1ZL9A

Crystal structure of a major nematode c.elegans specific gst (ce01613)
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
207
structure length
207
Chain Sequence
MVSYKLTYFNGRGAGEVSRQIFAYAGQQYEDNRVTQEQWPALKETCAAPFGQLPFLEVDGKKLAQSHAIARFLAREFKLNGKTAWEEAQVNSLADQYKDYSSEARPYFYAVMGFGPGDVETLKKDIFLPAFEKFYGFLVNFLKASGSGFLVGDSLTWIDLAIAQHSADLIAKGGDFSKFPELKAHAEKIQAIPQIKKWIETRPVTPF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords glutathione S-transferase 5
publication title Crystal structure of a major nematode C.elegans specific GST (CE01613)
rcsb
source organism Caenorhabditis elegans
molecule tags Transferase
total genus 75
structure length 207
sequence length 207
chains with identical sequence B
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2005-05-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
A PF14497 GST_C_3 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 1zl9A02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1zl9A01
2YV7A 1EZKA 5HFGA 2LTKA 2YWNA 1Y6EA 5DDLA 2PPTA 1A0FA 2H19A 1V58A 1UC7A 2HRKB 3ZVJA 3APOA 3H1NA 4MF6A 1M2BA 1S3AA 2JU5A 2D2ZA 2B1LA 4DSSA 4G10A 3QAGA 5ENUA 1ABAA 2L6DA 6GSTA 3Q6OA 2HSHA 1Q98A 1JHBA 3HVVA 3C8EA 4ECCA 2VOCA 1GSSA 3G9BA 5CRGA 1XBSA 3EYTA 1K0CA 4XRDA 5IMZA 3DKSA 2YCDA 3UMAA 2DIZA 2R4VA 1T1VA 2RM6A 4I97A 1ON4A 2KHPA 2X99A 2IMFA 2FA4A 3QPMA 3QAWA 3TJGA 1TJDA 3QAVA 3GIXA 1Z6NA 2PVQA 4HQZA 2H6ZA 2C3TA 4GQFA 4HUAA 3P2AA 4E8EA 2H30A 1R4WA 4POBA 5D73A 1B9XC 3A3TA 4X0XA 4EXJA 3IRAA 4BL7A 4AJ8A 4IP1A 3RDWA 1TRSA 4TW5A 4MF7A 2WULA 2L4QA 5A4WA 2VCQA 3KEBA 2LSTA 5ECOB 3HDCA 4OWYA 3LG6A 1SK0A 3GSTA 4IJIA 2B3SA 1TDIA 2RM5A 5J3RA 3ZZXA 1QFNA 1YEXA 1ERUA 1LU4A 3QCPA 2LV3A 19GSA 1XVQA 4WBRD 3EU3A 4K9ZA 2K6VA 2LRCA 4LMWA 3M3MA 4KDYA 1JZWA 3FR6A 2M80A 4O7HA 4PQHA 3ZREA 4KX4A 2OACA 2RUFA 5CYYA 3MDKA 3FR3A 2V41A 5D96A 2VL3A 2WRTA 1U87A 4MJBA 1BQ7A 4RQRA 2GSRA 2YJHA 4MLYA 4EDYA 1OC8A 4D73B 2L4CA 4PUAA 3TRXA 2GSSA 1THOA 2VO4A 1RW1A 3DYRA 4FYUA 2ES7A 4HS1A 1QK8A 1YY7A 2QKEA 3GL3A 3FZ9A 3RPNA 1AAZA 2OADA 5D9TA 5J4UA 3H93A 1GP1A 2HZEB 1GULA 3DWVA 1X5DA 3F4RA 3TJKA 1WE0A 3LSZA 4ZBAA 5L71A 4MZCA 2X8CA 1GUHA 3F3RA 2GLRA 1RK4A 1PX7A 1TKDB 1F3AA 1PRXA 4DEJA 4KSOA 3VLNA 1R7HA 4ZIJA 1SYRA 3GH6A 3D22A 2H6YA 3GUSA 1O8WA 1J9BA 2YWOA 5IOXA 3GA4A 2JZSA 2B1KA 4F9ZA 3J7Yb 1TI3A 5EPFA 1UVZA 4H86A 2GQMA 1XW9A 1BG5A 5DAKA 4XCSA 5DJMA 4IHUA 1M7TA 2HSNB 2H8LA 4RUVA 4K7IA 2VD0A 2OE3A 4OFMA 3NZNA 2MMAA 4KW6A 2XPEA 1F37A 2G0FA 1B4QA 2VCVA 3DVXA 4EO3A 4MZWA 2REMA 