  1X0R A;  5IMZ A;  1UVZ A;  1A24 A;  3HZ8 A;  3KP9 A;  5IMA A;  4EUY A;  1FOV A;  1A0R P;  5J3R A;  4O92 A;  3L78 A;  4OCF A;  2R37 A;  4FQU A;  3FZA A;  4MF5 A;  3D22 A;  3ISO A;  4MPG A;  3CXG A;  2VCT A;  2B1L A;  3M9J A;  1HD2 A;  2YZU A;  2LNT A;  2JSZ A;  2ZNM A;  1U87 A;  4XS1 A;  3PPU A;  1FVJ A;  3DEX A;  4ECB A;  3GTU A;  4IP6 A;  1QXH A;  2LQO A;  2CVD A;  4CW9 A;  2X99 A;  5LNK e;  2FA8 A;  2V6O A;  3UJ1 A;  1JLW A;  1E2Y A;  1O7U A;  5DCG A;  1OE7 A;  3LG6 A;  2ON5 A;  5IMV A;  2PPT A;  1SK0 A;  2HI7 A;  2L5O A;  3H93 A;  2WGR A;  2VCV A;  1SYR A;  4IP1 A;  4ML1 A;  10GS A;  1K0C A;  1O6J A;  4F03 A;  1YKA A;  2BMX A;  2XPD A;  1YF0 A;  5G1L A;  2C80 A;  3GIX A;  2JSY A;  2H1B A;  3ZZX A;  1YF1 A;  3P90 A;  1URM A;  1HNC A;  2DJ1 A;  2CVK A;  3ZMK A;  4HZ2 A;  3ZFL A;  2QGV A;  4YQV A;  4ISD A;  1SK1 A;  1U3A A;  1V58 A;  2YJ7 A;  1A8L A;  3LEF A;  5ID2 B;  3HCZ A;  1EEM A;  4CDO A;  2PN8 A;  4OD7 A;  5IPG A;  1GTB A;  4I97 A;  2WCI A;  3MSZ A;  2LJR A;  2HQT A;  3G9B A;  3Q18 A;  2JAC A;  2MZC A;  3H4K A;  4I2T A;  4I8B A;  3RBT A;  1TU8 A;  3UMA A;  4KW6 A;  3US3 A;  2H1D A;  5H5R A;  1M9A A;  4PGT A;  2DIY A;  3WT2 A;  4JU5 A;  2RM5 A;  2CZ3 A;  1YEP A;  1GTI A;  3RHC A;  3A2X A;  4KGI A;  1O8X A;  1T7P B;  3QAG A;  2VUP A;  1PKW A;  4Q5F A;  1HNA A;  3LYK A;  2H70 A;  5COH A;  1G0T A;  3VI7 A;  1QK8 A;  3IK9 A;  1OC9 A;  3HA9 A;  5JWR B;  2QKE A;  3C1S A;  3ERG A;  1GSU A;  4G2E A;  3KZQ A;  1JHB A;  1O8W A;  3TB2 A;  1JZW A;  5F07 A;  2ZUP A;  4TXO B;  3GL5 A;  1EOG A;  5FWG A;  5DQY A;  2L6D A;  1SKS B;  4MPF A;  3IHQ A;  2GZY A;  4BWQ A;  2CX3 A;  1XWA A;  5JWQ B;  4I5Q A;  3DKS A;  4TR1 B;  1QMV A;  2CV4 A;  2XBI A;  1PN9 A;  4WR4 A;  1TXX A;  4EL1 A;  2R4V A;  2EIR A;  4ZB8 A;  4ILF A;  1NW2 A;  2NTO A;  2B6M A;  4XIH A;  2L57 A;  3IV4 A;  1KEB A;  1TRS A;  2DMM A;  3QMX A;  2OA7 A;  4HU9 A;  1MDJ A;  5CNW A;  4KCA A;  1GSQ A;  5ECS A;  2XHF A;  2PMT A;  4WBR D;  4PX1 A;  2XPE A;  2MMO A;  2PER A;  2HSM B;  1RQM A;  4IKH A;  1ZMA A;  1GNW A;  3ZML A;  1FG4 A;  4ZL8 A;  4E8H A;  3BJ5 A;  3TKP A;  4NHW A;  3KMO A;  4OFN A;  2LUS A;  1Z3E A;  4XRD A;  1AW9 A;  1FVK A;  2OKA A;  14GS A;  1X5D A;  1ILO A;  3QCP A;  1OVN A;  1C72 A;  1WWJ A;  2O8V B;  20GS A;  1G7O A;  4IBP A;  2BJX A;  3JCM L;  4GWR A;  2CX4 A;  3MAK A;  3QAV A;  2YOI A;  4FYU A;  2O87 A;  5HR2 A;  2WFC A; 
#chains in the Genus database with same CATH topology
 4OMV A;  4Q5R A;  2IPA A;  3IK7 A;  2OBI A;  2GST A;  2C3T A;  2DJK A;  1K0D A;  3TRX A;  3APS A;  1ZYP A;  3KH9 A;  5BMU A;  2K9F A;  1SL2 B;  2JZT A;  4FH8 A;  5G1K A;  3VI5 A;  2H0I A;  4O5R A;  3APQ A;  3F3Q A;  4EKZ A;  4G0I A;  2WDU A;  1V57 A;  1X5E A;  3A2V A;  2I9H A;  3F4R A;  1EWX A;  3MWH A;  5CRD A;  1SKW B;  5A1N A;  1LU4 A;  2PU9 C;  3DXB A;  2LQQ A;  1T4Z A;  2EIO A;  1ZOF A;  3ZIJ A;  1EP8 A;  1T00 A;  1TI3 A;  4BL7 B;  4XS4 B;  5CP1 A;  3V1W A;  2AV4 A;  3GKX A;  3GX0 A;  2LKU A;  3ZLP A;  1UC7 A;  3HZ4 A;  4NV2 A;  3E3E A;  1XBS A;  2JL4 A;  2TRC P;  2VIM A;  2R3X A;  1SU9 A;  4L0U A;  5AIV A;  2OBK A;  2WW2 A;  2E7P A;  3ZIT A;  2OE1 A;  1M0U A;  1U88 A;  4KSM A;  1R4W A;  1T4Y A;  2X8C A;  1DUG A;  2HSN A;  2ZCT A;  1A2M A;  1TK5 B;  3LSZ A;  1M2B A;  1BG1 A;  4HS1 A;  4WR5 A;  1GLP A;  2JZS A;  2IFQ B;  4GST A;  3EE2 A;  4TOP A;  1A23 A;  3KTB A;  4K5R A;  1KBN A;  3KH7 A;  2H19 A;  3VLN A;  1BJX A;  3WD6 A;  1PQN A;  2DJ2 A;  3D6I A;  2B7K A;  3EVI A;  3TKR A;  5D8I A;  2VCX A;  4MNN A;  2GT5 A;  2YWM A;  3GSS A;  2IMD A;  5D9W A;  1PMT A;  3F6D A;  1Z9H A;  1CQH A;  4TR4 A;  2RUF A;  1B9Y C;  1GSE A;  3CRU A;  4FYC A;  4TR0 A;  4QQ7 A;  2C0E A;  1IYI A;  4MA9 A;  1X9S B;  4N0V A;  1SD9 A;  4PXO A;  2DKI A;  3O3T A;  4IEL A;  2IMF A;  3EWL A;  4MCU A;  1SVL A;  5GAP D;  2OAC A;  3GV1 A;  2NVL A;  1GNE A;  1PFO A;  4PI0 C;  2FWG A;  2JU5 A;  2FUG 2;  1VGL A;  2WZ9 A;  1PL2 A;  4PHZ C;  4V2N A;  19GS A;  2FWF A;  3CSH A;  1TP9 A;  3TDG A;  2C0D A;  4OWY A;  4TXO A;  2XC2 A;  4WXT A;  4MH3 A;  1GSD A;  2V1M A;  3FK8 A;  2MMA A;  4OFT A;  2B5Y A;  1XCC