1PD21

Crystal structure of hematopoietic prostaglandin d synthase complex with glutathione
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
199
structure length
199
Chain Sequence
b'MPNYKLLYFNMRGRAEIIRYIFAYLDIKYEDHRIEQADWPKIKPTLPFGKIPVLEVEGLTLHQSLAIARYLTKNTDLAGKTELEQCQVDAVVDTLDDFMSLFPWAEENQDLKERTFNDLLTRQAPHLLKDLDTYLGDKEWFIGNYVTWADFYWDICSTTLLVLKPDLLGIYPRLVSLRNKVQAIPAISAWILKRPQTKL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HEMATOPOIETIC PROSTAGLANDIN D SYNTHASE
publication title Cloning and crystal structure of hematopoietic prostaglandin D synthase.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Ligase
total genus 70
structure length 199
sequence length 199
chains with identical sequence 2
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 1998-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
1 PF02798 GST_N Glutathione S-transferase, N-terminal domain
1 PF14497 GST_C_3 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 1pd2102
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1pd2101
1FO5A 2VCXA 1OKDA 3HZ4A 4KH7A 2E0QA 1KBNA 1GUKA 2RIIA 1MD3A 2CX3A 3EE2A 3CTGA 1IYIA 1Y25A 3QCPA 2CV4A 1XCCA 4MZCA 2LEGA 4RQXA 2AAWA 1V2AA 4G9HA 4IBPA 4GF0A 3GRXA 3IE3A 3AY8A 3GIXA 4PUFC 1V98A 5IMFA 4F9ZA 1TK0B 4E8EA 1ACVA 4O92A 3KZQA 2DJ2A 2VL3A 4QL7A 4F03A 5HQPA 2H19A 2IMIA 3UARA 2HRFA 5BMUA 5DCGA 1JZDA 5G30A 3CBUA 1SL2B 1USBA 3DGQA 2B6MA 2V41A 5FHIA 2AUVA 3VLNA 4AJ7A 5DDLA 1I5GA 4PQHA 2H1AA 1XW5A 5LCZA 4XTSA 1GNWA 3QFBC 2O8VB 5COHA 3KP8A 1ERTA 3QAWA 2KP2A 1B4PA 3TKPA 1M7TA 2JSYA 4OFMA 1F9MA 3FR3A 4IQAA 2FY6A 2YPMA 3NOFA 3PPUA 4F0BA 2H73A 5IMCA 1GSUA 2DJJA 4TR3A 4XCSA 2K6VA 4BL7B 2R37A 3VPQA 1X5DA 3QAVA 3FZ5A 3QR6A 1SJZA 5KN3A 2FHEA 1OC8A 3TOUA 2F3MA 4NHWA 1GL8A 3LQ7A 1OVNA 2HQTA 4XRDA 2CT6A 4V2LA 4KF9A 3QD9A 2LUSA 2GZPA 5D8IA 1SJ6A 1N8JA 1A2LA 4PQIA 1SKRB 1ZYQB 1K0AA 3M8NA 1R4WA 3VURA 3F4TA 4L5OA 5ECOB 5G31A 3FEUA 3F63A 4BL7A 3ZZXA 4HS1A 2YWMA 4EF0A 4GTUA 2M80A 1PL2A 2H72A 4TOPA 14GSA 4PNFA 3EU4A 2WZ9A 5D93A 1EP7A 3EMPA 3MSZA 2AB6A 3TKSE 3CTFA 1YF1A 4JEDA 1X0RA 4F2IA 5D9XA 3UVHA 2O89A 3ZTLA 2BJXA 2ZNMA 5JWOB 4KDUA 3FW2A 1BG5A 1A8YA 3UBLA 1ERUA 2LNTA 2KHPA 1M2AA 9GSSA 1GTUA 1XVWA 3DWVA 3MWHA 5CYYA 2AJQB 2LQOA 4O5RA 1J9BA 1UA5A 3S9FA 2OACA 1KNGA 3WT2A 1G6YA 1O8WA 2L57A 5IM9A 4ZILA 4MH3A 3HA9A 1GUHA 3LXTA 5HR0A 1SYRA 1DE1A 1XBSA 3D21A 3I9V2 4MJEA 1WIKA 3TRXA 1ZYEA 2AYTA 5JWRB 5B6MA 3P7XA 5ECKB 3ZREA 4ECCA 1QUWA 5EL8A 2OA7A 2PU9C 3M1GA 2KLXA 2HSMB 2FGXA 1U88A 1O81A 2L5LA 1SYXA 5HFIA 1ML6A 5ECPB 4G10A 4ZBAA 3H79A 4Q5RA 3UOMA 4MZWA 2IWTA 4TXVA 1B9XC 4MZBA 1ZZYA 2GZZA 1YQ1A 2H0HA 2N5AA 2N5BA 5CRWA 1GRXA 3M3MA 4KB3A 4BVYB 1K0BA 1V58A 2YJ7A 2PMTA 3HD5A 2DIZA 4PUAA 2I3YA 2YANA 2DMLA 1YDKA 2HSMA 3QOUA 3DD3A 3H1NA 2DBCA 1NHYA 4X43A 4NPBA 5GSSA 3CSJA 5DCHA 4IGJA 5H5QA 2GTUA 5AIVA 2XHFA 2CQ9A 3IAM2 1PD21 5INYA 4ZL7A 1ZMAA 3TOTA 4L0WA 2MZCA 4IP6A 3GURA 1FG4A 1GSYA 3F0IA 4FYCA 4BVYA 3KCMA 2C80A 1T4ZA 3L78A 3QPMA 3Q74A 3ZYWA 5DBQA 4Z7XA 2YZHA 4V2MA 2RM6A 3LWAA 4IQ1A 2HSHA 4EXJA 2LJKA 4I6XA 3UJ1A 4AJ6A 4I8BA 3FZ4A 3IA1A 4K7OA 1KTEA 1M9AA 1H4OA 4IP1A 4XIHA 2HSNB 3DVWA 1PGTA 5H5SA 2VCTA 2KP1A 2OKAA 3L9UA 1VF4A 5FT3A 1GUMA 3KMOA 3UEMA 1JLVA 5KEJA 3FHKA 18GSA 2PBJA 3KTBA 4ECJA 2JL4A 1MEKA 4AJ8A 5GAND 2XBIA 3TRQA 3L4NA 2JZRA 2WDUA 1OC9B 3GKXA 2VM2A 2MMZA 5KN0A 1K0CA 5B8BA 2VCWA 3F6FA 5G5FA 1XWAA 3I6AA 2CA8A 4PXOA 2KOKA 4TR0A 1JFUA 4KE3A 2TRCP 2CVKA 4BVXB 4MCUA 1SK1A 3TB2A 3F4SA 1XOBA 4DSRA 1K0OA 4XS4B 2PUKC 2F51A 1EEJA 1NW2A 3TJJA 5JWQB 1GP1A 2JU5A 2ON7A 3KH7A 2MMNA 4ILFA 4FYUA 2IPAA 1OC9A 1R5AA 4GXZA 4G19A 1EZKA 4HUAA 4USSA 1F2EA 3HCZA 1EGOA 4I2TA 3ZIVA 3H93A 2WCIA 4KGIA 1KEBA 4BVXA 2YV7A 3DEXA 2LV3A 3D5JA 4MPFA 4RUVA 2ES7A 1PKWA 4RQRA 4XS4A 1SK2A 4LL4B 4NV5A 2V2GA 3EYTA 5CRHA 3RHBA 1J0FA 2H6ZA 4KSOA 4TR1B 1WPIA 3Q6OA 3U6VA 4E8HA 3LFLA 4YH2A 1ILOA 2I4AA 2FA4A 1FB6A 3ZIJA 2VD0A 2KUCA 3LEFA 2HI7A 3RPNA 1VGLA 2YNXA 2AV4A 3WGEA 1A8LA 3IPZA 3CSHA 3WGXA 5ECMB 4NV2A 5CAXA 3TKSC 2C0GA 4WBJA 3DXBA 5HR3A 1SD9A 2OE0A 1E6BA 2RUEA 3F3RA 4TR1A 2IFQB 2FCHA 1PX6A 3WGDA 4GSTA 2WULA 3UAPA 1A0FA 4BWQA 1X9SB 3L9VA 1V40A 2GGTA 2B5EA 4TRXA 1HNAA 3ZMKA 1EP8A 1GSEA 5D96A 2C0FA 22GSA 1URMA 4WEYA 3D0ZA 3GUSA 3GSSA 2MMOA 4IKHA 3APOA 3GX8A 1TP9A 5J9BA 4K7NA 2DC5A 1Z5YE 3O6TA 1GLPA 4NXIA 1B8XA 5D9WA 4ZL8A 4POLA 2IFQA 1O73A 1XXUA 3HXSA 2P0GA 3M9JA 3IDVA 1B9YC 4GQCA 1ZL9A 1K3OA 1TU8A 2IMDA 4QQ7A 1HYUA 3ERFA 1G7EA 1Z7RA 3GKMA 2VL2C 2GVPA 2H1GA 1T4YA 4ML6A 1GSDA 4RI6A 4WETA 3C71A 3RAZA 2X8HA 2O87A 3TJBA 3F3QA 3FZ9A 4XRAA 5JCWA 2CVDA 2PGTA 1FAAA 4I2UA 2GSSA 1W4VA 3HY2A 5J3RA 2DJKA 1GLQA 3UMAA 5E4WA 1GNEA 4OD7A 2X8CA 2HLSA 3SBCA 4Q5QA 5DJLA 1C72A 4ECIA 3WD6A 1QFNA 2DIYA 2I1UA 3BCIA 1OYJA 4HZ2A 4HQSA 4MABA 4TN8A 1HD2A 1BAYA 1BQ7A 1HQOA 4HDEA 3GA4A 2H75A 5DQSA 3VWVA 2HRKB 5F07A 4ZL9A 1GWCA 5G5EA 2IL3A 5ABRA 2HZFA 2CAQA 2M72A 4FH8A 1XPVA 2B5YA 2LQQA 2QKEA 5L71A 2OADA 2CAIA 1CQHA 4IN0A 3H4KA 2TRXA 1T7PB 1PMTA 6GSTA 1S3AA 3DKSA 1XWCA 3GTUB 4MK3A 1AQXA 3A3TA 3LG6A 2REMA 1GTBA 2VD1A 2YWOA 3KP9A 2JZTA 4EE0A 2EIQA 2HRKA 3KIJA 4GSNA 1XWBA 1TJDA 3KTLA 2CZ3A 2JADA 4WF4A 4JRRA 2H0IA 1X5CA 3UVTA 1EOGA 3I69A 1FHEA 1G0TA 4HOJA 1SK0A 17GSA 1PQNA 1PN9A 3GTUA 2A2SA 1YEXA 1OE7A 1BJXA 4Q5NA 4BPYA 2VL9A 4KNDA 1X9WB 3KH9A 3ZFLA 4V2NA 3W8JA 1DUGA 2H76A 1M99A 2X64A 2C3TA 2GQMA 5F06A 4MLYA 3BCKA 4TR4A 3NIVA 1OKTA 1FW1A 4HZ4A 2IMFA 5ECIB 1SL0B 3RBTA 1J08A 4O7HA 3UL3A 1TTZA 2MYGA 3NZNA 3LJRA 5DVBA 2VLTA 2C0DA 4WKWA 2H6XA 1A24A 4KCAA 3P90A 4ACSA 4L0UA 1YJ6A 3DIEA 1EEMA 2CX4A 3ZLPA 3KXOA 4OFNA 2YN1A 1QK8A 4ZBBA 1O6JA 5ELGA 1GH2A 5EPFA 3ED3A 4ISDA 4OO5A 1HNBA 1E2YA 1ZOFA 4POKA 2XPEA 3TKSA 5A4WA 4D73B 4K0NA 1TRSA 3CMIA 2DJ0A 4POBA 1M2BA 4OCFA 1F3AA 1UN2A 1TRVA 4JU5A 4IHUA 5IO2A 5CRDA 2DJ3A 8GSSA 4DSSB 1DBYA 2H1BA 2GQKA 5IPHA 5IOWA 4DVCA 3IHQA 3CRTA 1XZOA 3BOAA 1VRSD 2B1LA 3HVXA 5A5KA 2V1MA 2B1KA 6GSXA 3ME8A 4EC0A 4J56E 4WXTA 4MP4A 4D73A 4XS6A 1B48A 2DSAA 3O76A 5G1LA 2I9HA 4GCIA 5AN1A 5IIZA 1WJKA 2NDOA 2I81A 1ZCPA 3TRPA 4PQ1A 2GLRA 1YKAA 2IMEA 1XWGA 2K8VA 1BYEA 1TOFA 4DSSA 7GSSA 1QMVA 3C1SA 3O3TA 4PNGA 1BX9A 5ECLB 2H30A 2HSYA 2LSTA 4IW9A 1EOHA 3ERGA 2R5GA 3HZ8A 2VL2A 3IAS2 3APQA 3PGTA 3E3EA 1Z7PA 2ON5A 2YP6A 1AW9A 3F6DA 3MNGA 4N11A 5CP1A 4GSSA 1SU9A 1T1VA 1A2MA 4KCEA 5CNWA 5IQYA 2C8UA 1YEPA 2QGVA 1XW9A 2GT5A 2VOCA 3GNJA 3KJYA 1TRUA 2YZUA 5DQYA 1H75A 3US3A 3G7IA 2A2RA 3L0HA 4OO4A 1LJRA 3KM6A 1WRYA 2LJAA 3IRAA 1UVZA 4HJ2A 1Z6NA 4GRFA 3I43A 3HJOA 5DJMA 2R6KA 4ECBA 4OCEA 4NAXA 4OMVA 2OJLA 2NTOA 2QC7A 3W8SA 3TDGA 2WGRA 4ZXGA 1TI1A 5DALB 1G7OA 3D4MA 4FYBA 4I5QA 4POMA 1U6TA 2MBTA 1R7HA 2WS2A 1OC3A 4YQMA 3ZITA 2LNSA 1GSFA 3UIWA 12GSA 2EC4A 1YY7A 2J9HA 3A2XA 4KAEA 3KGKA 4Q5FA 2LS5A 2VLUA 3ZL5A 2YCDA 5A4VA 10GSA 3CRUA 1JZRA 1T00A 4K6XA 3Q18A 1TI3A 2J23A 3N9JA 1VF2A 5DALA 4BWSA 2R2JA 1WMJA 3BJ5A 1M0UA 3VI7A 5LNKe 3GYKA 1PKZA 2C1YA 5EY6A 2NBSA 1AXDA 4CW9A 5AGYA 5IMZA 3R3EA 5IMVA 1EV4A 1TW9A 1ST9A 5HR1A 2H70A 2HE3A 1GTIA 2V6OA 4MJCA 2YV9A 3VI5A 4EDYA 3C7MA 1ERVA 2BMXA 3M0FA 2H1DA 1JLWA 2OE1A 4MH2A 4FQUA 5AISA 4X1UA 3F8UA 5LD0A 6GSYA 4N0ZA 2G0FA 4TXOB 3OR5A 2IN3A 4WR4A 2L4QA 4HJMA 19GSA 1SKWB 3HVVA 2PVOC 6GSWA 4XS1A 3UBKA 3FZAA 3P2AA 3TJFA 1PL1A 4MF6A 2X99A 3QFAC 1U3AA 1LBKA 1K0NA 3IK7A 2ZCTA 5HFKA 1TXXA 2CZ2A 4KSMA 4NHZA 2CVBA 2H6YA 3IXRA 1Z9HA 6GSSA 4JR4A 4YAVA 4V1Ag 4CDOA 4TXOA 1CQGA 1RW1A 3DRNA 5E59A 1QXHA 4MPGA 3GV1A 2MBSA 1JZWA 2NPBA 4LMVA 5IMDA 4LL1B 1IYHA 5FWGA 3G9BA 1OE8A 2B7JA 2FA8A 1F37A 1TK5B 2B5XA 5IMAA 1XIYA 3TKQA 2BTOT 3GH9A 3D6IA 3LSZA 3VK9A 3EMXA 1F6MC 3GMFA 16GSA 4KDYA 3ZRDA 1X9MB 1SENA 2VCVA 4WF5A 3ZVJA 5F8BA 3F9UA 1PX7A 2OBKA 1VF1A 4ULXA 3QMXA 3FK8A 3VPTA 4RI7A 2IMKA 3J7Yb 2B7KA 2PPTA 3APSA 2RLIA 4I97A 3SWLA 2PERA 2RUFA 2GDRA 5F0GA 5A4UA 1THXA 2P5RA 3CYNA 2Z9SA 1U87A 1S3CA 3BBYA 2F9SA 2UZ8A 3EVIA 3K8NA 5C00A 3RHCA 4P3YB 3IC8A 4DSQA 4HU7A 5GSTA 4JR6A 4N10A 1WE0A 5J4UA 5IO0A 3TJKA 5ENUA 2OE3A 1K0MA 5D9VA 1AUCA 2GSTA 3IC4A 2HYXA 2AHEA 2GSQA 2MMAA 4LA1A 4IELA 2FWGA 1SL1B 2V32A 3EINA 1XVQA 2K18A 2GSRA 2PWJA 4K0GA 1WWJA 4XHMA 1Z3EA 1TK8B 4ZB9A 4TVEA 2WRTA 3QDNA 2YWNA 1AC1A 2WJUA 5H5RA 1AIUA 4G0IA 4N0VA 4K1FA 4DEJA 3EC3A 3LXZA 4G2EA 4L8EA 1R26A 1N2AA 2IIYA 1EV9A 2HRAA 3R2QA 5ECSA 2FWHA 2JSZA 4KUNA 3HKRA 4ID0A 2XC2A 2PN8A 2P5QA 2L4CA 3CXGA 3E0UA 1GSQA 1SJIA 2L6CA 1MDKA 3GFKA 2V6KA 4KDXA 2F8FA 2DJ1A 5B8AA 4ZB8A 1YKCA 4PX1A 5J41A 4JE1A 2HT9A 1YF0A 1EGRA 3FY7A 3E9JB 1TU7A 2LRTA 3DMLA 5G1KA 4YAPA 4F82A 2ALBA 1W89A 5KN1A 2A4VA 4ZIJA 3DVXA 3LYKA 3C8EA 1QGVA 2VUPA 1V9WA 3GL5A 3L9SA 4JZQA 3LORA 3VWUA 1XW6A 4KX4A 3P8WA 3WYWA 4LLRA 2X8GA 4PTSA 1ZGNA 3IV4A 4JBBA 2EIRA 2VIMA 2WB9A 4EUYA 2YOIA 3HYPA 2GT6A 1Q98A 5ELAA 4J57E 5AIXA 4ML1A 3A2WA 5HFGA 2C0EA 4IJ3A 1O8XA 3HDCA 3U5RE 1FVJA 2O7KA 2YWIA 2HZEB 3A2VA 1XOAA 2PVQA 1GSSA 4YQUA 2DMMA 2OBIA 2JACA 4ZB6A 4GQFA 3VWXA 3MAKA 4NWYA 4ZBDA 1RQMA 1FOVA 3LYPA 3TGZA 4V1Ap 4OFTA 1V57A 2FWFA 2C3NA 4HI7A 5DAKB 4K2DA 2P31A 4MF7A 1BEDA 3D4TA 5IPGA 4X0XA 4KA0A 20GSA 2HZEA 4J2FA 5G2ZA 2H74A 1ON4A 4KW6A 3N5OA 3IR4A 3HVSA 3GL3A 4HQZA 3FRCA 1XFLA 4EKZA 5J5NA 4K9ZA 3EWLA 2NVLA 1OAZA 4G0LA 1R5PA 5CRGA 5DAKA 4OWYA 5D9TA 5J9CA 1S3DA 3DYRA 3FR6A 3HHVA 4N30A 1M9BA 3KMNA 2ZUPA 3C73A 1K3YA 1U3IA 1B4QA 2VAFA 2R3XA 4G0KA 4NMUA 2H71A 2R4VA 4AGSA 1K0DA 1AAZA 3MDKA 2H0GA 1A23A 3GSTA 1Z6MA 3HJMA 2L59A 4TW5A 5ID2B 3Q19A 1MDIA 3ZMLA 2E2MA 1HNCA 1SKSB 3PINA 3GKNA 1QQ2A 4TKYA 1F3BA 1SD8A 3KD0A 4FIWA 1YZXA 3HJPA 4EVMA 2D2ZA 1RK4A 2LKUA 3A5WA 3H8QA 4CHSA 2L5OA 2VLVA 1TRWA 2H66A 3C1RA 3F4RA 4FO5A 3IK9A 2VM1A 3EU3A 4HEA2 3FYGA 5IOXA 1TDIA 5F05A 4O32A 4IJIA 5ECHB 3LGCA 2L6DA 5ID2A 4QL9A 2FNOA 1O85A 3TJGA 1DE2A 1DSBA 3ERWA 13GSA 2JZSA 1NM3A 2C4JA 2VCZA 5GZZB 1G6WA 2XPDA 3V1WA 1UC7A 3VWWA 6GSUA 4AF2A 1GULA 5EVOA 4K7IA 2GZYA 2HXKA 2EIOA 4PURA 4MMMA 3GX0A 1ERWA 3D22A 1LU4A 5JCGA 1MD4A 3GN3A 1Y6EA 1O7UA 1MTCA 2C3QA 2YJHA 5B7CA 1T8EB 2E2GA 5CO3A 1A2JA 3TUEA 2LTKA 3PR8A 1M2DA 3ZFBA 3G7YA 3W6GA 2FWEA 2QSIA 4EDZA 4MJBA 4GWRA 1T3BA 2RM5A 1FVKA 2FLSA 2LRNA 2GS3A 4IVFA 2N5FA 3ZVJD 1XWKA 2HFDA 4MJAA 5ECQB 4BA7A 3TCOA 1X5EA 2B3SA 1EWXA 1JZOA 1GTAA 4YQVA 1I9DA 1Q4JA 3FR9A 2FD3A 2VCQA 4F0CA 3GH6A 5C04A 1JHBA 1FB0A 3QAGA 3GKKA 4H86A 5CREA 1THOA 3ME7A 4MF5A 4GLTA 1MDJA 2LRCA 2TIRA 5GAPD 3KEBA 4L5LA 2HRNA 4LMWA 4HU9A 1A0RP 3TKRA 1VF3A 3GHAA 4WR5A 11GSA 2WFCA 2DLXA 3CSIA 4K8MA 4MA9A 5B6NA 2VO4A 2G2QA 3ISOA 1NSWA 3RPPA 4EL1A 2H01A 1TKDB 1PA3A 1AQWA 2HNLA 3FKFA 3J7Yk 3M9KA 2GQLA 4EO3A 1WOUA 6GSVA 2M46A 1WP0A 1K3LA 4IS0A 1AQVA 2K8SA 2E7PA 2O85A 3G7JA 5ECNB 3RDWA 5ECRB 2H8LA 3IBHA 5KN2A 5HR2A 2K9FA 4WBRD 3PH9A 3EURA 1PRXA 1PSQA 5JCUA 2LJRA 3VFIA 1NHOA 3IOSA 2IJYA 3JCML 1ABAA 2FUG2 3WT1A 4MDCA 4PGTA 2F8AA 5D73A 2XBQA 3BD2A
