1PD21

Crystal structure of hematopoietic prostaglandin d synthase complex with glutathione
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
199
structure length
199
Chain Sequence
MPNYKLLYFNMRGRAEIIRYIFAYLDIKYEDHRIEQADWPKIKPTLPFGKIPVLEVEGLTLHQSLAIARYLTKNTDLAGKTELEQCQVDAVVDTLDDFMSLFPWAEENQDLKERTFNDLLTRQAPHLLKDLDTYLGDKEWFIGNYVTWADFYWDICSTTLLVLKPDLLGIYPRLVSLRNKVQAIPAISAWILKRPQTKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HEMATOPOIETIC PROSTAGLANDIN D SYNTHASE
publication title Cloning and crystal structure of hematopoietic prostaglandin D synthase.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Ligase
total genus 70
structure length 199
sequence length 199
chains with identical sequence 2
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 1998-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
1 PF02798 GST_N Glutathione S-transferase, N-terminal domain
1 PF14497 GST_C_3 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 1pd2102
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1pd2101
3M0FA 4TOPA 2HRKA 1FB6A 2C80A 2J23A 3MSZA 3D21A 4OFNA 4TR1B 3KGKA 5IO0A 2QGVA 4AGSA 1HD2A 3BJ5A 5L71A 3IK9A 2N5BA 4G10A 3KP9A 3V1WA 4L5OA 1O6JA 2GT6A 2IMDA 3FR6A 4IW9A 3G9BA 3KTLA 4ZB8A 2YOIA 5EVOA 1PD21 1PRXA 1MD4A 5CRHA 1FVKA 2OA7A 1VF3A 5CRGA 4CW9A 3GTUB 1T1VA 1S3AA 1M9BA 2H70A 1FVJA 4IP1A 3DEXA 1A8LA 4N0VA 2H72A 2H30A 3DXBA 4TN8A 4ZL8A 3IR4A 4RQXA 4P3YB 2C3NA 2DJKA 4CHSA 2ZUPA 3FZAA 2CQ9A 1TW9A 4GCIA 4EE0A 3SWLA 1ZYEA 1GSDA 4K7OA 2OE1A 3IXRA 1TK0B 3VLNA 5H5QA 3EU3A 1USBA 3NOFA 3F8UA 2B5XA 5G2ZA 1XXUA 2O7KA 1O8XA 2PVOC 3BCKA 2PPTA 4NPBA 4POKA 4ML1A 3PPUA 4PUAA 1R5AA 2JACA 4G19A 3I69A 1U87A 1QGVA 3VK9A 3ZREA 1Z7RA 4E8HA 2FY6A 4F0CA 4TR1A 1GSEA 5F0GA 5IMDA 2PN8A 4I8BA 1TU7A 1X9SB 4ZL9A 3ZVJA 3C1SA 4EXJA 3E9JB 2FD3A 1A0RP 3RAZA 2C3TA 2VL9A 1PL2A 3RHBA 2IIYA 3ERFA 3TDGA 4MF6A 2CVBA 3EINA 2RUFA 4NV2A 3GNJA 1SYXA 5IIZA 3GTUA 2LV3A 1ZYQB 3NIVA 3WT1A 3VURA 5KEJA 1QMVA 4MJCA 8GSSA 5HR3A 1EWXA 1GSFA 1MDIA 4YQMA 4G2EA 2MBTA 4NHWA 4HQSA 3A3TA 4PXOA 14GSA 4WR4A 1VF2A 1THXA 2KHPA 2CX4A 4MZBA 3M8NA 4OMVA 3QD9A 3QMXA 5ECNB 3TUEA 2PERA 1O8WA 3I9V2 2I4AA 5D96A 3ZLPA 2VUPA 3TCOA 2GSQA 3UEMA 2GSRA 2H75A 1DE1A 1A24A 2N5FA 5G5FA 6GSWA 1DUGA 4MH3A 3FZ9A 4RQRA 1SK0A 4GRFA 1DBYA 2B3SA 2NBSA 2X8HA 3ME8A 4K8MA 5JCUA 5B6NA 6GSSA 1GSQA 1VRSD 2L6CA 3C7MA 5G5EA 2HSNB 2KP1A 5CAXA 4V1Ap 1GNWA 2C1YA 3MDKA 3QCPA 4KX4A 1V9WA 3ZFBA 3DMLA 1DE2A 4OO5A 3Q19A 3KMOA 3GKXA 5HFGA 2TRXA 3GSTA 1AUCA 1CQGA 2LEGA 3KP8A 4IS0A 2G0FA 4IVFA 2JZTA 4PQIA 5G1KA 1K0BA 3APQA 1X5CA 4YQUA 2V6OA 4IQ1A 5ECIB 4OWYA 4YQVA 1G7EA 3BCIA 5BMUA 4J57E 1B8XA 1B4PA 2HLSA 4XS6A 2JSYA 2HSYA 4DEJA 1F3BA 1LU4A 4L0WA 3F63A 3A2VA 1Q4JA 18GSA 4WBRD 2K8VA 5GSTA 1QUWA 1M7TA 2GQLA 1J9BA 4FH8A 1HNAA 3KD0A 4MF5A 3GKKA 3ZVJD 1XBSA 4BPYA 3ZMLA 1ERUA 3NZNA 4E8EA 5DQYA 1EZKA 4JBBA 4FYBA 4K0NA 2G2QA 1M99A 3LQ7A 4O5RA 2F8FA 1WIKA 1RW1A 1GNEA 3E0UA 1V58A 1BAYA 3EE2A 4D73B 2B5YA 1T3BA 2I81A 1SKSB 1BEDA 1URMA 1TRUA 1QK8A 1LBKA 1W4VA 2VO4A 2LNSA 3EVIA 2GSSA 3DVWA 2H6YA 4DSSA 1GP1A 3HCZA 2FNOA 2H01A 4F9ZA 4ECJA 1ABAA 5D8IA 4MP4A 1K3OA 3G7IA 3GHAA 5ECRB 1K0DA 2E2GA 5JWQB 2MMOA 1AQWA 2MYGA 1TRSA 2ZCTA 2L4QA 4WF4A 2L4CA 4WEYA 4JZQA 4MCUA 2A2RA 2YV7A 5IMZA 1SK2A 4POBA 3TRPA 3KIJA 4MPFA 3P7XA 3QFBC 5J9CA 2FGXA 2YWIA 2R6KA 1OC9A 5D73A 3IV4A 4AJ6A 4Q5NA 4FYCA 1O81A 2FA8A 4XTSA 3HJOA 3ZZXA 2PUKC 1GUMA 4NAXA 4MLYA 3WGEA 1PMTA 2LRCA 4XRAA 4BWQA 1V98A 5ENUA 1X5DA 1T4YA 1TXXA 4N10A 3TJKA 3TRXA 3HHVA 5JCGA 1TRVA 2WDUA 3TKRA 2H73A 2O85A 2H66A 4TXVA 5D93A 5CP1A 4J56E 22GSA 4G0KA 4PQHA 4EKZA 1X0RA 4JE1A 3FY7A 1HYUA 4JR6A 1N2AA 2LUSA 2FWGA 1V40A 3U6VA 1JZDA 3G7YA 1EOHA 6GSVA 2IWTA 2EIRA 1ERTA 1FOVA 5D9WA 2F51A 4JRRA 2WB9A 2L5LA 2HRNA 1A2LA 1QQ2A 3CSHA 1JZOA 5ID2B 3D22A 1J0FA 2YJHA 2R5GA 1G6WA 1UN2A 4G0IA 3GSSA 1AC1A 4POLA 4BWSA 1X9MB 2V1MA 2DJ3A 1ZGNA 1NHOA 4RI7A 1SD9A 5DJLA 4IKHA 4I97A 2PBJA 1FAAA 4FYUA 3LYPA 1UVZA 5J5NA 1S3CA 3FHKA 3G7JA 2C0GA 3CXGA 4OCFA 1R4WA 3VWUA 5B6MA 3M1GA 2B5EA 3TKSA 5EY6A 1MDJA 7GSSA 2OBIA 4K9ZA 5IOWA 2YZUA 1YZXA 5FT3A 5F05A 1XW6A 1NW2A 4EDZA 2B7JA 1TI1A 4EVMA 2NTOA 3GL5A 5FWGA 2LRNA 2TIRA 2N5AA 2HE3A 3GX0A 4BVYA 2C0DA 3PH9A 5CYYA 3O3TA 5DAKB 4EUYA 5DALB 2DJJA 2REMA 4TXOB 3DGQA 2K6VA 4JEDA 2ZNMA 5ID2A 1S3DA 4ZIJA 4CDOA 1QFNA 3FZ4A 3DIEA 1GTIA 1YKCA 2P0GA 2WGRA 3HZ8A 5IMVA 1F2EA 4KNDA 3LXZA 1GSYA 3QFAC 3ISOA 1K0MA 1YJ6A 2HZEB 3H79A 2C4JA 2V32A 2C8UA 3CTGA 1A2MA 3VWXA 4ZXGA 4NMUA 2Z9SA 3ZIVA 3F3QA 1PKZA 4MH2A 5F07A 1EGRA 1ZL9A 4ZBAA 3EMXA 1CQHA 1TDIA 1F9MA 2CA8A 3DVXA 5B7CA 2RM5A 4GSTA 1IYHA 1XWAA 4BA7A 17GSA 4HQZA 2E2MA 5G1LA 4IQAA 2O89A 1XVWA 3K8NA 4TR4A 2WS2A 5DAKA 1PKWA 1I5GA 5DALA 5LNKe 2GTUA 2LJRA 1GUHA 3CTFA 2GZPA 1G6YA 4KCAA 2AHEA 3QR6A 3N9JA 3GYKA 2CT6A 2J9HA 2O87A 2O8VB 4Q5RA 1XWCA 2X64A 5AIXA 2E0QA 5KN2A 3IAM2 2XHFA 1ST9A 5GAPD 2FHEA 2XPEA 2GS3A 3E3EA 19GSA 3QAWA 3I43A 1X5EA 5CRDA 2HZEA 4WF5A 11GSA 3UVHA 1KEBA 2DIZA 1G7OA 3GURA 1XWGA 3BOAA 1OYJA 2CZ2A 1ZOFA 2HQTA 3DKSA 2P5RA 2VCZA 3C73A 2KOKA 1GL8A 2GLRA 4AJ8A 3HJPA 2VD1A 5CRWA 3TKSC 2AV4A 3WT2A 1WWJA 4ZB6A 1EGOA 5HQPA 4MZWA 5HFIA 3ZYWA 2K18A 4GQFA 1ML6A 2HNLA 2EIQA 4QL9A 1E2YA 3O76A 2IN3A 2M72A 4NHZA 3UL3A 4KSOA 3HXSA 1WPIA 2VAFA 1SU9A 2A2SA 5DVBA 3S9FA 1YEXA 2P5QA 4V2LA 2HXKA 5CREA 1XFLA 4HS1A 4KA0A 2QSIA 2H0IA 3KEBA 3L78A 3IRAA 1U6TA 3J7Yb 1ON4A 4ZILA 2DMMA 4O32A 2H6XA 1A2JA 1XWKA 1OE7A 3R3EA 1C72A 1MDKA 1O85A 4O7HA 3TOUA 2M46A 1BQ7A 2LTKA 2F9SA 6GSYA 2FCHA 3IAS2 2GZYA 5J3RA 2JL4A 10GSA 2FWFA 4PQ1A 5IMCA 3TJGA 1W89A 1IYIA 1RK4A 1XPVA 3FEUA 5D9XA 4OD7A 2B7KA 2X8GA 2QKEA 3F9UA 2JSZA 1KNGA 2YP6A 1BJXA 1UA5A 1EP8A 3HD5A 3H1NA 2DMLA 2UZ8A 2IMIA 1K0OA 2OKAA 4K6XA 1PSQA 4BL7B 1OKTA 2TRCP 4XCSA 2PMTA 1TJDA 5ECMB 4ILFA 4EDYA 2H1GA 1BG5A 3UAPA 2PU9C 3DYRA 1MEKA 4ECIA 2VLVA 2YPMA 3GKNA 3UMAA 5IO2A 1B4QA 2WJUA 4LMWA 4PURA 4QL7A 3F4RA 5C04A 1T7PB 4Z7XA 4X43A 3LXTA 5J4UA 1NHYA 3HVVA 1TTZA 3MNGA 2I9HA 2CX3A 4LMVA 1M2BA 3CRUA 1SK1A 1Z6MA 4H86A 4K7IA 1TOFA 5H5RA 3ME7A 1GSSA 3TB2A 2CZ3A 4TR3A 4WETA 4NXIA 1MD3A 4NWYA 4KAEA 4DSQA 3GIXA 4TW5A 4GXZA 2GT5A 1VF4A 2HSHA 3TJBA 3QAVA 4O92A 3KTBA 2VM2A 2H0HA 1K0NA 1T4ZA 2IL3A 3IK7A 1RQMA 4KDXA 2VM1A 2JZSA 2OBKA 2VCQA 2VLTA 1HNCA 4GF0A 3GX8A 1GTAA 1XW9A 2WZ9A 5D9VA 3VWWA 1M0UA 1EP7A 1FO5A 2V41A 2PWJA 4MJEA 2MMAA 3LWAA 2AUVA 5AISA 4BL7A 4HZ4A 1XZOA 3KJYA 3P90A 2E7PA 2YZHA 5INYA 3DRNA 4ZB9A 4MDCA 4FQUA 1Z6NA 5HFKA 6GSXA 1YDKA 4D73A 1A8YA 3KXOA 1PL1A 5DQSA 1VGLA 4HU9A 1HNBA 5IOXA 2IFQB 3GRXA 2H1DA 1SKWB 4MZCA 3RPNA 4WR5A 4OCEA 3QDNA 4WBJA 4I2TA 5A5KA 2CAQA 4HUAA 3HKRA 2ES7A 2LQQA 4L0UA 1SYRA 1R7HA 3EMPA 2VL2A 1VF1A 4N11A 4YAPA 4IGJA 3RDWA 4JU5A 1PX7A 3UIWA 4USSA 2VLUA 1A23A 2HRAA 2YANA 4ECBA 1XCCA 3ED3A 2DJ2A 4EF0A 5KN3A 1EEJA 3M9KA 1TP9A 3C1RA 3WYWA 3LG6A 5A4VA 1TK8B 3GH9A 2LKUA 3TGZA 4PX1A 4I6XA 2R2JA 2AJQB 1AXDA 3L9VA 3FKFA 1U3IA 3QPMA 4V2NA 4OFTA 1EEMA 3C8EA 4Q5QA 1YKAA 1FG4A 4HOJA 2CAIA 5ELGA 4IHUA 1PX6A 1M2DA 1O7UA 1OVNA 3ZIJA 2H19A 2OJLA 3APSA 2WULA 1GUKA 4KGIA 4ZBDA 4XHMA 1TRWA 2NPBA 1JLWA 4XS1A 1PGTA 2IFQA 5JWRB 3L9SA 2EIOA 2I1UA 4DSRA 4LA1A 2CV4A 1AAZA 1JFUA 2ON7A 2V6KA 4OO4A 4PGTA 2VD0A 2H8LA 1Z7PA 1ZMAA 1B9XC 5HR0A 5H5SA 4HEA2 3HJMA 4ZBBA 2HZFA 3ERWA 16GSA 4KSMA 2FLSA 2C0FA 1GLQA 3MWHA 2NVLA 1LJRA 3HY2A 3P8WA 3HA9A 3EWLA 3F3RA 2RIIA 2ON5A 4IJ3A 3VPTA 2H6ZA 2R3XA 4KDUA 3IC4A 2LS5A 2YJ7A 1OE8A 4MABA 2YCDA 4PTSA 1SJ6A 3KZQA 1F6MC 3I6AA 3TOTA 5JWOB 4AF2A 3LGCA 5DDLA 2IMFA 3BBYA 3IHQA 6GSTA 3W8JA 2H74A 1B9YC 1T8EB 4PNFA 1FB0A 2AYTA 3FW2A 4ULXA 3Q6OA 4X1UA 4XIHA 3IA1A 2RM6A 5IMFA 3A2WA 3US3A 3F6FA 1O73A 1GWCA 1GRXA 3P2AA 2B6MA 1H75A 1PQNA 1BYEA 4HJMA 1YY7A 5A4WA 2V2GA 3VI5A 3KH9A 2IJYA 2LSTA 1K0AA 2CVKA 3HZ4A 1ZCPA 2M80A 3GKMA 1SJIA 5C00A 5DCGA 1X9WB 1JHBA 3UVTA 3F6DA 2GQMA 1XW5A 3N5OA 5ECPB 4TKYA 5ECHB 4TXOA 2VIMA 2C0EA 1M9AA 3KCMA 3A2XA 5ELAA 13GSA 3UOMA 4IN0A 3D6IA 3UARA 3D4MA 2DC5A 4FIWA 2VL2C 2HRFA 2RUEA 2H76A 4V2MA 4GSNA 2MMZA 4DVCA 4GLTA 4FO5A 2PVQA 1K3YA 2JADA 4K0GA 4YAVA 2DIYA 1HQOA 1KTEA 3M9JA 1EV4A 3W8SA 4PNGA 5AGYA 3DWVA 1Z9HA 2LQOA 1TKDB 5G30A 3ZTLA 1MTCA 3GL3A 4RI6A 2AB6A 2JU5A 2H71A 2FUG2 3CYNA 2LRTA 5IMAA 1SKRB 1A0FA 1Z3EA 4IP6A 1ERVA 3IC8A 4N30A 2VCTA 1YEPA 1V2AA 5ECKB 1GLPA 3ZMKA 4WXTA 3GMFA 2BTOT 1FW1A 2IPAA 3H93A 3J7Yk 3IBHA 5EL8A 3PGTA 3EYTA 2B1LA 4G9HA 1GTUA 1AQVA 4F0BA 2OE0A 1R5PA 2HFDA 1F37A 3DD3A 4KH7A 2X8CA 5F8BA 5KN1A 3KMNA 3IPZA 5IQYA 1JZWA 5FHIA 4GWRA 1WOUA 3GH6A 4N0ZA 2C3QA 4ZL7A 2XBIA 1UC7A 2BJXA 5KN0A 1GULA 2AAWA 2H0GA 2VOCA 2HYXA 4HDEA 2F8AA 2K9FA 1FHEA 3QAGA 4EC0A 2H1BA 3VFIA 3KH7A 5HR2A 4F82A 1I9DA 2GDRA 2RLIA 4TRXA 4PUFC 5ECQB 2WRTA 2EC4A 3RHCA 1OC3A 3TKPA 3F4SA 3Q18A 2R37A 2OE3A 4JR4A 3IE3A 1XVQA 2K8SA 4TVEA 3CMIA 2L5OA 2GGTA 3D5JA 4DSSB 4GTUA 1XOAA 5B8AA 2D2ZA 2CVDA 5LD0A 3JCML 3Q74A 2GZZA 2IMKA 4XRDA 3VPQA 3TKSE 1WE0A 1SL0B 2VL3A 4OFMA 3U5RE 4KCEA 4K7NA 4XS4B 3GFKA 5GZZB 3BD2A 1XOBA 1SJZA 4I5QA 1J08A 1Q98A 5GSSA 1YQ1A 2QC7A 4MK3A 4GSSA 3H8QA 4IJIA 5DBQA 4EL1A 2YWMA 3L4NA 5COHA 2VCVA 3VWVA 3ZITA 1OC9B 2A4VA 2GVPA 3ERGA 3C71A 4TR0A 4I2UA 3CBUA 1GSUA 3H4KA 1OC8A 2L57A 5CO3A 2MBSA 1AW9A 1YF1A 5IPHA 5B8BA 3LJRA 2NDOA 3LSZA 4GQCA 1Z5YE 4LL4B 3RBTA 5A4UA 4KUNA 3CSJA 5GAND 3A5WA 4KE3A 4F2IA 4X0XA 1WMJA 5ECSA 2WCIA 2XPDA 4LL1B 4V1Ag 5G31A 2L6DA 2YN1A 3UJ1A 2L59A 3F4TA 3UBKA 2BMXA 3GUSA 5DCHA 1K3LA 2I3YA 4KW6A 1TU8A 1WJKA 1BX9A 3GV1A 3UBLA 3IDVA 2ALBA 3L9UA 1TI3A 2YWNA 1Y6EA 5JCWA 1THOA 4ID0A 1WP0A 3R2QA 2KUCA 4RUVA 2XC2A 3FYGA 4XS4A 4IELA 3L0HA 1U3AA 3O6TA 2XBQA 1WRYA 2LJKA 2X99A 3D4TA 5IM9A 4L8EA 2YNXA 1YF0A 4AJ7A 20GSA 2DSAA 1ZZYA 3ZRDA 5CNWA 4MMMA 1U88A 3ZL5A 1G0TA 3OR5A 1NSWA 1GH2A 3WGXA 3QOUA 5ECLB 3GA4A 2JZRA 3LYKA 1N8JA 3TKQA 4ISDA 5EPFA 2YV9A 3CSIA 3WD6A 2B1KA 5AN1A 3FR3A 1T00A 2HI7A 5ABRA 4MF7A 2HSMB 1DSBA 2IMEA 2R4VA 4LLRA 1SL1B 1AIUA 3M3MA 4HI7A 1OKDA 3EC3A 1ILOA 5E59A 1H4OA 3SBCA 4KF9A 3KM6A 3LORA 4Q5FA 3VI7A 1M2AA 1EV9A 2MZCA 4BVXB 3FRCA 1B48A 5F06A 2DBCA 2DLXA 4MA9A 3WGDA 1K0CA 2FA4A 1JLVA 2HRKB 2MMNA 2H1AA 3TJFA 4KB3A 5AIVA 4G0LA 1Y25A 4BVYB 3W6GA 3TJJA 4ML6A 3IOSA 4F03A 4IBPA 5IPGA 4POMA 4HJ2A 3CRTA 9GSSA 3RPPA 3EU4A 5J41A 1AQXA 4MJBA 2OADA 1SL2B 2LNTA 1SD8A 2WFCA 2KP2A 3EURA 1NM3A 3PINA 3D0ZA 4MJAA 3LFLA 2HT9A 3GN3A 1OAZA 3HVXA 2P31A 1KBNA 1F3AA 1SENA 1ERWA 3ZFLA 12GSA 4L5LA 4K1FA 1QXHA 2DJ0A 2YWOA 4ACSA 1E6BA 4WKWA 2GSTA 4HZ2A 4EO3A 5ECOB 4K2DA 4ECCA 1XIYA 4HU7A 2DJ1A 1V57A 2VCXA 2GQKA 3HYPA 1JZRA 1XWBA 6GSUA 2HSMA 1R26A 2VCWA 5D9TA 1ACVA 3APOA 3FZ5A 1EOGA 3HVSA 3AY8A 5HR1A 4KDYA 1GTBA 4YH2A 5DJMA 2FWEA 3HDCA 2OACA 5LCZA 3TRQA 1TK5B 4MPGA 4J2FA 3PR8A 3LEFA 3F0IA 3FR9A 3FK8A 2PGTA 5E4WA 4BVXA 2KLXA 1PA3A 2F3MA 4NV5A 5J9BA 2LJAA 1PN9A 3MAKA 4QQ7A 2FWHA