1TU7A 3D6IA 2H1AA 1O8XA 3GYKA 4WXTA 1SL0B 2B5XA 2YJ7A 3KTLA 3H79A 2RLIA 2HSYA 3KCMA 4WETA 5AISA 2C1YA 2FWEA 5ECQB 4YAVA 1S3CA 1U3AA 3C73A 2OBKA 1TK5B 1GTBA 1AUCA 2LQOA 2WFCA 2C4JA 1ERWA 4GCIA 2CVKA 1CQGA 1YKAA 2LEGA 14GSA 5AIXA 1WPIA 2VD1A 2K18A 3QFAC 3S9FA 3CMIA 1FVJA 1X9SB 3GKNA 4JU5A 1U88A 4FO5A 1T8EB 3D5JA 1T7PB 2QSIA 1DE1A 5JWQB 1OC9B 5G1KA 3M9JA 2LJRA 2P5QA 4MZBA 5IMDA 1O7UA 4NMUA 3GNJA 4KGIA 4GSNA 4HZ2A 3FEUA 5G30A 2LNTA 4GSTA 2HXKA 2EC4A 4ECJA 1QUWA 4IQAA 3KH7A 1YF1A 1EV4A 2I9HA 1V2AA 3TKSE 3M1GA 1Z6MA 4N0VA 2GT6A 4MMMA 5ECNB 5GZZB 5DJLA 5ECPB 3VI7A 3PR8A 3GTUB 1F6MC 3BOAA 1A2LA 3L78A 5EL8A 2H66A 5HR3A 4FH8A 2KLXA 2BTOT 2PU9C 4OCEA 5JWOB 4ML6A 2JADA 2VM1A 4HEA2 3VWWA 1X5CA 3UJ1A 4LA1A 5DCHA 3QFBC 2JL4A 1A8LA 2V32A 2FWHA 4TR1A 2VIMA 3ZRDA 4NAXA 1XOBA 2AJQB 2H73A 1AXDA 2K9FA 2MBSA 2J9HA 3M8NA 5ELGA 3EE2A 3TDGA 2TRXA 4K1FA 3TRPA 3E3EA 2FGXA 2C3NA 4TXOA 3IA1A 4ECIA 1EOHA 4ZXGA 3A2VA 3GX0A 5ECKB 5C00A 4OMVA 1GSFA 5H5SA 2C0FA 2K8VA 4OFTA 8GSSA 1ILOA 5KN3A 5H5QA 4YH2A 4NHZA 1X0RA 4KCAA 5KN0A 3ISOA 1JZDA 3IV4A 1S3DA 1SD8A 5DVBA 2GSTA 1ERVA 3HVXA 3EURA 4HQSA 4QL9A 2P5RA 4EC0A 1PL1A 4JR6A 4V2NA 1ZOFA 5IQYA 3ZTLA 1G7EA 2IWTA 5CREA 5D9XA 1HNBA 1B4PA 1XWGA 1USBA 3ERGA 1YKCA 3TKRA 3WGDA 3GH9A 2O7KA 5IPGA 5A4UA 3VPQA 3ME7A 3W8JA 3KGKA 1DSBA 5HFKA 5GAPD 6GSSA 2DC5A 4AF2A 2VCWA 2L6CA 5D9VA 4WEYA 3C1SA 4Q5RA 2O85A 3HZ8A 4IQ1A 1IYIA 5ECMB 3HZ4A 1TI1A 1XWAA 1QGVA 2O89A 2HRKA 1FB6A 3ED3A 4BA7A 5IIZA 4MJCA 1FO5A 4O5RA 2LRTA 4QQ7A 1XVWA 2FA8A 4I2UA 3WYWA 3VURA 1K3OA 3CRTA 1K3YA 2DSAA 4N30A 4TOPA 4MABA 1DE2A 1V98A 3HXSA 1PKWA 2H72A 4NWYA 4EKZA 1Q4JA 1LBKA 1PQNA 5JCGA 4X43A 4TRXA 5ECHB 2YN1A 4KNDA 1C72A 2YPMA 2V1MA 1AQXA 5F06A 2HFDA 3IDVA 3WD6A 4MJEA 2WZ9A 1E6BA 4PTSA 4ZL9A 3C71A 4CHSA 1QQ2A 4KB3A 3UARA 1GTAA 1FG4A 3ME8A 3QOUA 2AAWA 2VCXA 3F6FA 2DIYA 3FRCA 1GUMA 1BEDA 4MA9A 4RQXA 4GXZA 3TKQA 2YNXA 4Q5QA 4GLTA 2C8UA 5A5KA 3DVWA 4FYBA 4PURA 4LLRA 2CZ2A 2OKAA 1W4VA 2GQKA 1ML6A 5B6NA 2IPAA 1K0BA 1A24A 1O85A 1PSQA 2C0DA 1X9MB 5CNWA 2JZRA 2PVOC 4MPGA 1Z9HA 3VI5A 3LGCA 22GSA 3R2QA 4OO4A 17GSA 2AUVA 4PNFA 1WIKA 4ULXA 4IKHA 4ZILA 2GZYA 5ID2B 3FR9A 2A4VA 2H0IA 3EWLA 5ECRB 4ILFA 1X5EA 4XS4B 3UAPA 5J5NA 5EVOA 3KH9A 4BPYA 6GSXA 4OO5A 2DJJA 1Z7RA 3ZL5A 1FB0A 1URMA 4I6XA 1XXUA 4PQIA 3FW2A 2GT5A 5ABRA 2WGRA 3ZFBA 2MMOA 3ZIVA 5IO2A 3GHAA 5G5FA 3APSA 5DQYA 3HJOA 3FZ4A 1M2DA 4D73A 5DQSA 4GSSA 4KAEA 3F0IA 1I9DA 5G5EA 2HT9A 4G19A 2OJLA 3I6AA 4EDZA 2LJAA 3WGEA 1B48A 1RQMA 4ZB6A 3A2XA 3UVTA 3CTFA 3GKMA 1KNGA 1NW2A 