A;  2O7K A;  3VFI A;  2B5X A;  1E6B A;  2A2P A;  5CAX A;  1S3A A;  3UBL A;  1GUL A;  2VM1 A;  2WVX A;  4USS A;  3LXZ A;  2FY6 A;  1R7H A;  3UAR A;  2WVY A;  4X4J A;  1PN0 A;  2HRK B;  2HSM A;  1F3A A;  2K18 A;  2C0F A;  5C04 A;  2X49 A;  4G01 A;  1XOA A;  5LD0 A;  2KHP A;  4V1A p;  5F8B A;  4ML6 A;  1WE0 A;  3FYG A;  3W6G A;  2DJ0 A;  4V1A g;  4YQU A;  3F8U A;  4YAP A;  4IW9 A;  3D0Z A;  1I1I P;  4LL4 B;  4MZB A;  1S3D A;  5J5N A;  1SL0 B;  3U6V A;  5A4U A;  2QA1 A;  2H66 A;  3IA1 A;  4K1F A;  3ED3 A;  2H01 A;  3GL3 A;  3RPP A;  1SJZ A;  1BQ7 A;  3SWL A;  1ACV A;  4XCS A;  2EFE A;  4TR3 A;  5EY6 A;  2VCQ A;  1TXU A;  3GNJ A;  1FO5 A;  1BF5 A;  2ALB A;  1Q4J A;  1SJI A;  2OE0 A;  5A5K A;  4QL9 A;  1G6W A;  1K0B A;  3L0H A;  2X8G A;  4K7O A;  2KLX A;  4XHM A;  2A2S A;  1O81 A;  3BCI A;  5ECI B;  3F3R A;  2CAQ A;  4OFM A;  1A2L A;  2WUL A;  2YP6 A;  4IN0 A;  5D73 A;  3M0F A;  4PNG A;  3F0I A;  1PGT A;  2QA2 A;  3GST A;  4EF0 A;  4ZBB A;  4TXV A;  1KTE A;  3PIN A;  4XS4 A;  2WB9 A;  2QC7 A;  4BIK A;  2MMN A;  3UVH A;  3TCO A;  5ECH B;  1THO A;  3CYN A;  4RUV A;  1GWC A;  5D9V A;  2FNO A;  4GCI A;  2O89 A;  3TUE A;  2LRN A;  1TI1 A;  1K0A A;  2V41 A;  4F9Z A;  2R0P A;  3ZYW A;  2VLT A;  18GS A;  1GUH A;  4J56 E;  5J4U A;  1HQO A;  1ZL9 A;  3M3M A;  1M2D A;  4GQF A;  5ENU A;  6GST A;  2C1Y A;  2FWH A;  3IXR A;  1B4P A;  1YEX A;  3EPT A;  2CA8 A;  5B7C A;  2E2M A;  3APO A;  4KDX A;  3O76 A;  4JE1 A;  4IS0 A;  1Z7R A;  2GLR A;  2DBC A;  5IM9 A;  4Q5Q A;  4ZL9 A;  1F6M C;  3F6F A;  3G7J A;  5AIS A;  2I4A A;  1QGV A;  4GSN A;  2AB6 A;  3BBY A;  2YV7 A;  4FO5 A;  4YKG A;  1FB6 A;  2EC4 A;  4ZB6 A;  1AIU A;  3GUS A;  1QQ2 A;  3HVS A;  2E2G A;  2L5L A;  1FHE A;  5D96 A;  2B7J A;  2B5E A;  3GX8 A;  4EO3 A;  2OJL A;  5H5Q A;  1PKZ A;  1TDI A;  3L4N A;  1Y25 A;  1PD2 1;  1NM3 A;  4JED A;  1N8J A;  4BPY A;  4EXJ A;  3IC8 A;  2LV3 A;  1ERW A;  2VCW A;  4EVM A;  2LJK A;  3ZTL A;  2HSH A;  3ZRE A;  1PX7 A;  1UA5 A;  1ON4 A;  3LGC A;  4EC0 A;  3S9F A;  4BA7 A;  1PA3 A;  2O3E A;  2HYX A;  1S4B P;  5FHI A;  4N0Z A;  2F9S A;  2DLX A;  1B9X C;  2C0G A;  5HFK A;  1V2A A;  5F06 A;  4WF5 A;  4IQA A;  4HDE A;  3EIN A;  4K9Z A;  3IDV A;  3GUR A;  7GSS A;  3C71 A;  3G7Y A;  2HSY A;  3FR3 A;  5ECK B;  2H75 A;  1VF1 A;  3QAW A;  3LYP A;  2FLS A;  1EZK A;  5EPF A;  3SBC A;  3GFK A;  2HRK A;  2CT6 A;  1YKC A;  4KA0 A;  4BVX A;  1ZZY A;  2G2Q A;  2WZS A;  4NMU A;  1R5P A;  4AGS A;  3UVT A;  4AKG A;  4K8M A;  1T1V A;  5IO0 A;  5HR3 A;  1QUW A;  1H4O A;  1CQG A;  4ZIJ A;  3CQF A;  2UV8 G;  1BAY A;  3DVW A;  2P5Q A;  3FRC A;  3PGT A;  1WOU A;  4ECJ A;  4HI7 A;  2H6X A;  2LRC A;  2L59 A;  3EUR A;  4RI7 A;  1M99 A;  3HMJ G;  1TRW A;  2VL2 A;  5EVO A;  2F8F A;  3UBK A;  5CRH A;  4NWY A;  1AUC A;  5HR1 A;  4HEA 2;  2H6Z A;  2C3N A;  4ZL7 A;  1Z6N A;  1OKT A;  3WGE A;  2UZ8 A;  5DAL A;  2H8L A;  1F37 A;  4KAE A;  4KH7 A;  3DGQ A;  2DKH A;  1FAA A;  1GSY A;  4WF4 A;  1J08 A;  4L0W A;  3ZIV A;  3DML A;  4RQR A;  3IRA A;  1V40 A;  5KOW A;  1T8E B;  4MZC A;  5ECM B;  5J4Y A;  1NHO A;  3U5R E;  1YEW C;  1GP1 A;  4PQI A;  4AKX B;  4L5O A;  3A5W A;  5IIZ A;  4KDU A;  5ECP B;  1JFU A;  2CVB A;  4N11 A;  4G0K A;  1EOH A;  5KN1 A;  3GHA A;  1F2E A;  1PL1 A;  3LFL A;  3HVV A;  5A34 B;  1ML6 A;  1I5G A;  3HY2 A;  3CTG A;  3A5I A;  1A8Y A;  4WKW A;  2AHE A;  3E9J B;  1QFN A;  3TJB A;  3FY7 A;  1GUM A;  1UN2 A;  2C3Q A;  2IIY A;  3DYR A;  2RUE A;  3QFA C;  2DIZ A;  3EYT A;  3IAS 2;  9GSS A;  2HRF A;  3HXS A;  1M7T A;  1AQW A;  5GAN D;  3CSI A;  3EMP A;  2YWO A;  2CZ2 A;  1XVQ A;  2OT3 A;  3BCK A;  3C7M A;  4QMK A;  2H1G A;  1M2A A;  5JCW A;  2YNX A;  2J9H A;  2I81 A;  2GGT A;  2GSQ A;  3GKN A;  3HD5 A;  3C1R A;  3QOU A;  3H1N A;  1K3O A;  2BTO T;  4J57 E;  4POM A;  5HR0 A;  2PGT A;  2N5A A;  1F3B A;  3IOS A;  2GQM A;  4KND A;  4IHU A;  3NIV A;  1XWC A;  1Z7P A;  4ACS A;  2DSA A;  1GSF A;  2V2G A;  4DSQ A;  4KCE A;  3R2Q A;  1M9B A;  2HT9 A;  1RW1 A;  3DVX A;  4IQ1 A;  1BED A;  3VK9 A;  3EMX A;  1W4V A;  3VWX A;  2YZH A;  3W8J A;  2HZE B;  3WGX A;  2J23 A;  5DBQ A;  5ID2 