chains in the Genus database with same CATH superfamily
3M0FA 4TOPA 2HRKA 1FB6A 2C80A 2J23A 3MSZA 2QA2A 3D21A 4OFNA 4Z2TA 4TR1B 3KGKA 5IO0A 2QGVA 3MYDA 4AGSA 1HD2A 3BJ5A 5L71A 3IK9A 2N5BA 4G10A 3KP9A 3V1WA 4L5OA 1O6JA 2GT6A 2IMDA 3FR6A 4IW9A 3G9BA 3KTLA 4ZB8A 2YOIA 5EVOA 1PD21 1PRXA 1MD4A 5CRHA 1FVKA 2OA7A 1VF3A 5CRGA 4CW9A 3GTUB 1T1VA 1S3AA 1M9BA 2H70A 1FVJA 4IP1A 4AI6A 3DEXA 2H1LA 1A8LA 4N0VA 2H72A 2H30A 5J4VA 2WVZA 3DXBA 4TN8A 4ZL8A 3IR4A 4RQXA 4P3YB 2C3NA 2DJKA 4CHSA 2ZUPA 3FZAA 2CQ9A 1TW9A 4GCIA 4EE0A 3SWLA 1ZYEA 1GSDA 4K7OA 2OE1A 3IXRA 1TK0B 3VLNA 5H5QA 3EU3A 1USBA 3NOFA 3F8UA 2B5XA 5G2ZA 1XXUA 2O7KA 1O8XA 2PVOC 3BCKA 2PPTA 4NPBA 4POKA 4ML1A 3PPUA 4PUAA 1R5AA 2JACA 3I69A 4G19A 1U87A 1QGVA 3VK9A 3ZREA 1Z7RA 4E8HA 1S3RA 2FY6A 4F0CA 4TR1A 1GSEA 5F0GA 5IMDA 2PN8A 4I8BA 1TU7A 1X9SB 4ZL9A 3ZVJA 3C1SA 1ZYNA 4EXJA 3E9JB 2FD3A 1A0RP 3RAZA 2C3TA 2VL9A 1PL2A 3RHBA 2IIYA 3ERFA 3TDGA 4MF6A 2CVBA 3EINA 2RUFA 4NV2A 3GNJA 1SYXA 5IIZA 3GTUA 2LV3A 1ZYQB 3NIVA 3WT1A 3VURA 5KEJA 1QMVA 4MJCA 8GSSA 5HR3A 1EWXA 1GSFA 1MDIA 4YQMA 4G2EA 2MBTA 4NHWA 4HQSA 3A3TA 4PXOA 14GSA 4WR4A 1VF2A 1THXA 2KHPA 2CX4A 4MZBA 3M8NA 4OMVA 3QD9A 3QMXA 5ECNB 3TUEA 2PERA 1O8WA 3I9V2 2I4AA 5D96A 5BMUB 3ZLPA 2VUPA 3TCOA 2GSQA 3UEMA 5J40A 2GSRA 2H75A 1DE1A 1A24A 2N5FA 5G5FA 6GSWA 1DUGA 4MH3A 3FZ9A 4RQRA 1SK0A 4GRFA 1DBYA 2B3SA 2NBSA 2X8HA 3ME8A 4K8MA 5JCUA 5B6NA 6GSSA 1GSQA 4K2XA 4ZB7A 1VRSD 2L6CA 3C7MA 5G5EA 2HSNB 2EFDA 4A5PA 2KP1A 5CAXA 4V1Ap 1GNWA 2C1YA 3MDKA 3QCPA 4KX4A 1V9WA 3ZFBA 3DMLA 1DE2A 4OO5A 3Q19A 3KMOA 3GKXA 3FMWA 5HFGA 2TRXA 3GSTA 1AUCA 1CQGA 2LEGA 3KP8A 4IS0A 2G0FA 4IVFA 2JZTA 4PQIA 5G1KA 1K0BA 3APQA 1X5CA 4YQUA 2V6OA 4IQ1A 4K5SA 5ECIB 4OWYA 4YQVA 1G7EA 3BCIA 2WW1A 5BMUA 4J57E 1B8XA 2O5VA 1B4PA 2HLSA 4XS6A 2JSYA 2HSYA 4DEJA 1F3BA 1LU4A 4L0WA 3F63A 3A2VA 1Q4JA 18GSA 4WBRD 2K8VA 5GSTA 1QUWA 1M7TA 2GQLA 1J9BA 4FH8A 1HNAA 3KD0A 4MF5A 3GKKA 3ZVJD 1XBSA 4BPYA 3ZMLA 1ERUA 3NZNA 4E8EA 5DQYA 1EZKA 4JBBA 4FYBA 4K0NA 2G2QA 1M99A 3LQ7A 4O5RA 2F8FA 2HSNA 1WIKA 1RW1A 1GNEA 3E0UA 1V58A 1BAYA 3EE2A 4D73B 2B5YA 1T3BA 2I81A 1SKSB 2WVXB 1BEDA 1URMA 1TRUA 1QK8A 1LBKA 1W4VA 2VO4A 2LNSA 3EVIA 2GSSA 3DVWA 2H6YA 4ICYA 4DSSA 1GP1A 3HCZA 2FNOA 2H01A 4F9ZA 4ECJA 1ABAA 5D8IA 4MP4A 1K3OA 3G7IA 3GHAA 5ECRB 1K0DA 3HMJG 2E2GA 5JWQB 2MMOA 1AQWA 2MYGA 1TRSA 2ZCTA 2L4QA 4WF4A 2L4CA 4WEYA 4JZQA 4MCUA 2A2RA 2YV7A 5IMZA 1SK2A 4POBA 3TRPA 4MPFA 3KIJA 3P7XA 3QFBC 5J9CA 2FGXA 2YWIA 2R6KA 1OC9A 5D73A 3IV4A 4AJ6A 4Q5NA 4FYCA 1O81A 2FA8A 4YKGA 4XTSA 3HJOA 3ZZXA 2PUKC 1GUMA 4NAXA 4MLYA 3WGEA 1PMTA 2LRCA 4XRAA 4BWQA 2DKIA 1V98A 5ENUA 1X5DA 1T4YA 1TXXA 4N10A 3TJKA 3TRXA 3HHVA 5JCGA 1TRVA 2WDUA 3TKRA 2H73A 2WVXA 2O85A 2H66A 4TXVA 5D93A 5A34B 5CP1A 4J56E 22GSA 4G0KA 4PQHA 4EKZA 1X0RA 4JE1A 3FY7A 1HYUA 4JR6A 1N2AA 5KOXA 2LUSA 2FWGA 1V40A 3U6VA 1JZDA 2VKZG 3G7YA 1EOHA 6GSVA 2IWTA 2EIRA 1ERTA 2DKHA 1FOVA 5D9WA 2F51A 4JRRA 2WB9A 2L5LA 2HRNA 1A2LA 1QQ2A 3CSHA 1JZOA 5ID2B 3D22A 1J0FA 2YJHA 2R5GA 1G6WA 1UN2A 4G0IA 3GSSA 1AC1A 4POLA 4BWSA 3EPTA 1X9MB 2V1MA 2DJ3A 1ZGNA 1NHOA 4RI7A 1SD9A 5DJLA 4IKHA 4I97A 2PBJA 1FAAA 4FYUA 3LYPA 1UVZA 5J5NA 5BRTA 1S3CA 3FHKA 3G7JA 2C0GA 3CXGA 4OCFA 1R4WA 3VWUA 2R0PA 5B6MA 3M1GA 2B5EA 3TKSA 1Y1UA 5EY6A 1MDJA 7GSSA 2OBIA 4K9ZA 5IOWA 2YZUA 1YZXA 5FT3A 5F05A 1XW6A 1NW2A 4EDZA 2B7JA 1TI1A 4HSCX 4EVMA 2NTOA 3GL5A 5FWGA 2LRNA 2TIRA 2N5AA 2HE3A 3GX0A 4BVYA 2C0DA 3PH9A 5CYYA 3O3TA 5DAKB 4EUYA 5DALB 2X49A 2DJJA 2REMA 4TXOB 3DGQA 2K6VA 4JEDA 2ZNMA 5ID2A 1S3DA 4ZIJA 4CDOA 1QFNA 3FZ4A 3DIEA 3RFRC 1GTIA 1YKCA 2P0GA 2WGRA 3HZ8A 5IMVA 1F2EA 4KNDA 3LXZA 1GSYA 3QFAC 3ISOA 1K0MA 1YJ6A 2HZEB 3H79A 2C4JA 2V32A 2C8UA 3CTGA 4N3ZA 1A2MA 3VWXA 4ZXGA 4NMUA 2Z9SA 3ZIVA 3F3QA 1PKZA 4MH2A 5F07A 1EGRA 1ZL9A 4ZBAA 3EMXA 1CQHA 1TDIA 1F9MA 1PFOA 2CA8A 1M3JA 3DVXA 5B7CA 2QA1A 2RM5A 4GSTA 1IYHA 1XWAA 1BG1A 4BA7A 2OT3A 17GSA 4HQZA 2E2MA 5G1LA 4K5RA 4IQAA 4PI0C 4Z2RA 2O89A 1XVWA 3K8NA 4TR4A 2WS2A 5DAKA 1PKWA 1I5GA 5A1NB 5DALA 5LNKe 2GTUA 2LJRA 1GUHA 3CTFA 2GZPA 1G6YA 2WW2A 4KCAA 2AHEA 3QR6A 3N9JA 3GYKA 2CT6A 2J9HA 2O87A 2O8VB 4Q5RA 1XWCA 2X64A 5AIXA 2E0QA 5KN2A 5A5HB 3IAM2 2XHFA 1ST9A 5GAPD 2FHEA 2XPEA 2GS3A 3E3EA 19GSA 3QAWA 3I43A 1X5EA 5CRDA 2HZEA 4WF5A 11GSA 3UVHA 1KEBA 2DIZA 1G7OA 3GURA 1XWGA 3BOAA 1OYJA 2CZ2A 1ZOFA 2HQTA 3DKSA 2P5RA 2VCZA 3C73A 2KOKA 1GL8A 2GLRA 4AJ8A 3HJPA 2VD1A 5CRWA 3TKSC 2AV4A 3WT2A 1WWJA 4ZB6A 1EGOA 5HQPA 4MZWA 5HFIA 3A5IA 3ZYWA 2K18A 4GQFA 1ML6A 2HNLA 2EIQA 4QL9A 4PI2C 1E2YA 3O76A 2IN3A 2M72A 4NHZA 3UL3A 4KSOA 3HXSA 1WPIA 2VAFA 1SU9A 2A2SA 5A1NA 5DVBA 3S9FA 5KOWA 1YEXA 2P5QA 4V2LA 2HXKA 5CREA 1XFLA 4HS1A 4KA0A 2QSIA 2H0IA 3KEBA 3L78A 3IRAA 1U6TA 3J7Yb 1ON4A 4ZILA 4MNNA 2DMMA 4O32A 5A5HA 2H6XA 1A2JA 1XWKA 1OE7A 3R3EA 1C72A 1MDKA 1O85A 4O7HA 3TOUA 2M46A 1BQ7A 2LTKA 2F9SA 6GSYA 2FCHA 3IAS2 2GZYA 5J3RA 2JL4A 10GSA 2FWFA 4PQ1A 5IMCA 3TJGA 1W89A 1IYIA 1TXUA 1RK4A 1XPVA 3FEUA 5D9XA 4OD7A 2B7KA 4QMKA 2X8GA 1YEWC 2QKEA 1ZYPA 3F9UA 2JSZA 1KNGA 2YP6A 1BJXA 1UA5A 1EP8A 3HD5A 3H1NA 2DMLA 2UZ8A 2IMIA 1K0OA 4YKFA 2OKAA 4K6XA 1PSQA 4BL7B 4EIPA 2O36A 1OKTA 2TRCP 4XCSA 2PMTA 1TJDA 5ECMB 4ILFA 4EDYA 2H1GA 1BG5A 3UAPA 2PU9C 3DYRA 1MEKA 4ECIA 2VLVA 2YPMA 3GKNA 3UMAA 5IO2A 1B4QA 2WJUA 4AKGA 4LMWA 4PURA 4QL7A 3F4RA 5C04A 1T7PB 4Z7XA 4X43A 3LXTA 5J4UA 1NHYA 3HVVA 1TTZA 3MNGA 2I9HA 2CX3A 4LMVA 1M2BA 3CRUA 1SK1A 1Z6MA 4H86A 4K7IA 1TOFA 5H5RA 3ME7A 1GSSA 3TB2A 2WZSA 2CZ3A 4TR3A 4WETA 4FXYP 4NXIA 1MD3A 4NWYA 2O3EA 4KAEA 4DSQA 3GIXA 4TW5A 4GXZA 3LW9A 2GT5A 1VF4A 2HSHA 3TJBA 3QAVA 4O92A 3KTBA 2VM2A 2H0HA 1K0NA 1T4ZA 3MIXA 2IL3A 3IK7A 1RQMA 4KDXA 2VM1A 2JZSA 4BIKA 2OBKA 2VCQA 2VLTA 1HNCA 4GF0A 3GX8A 1GTAA 1XW9A 2WZ9A 5D9VA 3VWWA 1M0UA 1EP7A 1FO5A 2V41A 2PWJA 4MJEA 2MMAA 3LWAA 2AUVA 5AISA 3TU3B 4BL7A 4HZ4A 1XZOA 3KJYA 3P90A 2E7PA 2YZHA 5INYA 3DRNA 4ZB9A 4Z2UA 4MDCA 4FQUA 4CY6A 1Z6NA 5HFKA 6GSXA 1YDKA 4D73A 1A8YA 3KXOA 3CQFA 1PL1A 5DQSA 1VGLA 4HU9A 1HNBA 5IOXA 2IFQB 3GRXA 2H1DA 1SKWB 4MZCA 3RPNA 4WR5A 4OCEA 3QDNA 4WBJA 4I2TA 5A5KA 2CAQA 4HUAA 3HKRA 2ES7A 2LQQA 4L0UA 1SYRA 1R7HA 3EMPA 2VL2A 1VF1A 4N11A 4YAPA 4IGJA 3RDWA 4JU5A 1PX7A 3UIWA 4USSA 1S4BP 1SVMA 2VLUA 1A23A 2HRAA 2YANA 4ECBA 1XCCA 3ED3A 2DJ2A 4EF0A 5KN3A 1EEJA 3M9KA 1TP9A 3C1RA 3WYWA 3LG6A 5A4VA 1TK8B 3GH9A 2LKUA 4W66A 3TGZA 4PX1A 4I6XA 2R2JA 2AJQB 1AXDA 3HVNA 3L9VA 3FKFA 1U3IA 3QPMA 4V2NA 4OFTA 1EEMA 3C8EA 1I1IP 4Q5QA 1YKAA 1FG4A 4O5UA 4HOJA 2CAIA 5ELGA 4IHUA 1PX6A 1M2DA 1O7UA 1OVNA 3ZIJA 4AKXB 2H19A 2OJLA 3APSA 2WULA 1GUKA 4KGIA 4ZBDA 4XHMA 1TRWA 1YVLA 5A34A 2NPBA 1JLWA 4XS1A 1PGTA 2IFQA 5JWRB 3L9SA 2EIOA 2I1UA 4DSRA 2X4AA 2CV4A 4LA1A 1AAZA 1JFUA 2ON7A 2V6KA 4OO4A 4PGTA 2VD0A 2H8LA 1Z7PA 2UV8G 1ZMAA 4PHZC 1B9XC 5HR0A 5H5SA 4O5QA 1FOHA 4HEA2 3HJMA 4ZBBA 2HZFA 3ERWA 16GSA 4KSMA 2FLSA 2C0FA 1GLQA 3MWHA 2NVLA 1LJRA 3HY2A 3P8WA 3HA9A 3EWLA 3F3RA 2RIIA 2ON5A 4IJ3A 3VPTA 5J4YA 2H6ZA 2R3XA 4KDUA 3IC4A 2LS5A 2YJ7A 1OE8A 4MABA 2YCDA 4PTSA 1SJ6A 3KZQA 1F6MC 3I6AA 3TOTA 5JWOB 4AF2A 3LGCA 5DDLA 2IMFA 3BBYA 3IHQA 4EIQA 6GSTA 3W8JA 2H74A 1B9YC 1T8EB 4PNFA 1FB0A 2AYTA 3FW2A 4ULXA 3Q6OA 4X1UA 4XIHA 3IA1A 2RM6A 5IMFA 3A2WA 3US3A 3F6FA 1O73A 1GWCA 1GRXA 3P2AA 2B6MA 1H75A 1PQNA 1BYEA 4HJMA 1YY7A 5A4WA 2V2GA 3VI5A 3KH9A 2IJYA 2LSTA 1K0AA 2CVKA 3HZ4A 1ZCPA 2M80A 3GKMA 1SJIA 5C00A 5DCGA 1BF5A 1X9WB 1JHBA 3UVTA 2EFEA 3F6DA 2GQMA 1XW5A 3N5OA 5ECPB 4TKYA 5ECHB 4TXOA 2VIMA 2C0EA 1M9AA 3KCMA 3A2XA 5ELAA 13GSA 3UOMA 4IN0A 3D6IA 3UARA 3D4MA 2DC5A 4FIWA 2VL2C 2HRFA 2RUEA 2H76A 4V2MA 4GSNA 2MMZA 4DVCA 4GLTA 4FO5A 2PVQA 1K3YA 2JADA 4K0GA 4YAVA 2DIYA 1HQOA 1KTEA 3M9JA 1EV4A 3W8SA 4PNGA 5AGYA 2WVYA 3DWVA 1Z9HA 2LQOA 1TKDB 5G30A 3ZTLA 1MTCA 3GL3A 4RI6A 2AB6A 2JU5A 2H71A 2FUG2 4GDFA 3CYNA 2LRTA 5IMAA 1SKRB 1A0FA 1Z3EA 4IP6A 1ERVA 3IC8A 4N30A 2VCTA 1YEPA 1V2AA 5ECKB 1GLPA 3ZMKA 4WXTA 3GMFA 2BTOT 1FW1A 2IPAA 3H93A 3J7Yk 3IBHA 5EL8A 3PGTA 3EYTA 2B1LA 4G9HA 1GTUA 1AQVA 4F0BA 2OE0A 1R5PA 2HFDA 1F37A 3DD3A 3CWGA 4KH7A 2X8CA 5F8BA 5KN1A 3KMNA 3IPZA 5IQYA 2WW3A 1JZWA 2WW0A 5FHIA 4GWRA 1WOUA 3GH6A 3CHXC 4N0ZA 2C3QA 4ZL7A 2XBIA 1UC7A 2BJXA 5KN0A 1GULA 2AAWA 2H0GA 2VOCA 4AKHA 2HYXA 4HDEA 2F8AA 2K9FA 1FHEA 3QAGA 4EC0A 2H1BA 3VFIA 3KH7A 5HR2A 4F82A 1I9DA 2GDRA 2RLIA 4TRXA 4PUFC 5ECQB 2WRTA 2EC4A 3RHCA 1OC3A 3TKPA 3F4SA 3Q18A 2R37A 1N25A 2OE3A 4JR4A 1M3IA 3IE3A 1XVQA 2K8SA 4TVEA 3CMIA 2L5OA 2GGTA 3D5JA 4DSSB 4GTUA 1XOAA 5B8AA 2D2ZA 2CVDA 5LD0A 3JCML 4G01A 3Q74A 2GZZA 2IMKA 4XRDA 3VPQA 2A2PA 3TKSE 1WE0A 1SL0B 2VL3A 4OFMA 3U5RE 4KCEA 4K7NA 4XS4B 