chains in the Genus database with same CATH superfamily
1FO5A 2VCXA 1OKDA 3HZ4A 4KH7A 2E0QA 1KBNA 1GUKA 2RIIA 1MD3A 2CX3A 3EE2A 3CTGA 4EIQA 1IYIA 1Y25A 3QCPA 2CV4A 1XCCA 4MZCA 2LEGA 4RQXA 2AAWA 1V2AA 4G9HA 4HSCX 5BMUB 4IBPA 4GF0A 3GRXA 3IE3A 3AY8A 3GIXA 4PUFC 1V98A 5IMFA 4F9ZA 1TK0B 4E8EA 1ACVA 4O92A 3KZQA 2DJ2A 2VL3A 4QL7A 4F03A 4FXYP 5HQPA 4K5SA 2H19A 2R0CA 2IMIA 3UARA 2HRFA 5BMUA 5DCGA 1JZDA 5G30A 1SVLA 3CBUA 1SL2B 1USBA 3DGQA 2B6MA 2V41A 5FHIA 3A5IA 2AUVA 3VLNA 4Z2RA 4AJ7A 5DDLA 1I5GA 4PQHA 4QMKA 2H1AA 1XW5A 5LCZA 4XTSA 1GNWA 3QFBC 2O8VB 5COHA 3KP8A 1ERTA 3QAWA 2KP2A 1B4PA 3TKPA 1M7TA 2JSYA 4OFMA 1F9MA 3FR3A 4IQAA 2FY6A 2YPMA 3NOFA 3PPUA 4F0BA 2H73A 5IMCA 1GSUA 2DJJA 4TR3A 4XCSA 2K6VA 4BL7B 2R37A 3VPQA 1X5DA 3QAVA 3FZ5A 3QR6A 1SJZA 5KN3A 2FHEA 1OC8A 3TOUA 2F3MA 4NHWA 1GL8A 3LQ7A 1OVNA 2HQTA 4XRDA 2CT6A 4V2LA 4KF9A 4GDFA 3QD9A 2LUSA 2GZPA 5D8IA 1SJ6A 1N8JA 1A2LA 4PQIA 3MIXA 1SKRB 1ZYQB 1K0AA 3M8NA 1R4WA 3VURA 3F4TA 4L5OA 5ECOB 5G31A 3FEUA 3F63A 4BL7A 3ZZXA 4HS1A 2YWMA 4EF0A 4GTUA 2M80A 1PL2A 2H72A 4TOPA 14GSA 4PNFA 3EU4A 2WZ9A 5D93A 1EP7A 3EMPA 3MYDA 3MSZA 2AB6A 3TKSE 3CTFA 1YF1A 4JEDA 1X0RA 4F2IA 5D9XA 3UVHA 2O89A 3ZTLA 2BJXA 2ZNMA 5JWOB 4KDUA 3FW2A 1BG5A 1A8YA 3UBLA 1ERUA 2LNTA 2KHPA 1M2AA 9GSSA 1GTUA 1XVWA 3DWVA 3MWHA 5CYYA 2AJQB 2LQOA 4O5RA 4MNNA 1J9BA 1UA5A 3S9FA 2OACA 1KNGA 3WT2A 1G6YA 1O8WA 2L57A 5IM9A 4ZILA 4MH3A 3HA9A 1GUHA 3LXTA 5HR0A 1SYRA 1DE1A 1XBSA 3D21A 3I9V2 4MJEA 1WIKA 3TRXA 1ZYEA 2AYTA 5JWRB 5B6MA 3P7XA 5ECKB 3ZREA 4ECCA 1QUWA 5EL8A 2OA7A 2PU9C 3M1GA 2KLXA 2HSMB 2FGXA 1U88A 2EFHA 1O81A 2L5LA 1SYXA 5HFIA 1ML6A 5ECPB 4G10A 4ZBAA 3H79A 1YEWC 4Q5RA 3UOMA 4MZWA 2IWTA 4TXVA 1B9XC 4PI2C 4MZBA 1ZZYA 2GZZA 1YQ1A 2H0HA 2N5AA 2N5BA 5CRWA 1GRXA 3M3MA 4KB3A 4BVYB 1K0BA 1V58A 2YJ7A 2PMTA 3HD5A 2DIZA 4PUAA 2I3YA 2YANA 2DMLA 1YDKA 2HSMA 3QOUA 3DD3A 3H1NA 2DBCA 1NHYA 4X43A 4NPBA 5GSSA 3CSJA 5DCHA 4IGJA 5H5QA 2GTUA 5AIVA 2XHFA 2CQ9A 3IAM2 1PD21 5INYA 4ZL7A 1ZMAA 3TOTA 4L0WA 2MZCA 4IP6A 3GURA 1FG4A 1GSYA 3F0IA 4FYCA 4BVYA 3KCMA 2C80A 1T4ZA 3L78A 3QPMA 3Q74A 3ZYWA 5DBQA 4Z7XA 2YZHA 4V2MA 2RM6A 3LWAA 4IQ1A 2HSHA 4EXJA 2LJKA 4I6XA 4O5QA 3UJ1A 4AJ6A 4I8BA 3FZ4A 3IA1A 4K7OA 5J47A 1KTEA 1M9AA 1H4OA 4IP1A 4XIHA 2HSNB 3DVWA 1PGTA 5H5SA 2VCTA 2KP1A 2OKAA 3IHGA 3L9UA 1VF4A 5FT3A 1GUMA 3KMOA 3UEMA 1JLVA 5KEJA 3FHKA 18GSA 2PBJA 3KTBA 4ECJA 2JL4A 1MEKA 4AJ8A 5GAND 1Y1UA 2XBIA 3TRQA 3L4NA 2JZRA 2WDUA 1OC9B 3GKXA 2VM2A 2MMZA 5KN0A 1K0CA 5B8BA 4Z2UA 2VCWA 3F6FA 5G5FA 1XWAA 3I6AA 2CA8A 2HSNA 4K5RA 4PXOA 2KOKA 4TR0A 1JFUA 4KE3A 2TRCP 2CVKA 4BVXB 4E68A 4MCUA 1SK1A 3TB2A 3F4SA 1XOBA 4DSRA 1K0OA 4XS4B 2PUKC 2F51A 1EEJA 1NW2A 3TJJA 5JWQB 1GP1A 2JU5A 2ON7A 3KH7A 2MMNA 4ILFA 2R0GA 4FYUA 2IPAA 1OC9A 1R5AA 4GXZA 4G19A 1EZKA 4PI0C 4HUAA 4USSA 1F2EA 3HCZA 1EGOA 4I2TA 3ZIVA 3H93A 2WCIA 4KGIA 1KEBA 4BVXA 2YV7A 3DEXA 2LV3A 3D5JA 4PHZC 4MPFA 4RUVA 2ES7A 1S4BP 1PKWA 4RQRA 4XS4A 1SK2A 4LL4B 4NV5A 2V2GA 3EYTA 5CRHA 3RHBA 1J0FA 2H6ZA 4KSOA 4TR1B 1WPIA 3Q6OA 3U6VA 4E8HA 3LFLA 4YH2A 1ILOA 2I4AA 2FA4A 1FB6A 3ZIJA 2VD0A 2KUCA 3LEFA 2HI7A 3RPNA 1VGLA 2YNXA 2AV4A 4O5UA 3WGEA 1A8LA 3IPZA 3CSHA 3WGXA 5ECMB 4NV2A 5CAXA 3TKSC 2C0GA 4WBJA 3DXBA 5HR3A 1SD9A 2OE0A 5KOXA 1E6BA 2RUEA 3F3RA 4TR1A 4Z2TA 2IFQB 2FCHA 1PX6A 3WGDA 4GSTA 2WULA 3UAPA 1A0FA 4BWQA 2R0PA 1X9SB 3L9VA 1V40A 2GGTA 3HVNA 2B5EA 4TRXA 1HNAA 3ZMKA 1EP8A 1GSEA 5D96A 2C0FA 22GSA 1URMA 4WEYA 3D0ZA 2H1LA 3GUSA 3GSSA 2MMOA 4IKHA 3APOA 3GX8A 1TP9A 5J9BA 4K7NA 2DC5A 1Z5YE 2WVXB 3O6TA 1GLPA 4NXIA 1B8XA 5D9WA 4ZL8A 4POLA 2IFQA 1O73A 1XXUA 3HXSA 2P0GA 3M9JA 3IDVA 1B9YC 4GQCA 1ZL9A 1K3OA 1TU8A 2IMDA 4QQ7A 1HYUA 3ERFA 1G7EA 1Z7RA 3GKMA 2VL2C 2GVPA 2H1GA 1T4YA 4ML6A 1GSDA 4RI6A 4WETA 3C71A 3RAZA 2X8HA 2O87A 3TJBA 2WVXA 3F3QA 4ZB7A 3FZ9A 4XRAA 5JCWA 2CVDA 2PGTA 1FAAA 4I2UA 2GSSA 1W4VA 3HY2A 5J3RA 2DJKA 1GLQA 3UMAA 5E4WA 1GNEA 3HMJG 4OD7A 4BIKA 2X8CA 5BRTA 2HLSA 3SBCA 4Q5QA 5DJLA 3CHXC 1C72A 4ECIA 3WD6A 1QFNA 2DIYA 2I1UA 3BCIA 1OYJA 4HZ2A 4HQSA 4MABA 4TN8A 1HD2A 1BAYA 1BQ7A 1HQOA 2EFDA 4A5PA 4HDEA 3GA4A 2H75A 5DQSA 3VWVA 2HRKB 5F07A 4ZL9A 1GWCA 5G5EA 2IL3A 5ABRA 2HZFA 2CAQA 2M72A 4FH8A 1XPVA 2B5YA 5A1NB 2LQQA 2QKEA 5L71A 2OADA 2CAIA 1CQHA 4IN0A 3H4KA 2TRXA 1T7PB 1PMTA 6GSTA 1S3AA 3DKSA 1XWCA 3GTUB 4MK3A 1AQXA 3A3TA 3LG6A 2REMA 1GTBA 2VD1A 2YWOA 2WW0A 3KP9A 2JZTA 4EE0A 2EIQA 2HRKA 3KIJA 4GSNA 1M3JA 1XWBA 1TJDA 3KTLA 2CZ3A 2JADA 4WF4A 4JRRA 5A1NA 2H0IA 1X5CA 3UVTA 1EOGA 3I69A 1FHEA 1G0TA 3LW9A 4HOJA 4W66A 1SK0A 17GSA 1PQNA 2WW3A 1PN9A 3GTUA 2A2SA 1YEXA 1OE7A 1BJXA 4Q5NA 4BPYA 2VL9A 4KNDA 1X9WB 3KH9A 3ZFLA 4V2NA 3W8JA 1DUGA 2H76A 1M99A 2X64A 2C3TA 2GQMA 5F06A 4MLYA 3BCKA 4TR4A 3NIVA 1OKTA 1FW1A 4HZ4A 2IMFA 5ECIB 1SL0B 3RBTA 1J08A 4O7HA 3UL3A 1TTZA 2MYGA 3NZNA 3LJRA 5DVBA 2VLTA 2C0DA 4WKWA 2H6XA 2O3EA 1A24A 4KCAA 3P90A 4ACSA 4L0UA 1YJ6A 3DIEA 1EEMA 2CX4A 3ZLPA 3KXOA 4OFNA 2YN1A 1YVLA 1QK8A 4ZBBA 1O6JA 5ELGA 1GH2A 5EPFA 3ED3A 4AKIA 4ISDA 4OO5A 1HNBA 1E2YA 1ZOFA 4POKA 2XPEA 2DKIA 3TKSA 2VKZG 5A4WA 4D73B 4K0NA 1TRSA 3CMIA 2DJ0A 4POBA 1M2BA 2A2PA 4OCFA 1F3AA 1UN2A 1TRVA 4JU5A 4IHUA 5IO2A 5CRDA 1SVMA 2DJ3A 8GSSA 4DSSB 1DBYA 2H1BA 2GQKA 5IPHA 5IOWA 4DVCA 3IHQA 3CRTA 1XZOA 3BOAA 1VRSD 2B1LA 3HVXA 5A5KA 2V1MA 2B1KA 6GSXA 3ME8A 4EC0A 4J56E 4WXTA 4MP4A 4D73A 4XS6A 1B48A 2DSAA 3O76A 5G1LA 2I9HA 4GCIA 5AN1A 5IIZA 1WJKA 2NDOA 2I81A 1ZCPA 3TRPA 4PQ1A 2GLRA 1YKAA 2IMEA 1XWGA 2K8VA 1BYEA 1TOFA 4DSSA 7GSSA 1QMVA 3C1SA 3O3TA 4PNGA 1BX9A 1BF5A 4K2XA 5ECLB 2H30A 2HSYA 2LSTA 4IW9A 1EOHA 3ERGA 2R5GA 3HZ8A 2VL2A 3IAS2 3APQA 3PGTA 3E3EA 1Z7PA 1FOHA 2ON5A 2YP6A 1AW9A 3F6DA 3MNGA 4N11A 5CP1A 4GSSA 2EFCA 1SU9A 1T1VA 3TU3B 1A2MA 4KCEA 5CNWA 5IQYA 2C8UA 1YEPA 2QGVA 1XW9A 2GT5A 2VOCA 2EFEA 3GNJA 3KJYA 1TRUA 2YZUA 5DQYA 1H75A 3US3A 3G7IA 2A2RA 3L0HA 4OO4A 1LJRA 3KM6A 1WRYA 2LJAA 3IRAA 1UVZA 4HJ2A 1Z6NA 4GRFA 3I43A 3HJOA 5DJMA 2R6KA 4ECBA 4OCEA 4NAXA 4OMVA 2OJLA 2NTOA 2QC7A 3W8SA 3TDGA 2WGRA 4ZXGA 1TI1A 5DALB 1G7OA 3D4MA 4FYBA 4I5QA 4POMA 1U6TA 2MBTA 1R7HA 2WS2A 1OC3A 4YQMA 3ZITA 2LNSA 1GSFA 3UIWA 12GSA 2EC4A 2QA2A 1YY7A 2J9HA 3A2XA 4KAEA 3KGKA 4Q5FA 2LS5A 2VLUA 3ZL5A 2YCDA 5A4VA 10GSA 3CRUA 1JZRA 1T00A 4K6XA 3Q18A 1TI3A 2J23A 3N9JA 1VF2A 5DALA 4BWSA 2R2JA 1WMJA 3BJ5A 1M0UA 3VI7A 5LNKe 1I1IP 3GYKA 1PKZA 2C1YA 5EY6A 2NBSA 1AXDA 4CW9A 5AGYA 5IMZA 3R3EA 5IMVA 1EV4A 1TW9A 1ST9A 5HR1A 2H70A 5J40A 1GTIA 2HE3A 2V6OA 4MJCA 3CWGA 2YV9A 5A34B 3VI5A 4EDYA 3C7MA 1ERVA 2BMXA 3M0FA 2H1DA 1JLWA 2OE1A 4MH2A 4FQUA 5AISA 4X1UA 3F8UA 5LD0A 6GSYA 4N0ZA 2G0FA 4TXOB 3OR5A 2IN3A 4WR4A 2L4QA 4HJMA 1M3IA 19GSA 1SKWB 3HVVA 2PVOC 6GSWA 4XS1A 3UBKA 3FZAA 3P2AA 3TJFA 1PL1A 4MF6A 2X99A 3QFAC 2WW1A 1U3AA 1LBKA 1K0NA 5A34A 3IK7A 2ZCTA 5HFKA 1TXXA 2CZ2A 4KSMA 4NHZA 2CVBA 2H6YA 3IXRA 1Z9HA 6GSSA 4JR4A 4YAVA 4V1Ag 4CDOA 4TXOA 1CQGA 1RW1A 3DRNA 5E59A 1QXHA 4MPGA 3GV1A 2MBSA 4AKGA 1JZWA 2NPBA 4LMVA 5IMDA 4LL1B 1IYHA 5FWGA 3G9BA 1OE8A 2B7JA 2FA8A 1F37A 1TK5B 2B5XA 5IMAA 1XIYA 3TKQA 2BTOT 3GH9A 3D6IA 3LSZA 3VK9A 3EMXA 1F6MC 3GMFA 2OT3A 16GSA 4KDYA 1N25A 3ZRDA 1X9MB 1SENA 1ZYNA 2VCVA 1XG8A 4WF5A 3RFRC 3RGBC 3ZVJA 5F8BA 3F9UA 1PX7A 2OBKA 1VF1A 4ULXA 3QMXA 3FK8A 3VPTA 4RI7A 1BG1A 2IMKA 3J7Yb 2B7KA 2PPTA 3APSA 2RLIA 4I97A 3SWLA 2PERA 2RUFA 2GDRA 5F0GA 5A4UA 1THXA 2P5RA 3CYNA 2Z9SA 1U87A 1S3CA 3BBYA 2F9SA 2UZ8A 3EPTA 3EVIA 3K8NA 5C00A 3RHCA 4P3YB 3IC8A 4DSQA 4HU7A 5GSTA 4JR6A 4N10A 1WE0A 5J4UA 5IO0A 3TJKA 5ENUA 2OE3A 1K0MA 5D9VA 3CQFA 1AUCA 2GSTA 3IC4A 2HYXA 2AHEA 2GSQA 2MMAA 4LA1A 4CY8A 4IELA 2FWGA 1SL1B 2V32A 1PN0A 3EINA 1XVQA 2K18A 2GSRA 2PWJA 4K0GA 1WWJA 4XHMA 1Z3EA 1TK8B 4ZB9A 4TVEA 2WRTA 3QDNA 4EIPA 2YWNA 1AC1A 2WJUA 5H5RA 5J4YA 1AIUA 4G0IA 2WZSA 4N0VA 4K1FA 4DEJA 3EC3A 3LXZA 4G2EA 4L8EA 1R26A 1N2AA 2IIYA 1EV9A 2HRAA 3R2QA 5ECSA 2FWHA 2JSZA 4KUNA 3HKRA 4ID0A 2XC2A 2PN8A 2P5QA 2L4CA 3CXGA 3E0UA 1GSQA 4N3ZA 1SJIA 2L6CA 1MDKA 4AI6A 3GFKA 2V6KA 4KDXA 2F8FA 2DJ1A 5B8AA 4ZB8A 1YKCA 4PX1A 5J41A 4JE1A 2HT9A 4X4JA 1YF0A 1EGRA 3FY7A 3E9JB 1TU7A 2LRTA 3DMLA 5G1KA 4YAPA 4F82A 2ALBA 4AKXB 1W89A 5KN1A 2A4VA 4ZIJA 3DVXA 3LYKA 3C8EA 1QGVA 2VUPA 1V9WA 3GL5A 3L9SA 4JZQA 3LORA 3VWUA 1XW6A 4KX4A 3P8WA 3WYWA 4LLRA 2X8GA 4PTSA 1ZGNA 3IV4A 4JBBA 2EIRA 2VIMA 2WB9A 4EUYA 2YOIA 3HYPA 2GT6A 4YKGA 1Q98A 5ELAA 4J57E 5AIXA 5J4VA 4ML1A 3A2WA 5HFGA 2C0EA 4IJ3A 1O8XA 2QA1A 3HDCA 3U5RE 1FVJA 2O7KA 2YWIA 2HZEB 3A2VA 1XOAA 2PVQA 1GSSA 4YQUA 2DMMA 2OBIA 4AKHA 2JACA 4ZB6A 4GQFA 3VWXA 3MAKA 4NWYA 4ZBDA 1RQMA 1FOVA 3LYPA 3TGZA 4V1Ap 4OFTA 1V57A 2FWFA 2C3NA 4HI7A 