A;  3Q6O A;  3H79 A;  3P8W A;  2RII A;  1SKR B;  1XIY A;  3KJY A;  2MMZ A;  4DEJ A;  4TKY A;  4CY6 A;  1TRU A;  3OR5 A;  2JZR A;  2K8V A;  4V2L A;  2VL3 A;  3TOT A;  1K0M A;  2EFD A;  2H71 A;  1MDK A;  3CHX C;  2P0G A;  4PNF A;  5F0G A;  3ZFB A;  5D9T A;  1EV4 A;  2EFH A;  2WVZ A;  2YAN A;  2H74 A;  1WIK A;  1WMJ A;  1TOF A;  2HRA A;  1AC1 A;  2LEG A;  2H6Y A;  3D4T A;  5GST A;  1YJ6 A;  2KOK A;  5IMD A;  2LS5 A;  2PVQ A;  2K6V A;  5ECN B;  2GQL A;  4TW5 A;  5J4V A;  4L8E A;  2IMK A;  3GMF A;  5ELG A;  4LA1 A;  4GDF A;  3RHB A;  2GT6 A;  4JBB A;  1MEK A;  5IQY A;  1GL8 A;  3LW9 A;  1TJD A;  2F8A A;  2PUK C;  2DJJ A;  4HOJ A;  2L6C A;  3CRT A;  2AYT A;  5JCU A;  4MJB A;  3L9U A;  4MH2 A;  2GDR A;  3TJG A;  1MDI A;  1K0O A;  1ZGN A;  1YDK A;  1Z6M A;  3TU3 B;  4TR1 A;  2GSS A;  1XW9 A;  5ECQ B;  3CTF A;  3WGD A;  2M46 A;  3A3T A;  4IVF A;  4E68 A;  3IE3 A;  2M80 A;  3Q19 A;  1MTC A;  1SYX A;  2LTK A;  4K0N A;  1IYH A;  1A2J A;  1HYU A;  2P5R A;  2G0F A;  4MDC A;  4KE3 A;  5KN0 A;  1OE8 A;  3FR6 A;  3J7Y b;  1B48 A;  4F0B A;  2MBT A;  4HQS A;  2XBQ A;  6GSV A;  2VD1 A;  3C73 A;  4GXZ A;  3IBH A;  4I6X A;  4EE0 A;  4X0X A;  2GSR A;  2MBS A;  3PR8 A;  1ZCP A;  4HSC X;  2B3S A;  3TRP A;  1U3I A;  2C4J A;  4JRR A;  1EP7 A;  3EU4 A;  4NPB A;  3QPM A;  2TIR A;  2HE3 A;  5DAK B;  5B6N A;  4ZB9 A;  1GTU A;  1GUK A;  3LJR A;  3ME7 A;  5G5E A;  2LNS A;  2KUC A;  4GLT A;  3LWA A;  4KB3 A;  1AQX A;  3FZ5 A;  6GSW A;  1TRV A;  1JZO A;  3C8E A;  2H76 A;  5J47 A;  3ZL5 A;  3TKS C;  2C8U A;  5B8B A;  4XS6 A;  1WRY A;  5KN3 A;  1OKD A;  5E59 A;  1B8X A;  5EL8 A;  2B1K A;  3VWV A;  1Z5Y E;  3TRQ A;  1B4Q A;  2AAW A;  4LLR A;  5BRT A;  5L71 A;  3D5J A;  4EDY A;  1NHY A;  3I43 A;  4IGJ A;  2FCH A;  4KUN A;  3TJF A;  3TJJ A;  5IMF A;  5G30 A;  3D21 A;  4K2X A;  2PBJ A;  3ZRD A;  3M9K A;  1SL1 B;  4BL7 A;  1DBY A;  1R5A A;  2A2R A;  1USB A;  3O6T A;  4IJI A;  4ECC A;  2IL3 A;  3I69 A;  1XFL A;  1PRX A;  11GS A;  3VUR A;  3TKS A;  3UL3 A;  5IPH A;  1T3B A;  2V6K A;  3FMW A;  2N5F A;  1DE1 A;  4TRX A;  5CO3 A;  2IN3 A;  4OO4 A;  4F82 A;  2VLU A;  4YQM A;  2WJU A;  2VL9 A;  1RK4 A;  2HZE A;  4O7H A;  3QDN A;  2A4V A;  4POL A;  5A5H B;  2GVP A;  3M8N A;  1OYJ A;  4MLY A;  4NHZ A;  2R0G A;  2IFQ A;  2VOC A;  3NOF A;  3BOA A;  3HJM A;  3BD2 A;  5H5S A;  5DCH A;  2GS3 A;  4HU7 A;  5D9X A;  4KSO A;  4ZBA A;  3TKQ A;  3GA4 A;  5ECO B;  3GKK A;  5HQP A;  5IOX A;  2KP1 A;  1YZX A;  5C00 A;  4BVY B;  1SK2 A;  2A4H A;  5BMU B;  1XW5 A;  1TTZ A;  5G31 A;  3DIE A;  1BYE A;  2IWT A;  3HHV A;  3LOR A;  4K0G A;  5DVB A;  3KIJ A;  4EDZ A;  4WBJ A;  3ERF A;  22GS A;  1I9D A;  1G7E A;  5J9B A;  1OAZ A;  3RDW A;  4HUA A;  3QFB C;  3HJP A;  4D73 B;  4IJ3 A;  3RFR C;  2YPM A;  4F0C A;  4KDY A;  1VF3 A;  5D93 A;  3GYK A;  4AJ7 A;  1Q98 A;  4G19 A;  4OCE A;  3KTL A;  4I2U A;  2PVO C;  3N9J A;  3VPQ A;  3QD9 A;  2GTU A;  5HFG A;  4ZBD A;  4NV5 A;  1TK8 B;  4ICY A;  3R3E A;  1ERT A;  4GSS A;  3HJO A;  3I6A A;  2YWI A;  3NZN A;  3H8Q A;  2RLI A;  3IAM 2;  2VCZ A;  2R6K A;  5LCZ A;  1FB0 A;  3WYW A;  2VL2 C;  4TN8 A;  2NBS A;  4YAV A;  3KP8 A;  2HSN B;  2CQ9 A;  2AUV A;  5DDL A;  3UOM A;  3D4M A;  1YY7 A;  4X43 A;  1EV9 A;  5AGY A;  1R26 A;  2H0H A;  4F2I A;  5IO2 A;  4MAB A;  4N10 A;  2H1L A;  3ME8 A;  1ZYQ B;  4ULX A;  4W66 A;  4LMV A;  3HDC A;  3LQ7 A;  3KEB A;  4PUA A;  3GH9 A;  1TW9 A;  4Z2T A;  1K3L A;  5JCG A;  3DWV A;  2FD3 A;  4MP4 A;  4JR6 A;  2DJ3 A;  3EC3 A;  3WT1 A;  5DAK A;  1GLQ A;  4MZW A;  1K0N A;  1U6T A;  1JZR A;  1VRS D;  4FXY P;  1BX9 A;  3CSJ A;  3UAP A;  4X1U A;  1J9B A;  5GSS A;  3KCM A;  5IOW A;  3G7I A;  1W89 A;  3TGZ A;  6GSX A;  2H1A A;  4HZ4 A;  4PI2 C;  2YN1 A;  1SD8 A;  2JAD A;  2CAI A;  5A4W A;  3F63 A;  3GH6 A;  2PWJ A;  1AAZ A;  5B8A A;  2FA4 A;  1GTA A;  3N5O A;  4KF9 A;  4WET A;  4TVE A;  4AKH A;  5GZZ B;  1K3Y A;  4NAX A;  3F9U A;  3MIX A;  1WPI A;  3IC4 A;  3IHG A;  4Z7X A;  5DJL A;  4EIP A;  3HVX A;  5KOX A;  1VF2 A;  2L4Q A;  1HNB A;  3DD3 A;  2H30 A;  1SJ6 A;  2VM2 A;  5J41 A;  1EGO A;  2HZF A;  1J0F A;  2P31 A;  4MJC A;  4GQC