3GFKA 5GZZB 3BD2A 1XOBA 1SJZA 4I5QA 1J08A 1Q98A 5GSSA 1YQ1A 2QC7A 4MK3A 4GSSA 3H8QA 4IJIA 5DBQA 4EL1A 2YWMA 3L4NA 5COHA 2VCVA 3VWVA 3ZITA 1OC9B 2A4VA 2GVPA 3ERGA 3C71A 4TR0A 4E68A 4I2UA 3CBUA 4AKIA 1GSUA 3H4KA 1OC8A 2L57A 5CO3A 2MBSA 1AW9A 1YF1A 5IPHA 5B8BA 3LJRA 2NDOA 3LSZA 4GQCA 3RGBC 1Z5YE 4LL4B 3RBTA 5A4UA 4KUNA 3CSJA 1XG8A 5GAND 3A5WA 4KE3A 4F2IA 4X0XA 1WMJA 5ECSA 2WCIA 2XPDA 4LL1B 4V1Ag 5G31A 4CY8A 2L6DA 2YN1A 3UJ1A 2L59A 3F4TA 3UBKA 2BMXA 3GUSA 5DCHA 1K3LA 2I3YA 4KW6A 1SVOA 1TU8A 1WJKA 1BX9A 3GV1A 3UBLA 3IDVA 2ALBA 3L9UA 1TI3A 2YWNA 1Y6EA 2EFHA 5JCWA 1THOA 4ID0A 1WP0A 3R2QA 2R0CA 2KUCA 4RUVA 2XC2A 3FYGA 4XS4A 4IELA 3L0HA 1U3AA 3O6TA 2XBQA 1WRYA 2LJKA 2X99A 3D4TA 5IM9A 4L8EA 2YNXA 1YF0A 4AJ7A 4X4JA 20GSA 2DSAA 1ZZYA 3ZRDA 5CNWA 4MMMA 1U88A 3ZL5A 1G0TA 3OR5A 1NSWA 1GH2A 3WGXA 3QOUA 5ECLB 3GA4A 2JZRA 3LYKA 1N8JA 3TKQA 4ISDA 5EPFA 2YV9A 3CSIA 3WD6A 2B1KA 1SVLA 5AN1A 3FR3A 1T00A 2HI7A 5ABRA 4MF7A 2HSMB 1DSBA 2IMEA 2R4VA 4LLRA 1SL1B 1AIUA 3IHGA 3M3MA 4HI7A 3EC3A 1OKDA 1ILOA 5E59A 1H4OA 3SBCA 4KF9A 3KM6A 2A4HA 3LORA 4Q5FA 3VI7A 1M2AA 1EV9A 2MZCA 4BVXB 3FRCA 1B48A 5F06A 2DBCA 2DLXA 4MA9A 3WGDA 1K0CA 2FA4A 1JLVA 2HRKB 2MMNA 2H1AA 3TJFA 4KB3A 5AIVA 4G0LA 1Y25A 4BVYB 3W6GA 3TJJA 4ML6A 3IOSA 4F03A 4IBPA 5IPGA 4POMA 4HJ2A 3CRTA 9GSSA 3RPPA 3EU4A 5J41A 1AQXA 4MJBA 2EFCA 2OADA 1SL2B 2LNTA 1SD8A 2WFCA 2KP2A 3EURA 1NM3A 3PINA 3D0ZA 4MJAA 3LFLA 2HT9A 3GN3A 1OAZA 3HVXA 2P31A 1KBNA 1F3AA 1SENA 1ERWA 3ZFLA 12GSA 4L5LA 4K1FA 1QXHA 2DJ0A 2YWOA 4ACSA 1E6BA 4WKWA 2GSTA 4HZ2A 4EO3A 5ECOB 4K2DA 4ECCA 1XIYA 4HU7A 2DJ1A 1V57A 2VCXA 2GQKA 1PN0A 3HYPA 1JZRA 1XWBA 6GSUA 2HSMA 1R26A 2VCWA 5D9TA 1ACVA 3APOA 3FZ5A 1EOGA 3HVSA 3AY8A 5HR1A 4KDYA 1GTBA 3HDCA 4YH2A 5DJMA 5J47A 2FWEA 2OACA 5LCZA 3TRQA 1TK5B 4MPGA 4J2FA 3PR8A 2R0GA 3LEFA 3F0IA 3FR9A 3FK8A 2PGTA 5E4WA 4BVXA 2KLXA 1PA3A 2F3MA 4NV5A 5J9BA 2LJAA 1PN9A 3MAKA 4QQ7A 2FWHA
chains in the Genus database with same CATH topology
3M0FA 4TOPA 2HRKA 1FB6A 2C80A 2J23A 3MSZA 2QA2A 3D21A 4OFNA 4Z2TA 4TR1B 3KGKA 5IO0A 2QGVA 3MYDA 4AGSA 1HD2A 3BJ5A 5L71A 3IK9A 2N5BA 4G10A 3KP9A 3V1WA 4L5OA 1O6JA 2GT6A 2IMDA 3FR6A 4IW9A 3G9BA 3KTLA 4ZB8A 2YOIA 5EVOA 1PD21 1PRXA 1MD4A 5CRHA 1FVKA 2OA7A 1VF3A 5CRGA 4CW9A 3GTUB 1T1VA 1S3AA 1M9BA 2H70A 1FVJA 4IP1A 4AI6A 3DEXA 2H1LA 1A8LA 4N0VA 2H72A 2H30A 5J4VA 3DXBA 4TN8A 4ZL8A 3IR4A 4RQXA 4P3YB 2C3NA 2DJKA 4CHSA 2ZUPA 3FZAA 2CQ9A 1TW9A 4GCIA 4EE0A 3SWLA 1ZYEA 1GSDA 4K7OA 2OE1A 3IXRA 1TK0B 3VLNA 5H5QA 3EU3A 1USBA 3NOFA 3F8UA 2B5XA 5G2ZA 1XXUA 2O7KA 1O8XA 2PVOC 3BCKA 2PPTA 4NPBA 4POKA 4ML1A 3PPUA 4PUAA 1R5AA 2JACA 3I69A 4G19A 1U87A 1QGVA 3VK9A 3ZREA 1Z7RA 4E8HA 2FY6A 4F0CA 4TR1A 1GSEA 5F0GA 5IMDA 2PN8A 4I8BA 1TU7A 1X9SB 4ZL9A 3ZVJA 3C1SA 1ZYNA 4EXJA 3E9JB 2FD3A 1A0RP 3RAZA 2C3TA 2VL9A 1PL2A 3RHBA 2IIYA 3ERFA 3TDGA 4MF6A 2CVBA 3EINA 2RUFA 4NV2A 3GNJA 1SYXA 5IIZA 3GTUA 2LV3A 1ZYQB 3NIVA 3WT1A 3VURA 5KEJA 1QMVA 4MJCA 8GSSA 5HR3A 1EWXA 1GSFA 1MDIA 4YQMA 4G2EA 2MBTA 4NHWA 4HQSA 3A3TA 4PXOA 14GSA 4WR4A 1VF2A 1THXA 2KHPA 2CX4A 4MZBA 3M8NA 4OMVA 3QD9A 3QMXA 5ECNB 3TUEA 2PERA 1O8WA 3I9V2 2I4AA 5D96A 5BMUB 3ZLPA 2VUPA 3TCOA 2GSQA 3UEMA 5J40A 2GSRA 2H75A 1DE1A 1A24A 2N5FA 5G5FA 6GSWA 1DUGA 4MH3A 3FZ9A 4RQRA 1SK0A 4GRFA 1DBYA 2B3SA 2NBSA 2X8HA 3ME8A 4K8MA 5JCUA 5B6NA 6GSSA 1GSQA 4K2XA 4ZB7A 1VRSD 2L6CA 3C7MA 5G5EA 2HSNB 2EFDA 4A5PA 2KP1A 5CAXA 4V1Ap 1GNWA 2C1YA 3MDKA 3QCPA 4KX4A 1V9WA 3ZFBA 3DMLA 1DE2A 4OO5A 3Q19A 3KMOA 3GKXA 3FMWA 5HFGA 2TRXA 3GSTA 1AUCA 1CQGA 2LEGA 3KP8A 4IS0A 2G0FA 4IVFA 2JZTA 4PQIA 5G1KA 1K0BA 3APQA 1X5CA 4YQUA 2V6OA 4IQ1A 4K5SA 5ECIB 4OWYA 4YQVA 1G7EA 3BCIA 5BMUA 4J57E 1B8XA 2O5VA 1B4PA 2HLSA 4XS6A 2JSYA 2HSYA 4DEJA 1F3BA 1LU4A 4L0WA 3F63A 3A2VA 1Q4JA 18GSA 4WBRD 2K8VA 5GSTA 1QUWA 1M7TA 2GQLA 1J9BA 4FH8A 1HNAA 3KD0A 4MF5A 3GKKA 3ZVJD 1XBSA 4BPYA 3ZMLA 1ERUA 3NZNA 4E8EA 5DQYA 1EZKA 4JBBA 4FYBA 4K0NA 2G2QA 1M99A 3LQ7A 4O5RA 2F8FA 2HSNA 1WIKA 1RW1A 1GNEA 3E0UA 1V58A 1BAYA 3EE2A 4D73B 2B5YA 1T3BA 2I81A 1SKSB 1BEDA 1URMA 1TRUA 1QK8A 1LBKA 1W4VA 2VO4A 2LNSA 3EVIA 2GSSA 3DVWA 2H6YA 4ICYA 4DSSA 1GP1A 3HCZA 2FNOA 2H01A 4F9ZA 4ECJA 1ABAA 5D8IA 4MP4A 1K3OA 3G7IA 3GHAA 5ECRB 1K0DA 3HMJG 2E2GA 5JWQB 2MMOA 1AQWA 2MYGA 1TRSA 2ZCTA 2L4QA 4WF4A 2L4CA 4WEYA 4JZQA 4MCUA 2A2RA 2YV7A 5IMZA 1SK2A 4POBA 3TRPA 3KIJA 4MPFA 3P7XA 3QFBC 5J9CA 2FGXA 2YWIA 2R6KA 1OC9A 5D73A 3IV4A 4AJ6A 4Q5NA 4FYCA 1O81A 2FA8A 4YKGA 4XTSA 3HJOA 3ZZXA 2PUKC 1GUMA 4NAXA 4MLYA 3WGEA 1PMTA 2LRCA 4XRAA 4BWQA 2DKIA 1V98A 5ENUA 1X5DA 1T4YA 1TXXA 4N10A 3TJKA 3TRXA 3HHVA 5JCGA 1TRVA 2WDUA 3TKRA 2H73A 2O85A 2H66A 4TXVA 5D93A 5A34B 5CP1A 4J56E 22GSA 4G0KA 4PQHA 4EKZA 1X0RA 4JE1A 3FY7A 1HYUA 4JR6A 1N2AA 5KOXA 2LUSA 2FWGA 1V40A 3U6VA 1JZDA 2VKZG 3G7YA 1EOHA 6GSVA 2IWTA 2EIRA 1ERTA 2DKHA 1FOVA 5D9WA 2F51A 4JRRA 2WB9A 2L5LA 2HRNA 1A2LA 1QQ2A 3CSHA 1JZOA 5ID2B 3D22A 1J0FA 2YJHA 2R5GA 1G6WA 1UN2A 4G0IA 3GSSA 1AC1A 4POLA 4BWSA 3EPTA 1X9MB 2V1MA 2DJ3A 1ZGNA 1NHOA 4RI7A 1SD9A 5DJLA 4IKHA 4I97A 2PBJA 1FAAA 4FYUA 3LYPA 1UVZA 5J5NA 5BRTA 1S3CA 3FHKA 3G7JA 2C0GA 3CXGA 4OCFA 1R4WA 3VWUA 2R0PA 5B6MA 3M1GA 2B5EA 3TKSA 1Y1UA 5EY6A 1MDJA 7GSSA 2OBIA 4K9ZA 5IOWA 2YZUA 1YZXA 5FT3A 5F05A 1XW6A 1NW2A 4EDZA 2B7JA 1TI1A 4EVMA 2NTOA 3GL5A 5FWGA 2LRNA 2TIRA 2N5AA 2HE3A 3GX0A 4BVYA 2C0DA 3PH9A 5CYYA 3O3TA 5DAKB 4EUYA 5DALB 2X49A 2DJJA 2REMA 4TXOB 3DGQA 2K6VA 4JEDA 2ZNMA 5ID2A 1S3DA 4ZIJA 4CDOA 1QFNA 3FZ4A 3DIEA 1GTIA 1YKCA 2P0GA 2WGRA 3HZ8A 5IMVA 1F2EA 4KNDA 3LXZA 1GSYA 3QFAC 3ISOA 1K0MA 1YJ6A 2HZEB 3H79A 2C4JA 2V32A 2C8UA 3CTGA 4N3ZA 1A2MA 3VWXA 4ZXGA 4NMUA 2Z9SA 3ZIVA 3F3QA 1PKZA 4MH2A 5F07A 1EGRA 1ZL9A 4ZBAA 3EMXA 1CQHA 1TDIA 1F9MA 2CA8A 3DVXA 5B7CA 2QA1A 2RM5A 4GSTA 1IYHA 1XWAA 1BG1A 4BA7A 2OT3A 17GSA 4HQZA 2E2MA 5G1LA 4K5RA 4IQAA 4Z2RA 2O89A 1XVWA 3K8NA 4TR4A 2WS2A 5DAKA 1PKWA 1I5GA 5A1NB 5DALA 5LNKe 2GTUA 2LJRA 1GUHA 3CTFA 2GZPA 1G6YA 4KCAA 2AHEA 3QR6A 3N9JA 3GYKA 2CT6A 2J9HA 2O87A 2O8VB 4Q5RA 1XWCA 2X64A 5AIXA 2E0QA 5KN2A 5A5HB 3IAM2 2XHFA 1ST9A 5GAPD 2FHEA 2XPEA 2GS3A 3E3EA 19GSA 3QAWA 3I43A 1X5EA 5CRDA 2HZEA 4WF5A 11GSA 3UVHA 1KEBA 2DIZA 1G7OA 3GURA 1XWGA 3BOAA 1OYJA 2CZ2A 1ZOFA 2HQTA 3DKSA 2P5RA 2VCZA 3C73A 2KOKA 1GL8A 2GLRA 4AJ8A 3HJPA 2VD1A 5CRWA 3TKSC 2AV4A 3WT2A 1WWJA 4ZB6A 1EGOA 5HQPA 4MZWA 5HFIA 3A5IA 3ZYWA 2K18A 4GQFA 1ML6A 2HNLA 2EIQA 4QL9A 1E2YA 3O76A 2IN3A 2M72A 4NHZA 3UL3A 4KSOA 3HXSA 1WPIA 2VAFA 1SU9A 2A2SA 5A1NA 5DVBA 3S9FA 5KOWA 1YEXA 2P5QA 4V2LA 2HXKA 5CREA 1XFLA 4HS1A 4KA0A 2QSIA 2H0IA 3KEBA 3L78A 3IRAA 1U6TA 3J7Yb 1ON4A 4ZILA 4MNNA 2DMMA 4O32A 5A5HA 2H6XA 1A2JA 1XWKA 1OE7A 3R3EA 1C72A 1MDKA 1O85A 4O7HA 3TOUA 2M46A 1BQ7A 2LTKA 2F9SA 6GSYA 2FCHA 3IAS2 2GZYA 5J3RA 2JL4A 10GSA 2FWFA 4PQ1A 5IMCA 3TJGA 1W89A 1IYIA 1TXUA 1RK4A 1XPVA 3FEUA 5D9XA 4OD7A 2B7KA 4QMKA 2X8GA 2QKEA 1ZYPA 3F9UA 2JSZA 1KNGA 2YP6A 1BJXA 1UA5A 1EP8A 3HD5A 3H1NA 2DMLA 2UZ8A 2IMIA 1K0OA 4YKFA 2OKAA 4K6XA 1PSQA 4BL7B 4EIPA 1OKTA 2TRCP 4XCSA 2PMTA 1TJDA 5ECMB 4ILFA 4EDYA 2H1GA 1BG5A 3UAPA 2PU9C 3DYRA 1MEKA 4ECIA 2VLVA 2YPMA 3GKNA 3UMAA 5IO2A 1B4QA 2WJUA 4AKGA 4LMWA 4PURA 4QL7A 3F4RA 5C04A 1T7PB 4Z7XA 4X43A 3LXTA 5J4UA 1NHYA 3HVVA 1TTZA 3MNGA 2I9HA 2CX3A 4LMVA 1M2BA 3CRUA 1SK1A 1Z6MA 4H86A 4K7IA 1TOFA 5H5RA 3ME7A 1GSSA 3TB2A 2CZ3A 4TR3A 4WETA 4NXIA 1MD3A 4NWYA 4KAEA 4DSQA 3GIXA 4TW5A 4GXZA 3LW9A 2GT5A 1VF4A 2HSHA 3TJBA 3QAVA 4O92A 3KTBA 2VM2A 2H0HA 1K0NA 1T4ZA 3MIXA 2IL3A 3IK7A 1RQMA 4KDXA 2VM1A 2JZSA 2OBKA 2VCQA 2VLTA 1HNCA 4GF0A 3GX8A 1GTAA 1XW9A 2WZ9A 5D9VA 3VWWA 1M0UA 1EP7A 1FO5A 2V41A 2PWJA 4MJEA 2MMAA 3LWAA 2AUVA 5AISA 3TU3B 4BL7A 4HZ4A 1XZOA 3KJYA 3P90A 2E7PA 2YZHA 5INYA 3DRNA 4ZB9A 4Z2UA 4MDCA 4FQUA 4CY6A 1Z6NA 5HFKA 6GSXA 1YDKA 4D73A 1A8YA 3KXOA 1PL1A 5DQSA 1VGLA 4HU9A 1HNBA 5IOXA 2IFQB 3GRXA 2H1DA 1SKWB 4MZCA 3RPNA 4WR5A 4OCEA 3QDNA 4WBJA 4I2TA 5A5KA 2CAQA 4HUAA 3HKRA 2ES7A 2LQQA 4L0UA 1SYRA 1R7HA 3EMPA 2VL2A 1VF1A 4N11A 4YAPA 4IGJA 3RDWA 4JU5A 1PX7A 3UIWA 4USSA 1SVMA 2VLUA 1A23A 2HRAA 2YANA 4ECBA 1XCCA 3ED3A 2DJ2A 4EF0A 5KN3A 1EEJA 3M9KA 1TP9A 3C1RA 3WYWA 3LG6A 5A4VA 1TK8B 3GH9A 2LKUA 4W66A 3TGZA 4PX1A 4I6XA 2R2JA 2AJQB 1AXDA 3L9VA 3FKFA 1U3IA 3QPMA 4V2NA 4OFTA 1EEMA 3C8EA 4Q5QA 1YKAA 1FG4A 4O5UA 4HOJA 2CAIA 5ELGA 4IHUA 1PX6A 1M2DA 1O7UA 1OVNA 3ZIJA 4AKXB 2H19A 2OJLA 3APSA 2WULA 1GUKA 4KGIA 4ZBDA 4XHMA 1TRWA 1YVLA 5A34A 2NPBA 1JLWA 4XS1A 1PGTA 2IFQA 5JWRB 3L9SA 2EIOA 2I1UA 4DSRA 2X4AA 2CV4A 4LA1A 1AAZA 1JFUA 2ON7A 2V6KA 4OO4A 4PGTA 2VD0A 2H8LA 1Z7PA 2UV8G 1ZMAA 1B9XC 5HR0A 5H5SA 4O5QA 1FOHA 4HEA2 3HJMA 4ZBBA 2HZFA 3ERWA 16GSA 4KSMA 2FLSA 2C0FA 1GLQA 3MWHA 2NVLA 1LJRA 3HY2A 3P8WA 3HA9A 3EWLA 3F3RA 2RIIA 2ON5A 4IJ3A 3VPTA 5J4YA 2H6ZA 2R3XA 4KDUA 3IC4A 2LS5A 2YJ7A 1OE8A 4MABA 2YCDA 4PTSA 1SJ6A 3KZQA 1F6MC 3I6AA 3TOTA 5JWOB 4AF2A 3LGCA 5DDLA 2IMFA 3BBYA 3IHQA 4EIQA 6GSTA 3W8JA 2H74A 1B9YC 1T8EB 4PNFA 1FB0A 2AYTA 3FW2A 4ULXA 3Q6OA 4X1UA 4XIHA 3IA1A 2RM6A 5IMFA 3A2WA 3US3A 3F6FA 1O73A 1GWCA 1GRXA 3P2AA 2B6MA 1H75A 1PQNA 1BYEA 4HJMA 1YY7A 5A4WA 2V2GA 3VI5A 3KH9A 2IJYA 2LSTA 1K0AA 2CVKA 3HZ4A 1ZCPA 2M80A 3GKMA 1SJIA 5C00A 5DCGA 1BF5A 1X9WB 1JHBA 3UVTA 2EFEA 3F6DA 2GQMA 1XW5A 3N5OA 5ECPB 4TKYA 5ECHB 4TXOA 2VIMA 2C0EA 1M9AA 3KCMA 3A2XA 5ELAA 13GSA 3UOMA 4IN0A 3D6IA 3UARA 3D4MA 2DC5A 4FIWA 2VL2C 2HRFA 2RUEA 2H76A 4V2MA 4GSNA 2MMZA 4DVCA 4GLTA 4FO5A 2PVQA 1K3YA 2JADA 4K0GA 4YAVA 2DIYA 1HQOA 1KTEA 3M9JA 1EV4A 3W8SA 4PNGA 5AGYA 3DWVA 1Z9HA 2LQOA 1TKDB 5G30A 3ZTLA 1MTCA 3GL3A 4RI6A 2AB6A 2JU5A 2H71A 2FUG2 4GDFA 3CYNA 2LRTA 5IMAA 1SKRB 1A0FA 1Z3EA 4IP6A 1ERVA 3IC8A 4N30A 2VCTA 1YEPA 1V2AA 5ECKB 1GLPA 3ZMKA 4WXTA 3GMFA 2BTOT 1FW1A 2IPAA 