5DAKB 4K2DA 2P31A 4MF7A 1BEDA 3D4TA 5IPGA 4X0XA 4KA0A 20GSA 2HZEA 4J2FA 5G2ZA 2H74A 1ON4A 4KW6A 3N5OA 3IR4A 3HVSA 3GL3A 4HQZA 3FRCA 1XFLA 4EKZA 4CY6A 2X49A 1SVOA 5J5NA 4K9ZA 3EWLA 2NVLA 1OAZA 4G0LA 1R5PA 2WW2A 5CRGA 5DAKA 4OWYA 5D9TA 5J9CA 1S3DA 3DYRA 3FR6A 3HHVA 4N30A 1M9BA 3KMNA 2ZUPA 3C73A 2WVYA 1K3YA 1U3IA 1B4QA 2VAFA 2R3XA 4G0KA 4NMUA 2H71A 2R4VA 4AGSA 1K0DA 2A4HA 1AAZA 3MDKA 2H0GA 1A23A 3GSTA 1Z6MA 3HJMA 2L59A 4TW5A 5ID2B 3Q19A 1MDIA 3ZMLA 2E2MA 1HNCA 1PFOA 1SKSB 3PINA 3GKNA 1QQ2A 4TKYA 1F3BA 1SD8A 3KD0A 4FIWA 1YZXA 3HJPA 4EVMA 2D2ZA 1RK4A 2LKUA 3A5WA 3H8QA 4CHSA 2L5OA 2VLVA 1TRWA 2H66A 3C1RA 3F4RA 4FO5A 3IK9A 2VM1A 2X4AA 3EU3A 4HEA2 4YKFA 3FYGA 2O36A 5IOXA 1TDIA 5F05A 4O32A 4IJIA 5ECHB 3LGCA 2L6DA 5ID2A 4QL9A 2FNOA 1O85A 3TJGA 1DE2A 1DSBA 3ERWA 13GSA 2JZSA 1NM3A 2C4JA 2VCZA 5GZZB 1G6WA 2XPDA 3V1WA 1UC7A 3VWWA 6GSUA 4AF2A 1GULA 5EVOA 4K7IA 2DKHA 1S3RA 2GZYA 2HXKA 2EIOA 4PURA 4MMMA 3GX0A 5A5HB 3FMWA 1ERWA 3D22A 1LU4A 5JCGA 1MD4A 3GN3A 1Y6EA 1O7UA 1MTCA 2C3QA 2YJHA 5B7CA 1T8EB 2E2GA 5CO3A 1A2JA 3TUEA 2LTKA 3PR8A 1M2DA 3ZFBA 3G7YA 3W6GA 2WVZA 2FWEA 2QSIA 4EDZA 4MJBA 4GWRA 1T3BA 2RM5A 1FVKA 2FLSA 2LRNA 2GS3A 4IVFA 1ZYPA 2N5FA 3ZVJD 1XWKA 2HFDA 2O5VA 4MJAA 5ECQB 4BA7A 3TCOA 1X5EA 2B3SA 5A5HA 1EWXA 1JZOA 1GTAA 4YQVA 1I9DA 1Q4JA 3FR9A 2FD3A 2VCQA 4F0CA 3GH6A 5C04A 1JHBA 1FB0A 3QAGA 5KOWA 3GKKA 4H86A 5CREA 1THOA 3ME7A 4ICYA 4MF5A 4GLTA 1MDJA 2LRCA 2TIRA 5GAPD 3KEBA 4L5LA 2HRNA 4LMWA 4HU9A 1A0RP 3TKRA 1VF3A 3GHAA 4WR5A 11GSA 2WFCA 2DLXA 3CSIA 4K8MA 4MA9A 5B6NA 2VO4A 2G2QA 3ISOA 1NSWA 1TXUA 3RPPA 4G01A 4EL1A 2H01A 1TKDB 1PA3A 1AQWA 2HNLA 3FKFA 3J7Yk 3M9KA 2GQLA 4EO3A 1WOUA 6GSVA 2M46A 1WP0A 1K3LA 2UV8G 4IS0A 1AQVA 2K8SA 2E7PA 2O85A 3G7JA 5ECNB 3RDWA 5ECRB 2H8LA 3IBHA 5KN2A 5HR2A 2K9FA 4WBRD 3PH9A 3EURA 1PRXA 1PSQA 5JCUA 2LJRA 3VFIA 1NHOA 3IOSA 2IJYA 3JCML 1ABAA 2FUG2 3WT1A 4MDCA 4PGTA 2F8AA 5D73A 2XBQA 3BD2A
chains in the Genus database with same CATH topology
1FO5A 2VCXA 1OKDA 3HZ4A 4KH7A 2E0QA 1KBNA 1GUKA 2RIIA 1MD3A 2CX3A 3EE2A 3CTGA 4EIQA 1IYIA 1Y25A 3QCPA 2CV4A 1XCCA 4MZCA 2LEGA 4RQXA 2AAWA 1V2AA 4G9HA 5BMUB 4IBPA 4GF0A 3GRXA 3IE3A 3AY8A 3GIXA 4PUFC 1V98A 5IMFA 4F9ZA 1TK0B 4E8EA 1ACVA 4O92A 3KZQA 2DJ2A 2VL3A 4QL7A 4F03A 5HQPA 4K5SA 2H19A 2R0CA 2IMIA 3UARA 2HRFA 5BMUA 5DCGA 1JZDA 5G30A 1SVLA 3CBUA 1SL2B 1USBA 3DGQA 2B6MA 2V41A 5FHIA 3A5IA 2AUVA 3VLNA 4Z2RA 4AJ7A 5DDLA 1I5GA 4PQHA 4QMKA 2H1AA 1XW5A 5LCZA 4XTSA 1GNWA 3QFBC 2O8VB 5COHA 3KP8A 1ERTA 3QAWA 2KP2A 1B4PA 3TKPA 1M7TA 2JSYA 4OFMA 1F9MA 3FR3A 4IQAA 2FY6A 2YPMA 3NOFA 3PPUA 4F0BA 2H73A 5IMCA 1GSUA 2DJJA 4TR3A 4XCSA 2K6VA 4BL7B 2R37A 3VPQA 1X5DA 3QAVA 3FZ5A 3QR6A 1SJZA 5KN3A 2FHEA 1OC8A 3TOUA 2F3MA 4NHWA 1GL8A 3LQ7A 1OVNA 2HQTA 4XRDA 2CT6A 4V2LA 4KF9A 4GDFA 3QD9A 2LUSA 2GZPA 5D8IA 1SJ6A 1N8JA 1A2LA 4PQIA 3MIXA 1SKRB 1ZYQB 1K0AA 3M8NA 1R4WA 3VURA 3F4TA 4L5OA 5ECOB 5G31A 3FEUA 3F63A 4BL7A 3ZZXA 4HS1A 2YWMA 4EF0A 4GTUA 2M80A 1PL2A 2H72A 4TOPA 14GSA 4PNFA 3EU4A 2WZ9A 5D93A 1EP7A 3EMPA 3MYDA 3MSZA 2AB6A 3TKSE 3CTFA 1YF1A 4JEDA 1X0RA 4F2IA 5D9XA 3UVHA 2O89A 3ZTLA 2BJXA 2ZNMA 5JWOB 4KDUA 3FW2A 1BG5A 1A8YA 3UBLA 1ERUA 2LNTA 2KHPA 1M2AA 9GSSA 1GTUA 1XVWA 3DWVA 3MWHA 5CYYA 2AJQB 2LQOA 4O5RA 4MNNA 1J9BA 1UA5A 3S9FA 2OACA 1KNGA 3WT2A 1G6YA 1O8WA 2L57A 5IM9A 4ZILA 4MH3A 3HA9A 1GUHA 3LXTA 5HR0A 1SYRA 1DE1A 1XBSA 3D21A 3I9V2 4MJEA 1WIKA 3TRXA 1ZYEA 2AYTA 5JWRB 5B6MA 3P7XA 5ECKB 3ZREA 4ECCA 1QUWA 5EL8A 2OA7A 2PU9C 3M1GA 2KLXA 2HSMB 2FGXA 1U88A 2EFHA 1O81A 2L5LA 1SYXA 5HFIA 1ML6A 5ECPB 4G10A 4ZBAA 3H79A 4Q5RA 3UOMA 4MZWA 2IWTA 4TXVA 1B9XC 4MZBA 1ZZYA 2GZZA 1YQ1A 2H0HA 2N5AA 2N5BA 5CRWA 1GRXA 3M3MA 4KB3A 4BVYB 1K0BA 1V58A 2YJ7A 2PMTA 3HD5A 2DIZA 4PUAA 2I3YA 2YANA 2DMLA 1YDKA 2HSMA 3QOUA 3DD3A 3H1NA 2DBCA 1NHYA 4X43A 4NPBA 5GSSA 3CSJA 5DCHA 4IGJA 5H5QA 2GTUA 5AIVA 2XHFA 2CQ9A 3IAM2 1PD21 5INYA 4ZL7A 1ZMAA 3TOTA 4L0WA 2MZCA 4IP6A 3GURA 1FG4A 1GSYA 3F0IA 4FYCA 4BVYA 3KCMA 2C80A 1T4ZA 3L78A 3QPMA 3Q74A 3ZYWA 5DBQA 4Z7XA 2YZHA 4V2MA 2RM6A 3LWAA 4IQ1A 2HSHA 4EXJA 2LJKA 4I6XA 4O5QA 3UJ1A 4AJ6A 4I8BA 3FZ4A 3IA1A 4K7OA 5J47A 1KTEA 1M9AA 1H4OA 4IP1A 4XIHA 2HSNB 3DVWA 1PGTA 5H5SA 2VCTA 2KP1A 2OKAA 3IHGA 3L9UA 1VF4A 5FT3A 1GUMA 3KMOA 3UEMA 1JLVA 5KEJA 3FHKA 18GSA 2PBJA 3KTBA 4ECJA 2JL4A 1MEKA 4AJ8A 5GAND 1Y1UA 2XBIA 3TRQA 3L4NA 2JZRA 2WDUA 1OC9B 3GKXA 2VM2A 2MMZA 5KN0A 1K0CA 5B8BA 4Z2UA 2VCWA 3F6FA 5G5FA 1XWAA 3I6AA 2CA8A 2HSNA 4K5RA 4PXOA 2KOKA 4TR0A 1JFUA 4KE3A 2TRCP 2CVKA 4BVXB 4E68A 4MCUA 1SK1A 3TB2A 3F4SA 1XOBA 4DSRA 1K0OA 4XS4B 2PUKC 2F51A 1EEJA 1NW2A 3TJJA 5JWQB 1GP1A 2JU5A 2ON7A 3KH7A 2MMNA 4ILFA 2R0GA 4FYUA 2IPAA 1OC9A 1R5AA 4GXZA 4G19A 1EZKA 4HUAA 4USSA 1F2EA 3HCZA 1EGOA 4I2TA 3ZIVA 3H93A 2WCIA 4KGIA 1KEBA 4BVXA 2YV7A 3DEXA 2LV3A 3D5JA 4MPFA 4RUVA 2ES7A 1PKWA 4RQRA 4XS4A 1SK2A 4LL4B 4NV5A 2V2GA 3EYTA 5CRHA 3RHBA 1J0FA 2H6ZA 4KSOA 4TR1B 1WPIA 3Q6OA 3U6VA 4E8HA 3LFLA 4YH2A 1ILOA 2I4AA 2FA4A 1FB6A 3ZIJA 2VD0A 2KUCA 3LEFA 2HI7A 3RPNA 1VGLA 2YNXA 2AV4A 4O5UA 3WGEA 1A8LA 3IPZA 3CSHA 3WGXA 5ECMB 4NV2A 5CAXA 3TKSC 2C0GA 4WBJA 3DXBA 5HR3A 1SD9A 2OE0A 5KOXA 1E6BA 2RUEA 3F3RA 4TR1A 4Z2TA 2IFQB 2FCHA 1PX6A 3WGDA 4GSTA 2WULA 3UAPA 1A0FA 4BWQA 2R0PA 1X9SB 3L9VA 1V40A 2GGTA 2B5EA 4TRXA 1HNAA 3ZMKA 1EP8A 1GSEA 5D96A 2C0FA 22GSA 1URMA 4WEYA 3D0ZA 2H1LA 3GUSA 3GSSA 2MMOA 4IKHA 3APOA 3GX8A 1TP9A 5J9BA 4K7NA 2DC5A 1Z5YE 3O6TA 1GLPA 4NXIA 1B8XA 5D9WA 4ZL8A 4POLA 2IFQA 1O73A 1XXUA 3HXSA 2P0GA 3M9JA 3IDVA 1B9YC 4GQCA 1ZL9A 1K3OA 1TU8A 2IMDA 4QQ7A 1HYUA 3ERFA 1G7EA 1Z7RA 3GKMA 2VL2C 2GVPA 2H1GA 1T4YA 4ML6A 1GSDA 4RI6A 4WETA 3C71A 3RAZA 2X8HA 2O87A 3TJBA 3F3QA 4ZB7A 3FZ9A 4XRAA 5JCWA 2CVDA 2PGTA 1FAAA 4I2UA 2GSSA 1W4VA 3HY2A 5J3RA 2DJKA 1GLQA 3UMAA 5E4WA 1GNEA 3HMJG 4OD7A 2X8CA 5BRTA 2HLSA 3SBCA 4Q5QA 5DJLA 1C72A 4ECIA 3WD6A 1QFNA 2DIYA 2I1UA 3BCIA 1OYJA 4HZ2A 4HQSA 4MABA 4TN8A 1HD2A 1BAYA 1BQ7A 1HQOA 2EFDA 4A5PA 4HDEA 3GA4A 2H75A 5DQSA 3VWVA 2HRKB 5F07A 4ZL9A 1GWCA 5G5EA 2IL3A 5ABRA 2HZFA 2CAQA 2M72A 4FH8A 1XPVA 2B5YA 5A1NB 2LQQA 2QKEA 5L71A 2OADA 2CAIA 1CQHA 4IN0A 3H4KA 2TRXA 1T7PB 1PMTA 6GSTA 1S3AA 3DKSA 1XWCA 3GTUB 4MK3A 1AQXA 3A3TA 3LG6A 2REMA 1GTBA 2VD1A 2YWOA 3KP9A 2JZTA 4EE0A 2EIQA 2HRKA 3KIJA 4GSNA 1XWBA 1TJDA 3KTLA 2CZ3A 2JADA 4WF4A 4JRRA 5A1NA 2H0IA 1X5CA 3UVTA 1EOGA 3I69A 1FHEA 1G0TA 3LW9A 4HOJA 4W66A 1SK0A 17GSA 1PQNA 1PN9A 3GTUA 2A2SA 1YEXA 1OE7A 1BJXA 4Q5NA 4BPYA 2VL9A 4KNDA 1X9WB 3KH9A 3ZFLA 4V2NA 3W8JA 1DUGA 2H76A 1M99A 2X64A 2C3TA 2GQMA 5F06A 4MLYA 3BCKA 4TR4A 3NIVA 1OKTA 1FW1A 4HZ4A 2IMFA 5ECIB 1SL0B 3RBTA 1J08A 4O7HA 3UL3A 1TTZA 2MYGA 3NZNA 3LJRA 5DVBA 2VLTA 2C0DA 4WKWA 2H6XA 1A24A 4KCAA 3P90A 4ACSA 4L0UA 1YJ6A 3DIEA 1EEMA 2CX4A 3ZLPA 3KXOA 4OFNA 2YN1A 1YVLA 1QK8A 4ZBBA 1O6JA 5ELGA 1GH2A 5EPFA 3ED3A 4AKIA 4ISDA 4OO5A 1HNBA 1E2YA 1ZOFA 4POKA 2XPEA 2DKIA 3TKSA 2VKZG 5A4WA 4D73B 4K0NA 1TRSA 3CMIA 2DJ0A 4POBA 1M2BA 2A2PA 4OCFA 1F3AA 1UN2A 1TRVA 4JU5A 4IHUA 5IO2A 5CRDA 1SVMA 2DJ3A 8GSSA 4DSSB 1DBYA 2H1BA 2GQKA 5IPHA 5IOWA 4DVCA 3IHQA 3CRTA 1XZOA 3BOAA 1VRSD 2B1LA 3HVXA 5A5KA 2V1MA 2B1KA 6GSXA 3ME8A 4EC0A 4J56E 4WXTA 4MP4A 4D73A 4XS6A 1B48A 2DSAA 3O76A 5G1LA 2I9HA 4GCIA 5AN1A 5IIZA 1WJKA 2NDOA 2I81A 1ZCPA 3TRPA 4PQ1A 2GLRA 1YKAA 2IMEA 1XWGA 2K8VA 1BYEA 1TOFA 4DSSA 7GSSA 1QMVA 3C1SA 3O3TA 4PNGA 1BX9A 1BF5A 4K2XA 5ECLB 2H30A 2HSYA 2LSTA 4IW9A 1EOHA 3ERGA 2R5GA 3HZ8A 2VL2A 3IAS2 3APQA 3PGTA 3E3EA 1Z7PA 1FOHA 2ON5A 2YP6A 1AW9A 3F6DA 3MNGA 4N11A 5CP1A 4GSSA 2EFCA 1SU9A 1T1VA 3TU3B 1A2MA 4KCEA 5CNWA 5IQYA 2C8UA 1YEPA 2QGVA 1XW9A 2GT5A 2VOCA 2EFEA 3GNJA 3KJYA 1TRUA 2YZUA 5DQYA 1H75A 3US3A 3G7IA 2A2RA 3L0HA 4OO4A 1LJRA 3KM6A 1WRYA 2LJAA 3IRAA 1UVZA 4HJ2A 1Z6NA 4GRFA 3I43A 3HJOA 5DJMA 2R6KA 4ECBA 4OCEA 4NAXA 4OMVA 2OJLA 2NTOA 2QC7A 3W8SA 3TDGA 2WGRA 4ZXGA 1TI1A 5DALB 1G7OA 3D4MA 4FYBA 4I5QA 4POMA 1U6TA 2MBTA 1R7HA 2WS2A 1OC3A 4YQMA 3ZITA 2LNSA 1GSFA 3UIWA 12GSA 2EC4A 2QA2A 1YY7A 2J9HA 3A2XA 4KAEA 3KGKA 4Q5FA 2LS5A 2VLUA 3ZL5A 2YCDA 5A4VA 10GSA 3CRUA 1JZRA 1T00A 4K6XA 3Q18A 1TI3A 2J23A 3N9JA 1VF2A 5DALA 4BWSA 2R2JA 1WMJA 3BJ5A 1M0UA 3VI7A 5LNKe 3GYKA 1PKZA 2C1YA 5EY6A 2NBSA 1AXDA 4CW9A 5AGYA 5IMZA 3R3EA 5IMVA 1EV4A 1TW9A 1ST9A 5HR1A 2H70A 5J40A 1GTIA 2HE3A 2V6OA 4MJCA 3CWGA 2YV9A 5A34B 3VI5A 4EDYA 3C7MA 1ERVA 2BMXA 3M0FA 2H1DA 1JLWA 2OE1A 4MH2A 4FQUA 5AISA 4X1UA 3F8UA 5LD0A 6GSYA 4N0ZA 2G0FA 4TXOB 3OR5A 2IN3A 4WR4A 2L4QA 4HJMA 19GSA 1SKWB 3HVVA 2PVOC 6GSWA 4XS1A 3UBKA 3FZAA 3P2AA 3TJFA 1PL1A 4MF6A 2X99A 3QFAC 1U3AA 1LBKA 1K0NA 5A34A 3IK7A 2ZCTA 5HFKA 1TXXA 2CZ2A 4KSMA 4NHZA 2CVBA 2H6YA 3IXRA 1Z9HA 6GSSA 4JR4A 4YAVA 4V1Ag 4CDOA 4TXOA 1CQGA 1RW1A 3DRNA 5E59A 1QXHA 4MPGA 3GV1A 2MBSA 4AKGA 1JZWA 2NPBA 4LMVA 5IMDA 4LL1B 1IYHA 5FWGA 3G9BA 1OE8A 2B7JA 2FA8A 1F37A 1TK5B 2B5XA 5IMAA 1XIYA 3TKQA 2BTOT 3GH9A 3D6IA 3LSZA 3VK9A 3EMXA 1F6MC 3GMFA 2OT3A 16GSA 4KDYA 1N25A 3ZRDA 1X9MB 1SENA 1ZYNA 2VCVA 4WF5A 3ZVJA 5F8BA 3F9UA 1PX7A 2OBKA 1VF1A 4ULXA 3QMXA 3FK8A 3VPTA 4RI7A 1BG1A 2IMKA 3J7Yb 2B7KA 2PPTA 3APSA 2RLIA 4I97A 3SWLA 2PERA 2RUFA 2GDRA 5F0GA 5A4UA 1THXA 2P5RA 3CYNA 2Z9SA 1U87A 1S3CA 3BBYA 2F9SA 2UZ8A 3EPTA 3EVIA 3K8NA 5C00A 3RHCA 4P3YB 3IC8A 4DSQA 4HU7A 5GSTA 4JR6A 4N10A 1WE0A 5J4UA 5IO0A 3TJKA 5ENUA 2OE3A 1K0MA 5D9VA 1AUCA 2GSTA 3IC4A 2HYXA 2AHEA 2GSQA 2MMAA 4LA1A 4CY8A 4IELA 2FWGA 1SL1B 2V32A 1PN0A 3EINA 1XVQA 2K18A 2GSRA 2PWJA 4K0GA 1WWJA 4XHMA 1Z3EA 1TK8B 4ZB9A 4TVEA 2WRTA 3QDNA 4EIPA 2YWNA 1AC1A 2WJUA 5H5RA 5J4YA 1AIUA 4G0IA 4N0VA 4K1FA 4DEJA 3EC3A 3LXZA 4G2EA 4L8EA 1R26A 1N2AA 2IIYA 1EV9A 2HRAA 3R2QA 5ECSA 2FWHA 2JSZA 4KUNA 3HKRA 4ID0A 2XC2A 2PN8A 2P5QA 2L4CA 3CXGA 3E0UA 1GSQA 