A;  2H0G A;  4A5P A;  4L5L A;  5AIX A;  4ZIL A;  2IJY A;  3HYP A;  2M72 A;  1EEJ A;  4OO5 A;  1ERU A;  2L4C A;  5A5H A;  1X9W B;  2R0C A;  3M1G A;  4KX4 A;  3IR4 A;  3GKM A;  2X8H A;  4K5S A;  13GS A;  2X4A A;  2GZP A;  3F4S A;  3FZ4 A;  1MD4 A;  5CRG A;  1KNG A;  4J2F A;  17GS A;  2HRN A;  3MYD A;  1EGR A;  1BG5 A;  2K8S A;  3P2A A;  5J40 A;  4N3Z A;  5ABR A;  5KEJ A;  4DSR A;  3L9S A;  4ZXG A;  4LMW A;  1AXD A;  2WW3 A;  2DML A;  2GQK A;  3VWW A;  2OAD A;  4DSS B;  1A0F A;  2FHE A;  1YVL A;  4BVY A;  1XWG A;  2F51 A;  1VF4 A;  2HNL A;  1N2A A;  4PQH A;  3FHK A;  5IMC A;  2HFD A;  2VO4 A;  1NSW A;  3KD0 A;  4YH2 A;  4GTU A;  2FWE A;  1PSQ A;  2HXK A;  2WS2 A;  5AN1 A;  2MYG A;  4ECI A;  4JZQ A;  2QSI A;  4V2M A;  4K7I A;  2YWN A;  2NDO A;  4POB A;  1LBK A;  4POK A;  5A4V A;  5DQS A;  1TU7 A;  4K6X A;  4AJ8 A;  1X5C A;  5ECL B;  3AY8 A;  4WEY A;  2IMI A;  4Z2U A;  4Q5N A;  3MNG A;  4AJ6 A;  5G2Z A;  4D73 A;  1LJR A;  1OC8 A;  1XG8 A;  2LJA A;  3RAZ A;  3KM6 A;  4MJA A;  4DVC A;  5F05 A;  3LXT A;  2H73 A;  3VWU A;  3KGK A;  3DRN A;  4YKF A;  4MF7 A;  1S3C A;  4H86 A;  3UEM A;  1PX6 A;  1DSB A;  4HJ2 A;  2R5G A;  1M3I A;  3MDK A;  5ECR B;  4MMM A;  3F4T A;  1N25 A;  4HQZ A;  6GSU A;  3W8S A;  4LL1 B;  1TK0 B;  2I1U A;  3E0U A;  1V9W A;  3FKF A;  4FYB A;  5HFI A;  2V32 A;  3K8N A;  2TRX A;  2YV9 A;  5G5F A;  3ERW A;  2KP2 A;  6GSS A;  3HKR A;  4ID0 A;  2VLV A;  2HLS A;  8GSS A;  2DC5 A;  3GRX A;  4GF0 A;  3J7Y k;  4XRA A;  3Q74 A;  1WJK A;  12GS A;  1WP0 A;  1XOB A;  4O32 A;  3EU3 A;  1DE2 A;  2WRT A;  3UIW A;  1FW1 A;  1TKD B;  3GTU B;  2NPB A;  2R2J A;  1V98 A;  3CBU A;  3ZVJ A;  2FGX A;  1GRX A;  4G0L A;  1GH2 A;  1O73 A;  3KXO A;  2VAF A;  2AJQ B;  1Y6E A;  4RI6 A;  1XPV A;  4EIQ A;  2D2Z A;  3QR6 A;  5CYY A;  2EFC A;  4HJM A;  4CY8 A;  1S3R A;  1XZO A;  2LST A;  2RM6 A;  3PH9 A;  4PUF C;  1ERV A;  4MJE A;  2OE3 A;  1ABA A;  2YJH A;  4N30 A;  3KMN A;  3FZ9 A;  4PUR A;  2YCD A;  4XTS A;  4P3Y B;  3HVN A;  3IPZ A;  3TJK A;  2F3M A;  1XW6 A;  4NXI A;  4K2D A;  1GSS A;  3FEU A;  2Z9S A;  2ON7 A;  5A34 A;  2X64 A;  4MK3 A;  2REM A;  5ELA A;  4PQ1 A;  3RPN A;  1MD3 A;  2VKZ G;  4AI6 A;  2I3Y A;  4BVX B;  2ES7 A;  4PTS A;  3ZVJ D;  1YQ1 A;  4QL7 A;  1XVW A;  1SEN A;  4AF2 A;  1AQV A;  6GSY A;  2WW1 A;  1JLV A;  4G9H A;  3L9V A;  3P7X A;  3FW2 A;  1Y1U A;  2VD0 A;  1OC9 B;  3GN3 A;  4FIW A;  3A2W A;  4RQX A;  4MF6 A;  2LRT A;  1O85 A;  2WW0 A;  4K7N A;  5JWO B;  5KN2 A;  1H75 A;  1XWK A;  5INY A;  1XWB A;  3FR9 A;  1FOH A;  1OC3 A;  5DAL B;  2EIQ A;  4DSS A;  2O5V A;  3TOU A;  4E8E A;  4ZB7 A;  2IME A;  5E4W A;  2E0Q A;  2O85 A;  5B6M A;  3CMI A;  5J9C A;  3VPT A;  4BWS A;  1G6Y A;  3I9V 2;  1THX A;  2H72 A;  5FT3 A;  4G10 A;  2N5B A;  16GS A;  5CRE A;  1X9M B;  4JR4 A;  1ST9 A;  3TKS E;  1F9M A;  5CRW A;  1XXU A;  5DJM A;  1ZYE A;  4GRF A;  2GZZ A;  4CHS A;  1JZD A;  1X0R A;  5IMZ A;  1UVZ A;  1A24 A;  3HZ8 A;  3KP9 A;  5IMA A;  4EUY A;  1FOV A;  1A0R P;  5J3R A;  4O92 A;  3L78 A;  4OCF A;  2R37 A;  4FQU A;  3FZA A;  4MF5 A;  3D22 A;  3ISO A;  4MPG A;  2O36 A;  3CXG A;  2VCT A;  2B1L A;  3M9J A;  1HD2 A;  2YZU A;  2LNT A;  2JSZ A;  2ZNM A;  4O5Q A;  1U87 A;  4XS1 A;  3PPU A;  1FVJ A;  3DEX A;  4ECB A;  3GTU A;  4IP6 A;  1QXH A;  2LQO A;  2CVD A;  4CW9 A;  2X99 A;  5LNK e;  5A1N B;  2FA8 A;  2V6O A;  3UJ1 A;  1JLW A;  1E2Y A;  1O7U A;  5DCG A;  1OE7 A;  3LG6 A;  2ON5 A;  5IMV A;  2PPT A;  1SK0 A;  2HI7 A;  2L5O A;  3H93 A;  2WGR A;  2VCV A;  1SYR A;  4IP1 A;  4ML1 A;  1SVM A;  10GS A;  1K0C A;  1O6J A;  4F03 A;  1YKA A;  2BMX A;  2XPD A;  1YF0 A;  5G1L A;  2C80 A;  1ZYN A;  3GIX A;  2JSY A;  2H1B A;  3ZZX A;  1YF1 A;  3P90 A;  1URM A;  1HNC A;  2DJ1 A;  4Z2R A;  2CVK A;  3ZMK A;  4HZ2 A;  3ZFL A;  2QGV A;  4YQV A;  4ISD A;  1SK1 A;  1U3A A;  1V58 A;  2YJ7 A;  3CWG A;  1A8L A;  3LEF A;  5ID2 B;  3HCZ A;  1EEM A;  4CDO A;  2PN8 A;  4AKI A;  4OD7 A;  1SVO A;  5IPG A;  1GTB A;  4I97 A;  2WCI A;  3MSZ A;  1M3J A;  2LJR A;  2HQT A;  3G9B A;  3Q18 A;  2JAC A;  2MZC A;  3H4K A;  4I2T A;  4I8B A;  3RBT A;  1TU8 A;  3UMA A;  