2C0GA 4TR0A 3IBHA 3LYKA 2HZEA 1SK1A 4F03A 1HD2A 3IXRA 1CQHA 1TOFA 2DJ1A 2HNLA 3DIEA 1QXHA 1GLPA 20GSA 2WS2A 1EEMA 4NXIA 3I9V2 1ERTA 1BAYA 1O73A 3CBUA 1ST9A 16GSA 4BVXB 2GS3A 5E4WA 3E0UA 4K8MA 1FVKA 2V6OA 3LORA 4POKA 4XS1A 1F3BA 3HJMA 3FZAA 1JLWA 5F0GA 5IMFA 3IOSA 3DMLA 5DALB 4TVEA 4NHWA 4FIWA 1SKRB 3AY8A 3O3TA 6GSVA 1GSUA 1AQVA 3HCZA 1SU9A 4BWQA 3ZMKA 2GZZA 7GSSA 4Z7XA 3MAKA 2N5AA 1R26A 2N5FA 2KOKA 4XHMA 1A2JA 1VF2A 4K2DA 2O87A 5H5RA 4TXVA 1R5AA 3TGZA 3I69A 3W8SA 1AQWA 5COHA 4KH7A 5LD0A 4F0BA 3P7XA 4J56E 1PD21 2H0GA 4KUNA 5CO3A 4BVYB 1PGTA 3Q19A 4EVMA 1K0OA 4KF9A 1KBNA 1PKZA 1M99A 4KDUA 2KP1A 2LRNA 1ZZYA 2BMXA 4GTUA 4TN8A 4ZBDA 1ZGNA 2DJ3A 3ZITA 2C80A 5INYA 2FD3A 2H75A 4LMVA 4NPBA 4MDCA 3RPPA 5JWRB 5IM9A 2AHEA 2PWJA 3EMPA 6GSWA 2HRFA 4KDXA 3MWHA 2CQ9A 1TK0B 1JFUA 3APQA 2KP2A 2OA7A 3F3QA 3N5OA 4FQUA 4MH3A 2NDOA 3LEFA 5HQPA 3VWVA 4ACSA 3G7IA 2ZCTA 3LFLA 1OC9A 2CAQA 4ISDA 2IFQB 4JR4A 2E0QA 4G2EA 3ZLPA 2A2RA 2XHFA 3CRUA 1OE8A 5IMVA 1UN2A 4K7NA 4K6XA 2I1UA 2IMEA 4EUYA 4IP6A 2LQQA 3F8UA 1M0UA 2GGTA 5IPHA 3FK8A 1KTEA 5D93A 1NSWA 2CT6A 1NM3A 4HU7A 2ON7A 1F2EA 3A2WA 2QC7A 1I5GA 3J7Yk 2E7PA 2HQTA 3GTUA 1TRVA 2VCTA 1ZYEA 1MDJA 3LXTA 2H76A 3O76A 2XBIA 3IK7A 3UVHA 4YAPA 2VL9A 4N0ZA 1U3IA 3QD9A 2AB6A 1IYHA 4LL1B 1MDKA 1GNEA 1EOGA 1B9YC 3IC4A 4OFNA 4PX1A 3OR5A 5DCGA 3D0ZA 2JZTA 2BJXA 3U6VA 4GWRA 1PX6A 4Q5FA 4USSA 3VWXA 4IW9A 5F8BA 1T00A 1G0TA 3I43A 3DD3A 2H70A 2VLVA 5EY6A 2L5OA 1SJIA 1TK8B 1FHEA 1FAAA 3VFIA 2V2GA 1Z5YE 2HSMB 2M72A 1O81A 4V1Ag 3TOUA 3L9VA 4MP4A 3CSJA 3GV1A 2B5YA 6GSUA 2G2QA 2E2MA 3KMOA 5ECIB 4ML1A 11GSA 3JCML 3BJ5A 3HY2A 13GSA 4RI6A 2R5GA 2EIOA 4O92A 3EINA 1QMVA 2X8HA 3ERFA 2VUPA 1V57A 1XCCA 2B7JA 2H0HA 3DRNA 2FNOA 2IN3A 3HKRA 2R3XA 1OAZA 2IMKA 3UL3A 1U6TA 1VF4A 3F4TA 4HU9A 5ECLB 4LL4B 3IC8A 3FY7A 2R37A 1FOVA 3L9UA 3HVSA 4G9HA 4ZB9A 1XWCA 4PQ1A 1YQ1A 3BCIA 3WT1A 2HI7A 2VL2C 4ID0A 3TUEA 1NHYA 2HZFA 5D9WA 1DUGA 3F6DA 1N2AA 4POMA 3TJJA 3C1RA 3CXGA 3IR4A 1SL2B 1PL2A 1OKDA 3BCKA 2PMTA 1OC3A 5AGYA 1G7OA 3VK9A 3U5RE 1JZRA 5J9CA 4WKWA 2R2JA 5LCZA 1YDKA 3DGQA 2HRAA 5B7CA 2GQLA 3ZYWA 1J08A 3GL5A 4JRRA 5FT3A 2NTOA 1HQOA 4PGTA 3NOFA 2J23A 2NVLA 1A23A 5GAND 2NPBA 5CAXA 2XPDA 1GSEA 1AC1A 3N9JA 5E59A 4EE0A 2DMLA 1XIYA 5KN2A 2VAFA 5AIVA 2GTUA 2GZPA 1M9BA 4V2MA 3FHKA 2B7KA 2H1GA 1KEBA 2NBSA 3F63A 1UA5A 1GWCA 5F05A 4HOJA 3QMXA 2YANA 3RHBA 2TIRA 1BYEA 4FYCA 2I3YA 2VCZA 2YWMA 2H1DA 2YOIA 2H6XA 4DSSB 3TB2A 1WMJA 2HLSA 1TRWA 5D8IA 1YZXA 5HR2A 3ZMLA 5IMCA 1GLQA 1ZCPA 2LJKA 2P0GA 2FCHA 2VL2A 3GMFA 