4N3ZA 1SJIA 2L6CA 1MDKA 4AI6A 3GFKA 2V6KA 4KDXA 2F8FA 2DJ1A 5B8AA 4ZB8A 1YKCA 4PX1A 5J41A 4JE1A 2HT9A 4X4JA 1YF0A 1EGRA 3FY7A 3E9JB 1TU7A 2LRTA 3DMLA 5G1KA 4YAPA 4F82A 2ALBA 4AKXB 1W89A 5KN1A 2A4VA 4ZIJA 3DVXA 3LYKA 3C8EA 1QGVA 2VUPA 1V9WA 3GL5A 3L9SA 4JZQA 3LORA 3VWUA 1XW6A 4KX4A 3P8WA 3WYWA 4LLRA 2X8GA 4PTSA 1ZGNA 3IV4A 4JBBA 2EIRA 2VIMA 2WB9A 4EUYA 2YOIA 3HYPA 2GT6A 4YKGA 1Q98A 5ELAA 4J57E 5AIXA 5J4VA 4ML1A 3A2WA 5HFGA 2C0EA 4IJ3A 1O8XA 2QA1A 3HDCA 3U5RE 1FVJA 2O7KA 2YWIA 2HZEB 3A2VA 1XOAA 2PVQA 1GSSA 4YQUA 2DMMA 2OBIA 4AKHA 2JACA 4ZB6A 4GQFA 3VWXA 3MAKA 4NWYA 4ZBDA 1RQMA 1FOVA 3LYPA 3TGZA 4V1Ap 4OFTA 1V57A 2FWFA 2C3NA 4HI7A 5DAKB 4K2DA 2P31A 4MF7A 1BEDA 3D4TA 5IPGA 4X0XA 4KA0A 20GSA 2HZEA 4J2FA 5G2ZA 2H74A 1ON4A 4KW6A 3N5OA 3IR4A 3HVSA 3GL3A 4HQZA 3FRCA 1XFLA 4EKZA 4CY6A 2X49A 1SVOA 5J5NA 4K9ZA 3EWLA 2NVLA 1OAZA 4G0LA 1R5PA 5CRGA 5DAKA 4OWYA 5D9TA 5J9CA 1S3DA 3DYRA 3FR6A 3HHVA 4N30A 1M9BA 3KMNA 2ZUPA 3C73A 1K3YA 1U3IA 1B4QA 2VAFA 2R3XA 4G0KA 4NMUA 2H71A 2R4VA 4AGSA 1K0DA 2A4HA 1AAZA 3MDKA 2H0GA 1A23A 3GSTA 1Z6MA 3HJMA 2L59A 4TW5A 5ID2B 3Q19A 1MDIA 3ZMLA 2E2MA 1HNCA 1SKSB 3PINA 3GKNA 1QQ2A 4TKYA 1F3BA 1SD8A 3KD0A 4FIWA 1YZXA 3HJPA 4EVMA 2D2ZA 1RK4A 2LKUA 3A5WA 3H8QA 4CHSA 2L5OA 2VLVA 1TRWA 2H66A 3C1RA 3F4RA 4FO5A 3IK9A 2VM1A 2X4AA 3EU3A 4HEA2 4YKFA 3FYGA 5IOXA 1TDIA 5F05A 4O32A 4IJIA 5ECHB 3LGCA 2L6DA 5ID2A 4QL9A 2FNOA 1O85A 3TJGA 1DE2A 1DSBA 3ERWA 13GSA 2JZSA 1NM3A 2C4JA 2VCZA 5GZZB 1G6WA 2XPDA 3V1WA 1UC7A 3VWWA 6GSUA 4AF2A 1GULA 5EVOA 4K7IA 2DKHA 2GZYA 2HXKA 2EIOA 4PURA 4MMMA 3GX0A 5A5HB 3FMWA 1ERWA 3D22A 1LU4A 5JCGA 1MD4A 3GN3A 1Y6EA 1O7UA 1MTCA 2C3QA 2YJHA 5B7CA 1T8EB 2E2GA 5CO3A 1A2JA 3TUEA 2LTKA 3PR8A 1M2DA 3ZFBA 3G7YA 3W6GA 2FWEA 2QSIA 4EDZA 4MJBA 4GWRA 1T3BA 2RM5A 1FVKA 2FLSA 2LRNA 2GS3A 4IVFA 1ZYPA 2N5FA 3ZVJD 1XWKA 2HFDA 2O5VA 4MJAA 5ECQB 4BA7A 3TCOA 1X5EA 2B3SA 5A5HA 1EWXA 1JZOA 1GTAA 4YQVA 1I9DA 1Q4JA 3FR9A 2FD3A 2VCQA 4F0CA 3GH6A 5C04A 1JHBA 1FB0A 3QAGA 5KOWA 3GKKA 4H86A 5CREA 1THOA 3ME7A 4ICYA 4MF5A 4GLTA 1MDJA 2LRCA 2TIRA 5GAPD 3KEBA 4L5LA 2HRNA 4LMWA 4HU9A 1A0RP 3TKRA 1VF3A 3GHAA 4WR5A 11GSA 2WFCA 2DLXA 3CSIA 4K8MA 4MA9A 5B6NA 2VO4A 2G2QA 3ISOA 1NSWA 1TXUA 3RPPA 4G01A 4EL1A 2H01A 1TKDB 1PA3A 1AQWA 2HNLA 3FKFA 3J7Yk 3M9KA 2GQLA 4EO3A 1WOUA 6GSVA 2M46A 1WP0A 1K3LA 2UV8G 4IS0A 1AQVA 2K8SA 2E7PA 2O85A 3G7JA 5ECNB 3RDWA 5ECRB 2H8LA 3IBHA 5KN2A 5HR2A 2K9FA 4WBRD 3PH9A 3EURA 1PRXA 1PSQA 5JCUA 2LJRA 3VFIA 1NHOA 3IOSA 2IJYA 3JCML 1ABAA 2FUG2 3WT1A 4MDCA 4PGTA 2F8AA 5D73A 2XBQA 3BD2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FO5 A;  2VCX A;  1OKD A;  3HZ4 A;  4KH7 A;  2E0Q A;  1KBN A;  1GUK A;  2RII A;  1MD3 A;  2CX3 A;  3EE2 A;  3CTG A;  1IYI A;  1Y25 A;  3QCP A;  2CV4 A;  1XCC A;  4MZC A;  2LEG A;  4RQX A;  2AAW A;  1V2A A;  4G9H A;  4IBP A;  4GF0 A;  3GRX A;  3IE3 A;  3AY8 A;  3GIX A;  4PUF C;  1V98 A;  5IMF A;  4F9Z A;  1TK0 B;  4E8E A;  1ACV A;  4O92 A;  3KZQ A;  2DJ2 A;  2VL3 A;  4QL7 A;  4F03 A;  5HQP A;  2H19 A;  2IMI A;  3UAR A;  2HRF A;  5BMU A;  5DCG A;  1JZD A;  5G30 A;  3CBU A;  1SL2 B;  1USB A;  3DGQ A;  2B6M A;  2V41 A;  5FHI A;  2AUV A;  3VLN A;  4AJ7 A;  5DDL A;  1I5G A;  4PQH A;  2H1A A;  1XW5 A;  5LCZ A;  4XTS A;  1GNW A;  3QFB C;  2O8V B;  5COH A;  3KP8 A;  1ERT A;  3QAW A;  2KP2 A;  1B4P A;  3TKP A;  1M7T A;  2JSY A;  4OFM A;  1F9M A;  3FR3 A;  4IQA A;  2FY6 A;  2YPM A;  3NOF A;  3PPU A;  4F0B A;  2H73 A;  5IMC A;  1GSU A;  2DJJ A;  4TR3 A;  4XCS A;  2K6V A;  4BL7 B;  2R37 A;  3VPQ A;  1X5D A;  3QAV A;  3FZ5 A;  3QR6 A;  1SJZ A;  5KN3 A;  2FHE A;  1OC8 A;  3TOU A;  2F3M A;  4NHW A;  1GL8 A;  3LQ7 A;  1OVN A;  2HQT A;  4XRD A;  2CT6 A;  4V2L A;  4KF9 A;  3QD9 A;  2LUS A;  2GZP A;  5D8I A;  1SJ6 A;  1N8J A;  1A2L A;  4PQI A;  1SKR B;  1ZYQ B;  1K0A A;  3M8N A;  1R4W A;  3VUR A;  3F4T A;  4L5O A;  5ECO B;  5G31 A;  3FEU A;  3F63 A;  4BL7 A;  3ZZX A;  4HS1 A;  2YWM A;  4EF0 A;  4GTU A;  2M80 A;  1PL2 A;  2H72 A;  4TOP A;  14GS A;  4PNF A;  3EU4 A;  2WZ9 A;  5D93 A;  1EP7 A;  3EMP A;  3MSZ A;  2AB6 A;  3TKS E;  3CTF A;  1YF1 A;  4JED A;  1X0R A;  4F2I A;  5D9X A;  3UVH A;  2O89 A;  3ZTL A;  2BJX A;  2ZNM A;  5JWO B;  4KDU A;  3FW2 A;  1BG5 A;  1A8Y A;  3UBL A;  1ERU A;  2LNT A;  2KHP A;  1M2A A;  9GSS A;  1GTU A;  1XVW A;  3DWV A;  3MWH A;  5CYY A;  2AJQ B;  2LQO A;  4O5R A;  1J9B A;  1UA5 A;  3S9F A;  2OAC A;  1KNG A;  3WT2 A;  1G6Y A;  1O8W A;  2L57 A;  5IM9 A;  4ZIL A;  4MH3 A;  3HA9 A;  1GUH A;  3LXT A;  5HR0 A;  1SYR A;  1DE1 A;  1XBS A;  3D21 A;  3I9V 2;  4MJE A;  1WIK A;  3TRX A;  1ZYE A;  2AYT A;  5JWR B;  5B6M A;  3P7X A;  5ECK B;  3ZRE A;  4ECC A;  1QUW A;  5EL8 A;  2OA7 A;  2PU9 C;  3M1G A;  2KLX A;  2HSM B;  2FGX A;  1U88 A;  1O81 A;  2L5L A;  1SYX A;  5HFI A;  1ML6 A;  5ECP B;  4G10 A;  4ZBA A;  3H79 A;  4Q5R A;  3UOM A;  4MZW A;  2IWT A;  4TXV A;  1B9X C;  4MZB A;  1ZZY A;  2GZZ A;  1YQ1 A;  2H0H A;  2N5A A;  2N5B A;  5CRW A;  1GRX A;  3M3M A;  4KB3 A;  4BVY B;  1K0B A;  1V58 A;  2YJ7 A;  2PMT A;  3HD5 A;  2DIZ A;  4PUA A;  2I3Y A;  2YAN A;  2DML A;  1YDK A;  2HSM A;  3QOU A;  3DD3 A;  3H1N A;  2DBC A;  1NHY A;  4X43 A;  4NPB A;  5GSS A;  3CSJ A;  5DCH A;  4IGJ A;  5H5Q A;  2GTU A;  5AIV A;  2XHF A;  2CQ9 A;  3IAM 2;  1PD2 1;  5INY A;  4ZL7 A;  1ZMA A;  3TOT A;  4L0W A;  2MZC A;  4IP6 A;  3GUR A;  1FG4 A;  1GSY A;  3F0I A;  4FYC A;  4BVY A;  3KCM A;  2C80 A;  1T4Z A;  3L78 A;  3QPM A;  3Q74 A;  3ZYW A;  5DBQ A;  4Z7X A;  2YZH A;  4V2M A;  2RM6 A;  3LWA A;  4IQ1 A;  2HSH A;  4EXJ A;  2LJK A;  4I6X A;  3UJ1 A;  4AJ6 A;  4I8B A;  3FZ4 A;  3IA1 A;  4K7O A;  1KTE A;  1M9A A;  1H4O A;  4IP1 A;  4XIH A;  2HSN B;  3DVW A;  1PGT A;  5H5S A;  2VCT A;  2KP1 A;  2OKA A;  3L9U A;  1VF4 A;  5FT3 A;  1GUM A;  3KMO A;  3UEM A;  1JLV A;  5KEJ A;  3FHK A;  18GS A;  2PBJ A;  3KTB A;  4ECJ A;  2JL4 A;  1MEK A;  4AJ8 A;  5GAN D;  2XBI A;  3TRQ A;  3L4N A;  2JZR A;  2WDU A;  1OC9 B;  3GKX A;  2VM2 A;  2MMZ A;  5KN0 A;  1K0C A;  5B8B A;  2VCW A;  3F6F A;  5G5F A;  1XWA A;  3I6A A;  2CA8 A;  4PXO A;  2KOK A;  4TR0 A;  1JFU A;  4KE3 A;  2TRC P;  2CVK A;  4BVX B;  4MCU A;  1SK1 A;  3TB2 A;  3F4S A;  1XOB A;  4DSR A;  1K0O A;  4XS4 B;  2PUK C;  2F51 A;  1EEJ A;  1NW2 A;  3TJJ A;  5JWQ B;  1GP1 A;  2JU5 A;  2ON7 A;  3KH7 A;  2MMN A;  4ILF A;  4FYU A;  2IPA A;  1OC9 A;  1R5A A;  4GXZ A;  4G19 A;  1EZK A;  4HUA A;  4USS A;  1F2E A;  3HCZ A;  1EGO A;  4I2T A;  3ZIV A;  3H93 A;  2WCI A;  4KGI A;  1KEB A;  4BVX A;  2YV7 A;  3DEX A;  2LV3 A;  3D5J A;  4MPF A;  4RUV A;  2ES7 A;  1PKW A;  4RQR A;  4XS4 A;  1SK2 A;  4LL4 B;  4NV5 A;  2V2G A;  3EYT A;  5CRH A;  3RHB A;  1J0F A;  2H6Z A;  4KSO A;  4TR1 B;  1WPI A;  3Q6O A;  3U6V A;  4E8H A;  3LFL A;  4YH2 A;  1ILO A;  2I4A A;  2FA4 A;  1FB6 A;  3ZIJ A;  2VD0 A;  2KUC A;  3LEF A;  2HI7 A;  3RPN A;  1VGL A;  2YNX A;  2AV4 A;  3WGE A;  1A8L A;  3IPZ A;  3CSH A;  3WGX A;  5ECM B;  4NV2 A;  5CAX A;  3TKS C;  2C0G A;  4WBJ A;  3DXB A;  5HR3 A;  1SD9 A;  2OE0 A;  1E6B A;  2RUE A;  3F3R A;  4TR1 A;  2IFQ B;  2FCH A;  1PX6 A;  3WGD A;  4GST A;  2WUL A;  3UAP A;  1A0F A;  4BWQ A;  1X9S B;  3L9V A;  1V40 A;  2GGT A;  2B5E A;  4TRX A;  1HNA A;  3ZMK A;  1EP8 A;  1GSE A;  5D96 A;  2C0F A;  22GS A;  1URM A;  4WEY A;  3D0Z A;  3GUS A;  3GSS A;  2MMO A;  4IKH A;  3APO A;  3GX8 A;  1TP9 A;  5J9B A;  4K7N A;  2DC5 A;  1Z5Y E;  3O6T A;  1GLP A;  4NXI A;  1B8X A;  5D9W A;  4ZL8 A;  4POL A;  2IFQ A;  1O73 A;  1XXU A;  3HXS A;  2P0G A;  3M9J A;  3IDV A;  1B9Y C;  4GQC A;  1ZL9 A;  1K3O A;  1TU8 A;  2IMD A;  4QQ7 A;  1HYU A;  3ERF A;  1G7E A;  1Z7R A;  3GKM A;  2VL2 C;  2GVP A;  2H1G A;  1T4Y A;  4ML6 A;  1GSD A;  4RI6 A;  4WET A;  3C71 A;  3RAZ A;  2X8H A;  2O87 A;  3TJB A;  3F3Q A;  3FZ9 A;  4XRA A;  5JCW A;  2CVD A;  2PGT A;  1FAA A;  4I2U A;  2GSS A;  1W4V A;  3HY2 A;  5J3R A;  2DJK A;  1GLQ A;  3UMA A;  5E4W A;  1GNE A;  4OD7 A;  2X8C A;  2HLS A;  3SBC A;  4Q5Q A;  5DJL A;  1C72 A;  4ECI A;  3WD6 A;  1QFN A;  2DIY A;  2I1U A;  3BCI A;  1OYJ A;  4HZ2 A;  4HQS A;  4MAB A;  4TN8 A;  1HD2 A;  1BAY A;  1BQ7 A;  1HQO A;  4HDE A;  3GA4 A;  2H75 A;  5DQS A;  3VWV A;  2HRK B;  5F07 A;  4ZL9 A;  1GWC A;  5G5E A;  2IL3 A;  5ABR A;  2HZF A;  2CAQ A;  2M72 A;  4FH8 A;  1XPV A;  2B5Y A;  2LQQ A;  2QKE A;  5L71 A;  2OAD A;  2CAI A;  1CQH A;  4IN0 A;  3H4K A;  2TRX A;  1T7P B;  1PMT A;  6GST A;  1S3A A;  3DKS A;  1XWC A;  3GTU B;  4MK3 A;  1AQX A;  3A3T A;  3LG6 A;  2REM A;  1GTB A;  2VD1 A;  2YWO A;  3KP9 A;  2JZT A;  4EE0 A;  2EIQ A;  2HRK A;  3KIJ A;  4GSN A;  1XWB A;  1TJD A;  3KTL A;  2CZ3 A;  2JAD A;  4WF4 A;  4JRR A;  2H0I A;  1X5C A;  3UVT A;  1EOG A;  3I69 A;  1FHE A;  1G0T A;  4HOJ A;  1SK0 A;  17GS A;  1PQN A;  1PN9 A;  3GTU A;  2A2S A;  1YEX A;  1OE7 A;  1BJX A;  4Q5N A;  4BPY A;  2VL9 A;  4KND A;  1X9W B;  3KH9 A;  3ZFL A;  4V2N A;  3W8J A;  1DUG A;  2H76 A;  1M99 A;  2X64 A;  2C3T A;  2GQM A;  5F06 A;  4MLY A;  3BCK A;  4TR4 A;  3NIV A;  1OKT A;  1FW1 A;  4HZ4 A;  2IMF A;  5ECI B;  1SL0 B;  3RBT A;  1J08 A;  4O7H A;  3UL3 A;  1TTZ A;  2MYG A;  3NZN A;  3LJR A;  5DVB A;  2VLT A;  2C0D A;  4WKW A;  2H6X A;  1A24 A;  4KCA A;  3P90 A;  4ACS A;  4L0U A;  1YJ6 A;  3DIE A;  1EEM A;  2CX4 A;  3ZLP A;  3KXO A;  4OFN A;  2YN1 A;  1QK8 A;  4ZBB A;  1O6J A;  5ELG A;  1GH2 A;  5EPF A;  3ED3 A;  4ISD A;  4OO5 A;  1HNB A;  1E2Y A;  1ZOF A;  4POK A;  2XPE A;  3TKS A;  5A4W A;  4D73 B;  4K0N A;  1TRS A;  3CMI A;  2DJ0 A;  4POB A;  1M2B A;  4OCF A;  1F3A A;  1UN2 A;  