4KW6 A;  3US3 A;  2H1D A;  5H5R A;  1M9A A;  4PGT A;  2DIY A;  3WT2 A;  4JU5 A;  2RM5 A;  2CZ3 A;  1YEP A;  1GTI A;  3RHC A;  3A2X A;  4KGI A;  1O8X A;  1T7P B;  3QAG A;  2VUP A;  1PKW A;  4Q5F A;  1HNA A;  3LYK A;  2H70 A;  5COH A;  1G0T A;  3VI7 A;  1QK8 A;  3IK9 A;  1OC9 A;  3HA9 A;  5JWR B;  2QKE A;  3C1S A;  3ERG A;  1GSU A;  4G2E A;  3KZQ A;  1JHB A;  1O8W A;  3TB2 A;  1JZW A;  5F07 A;  2ZUP A;  4TXO B;  3GL5 A;  1EOG A;  5FWG A;  5DQY A;  2L6D A;  1SKS B;  4MPF A;  3IHQ A;  2GZY A;  4BWQ A;  2CX3 A;  1XWA A;  5JWQ B;  4I5Q A;  3DKS A;  4TR1 B;  1QMV A;  2CV4 A;  2XBI A;  1PN9 A;  4WR4 A;  1TXX A;  4EL1 A;  2R4V A;  2EIR A;  4ZB8 A;  4ILF A;  1NW2 A;  2NTO A;  2B6M A;  4XIH A;  2WVX B;  3IV4 A;  2L57 A;  1KEB A;  1TRS A;  2DMM A;  3QMX A;  2OA7 A;  4HU9 A;  1MDJ A;  5CNW A;  4KCA A;  1GSQ A;  5ECS A;  2XHF A;  2PMT A;  4WBR D;  4PX1 A;  2XPE A;  2MMO A;  2PER A;  2HSM B;  1RQM A;  4IKH A;  1ZMA A;  1GNW A;  3ZML A;  1FG4 A;  4ZL8 A;  4E8H A;  3BJ5 A;  3TKP A;  4NHW A;  3KMO A;  4OFN A;  2LUS A;  1Z3E A;  4XRD A;  1AW9 A;  3RGB C;  1FVK A;  2OKA A;  14GS A;  1X5D A;  1ILO A;  3QCP A;  1OVN A;  4O5U A;  1C72 A;  1WWJ A;  2O8V B;  20GS A;  1G7O A;  4IBP A;  2BJX A;  3JCM L;  4GWR A;  2CX4 A;  3MAK A;  3QAV A;  2YOI A;  4FYU A;  2O87 A;  5HR2 A;  2WFC A; 
#chains in the Genus database with same CATH homology
 4OMV A;  4Q5R A;  2IPA A;  3IK7 A;  2OBI A;  2GST A;  2C3T A;  2DJK A;  1K0D A;  3TRX A;  3APS A;  1ZYP A;  3KH9 A;  5BMU A;  2K9F A;  1SL2 B;  2JZT A;  4FH8 A;  5G1K A;  3VI5 A;  2H0I A;  4O5R A;  3APQ A;  3F3Q A;  4EKZ A;  4G0I A;  2WDU A;  1V57 A;  1X5E A;  3A2V A;  2I9H A;  3F4R A;  1EWX A;  3MWH A;  5CRD A;  1SKW B;  5A1N A;  1LU4 A;  2PU9 C;  3DXB A;  2LQQ A;  1T4Z A;  2EIO A;  1ZOF A;  3ZIJ A;  1EP8 A;  1T00 A;  1TI3 A;  4BL7 B;  4XS4 B;  5CP1 A;  3V1W A;  2AV4 A;  3GKX A;  3GX0 A;  2LKU A;  3ZLP A;  1UC7 A;  3HZ4 A;  4NV2 A;  3E3E A;  1XBS A;  2JL4 A;  2TRC P;  2VIM A;  2R3X A;  1SU9 A;  4L0U A;  5AIV A;  2OBK A;  2E7P A;  3ZIT A;  2OE1 A;  1M0U A;  1U88 A;  4KSM A;  1R4W A;  1T4Y A;  2X8C A;  1DUG A;  2HSN A;  2ZCT A;  1A2M A;  1TK5 B;  3LSZ A;  1M2B A;  1BG1 A;  4HS1 A;  4WR5 A;  1GLP A;  2JZS A;  2IFQ B;  4GST A;  3EE2 A;  4TOP A;  1A23 A;  3KTB A;  4K5R A;  1KBN A;  3KH7 A;  2H19 A;  3VLN A;  1BJX A;  3WD6 A;  1PQN A;  2DJ2 A;  3D6I A;  2B7K A;  3EVI A;  3TKR A;  5D8I A;  2VCX A;  4MNN A;  2GT5 A;  2YWM A;  3GSS A;  2IMD A;  5D9W A;  1PMT A;  3F6D A;  1Z9H A;  1CQH A;  4TR4 A;  2RUF A;  1B9Y C;  1GSE A;  3CRU A;  4FYC A;  4TR0 A;  4QQ7 A;  2C0E A;  1IYI A;  4MA9 A;  1X9S B;  4N0V A;  1SD9 A;  4PXO A;  2DKI A;  3O3T A;  4IEL A;  2IMF A;  3EWL A;  4MCU A;  1SVL A;  5GAP D;  2OAC A;  3GV1 A;  2NVL A;  1GNE A;  2FWG A;  2JU5 A;  2FUG 2;  1VGL A;  2WZ9 A;  1PL2 A;  4V2N A;  19GS A;  2FWF A;  3CSH A;  1TP9 A;  3TDG A;  2C0D A;  4OWY A;  4TXO A;  2XC2 A;  4WXT A;  4MH3 A;  1GSD A;  2V1M A;  3FK8 A;  2MMA A;  4OFT A;  2B5Y A;  1XCC A;  2O7K A;  3VFI A;  2B5X A;  1E6B A;  2A2P A;  5CAX A;  1S3A A;  3UBL A;  1GUL A;  2VM1 A;  4USS A;  3LXZ A;  2FY6 A;  1R7H A;  3UAR A;  4X4J A;  1PN0 A;  2HRK B;  2HSM A;  1F3A A;  2K18 A;  2C0F A;  5C04 A;  2X49 A;  4G01 A;  1XOA A;  5LD0 A;  2KHP A;  4V1A p;  5F8B A;  4ML6 A;  1WE0 A;  3FYG A;  3W6G A;  2DJ0 A;  4V1A g;  4YQU A;  3F8U A;  4YAP A;  4IW9 A;  3D0Z A;  4LL4 B;  4MZB A;  1S3D A;  5J5N A;  1SL0 B;  3U6V A;  5A4U A;  2QA1 A;  2H66 A;  3IA1 A;  4K1F A;  3ED3 A;  2H01 A;  3GL3 A;  3RPP A;  1SJZ A;  1BQ7 A;  3SWL A;  1ACV A;  4XCS A;  2EFE A;  4TR3 A;  5EY6 A;  2VCQ A;  1TXU A;  3GNJ A;  1FO5 A;  1BF5 A;  2ALB A;  1Q4J A;  1SJI A;  2OE0 A;  5A5K A;  4QL9 A;  1G6W A;  1K0B A;  3L0H A;  2X8G A;  4K7O A;  2KLX A;  4XHM A;  2A2S A;  1O81 A;  3BCI A;  5ECI B;  3F3R A;  2CAQ A;  4OFM A;  1A2L A;  2WUL A;  2YP6 A;  4IN0 A;  5D73 A;  3M0F A;  4PNG A;  3F0I A;  1PGT A;  2QA2 A;  3GST A;  4EF0 A;  4ZBB A;  4TXV A;  1KTE A;  3PIN A;  4XS4 A;  2WB9 A;  2QC7 A;  2MMN A;  3UVH A;  3TCO A;  5ECH B;  1THO A;  3CYN A;  4RUV A;  1GWC A;  5D9V A;  2FNO A;  4GCI A;  2O89 A;  3TUE A;  