3H93A 3J7Yk 3IBHA 5EL8A 3PGTA 3EYTA 2B1LA 4G9HA 1GTUA 1AQVA 4F0BA 2OE0A 1R5PA 2HFDA 1F37A 3DD3A 3CWGA 4KH7A 2X8CA 5F8BA 5KN1A 3KMNA 3IPZA 5IQYA 1JZWA 5FHIA 4GWRA 1WOUA 3GH6A 4N0ZA 2C3QA 4ZL7A 2XBIA 1UC7A 2BJXA 5KN0A 1GULA 2AAWA 2H0GA 2VOCA 4AKHA 2HYXA 4HDEA 2F8AA 2K9FA 1FHEA 3QAGA 4EC0A 2H1BA 3VFIA 3KH7A 5HR2A 4F82A 1I9DA 2GDRA 2RLIA 4TRXA 4PUFC 5ECQB 2WRTA 2EC4A 3RHCA 1OC3A 3TKPA 3F4SA 3Q18A 2R37A 1N25A 2OE3A 4JR4A 3IE3A 1XVQA 2K8SA 4TVEA 3CMIA 2L5OA 2GGTA 3D5JA 4DSSB 4GTUA 1XOAA 5B8AA 2D2ZA 2CVDA 5LD0A 3JCML 4G01A 3Q74A 2GZZA 2IMKA 4XRDA 3VPQA 2A2PA 3TKSE 1WE0A 1SL0B 2VL3A 4OFMA 3U5RE 4KCEA 4K7NA 4XS4B 3GFKA 5GZZB 3BD2A 1XOBA 1SJZA 4I5QA 1J08A 1Q98A 5GSSA 1YQ1A 2QC7A 4MK3A 4GSSA 3H8QA 4IJIA 5DBQA 4EL1A 2YWMA 3L4NA 5COHA 2VCVA 3VWVA 3ZITA 1OC9B 2A4VA 2GVPA 3ERGA 3C71A 4TR0A 4E68A 4I2UA 3CBUA 4AKIA 1GSUA 3H4KA 1OC8A 2L57A 5CO3A 2MBSA 1AW9A 1YF1A 5IPHA 5B8BA 3LJRA 2NDOA 3LSZA 4GQCA 1Z5YE 4LL4B 3RBTA 5A4UA 4KUNA 3CSJA 5GAND 3A5WA 4KE3A 4F2IA 4X0XA 1WMJA 5ECSA 2WCIA 2XPDA 4LL1B 4V1Ag 5G31A 4CY8A 2L6DA 2YN1A 3UJ1A 2L59A 3F4TA 3UBKA 2BMXA 3GUSA 5DCHA 1K3LA 2I3YA 4KW6A 1SVOA 1TU8A 1WJKA 1BX9A 3GV1A 3UBLA 3IDVA 2ALBA 3L9UA 1TI3A 2YWNA 1Y6EA 2EFHA 5JCWA 1THOA 4ID0A 1WP0A 3R2QA 2R0CA 2KUCA 4RUVA 2XC2A 3FYGA 4XS4A 4IELA 3L0HA 1U3AA 3O6TA 2XBQA 1WRYA 2LJKA 2X99A 3D4TA 5IM9A 4L8EA 2YNXA 1YF0A 4AJ7A 4X4JA 20GSA 2DSAA 1ZZYA 3ZRDA 5CNWA 4MMMA 1U88A 3ZL5A 1G0TA 3OR5A 1NSWA 1GH2A 3WGXA 3QOUA 5ECLB 3GA4A 2JZRA 3LYKA 1N8JA 3TKQA 4ISDA 5EPFA 2YV9A 3CSIA 3WD6A 2B1KA 1SVLA 5AN1A 3FR3A 1T00A 2HI7A 5ABRA 4MF7A 2HSMB 1DSBA 2IMEA 2R4VA 4LLRA 1SL1B 1AIUA 3IHGA 3M3MA 4HI7A 3EC3A 1OKDA 1ILOA 5E59A 1H4OA 3SBCA 4KF9A 3KM6A 2A4HA 3LORA 4Q5FA 3VI7A 1M2AA 1EV9A 2MZCA 4BVXB 3FRCA 1B48A 5F06A 2DBCA 2DLXA 4MA9A 3WGDA 1K0CA 2FA4A 1JLVA 2HRKB 2MMNA 2H1AA 3TJFA 4KB3A 5AIVA 4G0LA 1Y25A 4BVYB 3W6GA 3TJJA 4ML6A 3IOSA 4F03A 4IBPA 5IPGA 4POMA 4HJ2A 3CRTA 9GSSA 3RPPA 3EU4A 5J41A 1AQXA 4MJBA 2EFCA 2OADA 1SL2B 2LNTA 1SD8A 2WFCA 2KP2A 3EURA 1NM3A 3PINA 3D0ZA 4MJAA 3LFLA 2HT9A 3GN3A 1OAZA 3HVXA 2P31A 1KBNA 1F3AA 1SENA 1ERWA 3ZFLA 12GSA 4L5LA 4K1FA 1QXHA 2DJ0A 2YWOA 4ACSA 1E6BA 4WKWA 2GSTA 4HZ2A 4EO3A 5ECOB 4K2DA 4ECCA 1XIYA 4HU7A 2DJ1A 1V57A 2VCXA 2GQKA 1PN0A 3HYPA 1JZRA 1XWBA 6GSUA 2HSMA 1R26A 2VCWA 5D9TA 1ACVA 3APOA 3FZ5A 1EOGA 3HVSA 3AY8A 5HR1A 4KDYA 1GTBA 3HDCA 4YH2A 5DJMA 5J47A 2FWEA 2OACA 5LCZA 3TRQA 1TK5B 4MPGA 4J2FA 3PR8A 2R0GA 3LEFA 3F0IA 3FR9A 3FK8A 2PGTA 5E4WA 4BVXA 2KLXA 1PA3A 2F3MA 4NV5A 5J9BA 2LJAA 1PN9A 3MAKA 4QQ7A 2FWHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3M0F A;  4TOP A;  2HRK A;  1FB6 A;  2C80 A;  2J23 A;  3MSZ A;  3D21 A;  4OFN A;  4TR1 B;  3KGK A;  5IO0 A;  2QGV A;  4AGS A;  1HD2 A;  3BJ5 A;  5L71 A;  3IK9 A;  2N5B A;  4G10 A;  3KP9 A;  3V1W A;  4L5O A;  1O6J A;  2GT6 A;  2IMD A;  3FR6 A;  4IW9 A;  3G9B A;  3KTL A;  4ZB8 A;  2YOI A;  5EVO A;  1PD2 1;  1PRX A;  1MD4 A;  5CRH A;  1FVK A;  2OA7 A;  1VF3 A;  5CRG A;  4CW9 A;  3GTU B;  1T1V A;  1S3A A;  1M9B A;  2H70 A;  1FVJ A;  4IP1 A;  3DEX A;  1A8L A;  4N0V A;  2H72 A;  2H30 A;  3DXB A;  4TN8 A;  4ZL8 A;  3IR4 A;  4RQX A;  4P3Y B;  2C3N A;  2DJK A;  4CHS A;  2ZUP A;  3FZA A;  2CQ9 A;  1TW9 A;  4GCI A;  4EE0 A;  3SWL A;  1ZYE A;  1GSD A;  4K7O A;  2OE1 A;  3IXR A;  1TK0 B;  3VLN A;  5H5Q A;  3EU3 A;  1USB A;  3NOF A;  3F8U A;  2B5X A;  5G2Z A;  1XXU A;  2O7K A;  1O8X A;  2PVO C;  3BCK A;  2PPT A;  4NPB A;  4POK A;  4ML1 A;  3PPU A;  4PUA A;  1R5A A;  2JAC A;  4G19 A;  3I69 A;  1U87 A;  1QGV A;  3VK9 A;  3ZRE A;  1Z7R A;  4E8H A;  2FY6 A;  4F0C A;  4TR1 A;  1GSE A;  5F0G A;  5IMD A;  2PN8 A;  4I8B A;  1TU7 A;  1X9S B;  4ZL9 A;  3ZVJ A;  3C1S A;  4EXJ A;  3E9J B;  2FD3 A;  1A0R P;  3RAZ A;  2C3T A;  2VL9 A;  1PL2 A;  3RHB A;  2IIY A;  3ERF A;  3TDG A;  4MF6 A;  2CVB A;  3EIN A;  2RUF A;  4NV2 A;  3GNJ A;  1SYX A;  5IIZ A;  3GTU A;  2LV3 A;  1ZYQ B;  3NIV A;  3WT1 A;  3VUR A;  5KEJ A;  1QMV A;  4MJC A;  8GSS A;  5HR3 A;  1EWX A;  1GSF A;  1MDI A;  4YQM A;  4G2E A;  2MBT A;  4NHW A;  4HQS A;  3A3T A;  4PXO A;  14GS A;  4WR4 A;  1VF2 A;  1THX A;  2KHP A;  2CX4 A;  4MZB A;  3M8N A;  4OMV A;  3QD9 A;  3QMX A;  5ECN B;  3TUE A;  2PER A;  1O8W A;  3I9V 2;  2I4A A;  5D96 A;  3ZLP A;  2VUP A;  3TCO A;  2GSQ A;  3UEM A;  2GSR A;  2H75 A;  1DE1 A;  1A24 A;  2N5F A;  5G5F A;  6GSW A;  1DUG A;  4MH3 A;  3FZ9 A;  4RQR A;  1SK0 A;  4GRF A;  1DBY A;  2B3S A;  2NBS A;  2X8H A;  3ME8 A;  4K8M A;  5JCU A;  5B6N A;  6GSS A;  1GSQ A;  1VRS D;  2L6C A;  3C7M A;  5G5E A;  2HSN B;  2KP1 A;  5CAX A;  4V1A p;  1GNW A;  2C1Y A;  3MDK A;  3QCP A;  4KX4 A;  1V9W A;  3ZFB A;  3DML A;  1DE2 A;  4OO5 A;  3Q19 A;  3KMO A;  3GKX A;  5HFG A;  2TRX A;  3GST A;  1AUC A;  1CQG A;  2LEG A;  3KP8 A;  4IS0 A;  2G0F A;  4IVF A;  2JZT A;  4PQI A;  5G1K A;  1K0B A;  3APQ A;  1X5C A;  4YQU A;  2V6O A;  4IQ1 A;  5ECI B;  4OWY A;  4YQV A;  1G7E A;  3BCI A;  5BMU A;  4J57 E;  1B8X A;  1B4P A;  2HLS A;  4XS6 A;  2JSY A;  2HSY A;  4DEJ A;  1F3B A;  1LU4 A;  4L0W A;  3F63 A;  3A2V A;  1Q4J A;  18GS A;  4WBR D;  2K8V A;  5GST A;  1QUW A;  1M7T A;  2GQL A;  1J9B A;  4FH8 A;  1HNA A;  3KD0 A;  4MF5 A;  3GKK A;  3ZVJ D;  1XBS A;  4BPY A;  3ZML A;  1ERU A;  3NZN A;  4E8E A;  5DQY A;  1EZK A;  4JBB A;  4FYB A;  4K0N A;  2G2Q A;  1M99 A;  3LQ7 A;  4O5R A;  2F8F A;  1WIK A;  1RW1 A;  1GNE A;  3E0U A;  1V58 A;  1BAY A;  3EE2 A;  4D73 B;  2B5Y A;  1T3B A;  2I81 A;  1SKS B;  1BED A;  1URM A;  1TRU A;  1QK8 A;  1LBK A;  1W4V A;  2VO4 A;  2LNS A;  3EVI A;  2GSS A;  3DVW A;  2H6Y A;  4DSS A;  1GP1 A;  3HCZ A;  2FNO A;  2H01 A;  4F9Z A;  4ECJ A;  1ABA A;  5D8I A;  4MP4 A;  1K3O A;  3G7I A;  3GHA A;  5ECR B;  1K0D A;  2E2G A;  5JWQ B;  2MMO A;  1AQW A;  2MYG A;  1TRS A;  2ZCT A;  2L4Q A;  4WF4 A;  2L4C A;  4WEY A;  4JZQ A;  4MCU A;  2A2R A;  2YV7 A;  5IMZ A;  1SK2 A;  4POB A;  3TRP A;  3KIJ A;  4MPF A;  3P7X A;  3QFB C;  5J9C A;  2FGX A;  2YWI A;  2R6K A;  1OC9 A;  5D73 A;  3IV4 A;  4AJ6 A;  4Q5N A;  4FYC A;  1O81 A;  2FA8 A;  4XTS A;  3HJO A;  3ZZX A;  2PUK C;  1GUM A;  4NAX A;  4MLY A;  3WGE A;  1PMT A;  2LRC A;  4XRA A;  4BWQ A;  1V98 A;  5ENU A;  1X5D A;  1T4Y A;  1TXX A;  4N10 A;  3TJK A;  3TRX A;  3HHV A;  5JCG A;  1TRV A;  2WDU A;  3TKR A;  2H73 A;  2O85 A;  2H66 A;  4TXV A;  5D93 A;  5CP1 A;  4J56 E;  22GS A;  4G0K A;  4PQH A;  4EKZ A;  1X0R A;  4JE1 A;  3FY7 A;  1HYU A;  4JR6 A;  1N2A A;  2LUS A;  2FWG A;  1V40 A;  3U6V A;  1JZD A;  3G7Y A;  1EOH A;  6GSV A;  2IWT A;  2EIR A;  1ERT A;  1FOV A;  5D9W A;  2F51 A;  4JRR A;  2WB9 A;  2L5L A;  2HRN A;  1A2L A;  1QQ2 A;  3CSH A;  1JZO A;  5ID2 B;  3D22 A;  1J0F A;  2YJH A;  2R5G A;  1G6W A;  1UN2 A;  4G0I A;  3GSS A;  1AC1 A;  4POL A;  4BWS A;  1X9M B;  2V1M A;  2DJ3 A;  1ZGN A;  1NHO A;  4RI7 A;  1SD9 A;  5DJL A;  4IKH A;  4I97 A;  2PBJ A;  1FAA A;  4FYU A;  3LYP A;  1UVZ A;  5J5N A;  1S3C A;  3FHK A;  3G7J A;  2C0G A;  3CXG A;  4OCF A;  1R4W A;  3VWU A;  5B6M A;  3M1G A;  2B5E A;  3TKS A;  5EY6 A;  1MDJ A;  7GSS A;  2OBI A;  4K9Z A;  5IOW A;  2YZU A;  1YZX A;  5FT3 A;  5F05 A;  1XW6 A;  1NW2 A;  4EDZ A;  2B7J A;  1TI1 A;  4EVM A;  2NTO A;  3GL5 A;  5FWG A;  2LRN A;  2TIR A;  2N5A A;  2HE3 A;  3GX0 A;  4BVY A;  2C0D A;  3PH9 A;  5CYY A;  3O3T A;  5DAK B;  4EUY A;  5DAL B;  2DJJ A;  2REM A;  4TXO B;  3DGQ A;  2K6V A;  4JED A;  2ZNM A;  5ID2 A;  1S3D A;  4ZIJ A;  4CDO A;  1QFN A;  3FZ4 A;  3DIE A;  1GTI A;  1YKC A;  2P0G A;  2WGR A;  3HZ8 A;  5IMV A;  1F2E A;  4KND A;  3LXZ A;  1GSY A;  3QFA C;  3ISO A;  1K0M A;  1YJ6 A;  2HZE B;  3H79 A;  2C4J A;  2V32 A;  2C8U A;  3CTG A;  1A2M A;  3VWX A;  4ZXG A;  4NMU A;  2Z9S A;  3ZIV A;  3F3Q A;  1PKZ A;  4MH2 A;  5F07 A;  1EGR A;  1ZL9 A;  4ZBA A;  3EMX A;  1CQH A;  1TDI A;  1F9M A;  2CA8 A;  3DVX A;  5B7C A;  2RM5 A;  4GST A;  1IYH A;  1XWA A;  4BA7 A;  17GS A;  4HQZ A;  2E2M A;  5G1L A;  4IQA A;  2O89 A;  1XVW A;  3K8N A;  4TR4 A;  2WS2 A;  5DAK A;  1PKW A;  1I5G A;  5DAL A;  5LNK e;  2GTU A;  2LJR A;  1GUH A;  3CTF A;  2GZP A;  1G6Y A;  4KCA A;  2AHE A;  3QR6 A;  3N9J A;  3GYK A;  2CT6 A;  2J9H A;  2O87 A;  2O8V B;  4Q5R A;  1XWC A;  2X64 A;  5AIX A;  2E0Q A;  5KN2 A;  3IAM 2;  2XHF A;  1ST9 A;  5GAP D;  2FHE A;  2XPE A;  2GS3 A;  3E3E A;  19GS A;  3QAW A;  3I43 A;  1X5E A;  5CRD A;  2HZE A;  4WF5 A;  11GS A;  3UVH A;  1KEB A;  2DIZ A;  1G7O A;  3GUR A;  1XWG A;  3BOA A;  1OYJ A;  2CZ2 A;  1ZOF A;  2HQT A;  3DKS A;  2P5R A;  2VCZ A;  3C73 A;  2KOK A;  1GL8 A;  2GLR A;  4AJ8 A;  3HJP A;  2VD1 A;  5CRW A;  3TKS C;  2AV4 A;  3WT2 A;  1WWJ A;  4ZB6 A;  1EGO A;  5HQP A;  4MZW A;  5HFI A;  3ZYW A;  2K18 A;  4GQF A;  1ML6 A;  2HNL A;  2EIQ A;  4QL9 A;  1E2Y A;  3O76 A;  2IN3 A;  2M72 A;  4NHZ A;  3UL3 A;  4KSO A;  3HXS A;  1WPI A;  2VAF A;  1SU9 A;  2A2S A;  5DVB A;  3S9F A;  1YEX A;  2P5Q A;  4V2L A;  2HXK A;  5CRE A;  1XFL A;  4HS1 A;  4KA0 A;  2QSI A;  2H0I A;  3KEB A;  3L78 A;  3IRA A;  1U6T A;  3J7Y b;  1ON4 A;  4ZIL A;  2DMM A;  4O32 A;  2H6X A;  1A2J A;  1XWK A;  1OE7 A;  3R3E A;  1C72 A;  1MDK A;  1O85 A;  4O7H A;  3TOU A;  2M46 A;  1BQ7 A;  2LTK A;  2F9S A;  6GSY A;  2FCH A;  3IAS 2;  2GZY A;  5J3R A;  2JL4 A;  10GS A;  2FWF A;  4PQ1 A;  5IMC A;  3TJG A;  1W89 A;  1IYI A;  1RK4 A;  1XPV A;  3FEU A;  5D9X A;  4OD7 A;  2B7K A;  2X8G A;  2QKE A;  3F9U A;  2JSZ A;  1KNG A;  2YP6 A;  1BJX A;  1UA5 A;  1EP8 A;  3HD5 A;  3H1N A;  2DML A;  2UZ8 A;  2IMI A;  1K0O A;  2OKA A;  4K6X A;  1PSQ A;  4BL7 B;  1OKT A;  2TRC P;  4XCS A;  