1TRV A;  4JU5 A;  4IHU A;  5IO2 A;  5CRD A;  2DJ3 A;  8GSS A;  4DSS B;  1DBY A;  2H1B A;  2GQK A;  5IPH A;  5IOW A;  4DVC A;  3IHQ A;  3CRT A;  1XZO A;  3BOA A;  1VRS D;  2B1L A;  3HVX A;  5A5K A;  2V1M A;  2B1K A;  6GSX A;  3ME8 A;  4EC0 A;  4J56 E;  4WXT A;  4MP4 A;  4D73 A;  4XS6 A;  1B48 A;  2DSA A;  3O76 A;  5G1L A;  2I9H A;  4GCI A;  5AN1 A;  5IIZ A;  1WJK A;  2NDO A;  2I81 A;  1ZCP A;  3TRP A;  4PQ1 A;  2GLR A;  1YKA A;  2IME A;  1XWG A;  2K8V A;  1BYE A;  1TOF A;  4DSS A;  7GSS A;  1QMV A;  3C1S A;  3O3T A;  4PNG A;  1BX9 A;  5ECL B;  2H30 A;  2HSY A;  2LST A;  4IW9 A;  1EOH A;  3ERG A;  2R5G A;  3HZ8 A;  2VL2 A;  3IAS 2;  3APQ A;  3PGT A;  3E3E A;  1Z7P A;  2ON5 A;  2YP6 A;  1AW9 A;  3F6D A;  3MNG A;  4N11 A;  5CP1 A;  4GSS A;  1SU9 A;  1T1V A;  1A2M A;  4KCE A;  5CNW A;  5IQY A;  2C8U A;  1YEP A;  2QGV A;  1XW9 A;  2GT5 A;  2VOC A;  3GNJ A;  3KJY A;  1TRU A;  2YZU A;  5DQY A;  1H75 A;  3US3 A;  3G7I A;  2A2R A;  3L0H A;  4OO4 A;  1LJR A;  3KM6 A;  1WRY A;  2LJA A;  3IRA A;  1UVZ A;  4HJ2 A;  1Z6N A;  4GRF A;  3I43 A;  3HJO A;  5DJM A;  2R6K A;  4ECB A;  4OCE A;  4NAX A;  4OMV A;  2OJL A;  2NTO A;  2QC7 A;  3W8S A;  3TDG A;  2WGR A;  4ZXG A;  1TI1 A;  5DAL B;  1G7O A;  3D4M A;  4FYB A;  4I5Q A;  4POM A;  1U6T A;  2MBT A;  1R7H A;  2WS2 A;  1OC3 A;  4YQM A;  3ZIT A;  2LNS A;  1GSF A;  3UIW A;  12GS A;  2EC4 A;  1YY7 A;  2J9H A;  3A2X A;  4KAE A;  3KGK A;  4Q5F A;  2LS5 A;  2VLU A;  3ZL5 A;  2YCD A;  5A4V A;  10GS A;  3CRU A;  1JZR A;  1T00 A;  4K6X A;  3Q18 A;  1TI3 A;  2J23 A;  3N9J A;  1VF2 A;  5DAL A;  4BWS A;  2R2J A;  1WMJ A;  3BJ5 A;  1M0U A;  3VI7 A;  5LNK e;  3GYK A;  1PKZ A;  2C1Y A;  5EY6 A;  2NBS A;  1AXD A;  4CW9 A;  5AGY A;  5IMZ A;  3R3E A;  5IMV A;  1EV4 A;  1TW9 A;  1ST9 A;  5HR1 A;  2H70 A;  2HE3 A;  1GTI A;  2V6O A;  4MJC A;  2YV9 A;  3VI5 A;  4EDY A;  3C7M A;  1ERV A;  2BMX A;  3M0F A;  2H1D A;  1JLW A;  2OE1 A;  4MH2 A;  4FQU A;  5AIS A;  4X1U A;  3F8U A;  5LD0 A;  6GSY A;  4N0Z A;  2G0F A;  4TXO B;  3OR5 A;  2IN3 A;  4WR4 A;  2L4Q A;  4HJM A;  19GS A;  1SKW B;  3HVV A;  2PVO C;  6GSW A;  4XS1 A;  3UBK A;  3FZA A;  3P2A A;  3TJF A;  1PL1 A;  4MF6 A;  2X99 A;  3QFA C;  1U3A A;  1LBK A;  1K0N A;  3IK7 A;  2ZCT A;  5HFK A;  1TXX A;  2CZ2 A;  4KSM A;  4NHZ A;  2CVB A;  2H6Y A;  3IXR A;  1Z9H A;  6GSS A;  4JR4 A;  4YAV A;  4V1A g;  4CDO A;  4TXO A;  1CQG A;  1RW1 A;  3DRN A;  5E59 A;  1QXH A;  4MPG A;  3GV1 A;  2MBS A;  1JZW A;  2NPB A;  4LMV A;  5IMD A;  4LL1 B;  1IYH A;  5FWG A;  3G9B A;  1OE8 A;  2B7J A;  2FA8 A;  1F37 A;  1TK5 B;  2B5X A;  5IMA A;  1XIY A;  3TKQ A;  2BTO T;  3GH9 A;  3D6I A;  3LSZ A;  3VK9 A;  3EMX A;  1F6M C;  3GMF A;  16GS A;  4KDY A;  3ZRD A;  1X9M B;  1SEN A;  2VCV A;  4WF5 A;  3ZVJ A;  5F8B A;  3F9U A;  1PX7 A;  2OBK A;  1VF1 A;  4ULX A;  3QMX A;  3FK8 A;  3VPT A;  4RI7 A;  2IMK A;  3J7Y b;  2B7K A;  2PPT A;  3APS A;  2RLI A;  4I97 A;  3SWL A;  2PER A;  2RUF A;  2GDR A;  5F0G A;  5A4U A;  1THX A;  2P5R A;  3CYN A;  2Z9S A;  1U87 A;  1S3C A;  3BBY A;  2F9S A;  2UZ8 A;  3EVI A;  3K8N A;  5C00 A;  3RHC A;  4P3Y B;  3IC8 A;  4DSQ A;  4HU7 A;  5GST A;  4JR6 A;  4N10 A;  1WE0 A;  5J4U A;  5IO0 A;  3TJK A;  5ENU A;  2OE3 A;  1K0M A;  5D9V A;  1AUC A;  2GST A;  3IC4 A;  2HYX A;  2AHE A;  2GSQ A;  2MMA A;  4LA1 A;  4IEL A;  2FWG A;  1SL1 B;  2V32 A;  3EIN A;  1XVQ A;  2K18 A;  2GSR A;  2PWJ A;  4K0G A;  1WWJ A;  4XHM A;  1Z3E A;  1TK8 B;  4ZB9 A;  4TVE A;  2WRT A;  3QDN A;  2YWN A;  1AC1 A;  2WJU A;  5H5R A;  1AIU A;  4G0I A;  4N0V A;  4K1F A;  4DEJ A;  3EC3 A;  3LXZ A;  4G2E A;  4L8E A;  1R26 A;  1N2A A;  2IIY A;  1EV9 A;  2HRA A;  3R2Q A;  5ECS A;  2FWH A;  2JSZ A;  4KUN A;  3HKR A;  4ID0 A;  2XC2 A;  2PN8 A;  2P5Q A;  2L4C A;  3CXG A;  3E0U A;  1GSQ A;  1SJI A;  2L6C A;  1MDK A;  3GFK A;  2V6K A;  4KDX A;  2F8F A;  2DJ1 A;  5B8A A;  4ZB8 A;  1YKC A;  4PX1 A;  5J41 A;  4JE1 A;  2HT9 A;  1YF0 A;  1EGR A;  3FY7 A;  3E9J B;  1TU7 A;  2LRT A;  3DML A;  5G1K A;  4YAP A;  4F82 A;  2ALB A;  1W89 A;  5KN1 A;  2A4V A;  4ZIJ A;  3DVX A;  3LYK A;  3C8E A;  1QGV A;  2VUP A;  1V9W A;  3GL5 A;  3L9S A;  4JZQ A;  3LOR A;  3VWU A;  1XW6 A;  4KX4 A;  3P8W A;  3WYW A;  4LLR A;  2X8G A;  4PTS A;  1ZGN A;  3IV4 A;  4JBB A;  2EIR A;  2VIM A;  2WB9 A;  4EUY A;  2YOI A;  3HYP A;  2GT6 A;  1Q98 A;  5ELA A;  4J57 E;  5AIX A;  4ML1 A;  3A2W A;  5HFG A;  2C0E A;  4IJ3 A;  1O8X A;  3HDC A;  3U5R E;  1FVJ A;  2O7K A;  2YWI A;  2HZE B;  3A2V A;  1XOA A;  2PVQ A;  1GSS A;  4YQU A;  2DMM A;  2OBI A;  2JAC A;  4ZB6 A;  4GQF A;  3VWX A;  3MAK A;  4NWY A;  4ZBD A;  1RQM A;  1FOV A;  3LYP A;  3TGZ A;  4V1A p;  4OFT A;  1V57 A;  2FWF A;  2C3N A;  4HI7 A;  5DAK B;  4K2D A;  2P31 A;  4MF7 A;  1BED A;  3D4T A;  5IPG A;  4X0X A;  4KA0 A;  20GS A;  2HZE A;  4J2F A;  5G2Z A;  2H74 A;  1ON4 A;  4KW6 A;  3N5O A;  3IR4 A;  3HVS A;  3GL3 A;  4HQZ A;  3FRC A;  1XFL A;  4EKZ A;  5J5N A;  4K9Z A;  3EWL A;  2NVL A;  1OAZ A;  4G0L A;  1R5P A;  5CRG A;  5DAK A;  4OWY A;  5D9T A;  5J9C A;  1S3D A;  3DYR A;  3FR6 A;  3HHV A;  4N30 A;  1M9B A;  3KMN A;  2ZUP A;  3C73 A;  1K3Y A;  1U3I A;  1B4Q A;  2VAF A;  2R3X A;  4G0K A;  4NMU A;  2H71 A;  2R4V A;  4AGS A;  1K0D A;  1AAZ A;  3MDK A;  2H0G A;  1A23 A;  3GST A;  1Z6M A;  3HJM A;  2L59 A;  4TW5 A;  5ID2 B;  3Q19 A;  1MDI A;  3ZML A;  2E2M A;  1HNC A;  1SKS B;  3PIN A;  3GKN A;  1QQ2 A;  4TKY A;  1F3B A;  1SD8 A;  3KD0 A;  4FIW A;  1YZX A;  3HJP A;  4EVM A;  2D2Z A;  1RK4 A;  2LKU A;  3A5W A;  3H8Q A;  4CHS A;  2L5O A;  2VLV A;  1TRW A;  2H66 A;  3C1R A;  3F4R A;  4FO5 A;  3IK9 A;  2VM1 A;  3EU3 A;  4HEA 2;  3FYG A;  5IOX A;  1TDI A;  5F05 A;  4O32 A;  4IJI A;  5ECH B;  3LGC A;  2L6D A;  5ID2 A;  4QL9 A;  2FNO A;  1O85 A;  3TJG A;  1DE2 A;  1DSB A;  3ERW A;  13GS A;  2JZS A;  1NM3 A;  2C4J A;  2VCZ A;  5GZZ B;  1G6W A;  2XPD A;  3V1W A;  1UC7 A;  3VWW A;  6GSU A;  4AF2 A;  1GUL A;  5EVO A;  4K7I A;  2GZY A;  2HXK A;  2EIO A;  4PUR A;  4MMM A;  3GX0 A;  1ERW A;  3D22 A;  1LU4 A;  5JCG A;  1MD4 A;  3GN3 A;  1Y6E A;  1O7U A;  1MTC A;  2C3Q A;  2YJH A;  5B7C A;  1T8E B;  2E2G A;  5CO3 A;  1A2J A;  3TUE A;  2LTK A;  3PR8 A;  1M2D A;  3ZFB A;  3G7Y A;  3W6G A;  2FWE A;  2QSI A;  4EDZ A;  4MJB A;  4GWR A;  1T3B A;  2RM5 A;  1FVK A;  2FLS A;  2LRN A;  2GS3 A;  4IVF A;  2N5F A;  3ZVJ D;  1XWK A;  2HFD A;  4MJA A;  5ECQ B;  4BA7 A;  3TCO A;  1X5E A;  2B3S A;  1EWX A;  1JZO A;  1GTA A;  4YQV A;  1I9D A;  1Q4J A;  3FR9 A;  2FD3 A;  2VCQ A;  4F0C A;  3GH6 A;  5C04 A;  1JHB A;  1FB0 A;  3QAG A;  3GKK A;  4H86 A;  5CRE A;  1THO A;  3ME7 A;  4MF5 A;  4GLT A;  1MDJ A;  2LRC A;  2TIR A;  5GAP D;  3KEB A;  4L5L A;  2HRN A;  4LMW A;  4HU9 A;  1A0R P;  3TKR A;  1VF3 A;  3GHA A;  4WR5 A;  11GS A;  2WFC A;  2DLX A;  3CSI A;  4K8M A;  4MA9 A;  5B6N A;  2VO4 A;  2G2Q A;  3ISO A;  1NSW A;  3RPP A;  4EL1 A;  2H01 A;  1TKD B;  1PA3 A;  1AQW A;  2HNL A;  3FKF A;  3J7Y k;  3M9K A;  2GQL A;  4EO3 A;  1WOU A;  6GSV A;  2M46 A;  1WP0 A;  1K3L A;  4IS0 A;  1AQV A;  2K8S A;  2E7P A;  2O85 A;  3G7J A;  5ECN B;  3RDW A;  5ECR B;  2H8L A;  3IBH A;  5KN2 A;  5HR2 A;  2K9F A;  4WBR D;  3PH9 A;  3EUR A;  1PRX A;  1PSQ A;  5JCU A;  2LJR A;  3VFI A;  1NHO A;  3IOS A;  2IJY A;  3JCM L;  1ABA A;  2FUG 2;  3WT1 A;  4MDC A;  4PGT A;  2F8A A;  5D73 A;  2XBQ A;  3BD2 A; 
#chains in the Genus database with same CATH topology
 1FO5 A;  2VCX A;  1OKD A;  3HZ4 A;  4KH7 A;  2E0Q A;  1KBN A;  1GUK A;  2RII A;  1MD3 A;  2CX3 A;  3EE2 A;  3CTG A;  4EIQ A;  1IYI A;  1Y25 A;  3QCP A;  2CV4 A;  1XCC A;  4MZC A;  2LEG A;  4RQX A;  2AAW A;  1V2A A;  4G9H A;  4HSC X;  5BMU B;  4IBP A;  4GF0 A;  3GRX A;  3IE3 A;  3AY8 A;  3GIX A;  4PUF C;  1V98 A;  5IMF A;  4F9Z A;  1TK0 B;  4E8E A;  1ACV A;  4O92 A;  3KZQ A;  2DJ2 A;  2VL3 A;  4QL7 A;  4F03 A;  4FXY P;  5HQP A;  4K5S A;  2H19 A;  2R0C A;  2IMI A;  3UAR A;  2HRF A;  5BMU A;  5DCG A;  1JZD A;  5G30 A;  1SVL A;  3CBU A;  1SL2 B;  1USB A;  3DGQ A;  2B6M A;  2V41 A;  5FHI A;  3A5I A;  2AUV A;  3VLN A;  4Z2R A;  4AJ7 A;  5DDL A;  1I5G A;  4PQH A;  4QMK A;  2H1A A;  1XW5 A;  5LCZ A;  4XTS A;  1GNW A;  3QFB C;  2O8V B;  5COH A;  3KP8 A;  1ERT A;  3QAW A;  2KP2 A;  1B4P A;  3TKP A;  1M7T A;  2JSY A;  4OFM A;  1F9M A;  3FR3 A;  4IQA A;  2FY6 A;  2YPM A;  3NOF A;  3PPU A;  4F0B A;  2H73 A;  5IMC A;  1GSU A;  2DJJ A;  4TR3 A;  4XCS A;  2K6V A;  4BL7 B;  2R37 A;  3VPQ A;  1X5D A;  3QAV A;  3FZ5 A;  3QR6 A;  1SJZ A;  5KN3 A;  2FHE A;  1OC8 A;  3TOU A;  2F3M A;  4NHW A;  1GL8 A;  3LQ7 A;  1OVN A;  2HQT A;  4XRD A;  2CT6 A;  4V2L A;  4KF9 A;  4GDF A;  3QD9 A;  2LUS A;  2GZP A;  5D8I A;  1SJ6 A;  1N8J A;  1A2L A;  4PQI A;  3MIX A;  1SKR B;  1ZYQ B;  1K0A A;  3M8N A;  1R4W A;  3VUR A;  3F4T A;  4L5O A;  5ECO B;  5G31 A;  3FEU A;  3F63 A;  4BL7 A;  3ZZX A;  4HS1 A;  2YWM A;  4EF0 A;  4GTU A;  2M80 A;  1PL2 A;  2H72 A;  4TOP A;  14GS A;  4PNF A;  3EU4 A;  2WZ9 A;  5D93 A;  1EP7 A;  3EMP A;  3MYD A;  3MSZ A;  2AB6 A;  3TKS E;  3CTF A;  1YF1 A;  4JED A;  1X0R A;  4F2I A;  5D9X A;  3UVH A;  2O89 A;  3ZTL A;  2BJX A;  2ZNM A;  5JWO B;  4KDU A;  3FW2 A;  1BG5 A;  1A8Y A;  3UBL A;  1ERU A;  2LNT A;  2KHP A;  1M2A A;  9GSS A;  1GTU A;  1XVW A;  3DWV A;  3MWH A;  5CYY A;  2AJQ B;  2LQO A;  4O5R A;  4MNN A;  1J9B A;  1UA5 A;  3S9F A;  2OAC A;  1KNG A;  3WT2 A;  1G6Y A;  1O8W A;  2L57 A;  5IM9 A;  4ZIL A;  4MH3 A;  3HA9 A;  1GUH A;  3LXT A;  5HR0 A;  1SYR A;  1DE1 A;  1XBS A;  3D21 A;  3I9V 2;  