4MPFA 1DBYA 4ECBA 1H4OA 2ZNMA 1XPVA 4G0KA 1PN9A 2E2GA 2YV9A 5ID2A 4L8EA 2N5BA 1SYXA 5B6MA 1M2AA 4XS4A 2AV4A 4E8HA 2JSZA 4ZBBA 2C0EA 4N10A 3W6GA 3CYNA 1TW9A 3UEMA 3EU4A 3LYPA 5JCWA 4RI7A 4KA0A 3NIVA 3G7YA 2DMMA 2F51A 2FHEA 5AN1A 1WJKA 4YQUA 4JEDA 1EP7A 10GSA 4BL7B 1JZOA 3QR6A 5B8BA 5DBQA 1AW9A 1F9MA 4G0IA 3TOTA 3GKKA 3UBLA 4IGJA 3E9JB 3GX8A 1XZOA 2GSQA 2MYGA 4WF5A 4OD7A 2CX3A 1TRUA 1SKWB 5J41A 1HYUA 1Z3EA 4EF0A 5KEJA 3CTGA 9GSSA 1GTIA 3KM6A 2EIQA 2VLTA 4KE3A 3KD0A 3KZQA 3TCOA 3MSZA 3BBYA 4GF0A 4HJ2A 4V1Ap 4O32A 1XW6A 1WP0A 2WDUA 4MH2A 3EMXA 1BJXA 3IPZA 1T3BA 2L57A 1SKSB 2JACA 5FHIA 3H4KA 3D21A 5GSSA 3QDNA 12GSA 3KP8A 3D4MA 1T4ZA 1YJ6A 2DLXA 1YEPA 3L0HA 4BVXA 4HI7A 2CX4A 2GDRA 3KP9A 1K0NA 3WT2A 4L0WA 3ERWA 2MMNA 2H71A 3FZ5A 3HYPA 3TRQA 2LUSA 2R6KA 5IMAA 1SENA 3IE3A 3FYGA 5DALA 4J57E 1FW1A 3GKXA 1XWBA 4TR3A 3TJBA 4I5QA 3VPTA 2X8GA 4ZL7A 1WOUA 2FY6A 1GRXA 2DJ2A 4I8BA 1TU8A 4AJ6A 2Z9SA 1AIUA 4ZB8A 2DJKA 1K3LA 3IAM2 1EEJA 1MDIA 3C7MA 1A8YA 1YF0A 4PNGA 1K0AA 2XBQA 1EP8A 3HJPA 2B6MA 2PGTA 2ZUPA 5ECSA 2UZ8A 3G7JA 1R5PA 2X64A 1JLVA 1WRYA 1N8JA 3A5WA 5HR1A 2ALBA 1B8XA 1TP9A 2EIRA 3Q74A 5CRWA 4BVYA 1GH2A 4GQCA 2AYTA 2TRCP 3DEXA 2M46A 3TKSC 3KTBA 2HE3A 5CRHA 1A2MA 2B5EA 1G6WA 3GSSA 4I2TA 2PN8A 4CDOA 4XIHA 2QGVA 2CA8A 4K0NA 4BWSA 4IBPA 3KJYA 3SWLA 4WF4A 1K0DA 3L4NA 3V1WA 3L9SA 5GSTA 2JSYA 3BD2A 1GL8A 2MZCA 2CZ3A 3FKFA 3EVIA 2LNSA 2YP6A 4IJ3A 4X1UA 2YWIA 5DAKB 4OCFA 1EGRA 1GTUA 4F0CA 1M9AA 2LKUA 3ZIJA 1V9WA 3UBKA 1ZL9A 3CSHA 4XRAA 4POLA 2IFQA 2XC2A 2IL3A 2A2SA 4WBJA 4EL1A 4PXOA 2PUKC 4YQVA 3WGXA 5CP1A 3P90A 2OE1A 4Q5NA 3IHQA 2IIYA 4ZL8A 4CW9A 2OE0A 2DJ0A 3HHVA 4IN0A 4L5LA 4HJMA 2CAIA 3LWAA 3UIWA 2YZUA 1BX9A 5G2ZA 4JE1A 4N11A 5HR0A 2C3QA 2PBJA 4G0LA 4JBBA 1XFLA 5C04A 5IOWA 2LS5A 1SK2A 2FLSA 1SJ6A 4DSRA 4JZQA 1NHOA 1ZYQB 1H75A 2F8FA 5HFIA 4MJAA 3TKSA 5B8AA 4YQMA 1PMTA 1Z7PA 3GURA 1SL1B 2RUEA 5IO0A 2IMIA 1MEKA 3KIJA 2O8VB 3ZFLA 4IELA 1VGLA 3R3EA 4HZ4A 2F9SA 1MD3A 3UOMA 1V40A 3TJFA 2I4AA 4P3YB 3RAZA 2H01A 3P8WA 1TTZA 4XTSA 3K8NA 2P31A 2HSMA 3SBCA 5JCUA 4AJ7A 2RIIA 2KUCA 4DSQA 1VRSD 5KN1A 3KMNA 4NV2A 3O6TA 5G1LA 1XW5A 5LNKe 3F4SA 4K0GA 2VM2A 2WCIA 1O6JA 2L5LA 2H74A 2FWFA 1HNCA 3M0FA 2HRNA 1THXA 3DXBA 3KXOA 1GSDA 5G31A 1OVNA 4IS0A 3H8QA 2F8AA 1XOAA 2OBIA 4WR5A 1PA3A 1SD9A 4HDEA 4XS6A 3PINA 1J0FA 4MF5A 2I81A 1WWJA 4WR4A 3LXZA 1MD4A 2VLUA 2CV4A 3Q18A 3GRXA 3PGTA 3CSIA 1VF3A 1EGOA 3RBTA 5BMUA 1SJZA 1MTCA 2V6KA 2WJUA 2MMZA 1VF1A 2IJYA 2L59A 4TR4A 1T4YA 3VWUA 3IAS2 4TR1B 4J2FA 5F07A 3PH9A 4NV5A 2HYXA 