2PMT A;  1TJD A;  5ECM B;  4ILF A;  4EDY A;  2H1G A;  1BG5 A;  3UAP A;  2PU9 C;  3DYR A;  1MEK A;  4ECI A;  2VLV A;  2YPM A;  3GKN A;  3UMA A;  5IO2 A;  1B4Q A;  2WJU A;  4LMW A;  4PUR A;  4QL7 A;  3F4R A;  5C04 A;  1T7P B;  4Z7X A;  4X43 A;  3LXT A;  5J4U A;  1NHY A;  3HVV A;  1TTZ A;  3MNG A;  2I9H A;  2CX3 A;  4LMV A;  1M2B A;  3CRU A;  1SK1 A;  1Z6M A;  4H86 A;  4K7I A;  1TOF A;  5H5R A;  3ME7 A;  1GSS A;  3TB2 A;  2CZ3 A;  4TR3 A;  4WET A;  4NXI A;  1MD3 A;  4NWY A;  4KAE A;  4DSQ A;  3GIX A;  4TW5 A;  4GXZ A;  2GT5 A;  1VF4 A;  2HSH A;  3TJB A;  3QAV A;  4O92 A;  3KTB A;  2VM2 A;  2H0H A;  1K0N A;  1T4Z A;  2IL3 A;  3IK7 A;  1RQM A;  4KDX A;  2VM1 A;  2JZS A;  2OBK A;  2VCQ A;  2VLT A;  1HNC A;  4GF0 A;  3GX8 A;  1GTA A;  1XW9 A;  2WZ9 A;  5D9V A;  3VWW A;  1M0U A;  1EP7 A;  1FO5 A;  2V41 A;  2PWJ A;  4MJE A;  2MMA A;  3LWA A;  2AUV A;  5AIS A;  4BL7 A;  4HZ4 A;  1XZO A;  3KJY A;  3P90 A;  2E7P A;  2YZH A;  5INY A;  3DRN A;  4ZB9 A;  4MDC A;  4FQU A;  1Z6N A;  5HFK A;  6GSX A;  1YDK A;  4D73 A;  1A8Y A;  3KXO A;  1PL1 A;  5DQS A;  1VGL A;  4HU9 A;  1HNB A;  5IOX A;  2IFQ B;  3GRX A;  2H1D A;  1SKW B;  4MZC A;  3RPN A;  4WR5 A;  4OCE A;  3QDN A;  4WBJ A;  4I2T A;  5A5K A;  2CAQ A;  4HUA A;  3HKR A;  2ES7 A;  2LQQ A;  4L0U A;  1SYR A;  1R7H A;  3EMP A;  2VL2 A;  1VF1 A;  4N11 A;  4YAP A;  4IGJ A;  3RDW A;  4JU5 A;  1PX7 A;  3UIW A;  4USS A;  2VLU A;  1A23 A;  2HRA A;  2YAN A;  4ECB A;  1XCC A;  3ED3 A;  2DJ2 A;  4EF0 A;  5KN3 A;  1EEJ A;  3M9K A;  1TP9 A;  3C1R A;  3WYW A;  3LG6 A;  5A4V A;  1TK8 B;  3GH9 A;  2LKU A;  3TGZ A;  4PX1 A;  4I6X A;  2R2J A;  2AJQ B;  1AXD A;  3L9V A;  3FKF A;  1U3I A;  3QPM A;  4V2N A;  4OFT A;  1EEM A;  3C8E A;  4Q5Q A;  1YKA A;  1FG4 A;  4HOJ A;  2CAI A;  5ELG A;  4IHU A;  1PX6 A;  1M2D A;  1O7U A;  1OVN A;  3ZIJ A;  2H19 A;  2OJL A;  3APS A;  2WUL A;  1GUK A;  4KGI A;  4ZBD A;  4XHM A;  1TRW A;  2NPB A;  1JLW A;  4XS1 A;  1PGT A;  2IFQ A;  5JWR B;  3L9S A;  2EIO A;  2I1U A;  4DSR A;  4LA1 A;  2CV4 A;  1AAZ A;  1JFU A;  2ON7 A;  2V6K A;  4OO4 A;  4PGT A;  2VD0 A;  2H8L A;  1Z7P A;  1ZMA A;  1B9X C;  5HR0 A;  5H5S A;  4HEA 2;  3HJM A;  4ZBB A;  2HZF A;  3ERW A;  16GS A;  4KSM A;  2FLS A;  2C0F A;  1GLQ A;  3MWH A;  2NVL A;  1LJR A;  3HY2 A;  3P8W A;  3HA9 A;  3EWL A;  3F3R A;  2RII A;  2ON5 A;  4IJ3 A;  3VPT A;  2H6Z A;  2R3X A;  4KDU A;  3IC4 A;  2LS5 A;  2YJ7 A;  1OE8 A;  4MAB A;  2YCD A;  4PTS A;  1SJ6 A;  3KZQ A;  1F6M C;  3I6A A;  3TOT A;  5JWO B;  4AF2 A;  3LGC A;  5DDL A;  2IMF A;  3BBY A;  3IHQ A;  6GST A;  3W8J A;  2H74 A;  1B9Y C;  1T8E B;  4PNF A;  1FB0 A;  2AYT A;  3FW2 A;  4ULX A;  3Q6O A;  4X1U A;  4XIH A;  3IA1 A;  2RM6 A;  5IMF A;  3A2W A;  3US3 A;  3F6F A;  1O73 A;  1GWC A;  1GRX A;  3P2A A;  2B6M A;  1H75 A;  1PQN A;  1BYE A;  4HJM A;  1YY7 A;  5A4W A;  2V2G A;  3VI5 A;  3KH9 A;  2IJY A;  2LST A;  1K0A A;  2CVK A;  3HZ4 A;  1ZCP A;  2M80 A;  3GKM A;  1SJI A;  5C00 A;  5DCG A;  1X9W B;  1JHB A;  3UVT A;  3F6D A;  2GQM A;  1XW5 A;  3N5O A;  5ECP B;  4TKY A;  5ECH B;  4TXO A;  2VIM A;  2C0E A;  1M9A A;  3KCM A;  3A2X A;  5ELA A;  13GS A;  3UOM A;  4IN0 A;  3D6I A;  3UAR A;  3D4M A;  2DC5 A;  4FIW A;  2VL2 C;  2HRF A;  2RUE A;  2H76 A;  4V2M A;  4GSN A;  2MMZ A;  4DVC A;  4GLT A;  4FO5 A;  2PVQ A;  1K3Y A;  2JAD A;  4K0G A;  4YAV A;  2DIY A;  1HQO A;  1KTE A;  3M9J A;  1EV4 A;  3W8S A;  4PNG A;  5AGY A;  3DWV A;  1Z9H A;  2LQO A;  1TKD B;  5G30 A;  3ZTL A;  1MTC A;  3GL3 A;  4RI6 A;  2AB6 A;  2JU5 A;  2H71 A;  2FUG 2;  3CYN A;  2LRT A;  5IMA A;  1SKR B;  1A0F A;  1Z3E A;  4IP6 A;  1ERV A;  3IC8 A;  4N30 A;  2VCT A;  1YEP A;  1V2A A;  5ECK B;  1GLP A;  3ZMK A;  4WXT A;  3GMF A;  2BTO T;  1FW1 A;  2IPA A;  3H93 A;  3J7Y k;  3IBH A;  5EL8 A;  3PGT A;  3EYT A;  2B1L A;  4G9H A;  1GTU A;  1AQV A;  4F0B A;  2OE0 A;  1R5P A;  2HFD A;  1F37 A;  3DD3 A;  4KH7 A;  2X8C A;  5F8B A;  5KN1 A;  3KMN A;  3IPZ A;  5IQY A;  1JZW A;  5FHI A;  4GWR A;  1WOU A;  3GH6 A;  4N0Z A;  2C3Q A;  4ZL7 A;  2XBI A;  1UC7 A;  2BJX A;  5KN0 A;  1GUL A;  2AAW A;  2H0G A;  2VOC A;  2HYX A;  4HDE A;  2F8A A;  2K9F A;  1FHE A;  3QAG A;  4EC0 A;  2H1B A;  3VFI A;  3KH7 A;  5HR2 A;  4F82 A;  1I9D A;  2GDR A;  2RLI A;  4TRX A;  4PUF C;  5ECQ B;  2WRT A;  2EC4 A;  3RHC A;  1OC3 A;  3TKP A;  3F4S A;  3Q18 A;  2R37 A;  2OE3 A;  4JR4 A;  3IE3 A;  1XVQ A;  2K8S A;  4TVE A;  3CMI A;  2L5O A;  2GGT A;  3D5J A;  4DSS B;  4GTU A;  1XOA A;  5B8A A;  2D2Z A;  2CVD A;  5LD0 A;  3JCM L;  3Q74 A;  2GZZ A;  2IMK A;  4XRD A;  3VPQ A;  3TKS E;  1WE0 A;  1SL0 B;  2VL3 A;  4OFM A;  3U5R E;  4KCE A;  4K7N A;  4XS4 B;  3GFK A;  5GZZ B;  3BD2 A;  1XOB A;  1SJZ A;  4I5Q A;  1J08 A;  1Q98 A;  5GSS A;  1YQ1 A;  2QC7 A;  4MK3 A;  4GSS A;  3H8Q A;  4IJI A;  5DBQ A;  4EL1 A;  2YWM A;  3L4N A;  5COH A;  2VCV A;  3VWV A;  3ZIT A;  1OC9 B;  2A4V A;  2GVP A;  3ERG A;  3C71 A;  4TR0 A;  4I2U A;  3CBU A;  1GSU A;  3H4K A;  1OC8 A;  2L57 A;  5CO3 A;  2MBS A;  1AW9 A;  1YF1 A;  5IPH A;  5B8B A;  3LJR A;  2NDO A;  3LSZ A;  4GQC A;  1Z5Y E;  4LL4 B;  3RBT A;  5A4U A;  4KUN A;  3CSJ A;  5GAN D;  3A5W A;  4KE3 A;  4F2I A;  4X0X A;  1WMJ A;  5ECS A;  2WCI A;  2XPD A;  4LL1 B;  4V1A g;  5G31 A;  2L6D A;  2YN1 A;  3UJ1 A;  2L59 A;  3F4T A;  3UBK A;  2BMX A;  3GUS A;  5DCH A;  1K3L A;  2I3Y A;  4KW6 A;  1TU8 A;  1WJK A;  1BX9 A;  3GV1 A;  3UBL A;  3IDV A;  2ALB A;  3L9U A;  1TI3 A;  2YWN A;  1Y6E A;  5JCW A;  1THO A;  4ID0 A;  1WP0 A;  3R2Q A;  2KUC A;  4RUV A;  2XC2 A;  3FYG A;  4XS4 A;  4IEL A;  3L0H A;  1U3A A;  3O6T A;  2XBQ A;  1WRY A;  2LJK A;  2X99 A;  3D4T A;  5IM9 A;  4L8E A;  2YNX A;  1YF0 A;  4AJ7 A;  20GS A;  2DSA A;  1ZZY A;  3ZRD A;  5CNW A;  4MMM A;  1U88 A;  3ZL5 A;  1G0T A;  3OR5 A;  1NSW A;  1GH2 A;  3WGX A;  3QOU A;  5ECL B;  3GA4 A;  2JZR A;  3LYK A;  1N8J A;  3TKQ A;  4ISD A;  5EPF A;  2YV9 A;  3CSI A;  3WD6 A;  2B1K A;  5AN1 A;  3FR3 A;  1T00 A;  2HI7 A;  5ABR A;  4MF7 A;  2HSM B;  1DSB A;  2IME A;  2R4V A;  4LLR A;  1SL1 B;  1AIU A;  3M3M A;  4HI7 A;  1OKD A;  3EC3 A;  1ILO A;  5E59 A;  1H4O A;  3SBC A;  4KF9 A;  3KM6 A;  3LOR A;  4Q5F A;  3VI7 A;  1M2A A;  1EV9 A;  2MZC A;  4BVX B;  3FRC A;  1B48 A;  5F06 A;  2DBC A;  2DLX A;  4MA9 A;  3WGD A;  1K0C A;  2FA4 A;  1JLV A;  2HRK B;  2MMN A;  2H1A A;  3TJF A;  4KB3 A;  5AIV A;  4G0L A;  1Y25 A;  4BVY B;  3W6G A;  3TJJ A;  4ML6 A;  3IOS A;  4F03 A;  4IBP A;  5IPG A;  4POM A;  4HJ2 A;  3CRT A;  9GSS A;  3RPP A;  3EU4 A;  5J41 A;  1AQX A;  4MJB A;  2OAD A;  1SL2 B;  2LNT A;  1SD8 A;  2WFC A;  2KP2 A;  3EUR A;  1NM3 A;  3PIN A;  3D0Z A;  4MJA A;  3LFL A;  2HT9 A;  3GN3 A;  1OAZ A;  3HVX A;  2P31 A;  1KBN A;  1F3A A;  1SEN A;  1ERW A;  3ZFL A;  12GS A;  4L5L A;  4K1F A;  1QXH A;  2DJ0 A;  2YWO A;  4ACS A;  1E6B A;  4WKW A;  2GST A;  4HZ2 A;  4EO3 A;  5ECO B;  4K2D A;  4ECC A;  1XIY A;  4HU7 A;  2DJ1 A;  1V57 A;  2VCX A;  2GQK A;  3HYP A;  1JZR A;  1XWB A;  6GSU A;  2HSM A;  1R26 A;  2VCW A;  5D9T A;  1ACV A;  3APO A;  3FZ5 A;  1EOG A;  3HVS A;  3AY8 A;  5HR1 A;  4KDY A;  1GTB A;  4YH2 A;  5DJM A;  2FWE A;  3HDC A;  2OAC A;  5LCZ A;  3TRQ A;  1TK5 B;  4MPG A;  4J2F A;  3PR8 A;  3LEF A;  3F0I A;  3FR9 A;  3FK8 A;  2PGT A;  5E4W A;  4BVX A;  2KLX A;  1PA3 A;  2F3M A;  4NV5 A;  5J9B A;  2LJA A;  1PN9 A;  3MAK A;  4QQ7 A;  2FWH A; 
#chains in the Genus database with same CATH topology
 3M0F A;  4TOP A;  2HRK A;  1FB6 A;  2C80 A;  2J23 A;  3MSZ A;  2QA2 A;  3D21 A;  4OFN A;  4Z2T A;  4TR1 B;  3KGK A;  5IO0 A;  2QGV A;  3MYD A;  4AGS A;  1HD2 A;  3BJ5 A;  5L71 A;  3IK9 A;  2N5B A;  4G10 A;  3KP9 A;  3V1W A;  4L5O A;  1O6J A;  2GT6 A;  2IMD A;  3FR6 A;  4IW9 A;  3G9B A;  3KTL A;  4ZB8 A;  2YOI A;  5EVO A;  1PD2 1;  1PRX A;  1MD4 A;  5CRH A;  1FVK A;  2OA7 A;  1VF3 A;  5CRG A;  4CW9 A;  3GTU B;  1T1V A;  1S3A A;  1M9B A;  2H70 A;  1FVJ A;  4IP1 A;  4AI6 A;  3DEX A;  2H1L A;  1A8L A;  4N0V A;  2H72 A;  2H30 A;  5J4V A;  2WVZ A;  3DXB A;  4TN8 A;  4ZL8 A;  3IR4 A;  4RQX A;  4P3Y B;  2C3N A;  2DJK A;  4CHS A;  2ZUP A;  3FZA A;  2CQ9 A;  1TW9 A;  4GCI A;  4EE0 A;  3SWL A;  1ZYE A;  1GSD A;  4K7O A;  2OE1 A;  3IXR A;  1TK0 B;  3VLN A;  5H5Q A;  3EU3 A;  1USB A;  3NOF A;  3F8U A;  2B5X A;  5G2Z A;  1XXU A;  2O7K A;  1O8X A;  2PVO C;  3BCK A;  2PPT A;  4NPB A;  4POK A;  4ML1 A;  3PPU A;  4PUA A;  1R5A A;  2JAC A;  3I69 A;  4G19 A;  1U87 A;  1QGV A;  3VK9 A;  3ZRE A;  1Z7R A;  4E8H A;  1S3R A;  2FY6 A;  4F0C A;  4TR1 A;  1GSE A;  5F0G A;  5IMD A;  2PN8 A;  4I8B A;  1TU7 A;  1X9S B;  4ZL9 A;  3ZVJ A;  3C1S A;  1ZYN A;  4EXJ A;  3E9J B;  2FD3 A;  1A0R P;  3RAZ A;  2C3T A;  2VL9 A;  1PL2 A;  3RHB A;  2IIY A;  3ERF A;  3TDG A;  4MF6 A;  2CVB A;  3EIN A;  2RUF A;  4NV2 A;  3GNJ A;  1SYX A;  5IIZ A;  3GTU A;  2LV3 A;  1ZYQ B;  3NIV A;  3WT1 A;  3VUR A;  5KEJ A;  1QMV A;  4MJC A;  8GSS A;  5HR3 A;  1EWX A;  1GSF A;  1MDI A;  4YQM A;  4G2E A;  2MBT A;  4NHW A;  4HQS A;  3A3T A;  4PXO A;  14GS A;  4WR4 A;  1VF2 A;  1THX A;  2KHP A;  2CX4 A;  4MZB A;  3M8N A;  4OMV A;  3QD9 A;  3QMX A;  5ECN B;  3TUE A;  2PER A;  1O8W A;  3I9V 2;  2I4A A;  5D96 A;  5BMU B;  3ZLP A;  2VUP A;  3TCO A;  2GSQ A;  3UEM A;  5J40 A;  2GSR A;  2H75 A;  1DE1 A;  1A24 A;  2N5F A;  5G5F A;  6GSW A;  1DUG A;  4MH3 A;  3FZ9 A;  4RQR A;  1SK0 A;  4GRF A;  1DBY A;  2B3S A;  2NBS A;  2X8H A;  3ME8 A;  4K8M A;  5JCU A;  5B6N A;  6GSS A;  1GSQ A;  4K2X A;  4ZB7 A;  1VRS D;  2L6C A;  3C7M A;  5G5E A;  2HSN B;  2EFD A;  