4MJE A;  1WIK A;  3TRX A;  1ZYE A;  2AYT A;  5JWR B;  5B6M A;  3P7X A;  5ECK B;  3ZRE A;  4ECC A;  1QUW A;  5EL8 A;  2OA7 A;  2PU9 C;  3M1G A;  2KLX A;  2HSM B;  2FGX A;  1U88 A;  2EFH A;  1O81 A;  2L5L A;  1SYX A;  5HFI A;  1ML6 A;  5ECP B;  4G10 A;  4ZBA A;  3H79 A;  1YEW C;  4Q5R A;  3UOM A;  4MZW A;  2IWT A;  4TXV A;  1B9X C;  4PI2 C;  4MZB A;  1ZZY A;  2GZZ A;  1YQ1 A;  2H0H A;  2N5A A;  2N5B A;  5CRW A;  1GRX A;  3M3M A;  4KB3 A;  4BVY B;  1K0B A;  1V58 A;  2YJ7 A;  2PMT A;  3HD5 A;  2DIZ A;  4PUA A;  2I3Y A;  2YAN A;  2DML A;  1YDK A;  2HSM A;  3QOU A;  3DD3 A;  3H1N A;  2DBC A;  1NHY A;  4X43 A;  4NPB A;  5GSS A;  3CSJ A;  5DCH A;  4IGJ A;  5H5Q A;  2GTU A;  5AIV A;  2XHF A;  2CQ9 A;  3IAM 2;  1PD2 1;  5INY A;  4ZL7 A;  1ZMA A;  3TOT A;  4L0W A;  2MZC A;  4IP6 A;  3GUR A;  1FG4 A;  1GSY A;  3F0I A;  4FYC A;  4BVY A;  3KCM A;  2C80 A;  1T4Z A;  3L78 A;  3QPM A;  3Q74 A;  3ZYW A;  5DBQ A;  4Z7X A;  2YZH A;  4V2M A;  2RM6 A;  3LWA A;  4IQ1 A;  2HSH A;  4EXJ A;  2LJK A;  4I6X A;  4O5Q A;  3UJ1 A;  4AJ6 A;  4I8B A;  3FZ4 A;  3IA1 A;  4K7O A;  5J47 A;  1KTE A;  1M9A A;  1H4O A;  4IP1 A;  4XIH A;  2HSN B;  3DVW A;  1PGT A;  5H5S A;  2VCT A;  2KP1 A;  2OKA A;  3IHG A;  3L9U A;  1VF4 A;  5FT3 A;  1GUM A;  3KMO A;  3UEM A;  1JLV A;  5KEJ A;  3FHK A;  18GS A;  2PBJ A;  3KTB A;  4ECJ A;  2JL4 A;  1MEK A;  4AJ8 A;  5GAN D;  1Y1U A;  2XBI A;  3TRQ A;  3L4N A;  2JZR A;  2WDU A;  1OC9 B;  3GKX A;  2VM2 A;  2MMZ A;  5KN0 A;  1K0C A;  5B8B A;  4Z2U A;  2VCW A;  3F6F A;  5G5F A;  1XWA A;  3I6A A;  2CA8 A;  2HSN A;  4K5R A;  4PXO A;  2KOK A;  4TR0 A;  1JFU A;  4KE3 A;  2TRC P;  2CVK A;  4BVX B;  4E68 A;  4MCU A;  1SK1 A;  3TB2 A;  3F4S A;  1XOB A;  4DSR A;  1K0O A;  4XS4 B;  2PUK C;  2F51 A;  1EEJ A;  1NW2 A;  3TJJ A;  5JWQ B;  1GP1 A;  2JU5 A;  2ON7 A;  3KH7 A;  2MMN A;  4ILF A;  2R0G A;  4FYU A;  2IPA A;  1OC9 A;  1R5A A;  4GXZ A;  4G19 A;  1EZK A;  4PI0 C;  4HUA A;  4USS A;  1F2E A;  3HCZ A;  1EGO A;  4I2T A;  3ZIV A;  3H93 A;  2WCI A;  4KGI A;  1KEB A;  4BVX A;  2YV7 A;  3DEX A;  2LV3 A;  3D5J A;  4PHZ C;  4MPF A;  4RUV A;  2ES7 A;  1S4B P;  1PKW A;  4RQR A;  4XS4 A;  1SK2 A;  4LL4 B;  4NV5 A;  2V2G A;  3EYT A;  5CRH A;  3RHB A;  1J0F A;  2H6Z A;  4KSO A;  4TR1 B;  1WPI A;  3Q6O A;  3U6V A;  4E8H A;  3LFL A;  4YH2 A;  1ILO A;  2I4A A;  2FA4 A;  1FB6 A;  3ZIJ A;  2VD0 A;  2KUC A;  3LEF A;  2HI7 A;  3RPN A;  1VGL A;  2YNX A;  2AV4 A;  4O5U A;  3WGE A;  1A8L A;  3IPZ A;  3CSH A;  3WGX A;  5ECM B;  4NV2 A;  5CAX A;  3TKS C;  2C0G A;  4WBJ A;  3DXB A;  5HR3 A;  1SD9 A;  2OE0 A;  5KOX A;  1E6B A;  2RUE A;  3F3R A;  4TR1 A;  4Z2T A;  2IFQ B;  2FCH A;  1PX6 A;  3WGD A;  4GST A;  2WUL A;  3UAP A;  1A0F A;  4BWQ A;  2R0P A;  1X9S B;  3L9V A;  1V40 A;  2GGT A;  3HVN A;  2B5E A;  4TRX A;  1HNA A;  3ZMK A;  1EP8 A;  1GSE A;  5D96 A;  2C0F A;  22GS A;  1URM A;  4WEY A;  3D0Z A;  2H1L A;  3GUS A;  3GSS A;  2MMO A;  4IKH A;  3APO A;  3GX8 A;  1TP9 A;  5J9B A;  4K7N A;  2DC5 A;  1Z5Y E;  2WVX B;  3O6T A;  1GLP A;  4NXI A;  1B8X A;  5D9W A;  4ZL8 A;  4POL A;  2IFQ A;  1O73 A;  1XXU A;  3HXS A;  2P0G A;  3M9J A;  3IDV A;  1B9Y C;  4GQC A;  1ZL9 A;  1K3O A;  1TU8 A;  2IMD A;  4QQ7 A;  1HYU A;  3ERF A;  1G7E A;  1Z7R A;  3GKM A;  2VL2 C;  2GVP A;  2H1G A;  1T4Y A;  4ML6 A;  1GSD A;  4RI6 A;  4WET A;  3C71 A;  3RAZ A;  2X8H A;  2O87 A;  3TJB A;  2WVX A;  3F3Q A;  4ZB7 A;  3FZ9 A;  4XRA A;  5JCW A;  2CVD A;  2PGT A;  1FAA A;  4I2U A;  2GSS A;  1W4V A;  3HY2 A;  5J3R A;  2DJK A;  1GLQ A;  3UMA A;  5E4W A;  1GNE A;  3HMJ G;  4OD7 A;  4BIK A;  2X8C A;  5BRT A;  2HLS A;  3SBC A;  4Q5Q A;  5DJL A;  3CHX C;  1C72 A;  4ECI A;  3WD6 A;  1QFN A;  2DIY A;  2I1U A;  3BCI A;  1OYJ A;  4HZ2 A;  4HQS A;  4MAB A;  4TN8 A;  1HD2 A;  1BAY A;  1BQ7 A;  1HQO A;  2EFD A;  4A5P A;  4HDE A;  3GA4 A;  2H75 A;  5DQS A;  3VWV A;  2HRK B;  5F07 A;  4ZL9 A;  1GWC A;  5G5E A;  2IL3 A;  5ABR A;  2HZF A;  2CAQ A;  2M72 A;  4FH8 A;  1XPV A;  2B5Y A;  5A1N B;  2LQQ A;  2QKE A;  5L71 A;  2OAD A;  2CAI A;  1CQH A;  4IN0 A;  3H4K A;  2TRX A;  1T7P B;  1PMT A;  6GST A;  1S3A A;  3DKS A;  1XWC A;  3GTU B;  4MK3 A;  1AQX A;  3A3T A;  3LG6 A;  2REM A;  1GTB A;  2VD1 A;  2YWO A;  2WW0 A;  3KP9 A;  2JZT A;  4EE0 A;  2EIQ A;  2HRK A;  3KIJ A;  4GSN A;  1M3J A;  1XWB A;  1TJD A;  3KTL A;  2CZ3 A;  2JAD A;  4WF4 A;  4JRR A;  5A1N A;  2H0I A;  1X5C A;  3UVT A;  1EOG A;  3I69 A;  1FHE A;  1G0T A;  3LW9 A;  4HOJ A;  4W66 A;  1SK0 A;  17GS A;  1PQN A;  2WW3 A;  1PN9 A;  3GTU A;  2A2S A;  1YEX A;  1OE7 A;  1BJX A;  4Q5N A;  4BPY A;  2VL9 A;  4KND A;  1X9W B;  3KH9 A;  3ZFL A;  4V2N A;  3W8J A;  1DUG A;  2H76 A;  1M99 A;  2X64 A;  2C3T A;  2GQM A;  5F06 A;  4MLY A;  3BCK A;  4TR4 A;  3NIV A;  1OKT A;  1FW1 A;  4HZ4 A;  2IMF A;  5ECI B;  1SL0 B;  3RBT A;  1J08 A;  4O7H A;  3UL3 A;  1TTZ A;  2MYG A;  3NZN A;  3LJR A;  5DVB A;  2VLT A;  2C0D A;  4WKW A;  2H6X A;  2O3E A;  1A24 A;  4KCA A;  3P90 A;  4ACS A;  4L0U A;  1YJ6 A;  3DIE A;  1EEM A;  2CX4 A;  3ZLP A;  3KXO A;  4OFN A;  2YN1 A;  1YVL A;  1QK8 A;  4ZBB A;  1O6J A;  5ELG A;  1GH2 A;  5EPF A;  3ED3 A;  4AKI A;  4ISD A;  4OO5 A;  1HNB A;  1E2Y A;  1ZOF A;  4POK A;  2XPE A;  2DKI A;  3TKS A;  2VKZ G;  5A4W A;  4D73 B;  4K0N A;  1TRS A;  3CMI A;  2DJ0 A;  4POB A;  1M2B A;  2A2P A;  4OCF A;  1F3A A;  1UN2 A;  1TRV A;  4JU5 A;  4IHU A;  5IO2 A;  5CRD A;  1SVM A;  2DJ3 A;  8GSS A;  4DSS B;  1DBY A;  2H1B A;  2GQK A;  5IPH A;  5IOW A;  4DVC A;  3IHQ A;  3CRT A;  1XZO A;  3BOA A;  1VRS D;  2B1L A;  3HVX A;  5A5K A;  2V1M A;  2B1K A;  6GSX A;  3ME8 A;  4EC0 A;  4J56 E;  4WXT A;  4MP4 A;  4D73 A;  4XS6 A;  1B48 A;  2DSA A;  3O76 A;  5G1L A;  2I9H A;  4GCI A;  5AN1 A;  5IIZ A;  1WJK A;  2NDO A;  2I81 A;  1ZCP A;  3TRP A;  4PQ1 A;  2GLR A;  1YKA A;  2IME A;  1XWG A;  2K8V A;  1BYE A;  1TOF A;  4DSS A;  7GSS A;  1QMV A;  3C1S A;  3O3T A;  4PNG A;  1BX9 A;  1BF5 A;  4K2X A;  5ECL B;  2H30 A;  2HSY A;  2LST A;  4IW9 A;  1EOH A;  3ERG A;  2R5G A;  3HZ8 A;  2VL2 A;  3IAS 2;  3APQ A;  3PGT A;  3E3E A;  1Z7P A;  1FOH A;  2ON5 A;  2YP6 A;  1AW9 A;  3F6D A;  3MNG A;  4N11 A;  5CP1 A;  4GSS A;  2EFC A;  1SU9 A;  1T1V A;  3TU3 B;  1A2M A;  4KCE A;  5CNW A;  5IQY A;  2C8U A;  1YEP A;  2QGV A;  1XW9 A;  2GT5 A;  2VOC A;  2EFE A;  3GNJ A;  3KJY A;  1TRU A;  2YZU A;  5DQY A;  1H75 A;  3US3 A;  3G7I A;  2A2R A;  3L0H A;  4OO4 A;  1LJR A;  3KM6 A;  1WRY A;  2LJA A;  3IRA A;  1UVZ A;  4HJ2 A;  1Z6N A;  4GRF A;  3I43 A;  3HJO A;  5DJM A;  2R6K A;  4ECB A;  4OCE A;  4NAX A;  4OMV A;  2OJL A;  2NTO A;  2QC7 A;  3W8S A;  3TDG A;  2WGR A;  4ZXG A;  1TI1 A;  5DAL B;  1G7O A;  3D4M A;  4FYB A;  4I5Q A;  4POM A;  1U6T A;  2MBT A;  1R7H A;  2WS2 A;  1OC3 A;  4YQM A;  3ZIT A;  2LNS A;  1GSF A;  3UIW A;  12GS A;  2EC4 A;  2QA2 A;  1YY7 A;  2J9H A;  3A2X A;  4KAE A;  3KGK A;  4Q5F A;  2LS5 A;  2VLU A;  3ZL5 A;  2YCD A;  5A4V A;  10GS A;  3CRU A;  1JZR A;  1T00 A;  4K6X A;  3Q18 A;  1TI3 A;  2J23 A;  3N9J A;  1VF2 A;  5DAL A;  4BWS A;  2R2J A;  1WMJ A;  3BJ5 A;  1M0U A;  3VI7 A;  5LNK e;  1I1I P;  3GYK A;  1PKZ A;  2C1Y A;  5EY6 A;  2NBS A;  1AXD A;  4CW9 A;  5AGY A;  5IMZ A;  3R3E A;  5IMV A;  1EV4 A;  1TW9 A;  1ST9 A;  5HR1 A;  2H70 A;  5J40 A;  1GTI A;  2HE3 A;  2V6O A;  4MJC A;  3CWG A;  2YV9 A;  5A34 B;  3VI5 A;  4EDY A;  3C7M A;  1ERV A;  2BMX A;  3M0F A;  2H1D A;  1JLW A;  2OE1 A;  4MH2 A;  4FQU A;  5AIS A;  4X1U A;  3F8U A;  5LD0 A;  6GSY A;  4N0Z A;  2G0F A;  4TXO B;  3OR5 A;  2IN3 A;  4WR4 A;  2L4Q A;  4HJM A;  1M3I A;  19GS A;  1SKW B;  3HVV A;  2PVO C;  6GSW A;  4XS1 A;  3UBK A;  3FZA A;  3P2A A;  3TJF A;  1PL1 A;  4MF6 A;  2X99 A;  3QFA C;  2WW1 A;  1U3A A;  1LBK A;  1K0N A;  5A34 A;  3IK7 A;  2ZCT A;  5HFK A;  1TXX A;  2CZ2 A;  4KSM A;  4NHZ A;  2CVB A;  2H6Y A;  3IXR A;  1Z9H A;  6GSS A;  4JR4 A;  4YAV A;  4V1A g;  4CDO A;  4TXO A;  1CQG A;  1RW1 A;  3DRN A;  5E59 A;  1QXH A;  4MPG A;  3GV1 A;  2MBS A;  4AKG A;  1JZW A;  2NPB A;  4LMV A;  5IMD A;  4LL1 B;  1IYH A;  5FWG A;  3G9B A;  1OE8 A;  2B7J A;  2FA8 A;  1F37 A;  1TK5 B;  2B5X A;  5IMA A;  1XIY A;  3TKQ A;  2BTO T;  3GH9 A;  3D6I A;  3LSZ A;  3VK9 A;  3EMX A;  1F6M C;  3GMF A;  2OT3 A;  16GS A;  4KDY A;  1N25 A;  3ZRD A;  1X9M B;  1SEN A;  1ZYN A;  2VCV A;  1XG8 A;  4WF5 A;  3RFR C;  3RGB C;  3ZVJ A;  5F8B A;  3F9U A;  1PX7 A;  2OBK A;  1VF1 A;  4ULX A;  3QMX A;  3FK8 A;  3VPT A;  4RI7 A;  1BG1 A;  2IMK A;  3J7Y b;  2B7K A;  2PPT A;  3APS A;  2RLI A;  4I97 A;  3SWL A;  2PER A;  2RUF A;  2GDR A;  5F0G A;  5A4U A;  1THX A;  2P5R A;  3CYN A;  2Z9S A;  1U87 A;  1S3C A;  3BBY A;  2F9S A;  2UZ8 A;  3EPT A;  3EVI A;  3K8N A;  5C00 A;  3RHC A;  4P3Y B;  3IC8 A;  4DSQ A;  4HU7 A;  5GST A;  4JR6 A;  4N10 A;  1WE0 A;  5J4U A;  5IO0 A;  3TJK A;  5ENU A;  2OE3 A;  1K0M A;  5D9V A;  3CQF A;  1AUC A;  2GST A;  3IC4 A;  2HYX A;  2AHE A;  2GSQ A;  2MMA A;  4LA1 A;  4CY8 A;  4IEL A;  2FWG A;  1SL1 B;  2V32 A;  1PN0 A;  3EIN A;  1XVQ A;  2K18 A;  2GSR A;  2PWJ A;  4K0G A;  1WWJ A;  4XHM A;  1Z3E A;  1TK8 B;  4ZB9 A;  4TVE A;  2WRT A;  3QDN A;  4EIP A;  2YWN A;  1AC1 A;  2WJU A;  5H5R A;  5J4Y A;  1AIU A;  4G0I A;  2WZS A;  4N0V A;  4K1F A;  4DEJ A;  3EC3 A;  3LXZ A;  4G2E A;  4L8E A;  1R26 A;  1N2A A;  2IIY A;  1EV9 A;  2HRA A;  3R2Q A;  5ECS A;  2FWH A;  2JSZ A;  4KUN A;  3HKR A;  4ID0 A;  2XC2 A;  2PN8 A;  2P5Q A;  2L4C A;  3CXG A;  3E0U A;  1GSQ A;  4N3Z A;  1SJI A;  2L6C A;  1MDK A;  4AI6 A;  3GFK A;  