1LJRA 2ON5A 4KCEA 1ZMAA 1GUKA 1ACVA 1XWKA 1W89A 4MCUA 1X9WB 1K0MA 2IMDA 4TXOB 2F3MA 3D4TA 4V2LA 1A0RP 4TKYA 2PERA 3GN3A 4GRFA 2WB9A 5ELAA 3RHCA 1EV9A 2K8SA 2GVPA 5A4VA 1GSQA 1EWXA 1OE7A 4QL7A 4L5OA 3MNGA 3PPUA 3IK9A 4AGSA 4PUFC 3GFKA 1Y25A 2FUG2 2CVBA 1OKTA 3US3A 5FWGA 4IVFA 2DBCA 1E2YA 3LJRA 5J9BA 4DVCA 2H1BA 1TXXA 1GSYA 3HD5A 3EC3A 2MBTA 18GSA 1HNAA 3M9KA 1OYJA 3F9UA 4F82A 4KSMA 1GNWA 4F2IA 4MK3A 3LQ7A 5CRDA 6GSYA 4L0UA 3ZVJD 4K7OA 2YZHA 3HA9A 2FWGA 3TKPA 1G6YA 2CVDA
chains in the Genus database with same CATH superfamily
2YV7A 1EZKA 5HFGA 2LTKA 2YWNA 1Y6EA 5DDLA 2PPTA 1A0FA 2H19A 5A5HA 1V58A 1UC7A 2HRKB 3ZVJA 3APOA 3H1NA 4MF6A 1M2BA 1S3AA 2JU5A 2D2ZA 2B1LA 3MYDA 4DSSA 4G10A 3QAGA 5ENUA 1ABAA 1M3JA 2L6DA 6GSTA 3Q6OA 2HSHA 1Q98A 1JHBA 3HVVA 3C8EA 4ECCA 2VOCA 1GSSA 3G9BA 5CRGA 1XBSA 3EYTA 1K0CA 1Y1UA 4XRDA 5IMZA 3DKSA 2YCDA 3UMAA 2DIZA 2R4VA 1T1VA 2RM6A 4I97A 1ON4A 2KHPA 2X99A 2IMFA 2FA4A 3QPMA 3QAWA 3TJGA 1TJDA 3QAVA 3GIXA 1Z6NA 2PVQA 4HQZA 2H6ZA 2C3TA 4GQFA 4HUAA 3RFRC 3P2AA 4E8EA 2H30A 1R4WA 4POBA 5D73A 1B9XC 3A3TA 4X0XA 4EXJA 3IRAA 4BL7A 4AJ8A 4IP1A 3RDWA 1TRSA 4W66A 4TW5A 4MF7A 2WULA 2L4QA 5A4WA 2VCQA 3KEBA 2LSTA 3RGBC 5ECOB 3HDCA 4OWYA 3LG6A 1SK0A 3GSTA 4IJIA 2B3SA 1TDIA 2RM5A 5J3RA 3ZZXA 1QFNA 1YEXA 1ERUA 1LU4A 3QCPA 2LV3A 19GSA 1XVQA 4WBRD 3EU3A 4K9ZA 2K6VA 2LRCA 4LMWA 3M3MA 4KDYA 1JZWA 3FR6A 2M80A 4O7HA 4PQHA 3ZREA 4KX4A 2OACA 2RUFA 4K2XA 5CYYA 3MDKA 5KOWA 3FR3A 2V41A 5D96A 2VL3A 2WRTA 1U87A 3CQFA 4MJBA 1BQ7A 4RQRA 2GSRA 2YJHA 4MLYA 4EDYA 1OC8A 2QA1A 4D73B 2L4CA 4PUAA 3TRXA 2GSSA 1THOA 2VO4A 1RW1A 3DYRA 4FYUA 3LW9A 2ES7A 4HS1A 1QK8A 4EIQA 1YY7A 2QKEA 3GL3A 3FZ9A 3RPNA 2WVYA 1AAZA 2OADA 5D9TA 5J4UA 3H93A 1GP1A 2HZEB 1GULA 3DWVA 1X5DA 3F4RA 3TJKA 1WE0A 3LSZA 4ZBAA 5L71A 4MZCA 2X8CA 1GUHA 3F3RA 2GLRA 1RK4A 1PX7A 1TKDB 1F3AA 1PRXA 4DEJA 4KSOA 4Z2RA 3VLNA 1R7HA 4HSCX 4ZIJA 1SYRA 3GH6A 3D22A 2H6YA 3TU3B 3GUSA 1O8WA 5BRTA 2WW1A 1J9BA 2YWOA 5IOXA 3GA4A 2JZSA 2B1KA 4F9ZA 3J7Yb 1TI3A 2DKHA 5EPFA 1UVZA 4H86A 2GQMA 1XW9A 1BG5A 5DAKA 4XCSA 5DJMA 4IHUA 1M7TA 2HSNB 2H8LA 4RUVA 4K7IA 2VD0A 2OE3A 4OFMA 5J47A 3NZNA 2MMAA 4KW6A 2XPEA 1F37A 2G0FA 1B4QA 2VCVA 3DVXA 4EO3A 4MZWA 2REMA 1TU7A 3D6IA 2H1AA 1O8XA 3GYKA 4WXTA 1SL0B 2B5XA 2YJ7A 3KTLA 3H79A 2RLIA 1TXUA 2HSYA 3KCMA 4WETA 5AISA 2C1YA 2FWEA 5ECQB 4YAVA 1S3CA 1U3AA 2EFHA 3C73A 2OBKA 1TK5B 1GTBA 1AUCA 1N25A 2LQOA 2WFCA 2C4JA 1ERWA 4GCIA 2CVKA 1CQGA 1YKAA 2LEGA 14GSA 5AIXA 1WPIA 2VD1A 2K18A 3QFAC 3S9FA 3CMIA 1FVJA 1X9SB 3GKNA 4JU5A 1U88A 