2LRN A;  1TI1 A;  1K0A A;  2V41 A;  4F9Z A;  2R0P A;  3ZYW A;  2VLT A;  18GS A;  1GUH A;  4J56 E;  5J4U A;  1HQO A;  1ZL9 A;  3M3M A;  1M2D A;  4GQF A;  5ENU A;  6GST A;  2C1Y A;  2FWH A;  3IXR A;  1B4P A;  1YEX A;  3EPT A;  2CA8 A;  5B7C A;  2E2M A;  3APO A;  4KDX A;  3O76 A;  4JE1 A;  4IS0 A;  1Z7R A;  2GLR A;  2DBC A;  5IM9 A;  4Q5Q A;  4ZL9 A;  1F6M C;  3F6F A;  3G7J A;  5AIS A;  2I4A A;  1QGV A;  4GSN A;  2AB6 A;  3BBY A;  2YV7 A;  4FO5 A;  4YKG A;  1FB6 A;  2EC4 A;  4ZB6 A;  1AIU A;  3GUS A;  1QQ2 A;  3HVS A;  2E2G A;  2L5L A;  1FHE A;  5D96 A;  2B7J A;  2B5E A;  3GX8 A;  4EO3 A;  2OJL A;  5H5Q A;  1PKZ A;  1TDI A;  3L4N A;  1Y25 A;  1PD2 1;  1NM3 A;  4JED A;  1N8J A;  4BPY A;  4EXJ A;  3IC8 A;  2LV3 A;  1ERW A;  2VCW A;  4EVM A;  2LJK A;  3ZTL A;  2HSH A;  3ZRE A;  1PX7 A;  1UA5 A;  1ON4 A;  3LGC A;  4EC0 A;  3S9F A;  4BA7 A;  1PA3 A;  2HYX A;  5FHI A;  4N0Z A;  2F9S A;  2DLX A;  1B9X C;  2C0G A;  5HFK A;  1V2A A;  5F06 A;  4WF5 A;  4IQA A;  4HDE A;  3EIN A;  4K9Z A;  3IDV A;  3GUR A;  7GSS A;  3C71 A;  3G7Y A;  2HSY A;  3FR3 A;  5ECK B;  2H75 A;  1VF1 A;  3QAW A;  3LYP A;  2FLS A;  1EZK A;  5EPF A;  3SBC A;  3GFK A;  2HRK A;  2CT6 A;  1YKC A;  4KA0 A;  4BVX A;  1ZZY A;  2G2Q A;  4NMU A;  1R5P A;  4AGS A;  3UVT A;  4AKG A;  4K8M A;  1T1V A;  5IO0 A;  5HR3 A;  1QUW A;  1H4O A;  1CQG A;  4ZIJ A;  2UV8 G;  1BAY A;  3DVW A;  2P5Q A;  3FRC A;  3PGT A;  1WOU A;  4ECJ A;  4HI7 A;  2H6X A;  2LRC A;  2L59 A;  3EUR A;  4RI7 A;  1M99 A;  3HMJ G;  1TRW A;  2VL2 A;  5EVO A;  2F8F A;  3UBK A;  5CRH A;  4NWY A;  1AUC A;  5HR1 A;  4HEA 2;  2H6Z A;  2C3N A;  4ZL7 A;  1Z6N A;  1OKT A;  3WGE A;  2UZ8 A;  5DAL A;  2H8L A;  1F37 A;  4KAE A;  4KH7 A;  3DGQ A;  2DKH A;  1FAA A;  1GSY A;  4WF4 A;  1J08 A;  4L0W A;  3ZIV A;  3DML A;  4RQR A;  3IRA A;  1V40 A;  5KOW A;  1T8E B;  4MZC A;  5ECM B;  5J4Y A;  1NHO A;  3U5R E;  1GP1 A;  4PQI A;  4AKX B;  4L5O A;  3A5W A;  5IIZ A;  4KDU A;  5ECP B;  1JFU A;  2CVB A;  4N11 A;  4G0K A;  1EOH A;  5KN1 A;  3GHA A;  1F2E A;  1PL1 A;  3LFL A;  3HVV A;  5A34 B;  1ML6 A;  1I5G A;  3HY2 A;  3CTG A;  3A5I A;  1A8Y A;  4WKW A;  2AHE A;  3E9J B;  1QFN A;  3TJB A;  3FY7 A;  1GUM A;  1UN2 A;  2C3Q A;  2IIY A;  3DYR A;  2RUE A;  3QFA C;  2DIZ A;  3EYT A;  3IAS 2;  9GSS A;  2HRF A;  3HXS A;  1M7T A;  1AQW A;  5GAN D;  3CSI A;  3EMP A;  2YWO A;  2CZ2 A;  1XVQ A;  2OT3 A;  3BCK A;  3C7M A;  4QMK A;  2H1G A;  1M2A A;  5JCW A;  2YNX A;  2J9H A;  2I81 A;  2GGT A;  2GSQ A;  3GKN A;  3HD5 A;  3C1R A;  3QOU A;  3H1N A;  1K3O A;  2BTO T;  4J57 E;  4POM A;  5HR0 A;  2PGT A;  2N5A A;  1F3B A;  3IOS A;  2GQM A;  4KND A;  4IHU A;  3NIV A;  1XWC A;  1Z7P A;  4ACS A;  2DSA A;  1GSF A;  2V2G A;  4DSQ A;  4KCE A;  3R2Q A;  1M9B A;  2HT9 A;  1RW1 A;  3DVX A;  4IQ1 A;  1BED A;  3VK9 A;  3EMX A;  1W4V A;  3VWX A;  2YZH A;  3W8J A;  2HZE B;  3WGX A;  2J23 A;  5DBQ A;  5ID2 A;  3Q6O A;  3H79 A;  3P8W A;  2RII A;  1SKR B;  1XIY A;  3KJY A;  2MMZ A;  4DEJ A;  4TKY A;  4CY6 A;  1TRU A;  3OR5 A;  2JZR A;  2K8V A;  4V2L A;  2VL3 A;  3TOT A;  1K0M A;  2EFD A;  2H71 A;  1MDK A;  2P0G A;  4PNF A;  5F0G A;  3ZFB A;  5D9T A;  1EV4 A;  2EFH A;  2YAN A;  2H74 A;  1WIK A;  1WMJ A;  1TOF A;  2HRA A;  1AC1 A;  2LEG A;  2H6Y A;  3D4T A;  5GST A;  1YJ6 A;  2KOK A;  5IMD A;  2LS5 A;  2PVQ A;  2K6V A;  5ECN B;  2GQL A;  4TW5 A;  5J4V A;  4L8E A;  2IMK A;  3GMF A;  5ELG A;  4LA1 A;  4GDF A;  3RHB A;  2GT6 A;  4JBB A;  1MEK A;  5IQY A;  1GL8 A;  3LW9 A;  1TJD A;  2F8A A;  2PUK C;  2DJJ A;  4HOJ A;  2L6C A;  3CRT A;  2AYT A;  5JCU A;  4MJB A;  3L9U A;  4MH2 A;  2GDR A;  3TJG A;  1MDI A;  1K0O A;  1ZGN A;  1YDK A;  1Z6M A;  3TU3 B;  4TR1 A;  2GSS A;  1XW9 A;  5ECQ B;  3CTF A;  3WGD A;  2M46 A;  3A3T A;  4IVF A;  4E68 A;  3IE3 A;  2M80 A;  3Q19 A;  1MTC A;  1SYX A;  2LTK A;  4K0N A;  1IYH A;  1A2J A;  1HYU A;  2P5R A;  2G0F A;  4MDC A;  4KE3 A;  5KN0 A;  1OE8 A;  3FR6 A;  3J7Y b;  1B48 A;  4F0B A;  2MBT A;  4HQS A;  2XBQ A;  6GSV A;  2VD1 A;  3C73 A;  4GXZ A;  3IBH A;  4I6X A;  4EE0 A;  4X0X A;  2GSR A;  2MBS A;  3PR8 A;  1ZCP A;  2B3S A;  3TRP A;  