2V6K A;  4KDX A;  2F8F A;  2DJ1 A;  5B8A A;  4ZB8 A;  1YKC A;  4PX1 A;  5J41 A;  4JE1 A;  2HT9 A;  4X4J A;  1YF0 A;  1EGR A;  3FY7 A;  3E9J B;  1TU7 A;  2LRT A;  3DML A;  5G1K A;  4YAP A;  4F82 A;  2ALB A;  4AKX B;  1W89 A;  5KN1 A;  2A4V A;  4ZIJ A;  3DVX A;  3LYK A;  3C8E A;  1QGV A;  2VUP A;  1V9W A;  3GL5 A;  3L9S A;  4JZQ A;  3LOR A;  3VWU A;  1XW6 A;  4KX4 A;  3P8W A;  3WYW A;  4LLR A;  2X8G A;  4PTS A;  1ZGN A;  3IV4 A;  4JBB A;  2EIR A;  2VIM A;  2WB9 A;  4EUY A;  2YOI A;  3HYP A;  2GT6 A;  4YKG A;  1Q98 A;  5ELA A;  4J57 E;  5AIX A;  5J4V A;  4ML1 A;  3A2W A;  5HFG A;  2C0E A;  4IJ3 A;  1O8X A;  2QA1 A;  3HDC A;  3U5R E;  1FVJ A;  2O7K A;  2YWI A;  2HZE B;  3A2V A;  1XOA A;  2PVQ A;  1GSS A;  4YQU A;  2DMM A;  2OBI A;  4AKH A;  2JAC A;  4ZB6 A;  4GQF A;  3VWX A;  3MAK A;  4NWY A;  4ZBD A;  1RQM A;  1FOV A;  3LYP A;  3TGZ A;  4V1A p;  4OFT A;  1V57 A;  2FWF A;  2C3N A;  4HI7 A;  5DAK B;  4K2D A;  2P31 A;  4MF7 A;  1BED A;  3D4T A;  5IPG A;  4X0X A;  4KA0 A;  20GS A;  2HZE A;  4J2F A;  5G2Z A;  2H74 A;  1ON4 A;  4KW6 A;  3N5O A;  3IR4 A;  3HVS A;  3GL3 A;  4HQZ A;  3FRC A;  1XFL A;  4EKZ A;  4CY6 A;  2X49 A;  1SVO A;  5J5N A;  4K9Z A;  3EWL A;  2NVL A;  1OAZ A;  4G0L A;  1R5P A;  2WW2 A;  5CRG A;  5DAK A;  4OWY A;  5D9T A;  5J9C A;  1S3D A;  3DYR A;  3FR6 A;  3HHV A;  4N30 A;  1M9B A;  3KMN A;  2ZUP A;  3C73 A;  2WVY A;  1K3Y A;  1U3I A;  1B4Q A;  2VAF A;  2R3X A;  4G0K A;  4NMU A;  2H71 A;  2R4V A;  4AGS A;  1K0D A;  2A4H A;  1AAZ A;  3MDK A;  2H0G A;  1A23 A;  3GST A;  1Z6M A;  3HJM A;  2L59 A;  4TW5 A;  5ID2 B;  3Q19 A;  1MDI A;  3ZML A;  2E2M A;  1HNC A;  1PFO A;  1SKS B;  3PIN A;  3GKN A;  1QQ2 A;  4TKY A;  1F3B A;  1SD8 A;  3KD0 A;  4FIW A;  1YZX A;  3HJP A;  4EVM A;  2D2Z A;  1RK4 A;  2LKU A;  3A5W A;  3H8Q A;  4CHS A;  2L5O A;  2VLV A;  1TRW A;  2H66 A;  3C1R A;  3F4R A;  4FO5 A;  3IK9 A;  2VM1 A;  2X4A A;  3EU3 A;  4HEA 2;  4YKF A;  3FYG A;  2O36 A;  5IOX A;  1TDI A;  5F05 A;  4O32 A;  4IJI A;  5ECH B;  3LGC A;  2L6D A;  5ID2 A;  4QL9 A;  2FNO A;  1O85 A;  3TJG A;  1DE2 A;  1DSB A;  3ERW A;  13GS A;  2JZS A;  1NM3 A;  2C4J A;  2VCZ A;  5GZZ B;  1G6W A;  2XPD A;  3V1W A;  1UC7 A;  3VWW A;  6GSU A;  4AF2 A;  1GUL A;  5EVO A;  4K7I A;  2DKH A;  1S3R A;  2GZY A;  2HXK A;  2EIO A;  4PUR A;  4MMM A;  3GX0 A;  5A5H B;  3FMW A;  1ERW A;  3D22 A;  1LU4 A;  5JCG A;  1MD4 A;  3GN3 A;  1Y6E A;  1O7U A;  1MTC A;  2C3Q A;  2YJH A;  5B7C A;  1T8E B;  2E2G A;  5CO3 A;  1A2J A;  3TUE A;  2LTK A;  3PR8 A;  1M2D A;  3ZFB A;  3G7Y A;  3W6G A;  2WVZ A;  2FWE A;  2QSI A;  4EDZ A;  4MJB A;  4GWR A;  1T3B A;  2RM5 A;  1FVK A;  2FLS A;  2LRN A;  2GS3 A;  4IVF A;  1ZYP A;  2N5F A;  3ZVJ D;  1XWK A;  2HFD A;  2O5V A;  4MJA A;  5ECQ B;  4BA7 A;  3TCO A;  1X5E A;  2B3S A;  5A5H A;  1EWX A;  1JZO A;  1GTA A;  4YQV A;  1I9D A;  1Q4J A;  3FR9 A;  2FD3 A;  2VCQ A;  4F0C A;  3GH6 A;  5C04 A;  1JHB A;  1FB0 A;  3QAG A;  5KOW A;  3GKK A;  4H86 A;  5CRE A;  1THO A;  3ME7 A;  4ICY A;  4MF5 A;  4GLT A;  1MDJ A;  2LRC A;  2TIR A;  5GAP D;  3KEB A;  4L5L A;  2HRN A;  4LMW A;  4HU9 A;  1A0R P;  3TKR A;  1VF3 A;  3GHA A;  4WR5 A;  11GS A;  2WFC A;  2DLX A;  3CSI A;  4K8M A;  4MA9 A;  5B6N A;  2VO4 A;  2G2Q A;  3ISO A;  1NSW A;  1TXU A;  3RPP A;  4G01 A;  4EL1 A;  2H01 A;  1TKD B;  1PA3 A;  1AQW A;  2HNL A;  3FKF A;  3J7Y k;  3M9K A;  2GQL A;  4EO3 A;  1WOU A;  6GSV A;  2M46 A;  1WP0 A;  1K3L A;  2UV8 G;  4IS0 A;  1AQV A;  2K8S A;  2E7P A;  2O85 A;  3G7J A;  5ECN B;  3RDW A;  5ECR B;  2H8L A;  3IBH A;  5KN2 A;  5HR2 A;  2K9F A;  4WBR D;  3PH9 A;  3EUR A;  1PRX A;  1PSQ A;  5JCU A;  2LJR A;  3VFI A;  1NHO A;  3IOS A;  2IJY A;  3JCM L;  1ABA A;  2FUG 2;  3WT1 A;  4MDC A;  4PGT A;  2F8A A;  5D73 A;  2XBQ A;  3BD2 A; 
#chains in the Genus database with same CATH homology
 1FO5 A;  2VCX A;  1OKD A;  3HZ4 A;  4KH7 A;  2E0Q A;  1KBN A;  1GUK A;  2RII A;  1MD3 A;  2CX3 A;  3EE2 A;  3CTG A;  4EIQ A;  1IYI A;  1Y25 A;  3QCP A;  2CV4 A;  1XCC A;  4MZC A;  2LEG A;  4RQX A;  2AAW A;  1V2A A;  4G9H A;  5BMU B;  4IBP A;  4GF0 A;  3GRX A;  3IE3 A;  3AY8 A;  3GIX A;  4PUF C;  1V98 A;  5IMF A;  4F9Z A;  1TK0 B;  4E8E A;  1ACV A;  4O92 A;  3KZQ A;  2DJ2 A;  2VL3 A;  4QL7 A;  4F03 A;  5HQP A;  4K5S A;  2H19 A;  2R0C A;  2IMI A;  3UAR A;  2HRF A;  5BMU A;  5DCG A;  1JZD A;  5G30 A;  1SVL A;  3CBU A;  1SL2 B;  1USB A;  3DGQ A;  2B6M A;  2V41 A;  5FHI A;  3A5I A;  2AUV A;  3VLN A;  4Z2R A;  4AJ7 A;  5DDL A;  1I5G A;  4PQH A;  4QMK A;  2H1A A;  1XW5 A;  5LCZ A;  4XTS A;  1GNW A;  3QFB C;  2O8V B;  5COH A;  3KP8 A;  1ERT A;  3QAW A;  2KP2 A;  1B4P A;  3TKP A;  1M7T A;  2JSY A;  4OFM A;  1F9M A;  3FR3 A;  4IQA A;  2FY6 A;  2YPM A;  3NOF A;  3PPU A;  4F0B A;  2H73 A;  5IMC A;  1GSU A;  2DJJ A;  4TR3 A;  4XCS A;  2K6V A;  4BL7 B;  2R37 A;  3VPQ A;  1X5D A;  3QAV A;  3FZ5 A;  3QR6 A;  1SJZ A;  5KN3 A;  2FHE A;  1OC8 A;  3TOU A;  2F3M A;  4NHW A;  1GL8 A;  3LQ7 A;  1OVN A;  2HQT A;  4XRD A;  2CT6 A;  4V2L A;  4KF9 A;  4GDF A;  3QD9 A;  2LUS A;  2GZP A;  5D8I A;  1SJ6 A;  1N8J A;  1A2L A;  4PQI A;  3MIX A;  1SKR B;  1ZYQ B;  1K0A A;  3M8N A;  1R4W A;  3VUR A;  3F4T A;  4L5O A;  5ECO B;  5G31 A;  3FEU A;  3F63 A;  4BL7 A;  3ZZX A;  4HS1 A;  2YWM A;  4EF0 A;  4GTU A;  2M80 A;  1PL2 A;  2H72 A;  4TOP A;  14GS A;  4PNF A;  3EU4 A;  2WZ9 A;  5D93 A;  1EP7 A;  3EMP A;  3MYD A;  3MSZ A;  2AB6 A;  3TKS E;  3CTF A;  1YF1 A;  4JED A;  1X0R A;  4F2I A;  5D9X A;  3UVH A;  2O89 A;  3ZTL A;  2BJX A;  2ZNM A;  5JWO B;  4KDU A;  3FW2 A;  1BG5 A;  1A8Y A;  3UBL A;  1ERU A;  2LNT A;  2KHP A;  1M2A A;  9GSS A;  1GTU A;  1XVW A;  3DWV A;  3MWH A;  5CYY A;  2AJQ B;  2LQO A;  4O5R A;  4MNN A;  1J9B A;  1UA5 A;  3S9F A;  2OAC A;  1KNG A;  3WT2 A;  1G6Y A;  1O8W A;  2L57 A;  5IM9 A;  4ZIL A;  4MH3 A;  3HA9 A;  1GUH A;  3LXT A;  5HR0 A;  1SYR A;  1DE1 A;  1XBS A;  3D21 A;  3I9V 2;  4MJE A;  1WIK A;  3TRX A;  1ZYE A;  2AYT A;  5JWR B;  5B6M A;  3P7X A;  5ECK B;  3ZRE A;  4ECC A;  1QUW A;  5EL8 A;  2OA7 A;  2PU9 C;  3M1G A;  2KLX A;  2HSM B;  2FGX A;  1U88 A;  2EFH A;  1O81 A;  2L5L A;  1SYX A;  5HFI A;  1ML6 A;  5ECP B;  4G10 A;  4ZBA A;  3H79 A;  4Q5R A;  3UOM A;  4MZW A;  2IWT A;  4TXV A;  1B9X C;  4MZB A;  1ZZY A;  2GZZ A;  1YQ1 A;  2H0H A;  2N5A A;  2N5B A;  5CRW A;  1GRX A;  3M3M A;  4KB3 A;  4BVY B;  1K0B A;  1V58 A;  2YJ7 A;  2PMT A;  3HD5 A;  2DIZ A;  4PUA A;  2I3Y A;  2YAN A;  2DML A;  1YDK A;  2HSM A;  3QOU A;  3DD3 A;  3H1N A;  2DBC A;  1NHY A;  4X43 A;  4NPB A;  5GSS A;  3CSJ A;  5DCH A;  4IGJ A;  5H5Q A;  2GTU A;  5AIV A;  2XHF A;  2CQ9 A;  3IAM 2;  1PD2 1;  5INY A;  4ZL7 A;  1ZMA A;  3TOT A;  4L0W A;  2MZC A;  4IP6 A;  3GUR A;  1FG4 A;  1GSY A;  3F0I A;  4FYC A;  4BVY A;  3KCM A;  2C80 A;  1T4Z A;  3L78 A;  3QPM A;  3Q74 A;  3ZYW A;  5DBQ A;  4Z7X A;  2YZH A;  4V2M A;  2RM6 A;  3LWA A;  4IQ1 A;  2HSH A;  4EXJ A;  2LJK A;  4I6X A;  4O5Q A;  3UJ1 A;  4AJ6 A;  4I8B A;  3FZ4 A;  3IA1 A;  4K7O A;  5J47 A;  1KTE A;  1M9A A;  1H4O A;  4IP1 A;  4XIH A;  2HSN B;  3DVW A;  1PGT A;  5H5S A;  2VCT A;  2KP1 A;  2OKA A;  3IHG A;  3L9U A;  1VF4 A;  5FT3 A;  1GUM A;  3KMO A;  3UEM A;  1JLV A;  5KEJ A;  3FHK A;  18GS A;  2PBJ A;  3KTB A;  4ECJ A;  2JL4 A;  1MEK A;  4AJ8 A;  5GAN D;  1Y1U A;  2XBI A;  3TRQ A;  3L4N A;  2JZR A;  2WDU A;  1OC9 B;  3GKX A;  2VM2 A;  2MMZ A;  5KN0 A;  1K0C A;  5B8B A;  4Z2U A;  2VCW A;  3F6F A;  5G5F A;  1XWA A;  3I6A A;  2CA8 A;  2HSN A;  4K5R A;  4PXO A;  2KOK A;  4TR0 A;  1JFU A;  4KE3 A;  2TRC P;  2CVK A;  4BVX B;  4E68 A;  4MCU A;  1SK1 A;  3TB2 A;  3F4S A;  1XOB A;  4DSR A;  1K0O A;  4XS4 B;  2PUK C;  2F51 A;  1EEJ A;  1NW2 A;  3TJJ A;  5JWQ B;  1GP1 A;  2JU5 A;  2ON7 A;  3KH7 A;  2MMN A;  4ILF A;  2R0G A;  4FYU A;  2IPA A;  1OC9 A;  1R5A A;  4GXZ A;  4G19 A;  1EZK A;  4HUA A;  4USS A;  1F2E A;  3HCZ A;  1EGO A;  4I2T A;  3ZIV A;  3H93 A;  2WCI A;  4KGI A;  1KEB A;  4BVX A;  2YV7 A;  3DEX A;  2LV3 A;  3D5J A;  4MPF A;  4RUV A;  2ES7 A;  1PKW A;  4RQR A;  4XS4 A;  1SK2 A;  4LL4 B;  4NV5 A;  2V2G A;  3EYT A;  5CRH A;  3RHB A;  1J0F A;  2H6Z A;  4KSO A;  4TR1 B;  1WPI A;  3Q6O A;  3U6V A;  4E8H A;  3LFL A;  4YH2 A;  1ILO A;  2I4A A;  2FA4 A;  1FB6 A;  3ZIJ A;  2VD0 A;  2KUC A;  3LEF A;  2HI7 A;  3RPN A;  1VGL A;  2YNX A;  2AV4 A;  4O5U A;  3WGE A;  1A8L A;  3IPZ A;  3CSH A;  3WGX A;  5ECM B;  4NV2 A;  5CAX A;  3TKS C;  2C0G A;  4WBJ A;  3DXB A;  5HR3 A;  1SD9 A;  2OE0 A;  5KOX A;  1E6B A;  2RUE A;  3F3R A;  4TR1 A;  4Z2T A;  2IFQ B;  2FCH A;  1PX6 A;  3WGD A;  4GST A;  2WUL A;  3UAP A;  1A0F A;  4BWQ A;  2R0P A;  1X9S B;  3L9V A;  1V40 A;  2GGT A;  2B5E A;  4TRX A;  1HNA A;  3ZMK A;  1EP8 A;  1GSE A;  5D96 A;  2C0F A;  22GS A;  1URM A;  4WEY A;  3D0Z A;  2H1L A;  3GUS A;  3GSS A;  2MMO A;  4IKH A;  3APO A;  3GX8 A;  1TP9 A;  5J9B A;  4K7N A;  2DC5 A;  1Z5Y E;  3O6T A;  1GLP A;  4NXI A;  1B8X A;  5D9W A;  4ZL8 A;  4POL A;  2IFQ A;  1O73 A;  1XXU A;  3HXS A;  2P0G A;  3M9J A;  3IDV A;  1B9Y C;  4GQC A;  1ZL9 A;  1K3O A;  1TU8 A;  2IMD A;  4QQ7 A;  1HYU A;  3ERF A;  1G7E A;  1Z7R A;  3GKM A;  2VL2 C;  2GVP A;  2H1G A;  1T4Y A;  4ML6 A;  1GSD A;  4RI6 A;  4WET A;  3C71 A;  3RAZ A;  2X8H A;  2O87 A;  3TJB A;  3F3Q A;  4ZB7 A;  3FZ9 A;  4XRA A;  5JCW A;  2CVD A;  2PGT A;  1FAA A;  4I2U A;  2GSS A;  1W4V A;  3HY2 A;  5J3R A;  2DJK A;  1GLQ A;  3UMA A;  5E4W A;  1GNE A;  3HMJ G;  4OD7 A;  2X8C A;  5BRT A;  2HLS A;  3SBC A;  4Q5Q A;  5DJL A;  1C72 