4FO5A 1T8EB 3D5JA 1T7PB 2QSIA 2QA2A 1DE1A 5JWQB 1OC9B 5G1KA 4Z2UA 3M9JA 2LJRA 2P5QA 4MZBA 5IMDA 1O7UA 4NMUA 2O36A 4K5RA 3GNJA 4KGIA 4GSNA 4HZ2A 3FEUA 5G30A 3HVNA 2LNTA 4GSTA 2HXKA 2EC4A 4ECJA 1QUWA 4IQAA 3KH7A 1YF1A 1EV4A 2I9HA 1V2AA 3TKSE 3M1GA 1Z6MA 4N0VA 2GT6A 4MMMA 5ECNB 5GZZB 5DJLA 5ECPB 3VI7A 3PR8A 3GTUB 1F6MC 4G01A 3BOAA 1A2LA 3L78A 5EL8A 2H66A 3FMWA 5HR3A 4N3ZA 4FH8A 2KLXA 2BTOT 2PU9C 4OCEA 5JWOB 4ML6A 3A5IA 2JADA 2VM1A 4HEA2 3VWWA 1X5CA 3UJ1A 4LA1A 5DCHA 3QFBC 2JL4A 1A8LA 2V32A 2FWHA 4TR1A 2VIMA 3ZRDA 4NAXA 1XOBA 2AJQB 2H73A 1AXDA 2K9FA 2MBSA 2J9HA 3M8NA 5ELGA 3EE2A 3TDGA 2TRXA 4K1FA 3TRPA 3E3EA 2FGXA 2C3NA 4TXOA 3IA1A 4ECIA 1EOHA 4ZXGA 3A2VA 3GX0A 5ECKB 5C00A 4OMVA 1GSFA 5H5SA 2C0FA 2K8VA 4OFTA 8GSSA 1ILOA 5KN3A 5H5QA 4YH2A 4NHZA 2O3EA 1X0RA 4KCAA 5KN0A 3ISOA 1JZDA 3IV4A 1S3DA 1SD8A 5DVBA 2GSTA 1ERVA 3HVXA 3EURA 4HQSA 4QL9A 2P5RA 4EC0A 1PL1A 4JR6A 2EFEA 4V2NA 1ZOFA 5IQYA 3ZTLA 1G7EA 2IWTA 5CREA 5D9XA 1HNBA 1B4PA 1XWGA 4PI2C 1USBA 3ERGA 1YKCA 3TKRA 3WGDA 3GH9A 5J4YA 2O7KA 5IPGA 5A4UA 3VPQA 3ME7A 3W8JA 3KGKA 1DSBA 5HFKA 5GAPD 6GSSA 2DC5A 4AF2A 2VCWA 5A1NA 2L6CA 5D9VA 4WEYA 3C1SA 4Q5RA 2O85A 3HZ8A 4IQ1A 1IYIA 2A4HA 5ECMB 3HZ4A 1TI1A 1XWAA 1QGVA 2O89A 2HRKA 1FB6A 3ED3A 4BA7A 5IIZA 4MJCA 1FO5A 4O5RA 2LRTA 4QQ7A 1XVWA 2FA8A 4I2UA 3WYWA 3VURA 1K3OA 3CRTA 1K3YA 2DSAA 4N30A 4TOPA 4MABA 1DE2A 1V98A 3HXSA 1PKWA 2H72A 4NWYA 4EKZA 1Q4JA 1LBKA 1PQNA 5JCGA 4X43A 4TRXA 5ECHB 2YN1A 4KNDA 1C72A 2YPMA 2V1MA 1AQXA 5F06A 2HFDA 3IDVA 3WD6A 4MJEA 2WZ9A 1E6BA 4PTSA 4ZL9A 3C71A 4CHSA 1QQ2A 3UARA 4KB3A 1GTAA 1FG4A 3ME8A 3QOUA 2AAWA 2VCXA 4MNNA 3F6FA 2DIYA 3FRCA 1GUMA 1BEDA 4MA9A 4RQXA 4GXZA 3TKQA 2YNXA 4Q5QA 4GLTA 2C8UA 5A5KA 3DVWA 4FYBA 4PURA 4LLRA 2CZ2A 2OKAA 1W4VA 4X4JA 2GQKA 1ML6A 5B6NA 2IPAA 1K0BA 1A24A 1O85A 1PSQA 2C0DA 1X9MB 5CNWA 2JZRA 2PVOC 4MPGA 1Z9HA 3VI5A 3LGCA 22GSA 3R2QA 4OO4A 17GSA 2AUVA 4PNFA 1WIKA 4ULXA 4IKHA 4ZILA 2GZYA 5ID2B 3FR9A 2A4VA 2H0IA 3EWLA 5ECRB 4ILFA 1X5EA 4XS4B 3UAPA 5J5NA 5EVOA 3KH9A 4BPYA 6GSXA 4OO5A 2DJJA 1Z7RA 3ZL5A 1FB0A 1URMA 4I6XA 1XXUA 4PQIA 3FW2A 2GT5A 5ABRA 2WGRA 3ZFBA 4PHZC 2MMOA 3ZIVA 5IO2A 3GHAA 5G5FA 3APSA 5DQYA 3HJOA 3FZ4A 1M2DA 4D73A 5DQSA 4GSSA 4KAEA 3F0IA 1I9DA 5G5EA 2HT9A 4G19A 2OJLA 3I6AA 4EDZA 2LJAA 3WGEA 1B48A 1RQMA 4ZB6A 3MIXA 3A2XA 3UVTA 3CTFA 3GKMA 4K5SA 1KNGA 1NW2A 3IHGA 2C0GA 4TR0A 3IBHA 3LYKA 2HZEA 1SK1A 4F03A 1HD2A 3IXRA 1CQHA 1TOFA 2DJ1A 2HNLA 3DIEA 1QXHA 1GLPA 20GSA 2WS2A 1EEMA 4NXIA 3I9V2 1ERTA 1BAYA 1O73A 3CBUA 1ST9A 16GSA 4BVXB 