4A5P A;  2KP1 A;  5CAX A;  4V1A p;  1GNW A;  2C1Y A;  3MDK A;  3QCP A;  4KX4 A;  1V9W A;  3ZFB A;  3DML A;  1DE2 A;  4OO5 A;  3Q19 A;  3KMO A;  3GKX A;  3FMW A;  5HFG A;  2TRX A;  3GST A;  1AUC A;  1CQG A;  2LEG A;  3KP8 A;  4IS0 A;  2G0F A;  4IVF A;  2JZT A;  4PQI A;  5G1K A;  1K0B A;  3APQ A;  1X5C A;  4YQU A;  2V6O A;  4IQ1 A;  4K5S A;  5ECI B;  4OWY A;  4YQV A;  1G7E A;  3BCI A;  2WW1 A;  5BMU A;  4J57 E;  1B8X A;  2O5V A;  1B4P A;  2HLS A;  4XS6 A;  2JSY A;  2HSY A;  4DEJ A;  1F3B A;  1LU4 A;  4L0W A;  3F63 A;  3A2V A;  1Q4J A;  18GS A;  4WBR D;  2K8V A;  5GST A;  1QUW A;  1M7T A;  2GQL A;  1J9B A;  4FH8 A;  1HNA A;  3KD0 A;  4MF5 A;  3GKK A;  3ZVJ D;  1XBS A;  4BPY A;  3ZML A;  1ERU A;  3NZN A;  4E8E A;  5DQY A;  1EZK A;  4JBB A;  4FYB A;  4K0N A;  2G2Q A;  1M99 A;  3LQ7 A;  4O5R A;  2F8F A;  2HSN A;  1WIK A;  1RW1 A;  1GNE A;  3E0U A;  1V58 A;  1BAY A;  3EE2 A;  4D73 B;  2B5Y A;  1T3B A;  2I81 A;  1SKS B;  2WVX B;  1BED A;  1URM A;  1TRU A;  1QK8 A;  1LBK A;  1W4V A;  2VO4 A;  2LNS A;  3EVI A;  2GSS A;  3DVW A;  2H6Y A;  4ICY A;  4DSS A;  1GP1 A;  3HCZ A;  2FNO A;  2H01 A;  4F9Z A;  4ECJ A;  1ABA A;  5D8I A;  4MP4 A;  1K3O A;  3G7I A;  3GHA A;  5ECR B;  1K0D A;  3HMJ G;  2E2G A;  5JWQ B;  2MMO A;  1AQW A;  2MYG A;  1TRS A;  2ZCT A;  2L4Q A;  4WF4 A;  2L4C A;  4WEY A;  4JZQ A;  4MCU A;  2A2R A;  2YV7 A;  5IMZ A;  1SK2 A;  4POB A;  3TRP A;  4MPF A;  3KIJ A;  3P7X A;  3QFB C;  5J9C A;  2FGX A;  2YWI A;  2R6K A;  1OC9 A;  5D73 A;  3IV4 A;  4AJ6 A;  4Q5N A;  4FYC A;  1O81 A;  2FA8 A;  4YKG A;  4XTS A;  3HJO A;  3ZZX A;  2PUK C;  1GUM A;  4NAX A;  4MLY A;  3WGE A;  1PMT A;  2LRC A;  4XRA A;  4BWQ A;  2DKI A;  1V98 A;  5ENU A;  1X5D A;  1T4Y A;  1TXX A;  4N10 A;  3TJK A;  3TRX A;  3HHV A;  5JCG A;  1TRV A;  2WDU A;  3TKR A;  2H73 A;  2WVX A;  2O85 A;  2H66 A;  4TXV A;  5D93 A;  5A34 B;  5CP1 A;  4J56 E;  22GS A;  4G0K A;  4PQH A;  4EKZ A;  1X0R A;  4JE1 A;  3FY7 A;  1HYU A;  4JR6 A;  1N2A A;  5KOX A;  2LUS A;  2FWG A;  1V40 A;  3U6V A;  1JZD A;  2VKZ G;  3G7Y A;  1EOH A;  6GSV A;  2IWT A;  2EIR A;  1ERT A;  2DKH A;  1FOV A;  5D9W A;  2F51 A;  4JRR A;  2WB9 A;  2L5L A;  2HRN A;  1A2L A;  1QQ2 A;  3CSH A;  1JZO A;  5ID2 B;  3D22 A;  1J0F A;  2YJH A;  2R5G A;  1G6W A;  1UN2 A;  4G0I A;  3GSS A;  1AC1 A;  4POL A;  4BWS A;  3EPT A;  1X9M B;  2V1M A;  2DJ3 A;  1ZGN A;  1NHO A;  4RI7 A;  1SD9 A;  5DJL A;  4IKH A;  4I97 A;  2PBJ A;  1FAA A;  4FYU A;  3LYP A;  1UVZ A;  5J5N A;  5BRT A;  1S3C A;  3FHK A;  3G7J A;  2C0G A;  3CXG A;  4OCF A;  1R4W A;  3VWU A;  2R0P A;  5B6M A;  3M1G A;  2B5E A;  3TKS A;  1Y1U A;  5EY6 A;  1MDJ A;  7GSS A;  2OBI A;  4K9Z A;  5IOW A;  2YZU A;  1YZX A;  5FT3 A;  5F05 A;  1XW6 A;  1NW2 A;  4EDZ A;  2B7J A;  1TI1 A;  4HSC X;  4EVM A;  2NTO A;  3GL5 A;  5FWG A;  2LRN A;  2TIR A;  2N5A A;  2HE3 A;  3GX0 A;  4BVY A;  2C0D A;  3PH9 A;  5CYY A;  3O3T A;  5DAK B;  4EUY A;  5DAL B;  2X49 A;  2DJJ A;  2REM A;  4TXO B;  3DGQ A;  2K6V A;  4JED A;  2ZNM A;  5ID2 A;  1S3D A;  4ZIJ A;  4CDO A;  1QFN A;  3FZ4 A;  3DIE A;  3RFR C;  1GTI A;  1YKC A;  2P0G A;  2WGR A;  3HZ8 A;  5IMV A;  1F2E A;  4KND A;  3LXZ A;  1GSY A;  3QFA C;  3ISO A;  1K0M A;  1YJ6 A;  2HZE B;  3H79 A;  2C4J A;  2V32 A;  2C8U A;  3CTG A;  4N3Z A;  1A2M A;  3VWX A;  4ZXG A;  4NMU A;  2Z9S A;  3ZIV A;  3F3Q A;  1PKZ A;  4MH2 A;  5F07 A;  1EGR A;  1ZL9 A;  4ZBA A;  3EMX A;  1CQH A;  1TDI A;  1F9M A;  1PFO A;  2CA8 A;  1M3J A;  3DVX A;  5B7C A;  2QA1 A;  2RM5 A;  4GST A;  1IYH A;  1XWA A;  1BG1 A;  4BA7 A;  2OT3 A;  17GS A;  4HQZ A;  2E2M A;  5G1L A;  4K5R A;  4IQA A;  4PI0 C;  4Z2R A;  2O89 A;  1XVW A;  3K8N A;  4TR4 A;  2WS2 A;  5DAK A;  1PKW A;  1I5G A;  5A1N B;  5DAL A;  5LNK e;  2GTU A;  2LJR A;  1GUH A;  3CTF A;  2GZP A;  1G6Y A;  2WW2 A;  4KCA A;  2AHE A;  3QR6 A;  3N9J A;  3GYK A;  2CT6 A;  2J9H A;  2O87 A;  2O8V B;  4Q5R A;  1XWC A;  2X64 A;  5AIX A;  2E0Q A;  5KN2 A;  5A5H B;  3IAM 2;  2XHF A;  1ST9 A;  5GAP D;  2FHE A;  2XPE A;  2GS3 A;  3E3E A;  19GS A;  3QAW A;  3I43 A;  1X5E A;  5CRD A;  2HZE A;  4WF5 A;  11GS A;  3UVH A;  1KEB A;  2DIZ A;  1G7O A;  3GUR A;  1XWG A;  3BOA A;  1OYJ A;  2CZ2 A;  1ZOF A;  2HQT A;  3DKS A;  2P5R A;  2VCZ A;  3C73 A;  2KOK A;  1GL8 A;  2GLR A;  4AJ8 A;  3HJP A;  2VD1 A;  5CRW A;  3TKS C;  2AV4 A;  3WT2 A;  1WWJ A;  4ZB6 A;  1EGO A;  5HQP A;  4MZW A;  5HFI A;  3A5I A;  3ZYW A;  2K18 A;  4GQF A;  1ML6 A;  2HNL A;  2EIQ A;  4QL9 A;  4PI2 C;  1E2Y A;  3O76 A;  2IN3 A;  2M72 A;  4NHZ A;  3UL3 A;  4KSO A;  3HXS A;  1WPI A;  2VAF A;  1SU9 A;  2A2S A;  5A1N A;  5DVB A;  3S9F A;  5KOW A;  1YEX A;  2P5Q A;  4V2L A;  2HXK A;  5CRE A;  1XFL A;  4HS1 A;  4KA0 A;  2QSI A;  2H0I A;  3KEB A;  3L78 A;  3IRA A;  1U6T A;  3J7Y b;  1ON4 A;  4ZIL A;  4MNN A;  2DMM A;  4O32 A;  5A5H A;  2H6X A;  1A2J A;  1XWK A;  1OE7 A;  3R3E A;  1C72 A;  1MDK A;  1O85 A;  4O7H A;  3TOU A;  2M46 A;  1BQ7 A;  2LTK A;  2F9S A;  6GSY A;  2FCH A;  3IAS 2;  2GZY A;  5J3R A;  2JL4 A;  10GS A;  2FWF A;  4PQ1 A;  5IMC A;  3TJG A;  1W89 A;  1IYI A;  1TXU A;  1RK4 A;  1XPV A;  3FEU A;  5D9X A;  4OD7 A;  2B7K A;  4QMK A;  2X8G A;  1YEW C;  2QKE A;  1ZYP A;  3F9U A;  2JSZ A;  1KNG A;  2YP6 A;  1BJX A;  1UA5 A;  1EP8 A;  3HD5 A;  3H1N A;  2DML A;  2UZ8 A;  2IMI A;  1K0O A;  4YKF A;  2OKA A;  4K6X A;  1PSQ A;  4BL7 B;  4EIP A;  2O36 A;  1OKT A;  2TRC P;  4XCS A;  2PMT A;  1TJD A;  5ECM B;  4ILF A;  4EDY A;  2H1G A;  1BG5 A;  3UAP A;  2PU9 C;  3DYR A;  1MEK A;  4ECI A;  2VLV A;  2YPM A;  3GKN A;  3UMA A;  5IO2 A;  1B4Q A;  2WJU A;  4AKG A;  4LMW A;  4PUR A;  4QL7 A;  3F4R A;  5C04 A;  1T7P B;  4Z7X A;  4X43 A;  3LXT A;  5J4U A;  1NHY A;  3HVV A;  1TTZ A;  3MNG A;  2I9H A;  2CX3 A;  4LMV A;  1M2B A;  3CRU A;  1SK1 A;  1Z6M A;  4H86 A;  4K7I A;  1TOF A;  5H5R A;  3ME7 A;  1GSS A;  3TB2 A;  2WZS A;  2CZ3 A;  4TR3 A;  4WET A;  4FXY P;  4NXI A;  1MD3 A;  4NWY A;  2O3E A;  4KAE A;  4DSQ A;  3GIX A;  4TW5 A;  4GXZ A;  3LW9 A;  2GT5 A;  1VF4 A;  2HSH A;  3TJB A;  3QAV A;  4O92 A;  3KTB A;  2VM2 A;  2H0H A;  1K0N A;  1T4Z A;  3MIX A;  2IL3 A;  3IK7 A;  1RQM A;  4KDX A;  2VM1 A;  2JZS A;  4BIK A;  2OBK A;  2VCQ A;  2VLT A;  1HNC A;  4GF0 A;  3GX8 A;  1GTA A;  1XW9 A;  2WZ9 A;  5D9V A;  3VWW A;  1M0U A;  1EP7 A;  1FO5 A;  2V41 A;  2PWJ A;  4MJE A;  2MMA A;  3LWA A;  2AUV A;  5AIS A;  3TU3 B;  4BL7 A;  4HZ4 A;  1XZO A;  3KJY A;  3P90 A;  2E7P A;  2YZH A;  5INY A;  3DRN A;  4ZB9 A;  4Z2U A;  4MDC A;  4FQU A;  4CY6 A;  1Z6N A;  5HFK A;  6GSX A;  1YDK A;  4D73 A;  1A8Y A;  3KXO A;  3CQF A;  1PL1 A;  5DQS A;  1VGL A;  4HU9 A;  1HNB A;  5IOX A;  2IFQ B;  3GRX A;  2H1D A;  1SKW B;  4MZC A;  3RPN A;  4WR5 A;  4OCE A;  3QDN A;  4WBJ A;  4I2T A;  5A5K A;  2CAQ A;  4HUA A;  3HKR A;  2ES7 A;  2LQQ A;  4L0U A;  1SYR A;  1R7H A;  3EMP A;  2VL2 A;  1VF1 A;  4N11 A;  4YAP A;  4IGJ A;  3RDW A;  4JU5 A;  1PX7 A;  3UIW A;  4USS A;  1S4B P;  1SVM A;  2VLU A;  1A23 A;  2HRA A;  2YAN A;  4ECB A;  1XCC A;  3ED3 A;  2DJ2 A;  4EF0 A;  5KN3 A;  1EEJ A;  3M9K A;  1TP9 A;  3C1R A;  3WYW A;  3LG6 A;  5A4V A;  1TK8 B;  3GH9 A;  2LKU A;  4W66 A;  3TGZ A;  4PX1 A;  4I6X A;  2R2J A;  2AJQ B;  1AXD A;  3HVN A;  3L9V A;  3FKF A;  1U3I A;  3QPM A;  4V2N A;  4OFT A;  1EEM A;  3C8E A;  1I1I P;  4Q5Q A;  1YKA A;  1FG4 A;  4O5U A;  4HOJ A;  2CAI A;  5ELG A;  4IHU A;  1PX6 A;  1M2D A;  1O7U A;  1OVN A;  3ZIJ A;  4AKX B;  2H19 A;  2OJL A;  3APS A;  2WUL A;  1GUK A;  4KGI A;  4ZBD A;  4XHM A;  1TRW A;  1YVL A;  5A34 A;  2NPB A;  1JLW A;  4XS1 A;  1PGT A;  2IFQ A;  5JWR B;  3L9S A;  2EIO A;  2I1U A;  4DSR A;  2X4A A;  2CV4 A;  4LA1 A;  1AAZ A;  1JFU A;  2ON7 A;  2V6K A;  4OO4 A;  4PGT A;  2VD0 A;  2H8L A;  1Z7P A;  2UV8 G;  1ZMA A;  4PHZ C;  1B9X C;  5HR0 A;  5H5S A;  4O5Q A;  1FOH A;  4HEA 2;  3HJM A;  4ZBB A;  2HZF A;  3ERW A;  16GS A;  4KSM A;  2FLS A;  2C0F A;  1GLQ A;  3MWH A;  2NVL A;  1LJR A;  3HY2 A;  3P8W A;  3HA9 A;  3EWL A;  3F3R A;  2RII A;  2ON5 A;  4IJ3 A;  3VPT A;  5J4Y A;  2H6Z A;  2R3X A;  4KDU A;  3IC4 A;  2LS5 A;  2YJ7 A;  1OE8 A;  4MAB A;  2YCD A;  4PTS A;  1SJ6 A;  3KZQ A;  1F6M C;  3I6A A;  3TOT A;  5JWO B;  4AF2 A;  3LGC A;  5DDL A;  2IMF A;  3BBY A;  3IHQ A;  4EIQ A;  6GST A;  3W8J A;  2H74 A;  1B9Y C;  1T8E B;  4PNF A;  1FB0 A;  2AYT A;  3FW2 A;  4ULX A;  3Q6O A;  4X1U A;  4XIH A;  3IA1 A;  2RM6 A;  5IMF A;  3A2W A;  3US3 A;  3F6F A;  1O73 A;  1GWC A;  1GRX A;  3P2A A;  2B6M A;  1H75 A;  1PQN A;  1BYE A;  4HJM A;  1YY7 A;  5A4W A;  2V2G A;  3VI5 A;  3KH9 A;  2IJY A;  2LST A;  1K0A A;  2CVK A;  3HZ4 A;  1ZCP A;  2M80 A;  3GKM A;  1SJI A;  5C00 A;  5DCG A;  1BF5 A;  1X9W B;  1JHB A;  3UVT A;  2EFE A;  3F6D A;  2GQM A;  1XW5 A;  3N5O A;  5ECP B;  4TKY A;  5ECH B;  4TXO A;  2VIM A;  2C0E A;  1M9A A;  3KCM A;  3A2X A;  5ELA A;  13GS A;  3UOM A;  4IN0 A;  3D6I A;  3UAR A;  3D4M A;  2DC5 A;  4FIW A;  2VL2 C;  2HRF A;  2RUE A;  2H76 A;  4V2M A;  4GSN A;  2MMZ A;  4DVC A;  4GLT A;  4FO5 A;  2PVQ A;  1K3Y A;  2JAD A;  4K0G A;  4YAV A;  2DIY A;  1HQO A;  1KTE A;  3M9J A;  1EV4 A;  3W8S A;  4PNG A;  5AGY A;  2WVY A;  3DWV A;  1Z9H A;  2LQO A;  1TKD B;  5G30 A;  3ZTL A;  1MTC A;  3GL3 A;  4RI6 A;  2AB6 A;  2JU5 A;  2H71 A;  2FUG 2;  4GDF A;  3CYN A;  2LRT A;  5IMA A;  1SKR B;  1A0F A;  1Z3E A;  4IP6 A;  1ERV A;  3IC8 A;  4N30 A;  2VCT A;  1YEP A;  1V2A A;  5ECK B;  1GLP A;  3ZMK A;  4WXT A;  3GMF A;  2BTO T;  1FW1 A;  2IPA A;  3H93 A;  3J7Y k;  3IBH A;  5EL8 A;  3PGT A;  