A;  4ECI A;  3WD6 A;  1QFN A;  2DIY A;  2I1U A;  3BCI A;  1OYJ A;  4HZ2 A;  4HQS A;  4MAB A;  4TN8 A;  1HD2 A;  1BAY A;  1BQ7 A;  1HQO A;  2EFD A;  4A5P A;  4HDE A;  3GA4 A;  2H75 A;  5DQS A;  3VWV A;  2HRK B;  5F07 A;  4ZL9 A;  1GWC A;  5G5E A;  2IL3 A;  5ABR A;  2HZF A;  2CAQ A;  2M72 A;  4FH8 A;  1XPV A;  2B5Y A;  5A1N B;  2LQQ A;  2QKE A;  5L71 A;  2OAD A;  2CAI A;  1CQH A;  4IN0 A;  3H4K A;  2TRX A;  1T7P B;  1PMT A;  6GST A;  1S3A A;  3DKS A;  1XWC A;  3GTU B;  4MK3 A;  1AQX A;  3A3T A;  3LG6 A;  2REM A;  1GTB A;  2VD1 A;  2YWO A;  3KP9 A;  2JZT A;  4EE0 A;  2EIQ A;  2HRK A;  3KIJ A;  4GSN A;  1XWB A;  1TJD A;  3KTL A;  2CZ3 A;  2JAD A;  4WF4 A;  4JRR A;  5A1N A;  2H0I A;  1X5C A;  3UVT A;  1EOG A;  3I69 A;  1FHE A;  1G0T A;  3LW9 A;  4HOJ A;  4W66 A;  1SK0 A;  17GS A;  1PQN A;  1PN9 A;  3GTU A;  2A2S A;  1YEX A;  1OE7 A;  1BJX A;  4Q5N A;  4BPY A;  2VL9 A;  4KND A;  1X9W B;  3KH9 A;  3ZFL A;  4V2N A;  3W8J A;  1DUG A;  2H76 A;  1M99 A;  2X64 A;  2C3T A;  2GQM A;  5F06 A;  4MLY A;  3BCK A;  4TR4 A;  3NIV A;  1OKT A;  1FW1 A;  4HZ4 A;  2IMF A;  5ECI B;  1SL0 B;  3RBT A;  1J08 A;  4O7H A;  3UL3 A;  1TTZ A;  2MYG A;  3NZN A;  3LJR A;  5DVB A;  2VLT A;  2C0D A;  4WKW A;  2H6X A;  1A24 A;  4KCA A;  3P90 A;  4ACS A;  4L0U A;  1YJ6 A;  3DIE A;  1EEM A;  2CX4 A;  3ZLP A;  3KXO A;  4OFN A;  2YN1 A;  1YVL A;  1QK8 A;  4ZBB A;  1O6J A;  5ELG A;  1GH2 A;  5EPF A;  3ED3 A;  4AKI A;  4ISD A;  4OO5 A;  1HNB A;  1E2Y A;  1ZOF A;  4POK A;  2XPE A;  2DKI A;  3TKS A;  2VKZ G;  5A4W A;  4D73 B;  4K0N A;  1TRS A;  3CMI A;  2DJ0 A;  4POB A;  1M2B A;  2A2P A;  4OCF A;  1F3A A;  1UN2 A;  1TRV A;  4JU5 A;  4IHU A;  5IO2 A;  5CRD A;  1SVM A;  2DJ3 A;  8GSS A;  4DSS B;  1DBY A;  2H1B A;  2GQK A;  5IPH A;  5IOW A;  4DVC A;  3IHQ A;  3CRT A;  1XZO A;  3BOA A;  1VRS D;  2B1L A;  3HVX A;  5A5K A;  2V1M A;  2B1K A;  6GSX A;  3ME8 A;  4EC0 A;  4J56 E;  4WXT A;  4MP4 A;  4D73 A;  4XS6 A;  1B48 A;  2DSA A;  3O76 A;  5G1L A;  2I9H A;  4GCI A;  5AN1 A;  5IIZ A;  1WJK A;  2NDO A;  2I81 A;  1ZCP A;  3TRP A;  4PQ1 A;  2GLR A;  1YKA A;  2IME A;  1XWG A;  2K8V A;  1BYE A;  1TOF A;  4DSS A;  7GSS A;  1QMV A;  3C1S A;  3O3T A;  4PNG A;  1BX9 A;  1BF5 A;  4K2X A;  5ECL B;  2H30 A;  2HSY A;  2LST A;  4IW9 A;  1EOH A;  3ERG A;  2R5G A;  3HZ8 A;  2VL2 A;  3IAS 2;  3APQ A;  3PGT A;  3E3E A;  1Z7P A;  1FOH A;  2ON5 A;  2YP6 A;  1AW9 A;  3F6D A;  3MNG A;  4N11 A;  5CP1 A;  4GSS A;  2EFC A;  1SU9 A;  1T1V A;  3TU3 B;  1A2M A;  4KCE A;  5CNW A;  5IQY A;  2C8U A;  1YEP A;  2QGV A;  1XW9 A;  2GT5 A;  2VOC A;  2EFE A;  3GNJ A;  3KJY A;  1TRU A;  2YZU A;  5DQY A;  1H75 A;  3US3 A;  3G7I A;  2A2R A;  3L0H A;  4OO4 A;  1LJR A;  3KM6 A;  1WRY A;  2LJA A;  3IRA A;  1UVZ A;  4HJ2 A;  1Z6N A;  4GRF A;  3I43 A;  3HJO A;  5DJM A;  2R6K A;  4ECB A;  4OCE A;  4NAX A;  4OMV A;  2OJL A;  2NTO A;  2QC7 A;  3W8S A;  3TDG A;  2WGR A;  4ZXG A;  1TI1 A;  5DAL B;  1G7O A;  3D4M A;  4FYB A;  4I5Q A;  4POM A;  1U6T A;  2MBT A;  1R7H A;  2WS2 A;  1OC3 A;  4YQM A;  3ZIT A;  2LNS A;  1GSF A;  3UIW A;  12GS A;  2EC4 A;  2QA2 A;  1YY7 A;  2J9H A;  3A2X A;  4KAE A;  3KGK A;  4Q5F A;  2LS5 A;  2VLU A;  3ZL5 A;  2YCD A;  5A4V A;  10GS A;  3CRU A;  1JZR A;  1T00 A;  4K6X A;  3Q18 A;  1TI3 A;  2J23 A;  3N9J A;  1VF2 A;  5DAL A;  4BWS A;  2R2J A;  1WMJ A;  3BJ5 A;  1M0U A;  3VI7 A;  5LNK e;  3GYK A;  1PKZ A;  2C1Y A;  5EY6 A;  2NBS A;  1AXD A;  4CW9 A;  5AGY A;  5IMZ A;  3R3E A;  5IMV A;  1EV4 A;  1TW9 A;  1ST9 A;  5HR1 A;  2H70 A;  5J40 A;  1GTI A;  2HE3 A;  2V6O A;  4MJC A;  3CWG A;  2YV9 A;  5A34 B;  3VI5 A;  4EDY A;  3C7M A;  1ERV A;  2BMX A;  3M0F A;  2H1D A;  1JLW A;  2OE1 A;  4MH2 A;  4FQU A;  5AIS A;  4X1U A;  3F8U A;  5LD0 A;  6GSY A;  4N0Z A;  2G0F A;  4TXO B;  3OR5 A;  2IN3 A;  4WR4 A;  2L4Q A;  4HJM A;  19GS A;  1SKW B;  3HVV A;  2PVO C;  6GSW A;  4XS1 A;  3UBK A;  3FZA A;  3P2A A;  3TJF A;  1PL1 A;  4MF6 A;  2X99 A;  3QFA C;  1U3A A;  1LBK A;  1K0N A;  5A34 A;  3IK7 A;  2ZCT A;  5HFK A;  1TXX A;  2CZ2 A;  4KSM A;  4NHZ A;  2CVB A;  2H6Y A;  3IXR A;  1Z9H A;  6GSS A;  4JR4 A;  4YAV A;  4V1A g;  4CDO A;  4TXO A;  1CQG A;  1RW1 A;  3DRN A;  5E59 A;  1QXH A;  4MPG A;  3GV1 A;  2MBS A;  4AKG A;  1JZW A;  2NPB A;  4LMV A;  5IMD A;  4LL1 B;  1IYH A;  5FWG A;  3G9B A;  1OE8 A;  2B7J A;  2FA8 A;  1F37 A;  1TK5 B;  2B5X A;  5IMA A;  1XIY A;  3TKQ A;  2BTO T;  3GH9 A;  3D6I A;  3LSZ A;  3VK9 A;  3EMX A;  1F6M C;  3GMF A;  2OT3 A;  16GS A;  4KDY A;  1N25 A;  3ZRD A;  1X9M B;  1SEN A;  1ZYN A;  2VCV A;  4WF5 A;  3ZVJ A;  5F8B A;  3F9U A;  1PX7 A;  2OBK A;  1VF1 A;  4ULX A;  3QMX A;  3FK8 A;  3VPT A;  4RI7 A;  1BG1 A;  2IMK A;  3J7Y b;  2B7K A;  2PPT A;  3APS A;  2RLI A;  4I97 A;  3SWL A;  2PER A;  2RUF A;  2GDR A;  5F0G A;  5A4U A;  1THX A;  2P5R A;  3CYN A;  2Z9S A;  1U87 A;  1S3C A;  3BBY A;  2F9S A;  2UZ8 A;  3EPT A;  3EVI A;  3K8N A;  5C00 A;  3RHC A;  4P3Y B;  3IC8 A;  4DSQ A;  4HU7 A;  5GST A;  4JR6 A;  4N10 A;  1WE0 A;  5J4U A;  5IO0 A;  3TJK A;  5ENU A;  2OE3 A;  1K0M A;  5D9V A;  1AUC A;  2GST A;  3IC4 A;  2HYX A;  2AHE A;  2GSQ A;  2MMA A;  4LA1 A;  4CY8 A;  4IEL A;  2FWG A;  1SL1 B;  2V32 A;  1PN0 A;  3EIN A;  1XVQ A;  2K18 A;  2GSR A;  2PWJ A;  4K0G A;  1WWJ A;  4XHM A;  1Z3E A;  1TK8 B;  4ZB9 A;  4TVE A;  2WRT A;  3QDN A;  4EIP A;  2YWN A;  1AC1 A;  2WJU A;  5H5R A;  5J4Y A;  1AIU A;  4G0I A;  4N0V A;  4K1F A;  4DEJ A;  3EC3 A;  3LXZ A;  4G2E A;  4L8E A;  1R26 A;  1N2A A;  2IIY A;  1EV9 A;  2HRA A;  3R2Q A;  5ECS A;  2FWH A;  2JSZ A;  4KUN A;  3HKR A;  4ID0 A;  2XC2 A;  2PN8 A;  2P5Q A;  2L4C A;  3CXG A;  3E0U A;  1GSQ A;  4N3Z A;  1SJI A;  2L6C A;  1MDK A;  4AI6 A;  3GFK A;  2V6K A;  4KDX A;  2F8F A;  2DJ1 A;  5B8A A;  4ZB8 A;  1YKC A;  4PX1 A;  5J41 A;  4JE1 A;  2HT9 A;  4X4J A;  1YF0 A;  1EGR A;  3FY7 A;  3E9J B;  1TU7 A;  2LRT A;  3DML A;  5G1K A;  4YAP A;  4F82 A;  2ALB A;  4AKX B;  1W89 A;  5KN1 A;  2A4V A;  4ZIJ A;  3DVX A;  3LYK A;  3C8E A;  1QGV A;  2VUP A;  1V9W A;  3GL5 A;  3L9S A;  4JZQ A;  3LOR A;  3VWU A;  1XW6 A;  4KX4 A;  3P8W A;  3WYW A;  4LLR A;  2X8G A;  4PTS A;  1ZGN A;  3IV4 A;  4JBB A;  2EIR A;  2VIM A;  2WB9 A;  4EUY A;  2YOI A;  3HYP A;  2GT6 A;  4YKG A;  1Q98 A;  5ELA A;  4J57 E;  5AIX A;  5J4V A;  4ML1 A;  3A2W A;  5HFG A;  2C0E A;  4IJ3 A;  1O8X A;  2QA1 A;  3HDC A;  3U5R E;  1FVJ A;  2O7K A;  2YWI A;  2HZE B;  3A2V A;  1XOA A;  2PVQ A;  1GSS A;  4YQU A;  2DMM A;  2OBI A;  4AKH A;  2JAC A;  4ZB6 A;  4GQF A;  3VWX A;  3MAK A;  4NWY A;  4ZBD A;  1RQM A;  1FOV A;  3LYP A;  3TGZ A;  4V1A p;  4OFT A;  1V57 A;  2FWF A;  2C3N A;  4HI7 A;  5DAK B;  4K2D A;  2P31 A;  4MF7 A;  1BED A;  3D4T A;  5IPG A;  4X0X A;  4KA0 A;  20GS A;  2HZE A;  4J2F A;  5G2Z A;  2H74 A;  1ON4 A;  4KW6 A;  3N5O A;  3IR4 A;  3HVS A;  3GL3 A;  4HQZ A;  3FRC A;  1XFL A;  4EKZ A;  4CY6 A;  2X49 A;  1SVO A;  5J5N A;  4K9Z A;  3EWL A;  2NVL A;  1OAZ A;  4G0L A;  1R5P A;  5CRG A;  5DAK A;  4OWY A;  5D9T A;  5J9C A;  1S3D A;  3DYR A;  3FR6 A;  3HHV A;  4N30 A;  1M9B A;  3KMN A;  2ZUP A;  3C73 A;  1K3Y A;  1U3I A;  1B4Q A;  2VAF A;  2R3X A;  4G0K A;  4NMU A;  2H71 A;  2R4V A;  4AGS A;  1K0D A;  2A4H A;  1AAZ A;  3MDK A;  2H0G A;  1A23 A;  3GST A;  1Z6M A;  3HJM A;  2L59 A;  4TW5 A;  5ID2 B;  3Q19 A;  1MDI A;  3ZML A;  2E2M A;  1HNC A;  1SKS B;  3PIN A;  3GKN A;  1QQ2 A;  4TKY A;  1F3B A;  1SD8 A;  3KD0 A;  4FIW A;  1YZX A;  3HJP A;  4EVM A;  2D2Z A;  1RK4 A;  2LKU A;  3A5W A;  3H8Q A;  4CHS A;  2L5O A;  2VLV A;  1TRW A;  2H66 A;  3C1R A;  3F4R A;  4FO5 A;  3IK9 A;  2VM1 A;  2X4A A;  3EU3 A;  4HEA 2;  4YKF A;  3FYG A;  5IOX A;  1TDI A;  5F05 A;  4O32 A;  4IJI A;  5ECH B;  3LGC A;  2L6D A;  5ID2 A;  4QL9 A;  2FNO A;  1O85 A;  3TJG A;  1DE2 A;  1DSB A;  3ERW A;  13GS A;  2JZS A;  1NM3 A;  2C4J A;  2VCZ A;  5GZZ B;  1G6W A;  2XPD A;  3V1W A;  1UC7 A;  3VWW A;  6GSU A;  4AF2 A;  1GUL A;  5EVO A;  4K7I A;  2DKH A;  2GZY A;  2HXK A;  2EIO A;  4PUR A;  4MMM A;  3GX0 A;  5A5H B;  3FMW A;  1ERW A;  3D22 A;  1LU4 A;  5JCG A;  1MD4 A;  3GN3 A;  1Y6E A;  1O7U A;  1MTC A;  2C3Q A;  2YJH A;  5B7C A;  1T8E B;  2E2G A;  5CO3 A;  1A2J A;  3TUE A;  2LTK A;  3PR8 A;  1M2D A;  3ZFB A;  3G7Y A;  3W6G A;  2FWE A;  2QSI A;  4EDZ A;  4MJB A;  4GWR A;  1T3B A;  2RM5 A;  1FVK A;  2FLS A;  2LRN A;  2GS3 A;  4IVF A;  1ZYP A;  2N5F A;  3ZVJ D;  1XWK A;  2HFD A;  2O5V A;  4MJA A;  5ECQ B;  4BA7 A;  3TCO A;  1X5E A;  2B3S A;  5A5H A;  1EWX A;  1JZO A;  1GTA A;  4YQV A;  1I9D A;  1Q4J A;  3FR9 A;  2FD3 A;  2VCQ A;  4F0C A;  3GH6 A;  5C04 A;  1JHB A;  1FB0 A;  3QAG A;  5KOW A;  3GKK A;  4H86 A;  5CRE A;  1THO A;  3ME7 A;  4ICY A;  4MF5 A;  4GLT A;  1MDJ A;  2LRC A;  2TIR A;  5GAP D;  3KEB A;  4L5L A;  2HRN A;  4LMW A;  4HU9 A;  1A0R P;  3TKR A;  1VF3 A;  3GHA A;  4WR5 A;  11GS A;  2WFC A;  2DLX A;  3CSI A;  4K8M A;  4MA9 A;  5B6N A;  2VO4 A;  2G2Q A;  3ISO A;  1NSW A;  1TXU A;  3RPP A;  4G01 A;  4EL1 A;  2H01 A;  1TKD B;  1PA3 A;  1AQW A;  2HNL A;  3FKF A;  3J7Y k;  3M9K A;  2GQL A;  4EO3 A;  1WOU A;  6GSV A;  2M46 A;  1WP0 A;  1K3L A;  2UV8 G;  4IS0 A;  1AQV A;  2K8S A;  2E7P A;  2O85 A;  3G7J A;  5ECN B;  3RDW A;  5ECR B;  2H8L A;  3IBH A;  5KN2 A;  5HR2 A;  2K9F A;  4WBR D;  3PH9 A;  3EUR A;  1PRX A;  1PSQ A;  5JCU A;  2LJR A;  3VFI A;  1NHO A;  3IOS A;  2IJY A;  3JCM L;  1ABA A;  2FUG 2;  3WT1 A;  4MDC A;  4PGT A;  2F8A A;  5D73 A;  2XBQ A;  3BD2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...