1U3I A;  2C4J A;  4JRR A;  1EP7 A;  3EU4 A;  4NPB A;  3QPM A;  2TIR A;  2HE3 A;  5DAK B;  5B6N A;  4ZB9 A;  1GTU A;  1GUK A;  3LJR A;  3ME7 A;  5G5E A;  2LNS A;  2KUC A;  4GLT A;  3LWA A;  4KB3 A;  1AQX A;  3FZ5 A;  6GSW A;  1TRV A;  1JZO A;  3C8E A;  2H76 A;  5J47 A;  3ZL5 A;  3TKS C;  2C8U A;  5B8B A;  4XS6 A;  1WRY A;  5KN3 A;  1OKD A;  5E59 A;  1B8X A;  5EL8 A;  2B1K A;  3VWV A;  1Z5Y E;  3TRQ A;  1B4Q A;  2AAW A;  4LLR A;  5BRT A;  5L71 A;  3D5J A;  4EDY A;  1NHY A;  3I43 A;  4IGJ A;  2FCH A;  4KUN A;  3TJF A;  3TJJ A;  5IMF A;  5G30 A;  3D21 A;  4K2X A;  2PBJ A;  3ZRD A;  3M9K A;  1SL1 B;  4BL7 A;  1DBY A;  1R5A A;  2A2R A;  1USB A;  3O6T A;  4IJI A;  4ECC A;  2IL3 A;  3I69 A;  1XFL A;  1PRX A;  11GS A;  3VUR A;  3TKS A;  3UL3 A;  5IPH A;  1T3B A;  2V6K A;  3FMW A;  2N5F A;  1DE1 A;  4TRX A;  5CO3 A;  2IN3 A;  4OO4 A;  4F82 A;  2VLU A;  4YQM A;  2WJU A;  2VL9 A;  1RK4 A;  2HZE A;  4O7H A;  3QDN A;  2A4V A;  4POL A;  5A5H B;  2GVP A;  3M8N A;  1OYJ A;  4MLY A;  4NHZ A;  2R0G A;  2IFQ A;  2VOC A;  3NOF A;  3BOA A;  3HJM A;  3BD2 A;  5H5S A;  5DCH A;  2GS3 A;  4HU7 A;  5D9X A;  4KSO A;  4ZBA A;  3TKQ A;  3GA4 A;  5ECO B;  3GKK A;  5HQP A;  5IOX A;  2KP1 A;  1YZX A;  5C00 A;  4BVY B;  1SK2 A;  2A4H A;  5BMU B;  1XW5 A;  1TTZ A;  5G31 A;  3DIE A;  1BYE A;  2IWT A;  3HHV A;  3LOR A;  4K0G A;  5DVB A;  3KIJ A;  4EDZ A;  4WBJ A;  3ERF A;  22GS A;  1I9D A;  1G7E A;  5J9B A;  1OAZ A;  3RDW A;  4HUA A;  3QFB C;  3HJP A;  4D73 B;  4IJ3 A;  2YPM A;  4F0C A;  4KDY A;  1VF3 A;  5D93 A;  3GYK A;  4AJ7 A;  1Q98 A;  4G19 A;  4OCE A;  3KTL A;  4I2U A;  2PVO C;  3N9J A;  3VPQ A;  3QD9 A;  2GTU A;  5HFG A;  4ZBD A;  4NV5 A;  1TK8 B;  4ICY A;  3R3E A;  1ERT A;  4GSS A;  3HJO A;  3I6A A;  2YWI A;  3NZN A;  3H8Q A;  2RLI A;  3IAM 2;  2VCZ A;  2R6K A;  5LCZ A;  1FB0 A;  3WYW A;  2VL2 C;  4TN8 A;  2NBS A;  4YAV A;  3KP8 A;  2HSN B;  2CQ9 A;  2AUV A;  5DDL A;  3UOM A;  3D4M A;  1YY7 A;  4X43 A;  1EV9 A;  5AGY A;  1R26 A;  2H0H A;  4F2I A;  5IO2 A;  4MAB A;  4N10 A;  2H1L A;  3ME8 A;  1ZYQ B;  4ULX A;  4W66 A;  4LMV A;  3HDC A;  3LQ7 A;  3KEB A;  4PUA A;  3GH9 A;  1TW9 A;  4Z2T A;  1K3L A;  5JCG A;  3DWV A;  2FD3 A;  4MP4 A;  4JR6 A;  2DJ3 A;  3EC3 A;  3WT1 A;  5DAK A;  1GLQ A;  4MZW A;  1K0N A;  1U6T A;  1JZR A;  1VRS D;  1BX9 A;  3CSJ A;  3UAP A;  4X1U A;  1J9B A;  5GSS A;  3KCM A;  5IOW A;  3G7I A;  1W89 A;  3TGZ A;  6GSX A;  2H1A A;  4HZ4 A;  2YN1 A;  1SD8 A;  2JAD A;  2CAI A;  5A4W A;  3F63 A;  3GH6 A;  2PWJ A;  1AAZ A;  5B8A A;  2FA4 A;  1GTA A;  3N5O A;  4KF9 A;  4WET A;  4TVE A;  4AKH A;  5GZZ B;  1K3Y A;  4NAX A;  3F9U A;  3MIX A;  1WPI A;  3IC4 A;  3IHG A;  4Z7X A;  5DJL A;  4EIP A;  3HVX A;  5KOX A;  1VF2 A;  2L4Q A;  1HNB A;  3DD3 A;  2H30 A;  1SJ6 A;  2VM2 A;  5J41 A;  1EGO A;  2HZF A;  1J0F A;  2P31 A;  4MJC A;  4GQC A;  2H0G A;  4A5P A;  4L5L A;  5AIX A;  4ZIL A;  2IJY A;  3HYP A;  2M72 A;  1EEJ A;  4OO5 A;  1ERU A;  2L4C A;  5A5H A;  1X9W B;  2R0C A;  3M1G A;  4KX4 A;  3IR4 A;  3GKM A;  2X8H A;  4K5S A;  13GS A;  2X4A A;  2GZP A;  3F4S A;  3FZ4 A;  1MD4 A;  5CRG A;  1KNG A;  4J2F A;  17GS A;  2HRN A;  3MYD A;  1EGR A;  1BG5 A;  2K8S A;  3P2A A;  5J40 A;  4N3Z A;  5ABR A;  5KEJ A;  4DSR A;  3L9S A;  4ZXG A;  4LMW A;  1AXD A;  2DML A;  2GQK A;  3VWW A;  2OAD A;  4DSS B;  1A0F A;  2FHE A;  1YVL A;  4BVY A;  1XWG A;  2F51 A;  1VF4 A;  2HNL A;  1N2A A;  4PQH A;  3FHK A;  5IMC A;  2HFD A;  2VO4 A;  1NSW A;  3KD0 A;  4YH2 A;  4GTU A;  2FWE A;  1PSQ A;  2HXK A;  2WS2 A;  5AN1 A;  2MYG A;  4ECI A;  4JZQ A;  2QSI A;  4V2M A;  4K7I A;  2YWN A;  2NDO A;  4POB A;  1LBK A;  4POK A;  5A4V A;  5DQS A;  1TU7 A;  4K6X A;  4AJ8 A;  1X5C A;  5ECL B;  3AY8 A;  4WEY A;  2IMI A;  4Z2U A;  4Q5N A;  3MNG A;  4AJ6 A;  5G2Z A;  4D73 A;  1LJR A;  1OC8 A;  2LJA A;  3RAZ A;  3KM6 A;  4MJA A;  4DVC A;  5F05 A;  3LXT A;  2H73 A;  3VWU A;  3KGK A;  3DRN A;  4YKF A;  4MF7 A;  1S3C A;  4H86 A;  3UEM A;  1PX6 A;  1DSB A;  4HJ2 A;  2R5G A;  3MDK A;  5ECR B;  4MMM A;  3F4T A;  1N25 A;  4HQZ A;  6GSU A;  3W8S A;  4LL1 B;  1TK0 B;  2I1U A;  3E0U A;  1V9W