3EYT A;  2B1L A;  4G9H A;  1GTU A;  1AQV A;  4F0B A;  2OE0 A;  1R5P A;  2HFD A;  1F37 A;  3DD3 A;  3CWG A;  4KH7 A;  2X8C A;  5F8B A;  5KN1 A;  3KMN A;  3IPZ A;  5IQY A;  2WW3 A;  1JZW A;  2WW0 A;  5FHI A;  4GWR A;  1WOU A;  3GH6 A;  3CHX C;  4N0Z A;  2C3Q A;  4ZL7 A;  2XBI A;  1UC7 A;  2BJX A;  5KN0 A;  1GUL A;  2AAW A;  2H0G A;  2VOC A;  4AKH A;  2HYX A;  4HDE A;  2F8A A;  2K9F A;  1FHE A;  3QAG A;  4EC0 A;  2H1B A;  3VFI A;  3KH7 A;  5HR2 A;  4F82 A;  1I9D A;  2GDR A;  2RLI A;  4TRX A;  4PUF C;  5ECQ B;  2WRT A;  2EC4 A;  3RHC A;  1OC3 A;  3TKP A;  3F4S A;  3Q18 A;  2R37 A;  1N25 A;  2OE3 A;  4JR4 A;  1M3I A;  3IE3 A;  1XVQ A;  2K8S A;  4TVE A;  3CMI A;  2L5O A;  2GGT A;  3D5J A;  4DSS B;  4GTU A;  1XOA A;  5B8A A;  2D2Z A;  2CVD A;  5LD0 A;  3JCM L;  4G01 A;  3Q74 A;  2GZZ A;  2IMK A;  4XRD A;  3VPQ A;  2A2P A;  3TKS E;  1WE0 A;  1SL0 B;  2VL3 A;  4OFM A;  3U5R E;  4KCE A;  4K7N A;  4XS4 B;  3GFK A;  5GZZ B;  3BD2 A;  1XOB A;  1SJZ A;  4I5Q A;  1J08 A;  1Q98 A;  5GSS A;  1YQ1 A;  2QC7 A;  4MK3 A;  4GSS A;  3H8Q A;  4IJI A;  5DBQ A;  4EL1 A;  2YWM A;  3L4N A;  5COH A;  2VCV A;  3VWV A;  3ZIT A;  1OC9 B;  2A4V A;  2GVP A;  3ERG A;  3C71 A;  4TR0 A;  4E68 A;  4I2U A;  3CBU A;  4AKI A;  1GSU A;  3H4K A;  1OC8 A;  2L57 A;  5CO3 A;  2MBS A;  1AW9 A;  1YF1 A;  5IPH A;  5B8B A;  3LJR A;  2NDO A;  3LSZ A;  4GQC A;  3RGB C;  1Z5Y E;  4LL4 B;  3RBT A;  5A4U A;  4KUN A;  3CSJ A;  1XG8 A;  5GAN D;  3A5W A;  4KE3 A;  4F2I A;  4X0X A;  1WMJ A;  5ECS A;  2WCI A;  2XPD A;  4LL1 B;  4V1A g;  5G31 A;  4CY8 A;  2L6D A;  2YN1 A;  3UJ1 A;  2L59 A;  3F4T A;  3UBK A;  2BMX A;  3GUS A;  5DCH A;  1K3L A;  2I3Y A;  4KW6 A;  1SVO A;  1TU8 A;  1WJK A;  1BX9 A;  3GV1 A;  3UBL A;  3IDV A;  2ALB A;  3L9U A;  1TI3 A;  2YWN A;  1Y6E A;  2EFH A;  5JCW A;  1THO A;  4ID0 A;  1WP0 A;  3R2Q A;  2R0C A;  2KUC A;  4RUV A;  2XC2 A;  3FYG A;  4XS4 A;  4IEL A;  3L0H A;  1U3A A;  3O6T A;  2XBQ A;  1WRY A;  2LJK A;  2X99 A;  3D4T A;  5IM9 A;  4L8E A;  2YNX A;  1YF0 A;  4AJ7 A;  4X4J A;  20GS A;  2DSA A;  1ZZY A;  3ZRD A;  5CNW A;  4MMM A;  1U88 A;  3ZL5 A;  1G0T A;  3OR5 A;  1NSW A;  1GH2 A;  3WGX A;  3QOU A;  5ECL B;  3GA4 A;  2JZR A;  3LYK A;  1N8J A;  3TKQ A;  4ISD A;  5EPF A;  2YV9 A;  3CSI A;  3WD6 A;  2B1K A;  1SVL A;  5AN1 A;  3FR3 A;  1T00 A;  2HI7 A;  5ABR A;  4MF7 A;  2HSM B;  1DSB A;  2IME A;  2R4V A;  4LLR A;  1SL1 B;  1AIU A;  3IHG A;  3M3M A;  4HI7 A;  3EC3 A;  1OKD A;  1ILO A;  5E59 A;  1H4O A;  3SBC A;  4KF9 A;  3KM6 A;  2A4H A;  3LOR A;  4Q5F A;  3VI7 A;  1M2A A;  1EV9 A;  2MZC A;  4BVX B;  3FRC A;  1B48 A;  5F06 A;  2DBC A;  2DLX A;  4MA9 A;  3WGD A;  1K0C A;  2FA4 A;  1JLV A;  2HRK B;  2MMN A;  2H1A A;  3TJF A;  4KB3 A;  5AIV A;  4G0L A;  1Y25 A;  4BVY B;  3W6G A;  3TJJ A;  4ML6 A;  3IOS A;  4F03 A;  4IBP A;  5IPG A;  4POM A;  4HJ2 A;  3CRT A;  9GSS A;  3RPP A;  3EU4 A;  5J41 A;  1AQX A;  4MJB A;  2EFC A;  2OAD A;  1SL2 B;  2LNT A;  1SD8 A;  2WFC A;  2KP2 A;  3EUR A;  1NM3 A;  3PIN A;  3D0Z A;  4MJA A;  3LFL A;  2HT9 A;  3GN3 A;  1OAZ A;  3HVX A;  2P31 A;  1KBN A;  1F3A A;  1SEN A;  1ERW A;  3ZFL A;  12GS A;  4L5L A;  4K1F A;  1QXH A;  2DJ0 A;  2YWO A;  4ACS A;  1E6B A;  4WKW A;  2GST A;  4HZ2 A;  4EO3 A;  5ECO B;  4K2D A;  4ECC A;  1XIY A;  4HU7 A;  2DJ1 A;  1V57 A;  2VCX A;  2GQK A;  1PN0 A;  3HYP A;  1JZR A;  1XWB A;  6GSU A;  2HSM A;  1R26 A;  2VCW A;  5D9T A;  1ACV A;  3APO A;  3FZ5 A;  1EOG A;  3HVS A;  3AY8 A;  5HR1 A;  4KDY A;  1GTB A;  3HDC A;  4YH2 A;  5DJM A;  5J47 A;  2FWE A;  2OAC A;  5LCZ A;  3TRQ A;  1TK5 B;  4MPG A;  4J2F A;  3PR8 A;  2R0G A;  3LEF A;  3F0I A;  3FR9 A;  3FK8 A;  2PGT A;  5E4W A;  4BVX A;  2KLX A;  1PA3 A;  2F3M A;  4NV5 A;  5J9B A;  2LJA A;  1PN9 A;  3MAK A;  4QQ7 A;  2FWH A; 
#chains in the Genus database with same CATH homology
 3M0F A;  4TOP A;  2HRK A;  1FB6 A;  2C80 A;  2J23 A;  3MSZ A;  2QA2 A;  3D21 A;  4OFN A;  4Z2T A;  4TR1 B;  3KGK A;  5IO0 A;  2QGV A;  3MYD A;  4AGS A;  1HD2 A;  3BJ5 A;  5L71 A;  3IK9 A;  2N5B A;  4G10 A;  3KP9 A;  3V1W A;  4L5O A;  1O6J A;  2GT6 A;  2IMD A;  3FR6 A;  4IW9 A;  3G9B A;  3KTL A;  4ZB8 A;  2YOI A;  5EVO A;  1PD2 1;  1PRX A;  1MD4 A;  5CRH A;  1FVK A;  2OA7 A;  1VF3 A;  5CRG A;  4CW9 A;  3GTU B;  1T1V A;  1S3A A;  1M9B A;  2H70 A;  1FVJ A;  4IP1 A;  4AI6 A;  3DEX A;  2H1L A;  1A8L A;  4N0V A;  2H72 A;  2H30 A;  5J4V A;  3DXB A;  4TN8 A;  4ZL8 A;  3IR4 A;  4RQX A;  4P3Y B;  2C3N A;  2DJK A;  4CHS A;  2ZUP A;  3FZA A;  2CQ9 A;  1TW9 A;  4GCI A;  4EE0 A;  3SWL A;  1ZYE A;  1GSD A;  4K7O A;  2OE1 A;  3IXR A;  1TK0 B;  3VLN A;  5H5Q A;  3EU3 A;  1USB A;  3NOF A;  3F8U A;  2B5X A;  5G2Z A;  1XXU A;  2O7K A;  1O8X A;  2PVO C;  3BCK A;  2PPT A;  4NPB A;  4POK A;  4ML1 A;  3PPU A;  4PUA A;  1R5A A;  2JAC A;  3I69 A;  4G19 A;  1U87 A;  1QGV A;  3VK9 A;  3ZRE A;  1Z7R A;  4E8H A;  2FY6 A;  4F0C A;  4TR1 A;  1GSE A;  5F0G A;  5IMD A;  2PN8 A;  4I8B A;  1TU7 A;  1X9S B;  4ZL9 A;  3ZVJ A;  3C1S A;  1ZYN A;  4EXJ A;  3E9J B;  2FD3 A;  1A0R P;  3RAZ A;  2C3T A;  2VL9 A;  1PL2 A;  3RHB A;  2IIY A;  3ERF A;  3TDG A;  4MF6 A;  2CVB A;  3EIN A;  2RUF A;  4NV2 A;  3GNJ A;  1SYX A;  5IIZ A;  3GTU A;  2LV3 A;  1ZYQ B;  3NIV A;  3WT1 A;  3VUR A;  5KEJ A;  1QMV A;  4MJC A;  8GSS A;  5HR3 A;  1EWX A;  1GSF A;  1MDI A;  4YQM A;  4G2E A;  2MBT A;  4NHW A;  4HQS A;  3A3T A;  4PXO A;  14GS A;  4WR4 A;  1VF2 A;  1THX A;  2KHP A;  2CX4 A;  4MZB A;  3M8N A;  4OMV A;  3QD9 A;  3QMX A;  5ECN B;  3TUE A;  2PER A;  1O8W A;  3I9V 2;  2I4A A;  5D96 A;  5BMU B;  3ZLP A;  2VUP A;  3TCO A;  2GSQ A;  3UEM A;  5J40 A;  2GSR A;  2H75 A;  1DE1 A;  1A24 A;  2N5F A;  5G5F A;  6GSW A;  1DUG A;  4MH3 A;  3FZ9 A;  4RQR A;  1SK0 A;  4GRF A;  1DBY A;  2B3S A;  2NBS A;  2X8H A;  3ME8 A;  4K8M A;  5JCU A;  5B6N A;  6GSS A;  1GSQ A;  4K2X A;  4ZB7 A;  1VRS D;  2L6C A;  3C7M A;  5G5E A;  2HSN B;  2EFD A;  4A5P A;  2KP1 A;  5CAX A;  4V1A p;  1GNW A;  2C1Y A;  3MDK A;  3QCP A;  4KX4 A;  1V9W A;  3ZFB A;  3DML A;  1DE2 A;  4OO5 A;  3Q19 A;  3KMO A;  3GKX A;  3FMW A;  5HFG A;  2TRX A;  3GST A;  1AUC A;  1CQG A;  2LEG A;  3KP8 A;  4IS0 A;  2G0F A;  4IVF A;  2JZT A;  4PQI A;  5G1K A;  1K0B A;  3APQ A;  1X5C A;  4YQU A;  2V6O A;  4IQ1 A;  4K5S A;  5ECI B;  4OWY A;  4YQV A;  1G7E A;  3BCI A;  5BMU A;  4J57 E;  1B8X A;  2O5V A;  1B4P A;  2HLS A;  4XS6 A;  2JSY A;  2HSY A;  4DEJ A;  1F3B A;  1LU4 A;  4L0W A;  3F63 A;  3A2V A;  1Q4J A;  18GS A;  4WBR D;  2K8V A;  5GST A;  1QUW A;  1M7T A;  2GQL A;  1J9B A;  4FH8 A;  1HNA A;  3KD0 A;  4MF5 A;  3GKK A;  3ZVJ D;  1XBS A;  4BPY A;  3ZML A;  1ERU A;  3NZN A;  4E8E A;  5DQY A;  1EZK A;  4JBB A;  4FYB A;  4K0N A;  2G2Q A;  1M99 A;  3LQ7 A;  4O5R A;  2F8F A;  2HSN A;  1WIK A;  1RW1 A;  1GNE A;  3E0U A;  1V58 A;  1BAY A;  3EE2 A;  4D73 B;  2B5Y A;  1T3B A;  2I81 A;  1SKS B;  1BED A;  1URM A;  1TRU A;  1QK8 A;  1LBK A;  1W4V A;  2VO4 A;  2LNS A;  3EVI A;  2GSS A;  3DVW A;  2H6Y A;  4ICY A;  4DSS A;  1GP1 A;  3HCZ A;  2FNO A;  2H01 A;  4F9Z A;  4ECJ A;  1ABA A;  5D8I A;  4MP4 A;  1K3O A;  3G7I A;  3GHA A;  5ECR B;  1K0D A;  3HMJ G;  2E2G A;  5JWQ B;  2MMO A;  1AQW A;  2MYG A;  1TRS A;  2ZCT A;  2L4Q A;  4WF4 A;  2L4C A;  4WEY A;  4JZQ A;  4MCU A;  2A2R A;  2YV7 A;  5IMZ A;  1SK2 A;  4POB A;  3TRP A;  3KIJ A;  4MPF A;  3P7X A;  3QFB C;  5J9C A;  2FGX A;  2YWI A;  2R6K A;  1OC9 A;  5D73 A;  3IV4 A;  4AJ6 A;  4Q5N A;  4FYC A;  1O81 A;  2FA8 A;  4YKG A;  4XTS A;  3HJO A;  3ZZX A;  2PUK C;  1GUM A;  4NAX A;  4MLY A;  3WGE A;  1PMT A;  2LRC A;  4XRA A;  4BWQ A;  2DKI A;  1V98 A;  5ENU A;  1X5D A;  1T4Y A;  1TXX A;  4N10 A;  3TJK A;  3TRX A;  3HHV A;  5JCG A;  1TRV A;  2WDU A;  3TKR A;  2H73 A;  2O85 A;  2H66 A;  4TXV A;  5D93 A;  5A34 B;  5CP1 A;  4J56 E;  22GS A;  4G0K A;  4PQH A;  4EKZ A;  1X0R A;  4JE1 A;  3FY7 A;  1HYU A;  4JR6 A;  1N2A A;  5KOX A;  2LUS A;  2FWG A;  1V40 A;  3U6V A;  1JZD A;  2VKZ G;  3G7Y A;  1EOH A;  6GSV A;  2IWT A;  2EIR A;  1ERT A;  2DKH A;  1FOV A;  5D9W A;  2F51 A;  4JRR A;  2WB9 A;  2L5L A;  2HRN A;  1A2L A;  1QQ2 A;  3CSH A;  1JZO A;  5ID2 B;  3D22 A;  1J0F A;  2YJH A;  2R5G A;  1G6W A;  1UN2 A;  4G0I A;  3GSS A;  1AC1 A;  4POL A;  4BWS A;  3EPT A;  1X9M B;  2V1M A;  2DJ3 A;  1ZGN A;  1NHO A;  4RI7 A;  1SD9 A;  5DJL A;  4IKH A;  4I97 A;  2PBJ A;  1FAA A;  4FYU A;  3LYP A;  1UVZ A;  5J5N A;  5BRT A;  1S3C A;  3FHK A;  3G7J A;  2C0G A;  3CXG A;  4OCF A;  1R4W A;  3VWU A;  2R0P A;  5B6M A;  3M1G A;  2B5E A;  3TKS A;  1Y1U A;  5EY6 A;  1MDJ A;  7GSS A;  2OBI A;  4K9Z A;  5IOW A;  2YZU A;  1YZX A;  5FT3 A;  5F05 A;  1XW6 A;  1NW2 A;  4EDZ A;  2B7J A;  1TI1 A;  4EVM A;  2NTO A;  3GL5 A;  5FWG A;  2LRN A;  2TIR A;  2N5A A;  2HE3 A;  3GX0 A;  4BVY A;  2C0D A;  3PH9 A;  5CYY A;  3O3T A;  5DAK B;  4EUY A;  5DAL B;  2X49 A;  2DJJ A;  2REM A;  4TXO B;  3DGQ A;  2K6V A;  4JED A;  2ZNM A;  5ID2 A;  1S3D A;  4ZIJ A;  4CDO A;  1QFN A;  3FZ4 A;  3DIE A;  1GTI A;  1YKC A;  2P0G A;  2WGR A;  3HZ8 A;  5IMV A;  1F2E A;  4KND A;  3LXZ A;  1GSY A;  3QFA C;  3ISO A;  1K0M A;  1YJ6 A;  2HZE B;  3H79 A;  2C4J A;  2V32 A;  2C8U A;  3CTG A;  4N3Z A;  1A2M A;  3VWX A;  4ZXG A;  4NMU A;  2Z9S A;  3ZIV A;  3F3Q A;  1PKZ A;  4MH2 A;  5F07 A;  1EGR A;  1ZL9 A;  4ZBA A;  3EMX A;  1CQH A;  1TDI A;  1F9M A;  2CA8 A;  3DVX A;  5B7C A;  2QA1 A;  2RM5 A;  4GST A;  1IYH A;  1XWA A;  1BG1 A;  4BA7 A;  2OT3 A;  17GS A;  4HQZ A;  2E2M A;  5G1L A;  4K5R A;  4IQA A;  4Z2R A;  2O89 