2GS3A 5E4WA 3E0UA 4K8MA 1FVKA 2V6OA 3LORA 4POKA 4XS1A 1F3BA 2WW3A 3HJMA 3FZAA 1JLWA 5F0GA 5IMFA 3IOSA 1S3RA 3DMLA 5DALB 4TVEA 4NHWA 4FIWA 1SKRB 3AY8A 3O3TA 6GSVA 1GSUA 1AQVA 3HCZA 1SU9A 4BWQA 3ZMKA 2GZZA 2HSNA 7GSSA 4Z7XA 3MAKA 2N5AA 1R26A 2N5FA 2KOKA 4XHMA 1A2JA 1VF2A 2R0CA 4K2DA 2O87A 5H5RA 4TXVA 1R5AA 3TGZA 3I69A 3W8SA 1AQWA 5COHA 1S4BP 4KH7A 5LD0A 4F0BA 3P7XA 4J56E 1PD21 2H0GA 4KUNA 5CO3A 4BVYB 1PGTA 3Q19A 4EVMA 1K0OA 4KF9A 1KBNA 1PKZA 1M99A 4KDUA 2KP1A 2WZSA 2LRNA 1ZZYA 2BMXA 1M3IA 4GTUA 4TN8A 4ZBDA 1ZGNA 1ZYNA 2DJ3A 3ZITA 2C80A 5INYA 2FD3A 2H75A 4LMVA 4NPBA 4MDCA 3RPPA 2WVXB 5JWRB 5IM9A 2AHEA 2PWJA 3EMPA 6GSWA 2HRFA 4KDXA 4EIPA 3MWHA 2CQ9A 1TK0B 1JFUA 3APQA 1SVOA 2KP2A 2OA7A 3F3QA 4O5QA 3N5OA 4FQUA 4MH3A 2NDOA 3LEFA 5HQPA 3VWVA 4ACSA 3G7IA 2WVZA 2ZCTA 3LFLA 1OC9A 2CAQA 4ISDA 2IFQB 4JR4A 2E0QA 4G2EA 3ZLPA 2A2RA 2XHFA 3CRUA 1OE8A 4AKGA 5IMVA 1UN2A 4K7NA 4K6XA 2I1UA 2IMEA 4EUYA 1XG8A 4IP6A 2LQQA 3F8UA 1M0UA 2GGTA 5IPHA 3FK8A 1KTEA 5D93A 4YKGA 1NSWA 2CT6A 1NM3A 4HU7A 2ON7A 1F2EA 3A2WA 2QC7A 5A34B 1I5GA 3J7Yk 2E7PA 2HQTA 3GTUA 1TRVA 2VCTA 1ZYEA 1MDJA 3LXTA 2H76A 3O76A 1I1IP 2XBIA 3IK7A 3UVHA 4YAPA 2VL9A 4QMKA 4N0ZA 1U3IA 3QD9A 2AB6A 1IYHA 4LL1B 1MDKA 1GNEA 1EOGA 1B9YC 3CHXC 3IC4A 4OFNA 4PX1A 3OR5A 5DCGA 3D0ZA 2JZTA 2BJXA 3U6VA 4GWRA 1PX6A 4Q5FA 4USSA 3VWXA 4IW9A 5F8BA 1T00A 1G0TA 3I43A 3DD3A 2H70A 2VLVA 5EY6A 5KOXA 2L5OA 1SJIA 1TK8B 4O5UA 1FHEA 1FAAA 3VFIA 2V2GA 1Z5YE 2HSMB 2M72A 1O81A 4V1Ag 3TOUA 3L9VA 1BG1A 4MP4A 3CSJA 3GV1A 2B5YA 6GSUA 2G2QA 2E2MA 3KMOA 5ECIB 4ML1A 11GSA 3JCML 3BJ5A 3HY2A 13GSA 1YEWC 4RI6A 2R5GA 2EIOA 4O92A 5J40A 3EINA 1QMVA 2X8HA 3ERFA 2VUPA 1V57A 1XCCA 2B7JA 2H0HA 2EFDA 2FNOA 3DRNA 1YVLA 2IN3A 3HKRA 2R3XA 2WW0A 1OAZA 2IMKA 3UL3A 5BMUB 1VF4A 1U6TA 3F4TA 5ECLB 2UV8G 4HU9A 4LL4B 3IC8A 3FY7A 2R37A 1FOVA 3L9UA 3HVSA 4G9HA 4ZB9A 1XWCA 4PQ1A 1YQ1A 3BCIA 3WT1A 2HI7A 2VL2C 2DKIA 4ID0A 3TUEA 1NHYA 2HZFA 5D9WA 1DUGA 3F6DA 1N2AA 4POMA 3TJJA 3CXGA 3C1RA 3IR4A 1SL2B 1PL2A 1OKDA 3BCKA 2PMTA 1OC3A 2X4AA 1SVLA 5AGYA 1G7OA 3VK9A 3HMJG 3U5RE 1JZRA 5J9CA 4WKWA 2R2JA 5LCZA 1YDKA 3DGQA 2HRAA 5B7CA 2GQLA 3ZYWA 1J08A 3GL5A 4JRRA 5FT3A 2NTOA 1HQOA 4PGTA 3NOFA 2J23A 2NVLA 1A23A 5GAND 2NPBA 5CAXA 2XPDA 1GSEA 1AC1A 3N9JA 5E59A 4AKIA 4EE0A 2DMLA 1XIYA 5KN2A 2VAFA 5AIVA 2GTUA 2GZPA 4A5PA 1M9BA 4V2MA 3FHKA 2B7KA 2H1GA 1KEBA 2NBSA 3F63A 1UA5A 1GWCA 1PFOA 1SVMA 5F05A 4HOJA 3QMXA 2YANA 3RHBA 2TIRA 3CWGA 5A5HB 1BYEA 4FYCA 2I3YA 2VCZA 2YWMA 2H1DA 2YOIA 2H6XA 4DSSB 3TB2A 1WMJA 2HLSA 1TRWA 