A;  3FKF A;  4FYB A;  5HFI A;  2V32 A;  3K8N A;  2TRX A;  2YV9 A;  5G5F A;  3ERW A;  2KP2 A;  6GSS A;  3HKR A;  4ID0 A;  2VLV A;  2HLS A;  8GSS A;  2DC5 A;  3GRX A;  4GF0 A;  3J7Y k;  4XRA A;  3Q74 A;  1WJK A;  12GS A;  1WP0 A;  1XOB A;  4O32 A;  3EU3 A;  1DE2 A;  2WRT A;  3UIW A;  1FW1 A;  1TKD B;  3GTU B;  2NPB A;  2R2J A;  1V98 A;  3CBU A;  3ZVJ A;  2FGX A;  1GRX A;  4G0L A;  1GH2 A;  1O73 A;  3KXO A;  2VAF A;  2AJQ B;  1Y6E A;  4RI6 A;  1XPV A;  4EIQ A;  2D2Z A;  3QR6 A;  5CYY A;  2EFC A;  4HJM A;  4CY8 A;  1XZO A;  2LST A;  2RM6 A;  3PH9 A;  4PUF C;  1ERV A;  4MJE A;  2OE3 A;  1ABA A;  2YJH A;  4N30 A;  3KMN A;  3FZ9 A;  4PUR A;  2YCD A;  4XTS A;  4P3Y B;  3IPZ A;  3TJK A;  2F3M A;  1XW6 A;  4NXI A;  4K2D A;  1GSS A;  3FEU A;  2Z9S A;  2ON7 A;  5A34 A;  2X64 A;  4MK3 A;  2REM A;  5ELA A;  4PQ1 A;  3RPN A;  1MD3 A;  2VKZ G;  4AI6 A;  2I3Y A;  4BVX B;  2ES7 A;  4PTS A;  3ZVJ D;  1YQ1 A;  4QL7 A;  1XVW A;  1SEN A;  4AF2 A;  1AQV A;  6GSY A;  1JLV A;  4G9H A;  3L9V A;  3P7X A;  3FW2 A;  1Y1U A;  2VD0 A;  1OC9 B;  3GN3 A;  4FIW A;  3A2W A;  4RQX A;  4MF6 A;  2LRT A;  1O85 A;  4K7N A;  5JWO B;  5KN2 A;  1H75 A;  1XWK A;  5INY A;  1XWB A;  3FR9 A;  1FOH A;  1OC3 A;  5DAL B;  2EIQ A;  4DSS A;  2O5V A;  3TOU A;  4E8E A;  4ZB7 A;  2IME A;  5E4W A;  2E0Q A;  2O85 A;  5B6M A;  3CMI A;  5J9C A;  3VPT A;  4BWS A;  1G6Y A;  3I9V 2;  1THX A;  2H72 A;  5FT3 A;  4G10 A;  2N5B A;  16GS A;  5CRE A;  1X9M B;  4JR4 A;  1ST9 A;  3TKS E;  1F9M A;  5CRW A;  1XXU A;  5DJM A;  1ZYE A;  4GRF A;  2GZZ A;  4CHS A;  1JZD A;  1X0R A;  5IMZ A;  1UVZ A;  1A24 A;  3HZ8 A;  3KP9 A;  5IMA A;  4EUY A;  1FOV A;  1A0R P;  5J3R A;  4O92 A;  3L78 A;  4OCF A;  2R37 A;  4FQU A;  3FZA A;  4MF5 A;  3D22 A;  3ISO A;  4MPG A;  3CXG A;  2VCT A;  2B1L A;  3M9J A;  1HD2 A;  2YZU A;  2LNT A;  2JSZ A;  2ZNM A;  4O5Q A;  1U87 A;  4XS1 A;  3PPU A;  1FVJ A;  3DEX A;  4ECB A;  3GTU A;  4IP6 A;  1QXH A;  2LQO A;  2CVD A;  4CW9 A;  2X99 A;  5LNK e;  5A1N B;  2FA8 A;  2V6O A;  3UJ1 A;  1JLW A;  1E2Y A;  1O7U A;  5DCG A;  1OE7 A;  3LG6 A;  2ON5 A;  5IMV A;  2PPT A;  1SK0 A;  2HI7 A;  2L5O A;  3H93 A;  2WGR A;  2VCV A;  1SYR A;  4IP1 A;  4ML1 A;  1SVM A;  10GS A;  1K0C A;  1O6J A;  4F03 A;  1YKA A;  2BMX A;  2XPD A;  1YF0 A;  5G1L A;  2C80 A;  1ZYN A;  3GIX A;  2JSY A;  2H1B A;  3ZZX A;  1YF1 A;  3P90 A;  1URM A;  1HNC A;  2DJ1 A;  4Z2R A;  2CVK A;  3ZMK A;  4HZ2 A;  3ZFL A;  2QGV A;  4YQV A;  4ISD A;  1SK1 A;  1U3A A;  1V58 A;  2YJ7 A;  3CWG A;  1A8L A;  3LEF A;  5ID2 B;  3HCZ A;  1EEM A;  4CDO A;  2PN8 A;  4AKI A;  4OD7 A;  1SVO A;  5IPG A;  1GTB A;  4I97 A;  2WCI A;  3MSZ A;  2LJR A;  2HQT A;  3G9B A;  3Q18 A;  2JAC A;  2MZC A;  3H4K A;  4I2T A;  4I8B A;  3RBT A;  1TU8 A;  3UMA A;  4KW6 A;  3US3 A;  2H1D A;  5H5R A;  1M9A A;  4PGT A;  2DIY A;  3WT2 A;  4JU5 A;  2RM5 A;  2CZ3 A;  1YEP A;  1GTI A;  3RHC A;  3A2X A;  4KGI A;  1O8X A;  1T7P B;  3QAG A;  2VUP A;  1PKW A;  4Q5F A;  1HNA A;  3LYK A;  2H70 A;  5COH A;  1G0T A;  3VI7 A;  1QK8 A;  3IK9 A;  1OC9 A;  3HA9 A;  5JWR B;  2QKE A;  3C1S A;  3ERG A;  1GSU A;  4G2E A;  3KZQ A;  1JHB A;  1O8W A;  3TB2 A;  1JZW A;  5F07 A;  2ZUP A;  4TXO B;  3GL5 A;  1EOG A;  5FWG A;  5DQY A;  2L6D A;  1SKS B;  4MPF A;  3IHQ A;  2GZY A;  4BWQ A;  2CX3 A;  1XWA A;  5JWQ B;  4I5Q A;  3DKS A;  4TR1 B;  1QMV A;  2CV4 A;  2XBI A;  1PN9 A;  4WR4 A;  1TXX A;  4EL1 A;  2R4V A;  2EIR A;  4ZB8 A;  4ILF A;  1NW2 A;  2NTO A;  2B6M A;  4XIH A;  2L57 A;  3IV4 A;  1KEB A;  1TRS A;  2DMM A;  3QMX A;  2OA7 A;  4HU9 A;  1MDJ A;  5CNW A;  4KCA A;  1GSQ A;  5ECS A;  2XHF A;  2PMT A;  4WBR D;  4PX1 A;  2XPE A;  2MMO A;  2PER A;  2HSM B;  1RQM A;  4IKH A;  1ZMA A;  1GNW A;  3ZML A;  1FG4 A;  4ZL8 A;  4E8H A;  3BJ5 A;  3TKP A;  4NHW A;  3KMO A;  4OFN A;  2LUS A;  1Z3E A;  4XRD A;  1AW9 A;  1FVK A;  2OKA A;  14GS A;  1X5D A;  1ILO A;  3QCP A;  1OVN A;  4O5U A;  1C72 A;  1WWJ A;  2O8V B;  20GS A;  1G7O A;  4IBP A;  2BJX A;  3JCM L;  4GWR A;  2CX4 A;  3MAK A;  3QAV A;  2YOI A;  4FYU A;  2O87 A;  5HR2 A;  2WFC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...