A;  1XVW A;  3K8N A;  4TR4 A;  2WS2 A;  5DAK A;  1PKW A;  1I5G A;  5A1N B;  5DAL A;  5LNK e;  2GTU A;  2LJR A;  1GUH A;  3CTF A;  2GZP A;  1G6Y A;  4KCA A;  2AHE A;  3QR6 A;  3N9J A;  3GYK A;  2CT6 A;  2J9H A;  2O87 A;  2O8V B;  4Q5R A;  1XWC A;  2X64 A;  5AIX A;  2E0Q A;  5KN2 A;  5A5H B;  3IAM 2;  2XHF A;  1ST9 A;  5GAP D;  2FHE A;  2XPE A;  2GS3 A;  3E3E A;  19GS A;  3QAW A;  3I43 A;  1X5E A;  5CRD A;  2HZE A;  4WF5 A;  11GS A;  3UVH A;  1KEB A;  2DIZ A;  1G7O A;  3GUR A;  1XWG A;  3BOA A;  1OYJ A;  2CZ2 A;  1ZOF A;  2HQT A;  3DKS A;  2P5R A;  2VCZ A;  3C73 A;  2KOK A;  1GL8 A;  2GLR A;  4AJ8 A;  3HJP A;  2VD1 A;  5CRW A;  3TKS C;  2AV4 A;  3WT2 A;  1WWJ A;  4ZB6 A;  1EGO A;  5HQP A;  4MZW A;  5HFI A;  3A5I A;  3ZYW A;  2K18 A;  4GQF A;  1ML6 A;  2HNL A;  2EIQ A;  4QL9 A;  1E2Y A;  3O76 A;  2IN3 A;  2M72 A;  4NHZ A;  3UL3 A;  4KSO A;  3HXS A;  1WPI A;  2VAF A;  1SU9 A;  2A2S A;  5A1N A;  5DVB A;  3S9F A;  5KOW A;  1YEX A;  2P5Q A;  4V2L A;  2HXK A;  5CRE A;  1XFL A;  4HS1 A;  4KA0 A;  2QSI A;  2H0I A;  3KEB A;  3L78 A;  3IRA A;  1U6T A;  3J7Y b;  1ON4 A;  4ZIL A;  4MNN A;  2DMM A;  4O32 A;  5A5H A;  2H6X A;  1A2J A;  1XWK A;  1OE7 A;  3R3E A;  1C72 A;  1MDK A;  1O85 A;  4O7H A;  3TOU A;  2M46 A;  1BQ7 A;  2LTK A;  2F9S A;  6GSY A;  2FCH A;  3IAS 2;  2GZY A;  5J3R A;  2JL4 A;  10GS A;  2FWF A;  4PQ1 A;  5IMC A;  3TJG A;  1W89 A;  1IYI A;  1TXU A;  1RK4 A;  1XPV A;  3FEU A;  5D9X A;  4OD7 A;  2B7K A;  4QMK A;  2X8G A;  2QKE A;  1ZYP A;  3F9U A;  2JSZ A;  1KNG A;  2YP6 A;  1BJX A;  1UA5 A;  1EP8 A;  3HD5 A;  3H1N A;  2DML A;  2UZ8 A;  2IMI A;  1K0O A;  4YKF A;  2OKA A;  4K6X A;  1PSQ A;  4BL7 B;  4EIP A;  1OKT A;  2TRC P;  4XCS A;  2PMT A;  1TJD A;  5ECM B;  4ILF A;  4EDY A;  2H1G A;  1BG5 A;  3UAP A;  2PU9 C;  3DYR A;  1MEK A;  4ECI A;  2VLV A;  2YPM A;  3GKN A;  3UMA A;  5IO2 A;  1B4Q A;  2WJU A;  4AKG A;  4LMW A;  4PUR A;  4QL7 A;  3F4R A;  5C04 A;  1T7P B;  4Z7X A;  4X43 A;  3LXT A;  5J4U A;  1NHY A;  3HVV A;  1TTZ A;  3MNG A;  2I9H A;  2CX3 A;  4LMV A;  1M2B A;  3CRU A;  1SK1 A;  1Z6M A;  4H86 A;  4K7I A;  1TOF A;  5H5R A;  3ME7 A;  1GSS A;  3TB2 A;  2CZ3 A;  4TR3 A;  4WET A;  4NXI A;  1MD3 A;  4NWY A;  4KAE A;  4DSQ A;  3GIX A;  4TW5 A;  4GXZ A;  3LW9 A;  2GT5 A;  1VF4 A;  2HSH A;  3TJB A;  3QAV A;  4O92 A;  3KTB A;  2VM2 A;  2H0H A;  1K0N A;  1T4Z A;  3MIX A;  2IL3 A;  3IK7 A;  1RQM A;  4KDX A;  2VM1 A;  2JZS A;  2OBK A;  2VCQ A;  2VLT A;  1HNC A;  4GF0 A;  3GX8 A;  1GTA A;  1XW9 A;  2WZ9 A;  5D9V A;  3VWW A;  1M0U A;  1EP7 A;  1FO5 A;  2V41 A;  2PWJ A;  4MJE A;  2MMA A;  3LWA A;  2AUV A;  5AIS A;  3TU3 B;  4BL7 A;  4HZ4 A;  1XZO A;  3KJY A;  3P90 A;  2E7P A;  2YZH A;  5INY A;  3DRN A;  4ZB9 A;  4Z2U A;  4MDC A;  4FQU A;  4CY6 A;  1Z6N A;  5HFK A;  6GSX A;  1YDK A;  4D73 A;  1A8Y A;  3KXO A;  1PL1 A;  5DQS A;  1VGL A;  4HU9 A;  1HNB A;  5IOX A;  2IFQ B;  3GRX A;  2H1D A;  1SKW B;  4MZC A;  3RPN A;  4WR5 A;  4OCE A;  3QDN A;  4WBJ A;  4I2T A;  5A5K A;  2CAQ A;  4HUA A;  3HKR A;  2ES7 A;  2LQQ A;  4L0U A;  1SYR A;  1R7H A;  3EMP A;  2VL2 A;  1VF1 A;  4N11 A;  4YAP A;  4IGJ A;  3RDW A;  4JU5 A;  1PX7 A;  3UIW A;  4USS A;  1SVM A;  2VLU A;  1A23 A;  2HRA A;  2YAN A;  4ECB A;  1XCC A;  3ED3 A;  2DJ2 A;  4EF0 A;  5KN3 A;  1EEJ A;  3M9K A;  1TP9 A;  3C1R A;  3WYW A;  3LG6 A;  5A4V A;  1TK8 B;  3GH9 A;  2LKU A;  4W66 A;  3TGZ A;  4PX1 A;  4I6X A;  2R2J A;  2AJQ B;  1AXD A;  3L9V A;  3FKF A;  1U3I A;  3QPM A;  4V2N A;  4OFT A;  1EEM A;  3C8E A;  4Q5Q A;  1YKA A;  1FG4 A;  4O5U A;  4HOJ A;  2CAI A;  5ELG A;  4IHU A;  1PX6 A;  1M2D A;  1O7U A;  1OVN A;  3ZIJ A;  4AKX B;  2H19 A;  2OJL A;  3APS A;  2WUL A;  1GUK A;  4KGI A;  4ZBD A;  4XHM A;  1TRW A;  1YVL A;  5A34 A;  2NPB A;  1JLW A;  4XS1 A;  1PGT A;  2IFQ A;  5JWR B;  3L9S A;  2EIO A;  2I1U A;  4DSR A;  2X4A A;  2CV4 A;  4LA1 A;  1AAZ A;  1JFU A;  2ON7 A;  2V6K A;  4OO4 A;  4PGT A;  2VD0 A;  2H8L A;  1Z7P A;  2UV8 G;  1ZMA A;  1B9X C;  5HR0 A;  5H5S A;  4O5Q A;  1FOH A;  4HEA 2;  3HJM A;  4ZBB A;  2HZF A;  3ERW A;  16GS A;  4KSM A;  2FLS A;  2C0F A;  1GLQ A;  3MWH A;  2NVL A;  1LJR A;  3HY2 A;  3P8W A;  3HA9 A;  3EWL A;  3F3R A;  2RII A;  2ON5 A;  4IJ3 A;  3VPT A;  5J4Y A;  2H6Z A;  2R3X A;  4KDU A;  3IC4 A;  2LS5 A;  2YJ7 A;  1OE8 A;  4MAB A;  2YCD A;  4PTS A;  1SJ6 A;  3KZQ A;  1F6M C;  3I6A A;  3TOT A;  5JWO B;  4AF2 A;  3LGC A;  5DDL A;  2IMF A;  3BBY A;  3IHQ A;  4EIQ A;  6GST A;  3W8J A;  2H74 A;  1B9Y C;  1T8E B;  4PNF A;  1FB0 A;  2AYT A;  3FW2 A;  4ULX A;  3Q6O A;  4X1U A;  4XIH A;  3IA1 A;  2RM6 A;  5IMF A;  3A2W A;  3US3 A;  3F6F A;  1O73 A;  1GWC A;  1GRX A;  3P2A A;  2B6M A;  1H75 A;  1PQN A;  1BYE A;  4HJM A;  1YY7 A;  5A4W A;  2V2G A;  3VI5 A;  3KH9 A;  2IJY A;  2LST A;  1K0A A;  2CVK A;  3HZ4 A;  1ZCP A;  2M80 A;  3GKM A;  1SJI A;  5C00 A;  5DCG A;  1BF5 A;  1X9W B;  1JHB A;  3UVT A;  2EFE A;  3F6D A;  2GQM A;  1XW5 A;  3N5O A;  5ECP B;  4TKY A;  5ECH B;  4TXO A;  2VIM A;  2C0E A;  1M9A A;  3KCM A;  3A2X A;  5ELA A;  13GS A;  3UOM A;  4IN0 A;  3D6I A;  3UAR A;  3D4M A;  2DC5 A;  4FIW A;  2VL2 C;  2HRF A;  2RUE A;  2H76 A;  4V2M A;  4GSN A;  2MMZ A;  4DVC A;  4GLT A;  4FO5 A;  2PVQ A;  1K3Y A;  2JAD A;  4K0G A;  4YAV A;  2DIY A;  1HQO A;  1KTE A;  3M9J A;  1EV4 A;  3W8S A;  4PNG A;  5AGY A;  3DWV A;  1Z9H A;  2LQO A;  1TKD B;  5G30 A;  3ZTL A;  1MTC A;  3GL3 A;  4RI6 A;  2AB6 A;  2JU5 A;  2H71 A;  2FUG 2;  4GDF A;  3CYN A;  2LRT A;  5IMA A;  1SKR B;  1A0F A;  1Z3E A;  4IP6 A;  1ERV A;  3IC8 A;  4N30 A;  2VCT A;  1YEP A;  1V2A A;  5ECK B;  1GLP A;  3ZMK A;  4WXT A;  3GMF A;  2BTO T;  1FW1 A;  2IPA A;  3H93 A;  3J7Y k;  3IBH A;  5EL8 A;  3PGT A;  3EYT A;  2B1L A;  4G9H A;  1GTU A;  1AQV A;  4F0B A;  2OE0 A;  1R5P A;  2HFD A;  1F37 A;  3DD3 A;  3CWG A;  4KH7 A;  2X8C A;  5F8B A;  5KN1 A;  3KMN A;  3IPZ A;  5IQY A;  1JZW A;  5FHI A;  4GWR A;  1WOU A;  3GH6 A;  4N0Z A;  2C3Q A;  4ZL7 A;  2XBI A;  1UC7 A;  2BJX A;  5KN0 A;  1GUL A;  2AAW A;  2H0G A;  2VOC A;  4AKH A;  2HYX A;  4HDE A;  2F8A A;  2K9F A;  1FHE A;  3QAG A;  4EC0 A;  2H1B A;  3VFI A;  3KH7 A;  5HR2 A;  4F82 A;  1I9D A;  2GDR A;  2RLI A;  4TRX A;  4PUF C;  5ECQ B;  2WRT A;  2EC4 A;  3RHC A;  1OC3 A;  3TKP A;  3F4S A;  3Q18 A;  2R37 A;  1N25 A;  2OE3 A;  4JR4 A;  3IE3 A;  1XVQ A;  2K8S A;  4TVE A;  3CMI A;  2L5O A;  2GGT A;  3D5J A;  4DSS B;  4GTU A;  1XOA A;  5B8A A;  2D2Z A;  2CVD A;  5LD0 A;  3JCM L;  4G01 A;  3Q74 A;  2GZZ A;  2IMK A;  4XRD A;  3VPQ A;  2A2P A;  3TKS E;  1WE0 A;  1SL0 B;  2VL3 A;  4OFM A;  3U5R E;  4KCE A;  4K7N A;  4XS4 B;  3GFK A;  5GZZ B;  3BD2 A;  1XOB A;  1SJZ A;  4I5Q A;  1J08 A;  1Q98 A;  5GSS A;  1YQ1 A;  2QC7 A;  4MK3 A;  4GSS A;  3H8Q A;  4IJI A;  5DBQ A;  4EL1 A;  2YWM A;  3L4N A;  5COH A;  2VCV A;  3VWV A;  3ZIT A;  1OC9 B;  2A4V A;  2GVP A;  3ERG A;  3C71 A;  4TR0 A;  4E68 A;  4I2U A;  3CBU A;  4AKI A;  1GSU A;  3H4K A;  1OC8 A;  2L57 A;  5CO3 A;  2MBS A;  1AW9 A;  1YF1 A;  5IPH A;  5B8B A;  3LJR A;  2NDO A;  3LSZ A;  4GQC A;  1Z5Y E;  4LL4 B;  3RBT A;  5A4U A;  4KUN A;  3CSJ A;  5GAN D;  3A5W A;  4KE3 A;  4F2I A;  4X0X A;  1WMJ A;  5ECS A;  2WCI A;  2XPD A;  4LL1 B;  4V1A g;  5G31 A;  4CY8 A;  2L6D A;  2YN1 A;  3UJ1 A;  2L59 A;  3F4T A;  3UBK A;  2BMX A;  3GUS A;  5DCH A;  1K3L A;  2I3Y A;  4KW6 A;  1SVO A;  1TU8 A;  1WJK A;  1BX9 A;  3GV1 A;  3UBL A;  3IDV A;  2ALB A;  3L9U A;  1TI3 A;  2YWN A;  1Y6E A;  2EFH A;  5JCW A;  1THO A;  4ID0 A;  1WP0 A;  3R2Q A;  2R0C A;  2KUC A;  4RUV A;  2XC2 A;  3FYG A;  4XS4 A;  4IEL A;  3L0H A;  1U3A A;  3O6T A;  2XBQ A;  1WRY A;  2LJK A;  2X99 A;  3D4T A;  5IM9 A;  4L8E A;  2YNX A;  1YF0 A;  4AJ7 A;  4X4J A;  20GS A;  2DSA A;  1ZZY A;  3ZRD A;  5CNW A;  4MMM A;  1U88 A;  3ZL5 A;  1G0T A;  3OR5 A;  1NSW A;  1GH2 A;  3WGX A;  3QOU A;  5ECL B;  3GA4 A;  2JZR A;  3LYK A;  1N8J A;  3TKQ A;  4ISD A;  5EPF A;  2YV9 A;  3CSI A;  3WD6 A;  2B1K A;  1SVL A;  5AN1 A;  3FR3 A;  1T00 A;  2HI7 A;  5ABR A;  4MF7 A;  2HSM B;  1DSB A;  2IME A;  2R4V A;  4LLR A;  1SL1 B;  1AIU A;  3IHG A;  3M3M A;  4HI7 A;  3EC3 A;  1OKD A;  1ILO A;  5E59 A;  1H4O A;  3SBC A;  4KF9 A;  3KM6 A;  2A4H A;  3LOR A;  4Q5F A;  3VI7 A;  1M2A A;  1EV9 A;  2MZC A;  4BVX B;  3FRC A;  1B48 A;  5F06 A;  2DBC A;  2DLX A;  4MA9 A;  3WGD A;  1K0C A;  2FA4 A;  1JLV A;  2HRK B;  2MMN A;  2H1A A;  3TJF A;  4KB3 A;  5AIV A;  4G0L A;  1Y25 A;  4BVY B;  3W6G A;  3TJJ A;  4ML6 A;  3IOS A;  4F03 A;  4IBP A;  5IPG A;  4POM A;  4HJ2 A;  3CRT A;  9GSS A;  3RPP A;  3EU4 A;  5J41 A;  1AQX A;  4MJB A;  2EFC A;  2OAD A;  1SL2 B;  2LNT A;  1SD8 A;  2WFC A;  2KP2 A;  3EUR A;  1NM3 A;  3PIN A;  3D0Z A;  4MJA A;  3LFL A;  2HT9 A;  3GN3 A;  1OAZ A;  3HVX A;  2P31 A;  1KBN A;  1F3A A;  1SEN A;  1ERW A;  3ZFL A;  12GS A;  4L5L A;  4K1F A;  1QXH A;  2DJ0 A;  2YWO A;  4ACS A;  1E6B A;  4WKW A;  2GST A;  4HZ2 A;  4EO3 A;  5ECO B;  4K2D A;  4ECC A;  1XIY A;  4HU7 A;  2DJ1 A;  1V57 A;  2VCX A;  2GQK A;  1PN0 A;  3HYP A;  1JZR A;  1XWB A;  6GSU A;  2HSM A;  1R26 A;  2VCW A;  5D9T A;  1ACV A;  3APO A;  3FZ5 A;  1EOG A;  3HVS A;  3AY8 A;  5HR1 A;  4KDY A;  1GTB A;  3HDC A;  4YH2 A;  5DJM A;  5J47 A;  2FWE A;  2OAC A;  5LCZ A;  3TRQ A;  1TK5 B;  4MPG A;  4J2F A;  3PR8 A;  2R0G A;  3LEF A;  3F0I A;  3FR9 A;  3FK8 A;  2PGT A;  5E4W A;  4BVX A;  2KLX A;  1PA3 A;  2F3M A;  4NV5 A;  5J9B A;  2LJA A;  1PN9 A;  3MAK A;  4QQ7 A;  2FWH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...