5D8IA 1YZXA 5HR2A 3ZMLA 5IMCA 1GLQA 1ZCPA 2LJKA 2P0GA 2FCHA 2VL2A 3GMFA 4MPFA 1DBYA 4ECBA 1H4OA 2ZNMA 1XPVA 4G0KA 1PN9A 2E2GA 2YV9A 5ID2A 4L8EA 2N5BA 1SYXA 5B6MA 1M2AA 4XS4A 2AV4A 4E8HA 2JSZA 4ZBBA 1ZYPA 2C0EA 4N10A 3W6GA 3CYNA 1TW9A 4PI0C 3UEMA 3EU4A 3LYPA 5JCWA 4RI7A 4KA0A 3NIVA 3G7YA 2DMMA 2F51A 2FHEA 5AN1A 1WJKA 4YQUA 4JEDA 4FXYP 1EP7A 10GSA 4Z2TA 4BL7B 1JZOA 3QR6A 5B8BA 5DBQA 1AW9A 1F9MA 4G0IA 3TOTA 3GKKA 3UBLA 4IGJA 3E9JB 3GX8A 1XZOA 2GSQA 2MYGA 4WF5A 4OD7A 2CX3A 1TRUA 2OT3A 1SKWB 5J41A 1HYUA 1Z3EA 4EF0A 5KEJA 3CTGA 9GSSA 1GTIA 3KM6A 2EIQA 2VLTA 4KE3A 3KD0A 3KZQA 3TCOA 3MSZA 3BBYA 4GF0A 4HJ2A 2EFCA 4V1Ap 4CY8A 4O32A 1XW6A 1WP0A 2WDUA 4MH2A 3EMXA 1BJXA 3IPZA 1T3BA 2L57A 1SKSB 2JACA 5FHIA 3H4KA 3D21A 5GSSA 3QDNA 12GSA 3KP8A 3D4MA 1T4ZA 1YJ6A 2DLXA 1YEPA 3L0HA 4BVXA 1FOHA 4HI7A 4AKXB 2CX4A 2GDRA 3KP9A 1K0NA 3WT2A 4L0WA 3ERWA 2MMNA 2H71A 3FZ5A 3HYPA 3TRQA 2LUSA 2R6KA 5IMAA 1SENA 3IE3A 3FYGA 5DALA 4J57E 1FW1A 3GKXA 1XWBA 4TR3A 3TJBA 4I5QA 3VPTA 2X8GA 4ZL7A 1WOUA 2FY6A 1GRXA 2DJ2A 4I8BA 1TU8A 4AJ6A 2Z9SA 1AIUA 4ZB8A 2WW2A 2DJKA 1K3LA 3IAM2 1EEJA 1MDIA 3C7MA 5J4VA 1A8YA 1YF0A 4PNGA 1K0AA 2XBQA 1EP8A 3HJPA 4YKFA 2B6MA 2PGTA 2ZUPA 5ECSA 2UZ8A 3G7JA 1R5PA 2X64A 1JLVA 1WRYA 1N8JA 3A5WA 5HR1A 2ALBA 1B8XA 4AI6A 1TP9A 2EIRA 3Q74A 5CRWA 4BVYA 1GH2A 4GQCA 2AYTA 2TRCP 3DEXA 2M46A 3TKSC 3KTBA 2HE3A 4AKHA 5CRHA 1A2MA 2B5EA 1G6WA 3GSSA 4I2TA 2PN8A 4CDOA 4XIHA 2QGVA 2CA8A 4K0NA 4BWSA 3EPTA 4IBPA 3KJYA 2WVXA 3SWLA 1K0DA 4WF4A 3L4NA 3V1WA 3L9SA 5GSTA 2JSYA 3BD2A 1GL8A 2MZCA 2CZ3A 3FKFA 3EVIA 2LNSA 2YP6A 4IJ3A 4X1UA 2YWIA 5DAKB 4OCFA 1EGRA 1GTUA 4F0CA 1M9AA 2LKUA 3ZIJA 1V9WA 3UBKA 1ZL9A 3CSHA 4XRAA 4POLA 2IFQA 2XC2A 2IL3A 2A2SA 4WBJA 4EL1A 4PXOA 2PUKC 4YQVA 3WGXA 5CP1A 3P90A 2OE1A 4Q5NA 3IHQA 2IIYA 4ZL8A 4CW9A 2OE0A 2DJ0A 3HHVA 4IN0A 4L5LA 4HJMA 2CAIA 3LWAA 2H1LA 3UIWA 2YZUA 1BX9A 5G2ZA 4E68A 4JE1A 4N11A 5HR0A 2C3QA 2PBJA 4G0LA 5A34A 4JBBA 1XFLA 2O5VA 5C04A 5IOWA 2LS5A 1SK2A 2FLSA 4GDFA 1SJ6A 4DSRA 4JZQA 1BF5A 1NHOA 1ZYQB 1H75A 2F8FA 5HFIA 4MJAA 3TKSA 5B8AA 4YQMA 1PMTA 1Z7PA 3GURA 2R0GA 2RUEA 5IO0A 1SL1B 2IMIA 1MEKA 3KIJA 2O8VB 3ZFLA 4IELA 1VGLA 3R3EA 4HZ4A 2F9SA 1MD3A 3UOMA 1V40A 3TJFA 2I4AA 4P3YB 3RAZA 2H01A 3P8WA 1PN0A 1TTZA 4XTSA 3K8NA 2VKZG 2P31A 2HSMA 3SBCA 5JCUA 4AJ7A 2RIIA 2KUCA 4DSQA 1VRSD 5KN1A 3KMNA 4NV2A 3O6TA 5G1LA 1XW5A 5LNKe 3F4SA 4K0GA 2VM2A 2WCIA 1O6JA 2L5LA 2H74A 2FWFA 1HNCA 3M0FA 2HRNA 1THXA 3DXBA 3KXOA 1GSDA 5G31A 1OVNA 4ICYA 4IS0A 3H8QA 2F8AA 1XOAA 2OBIA 4WR5A 1PA3A 1SD9A 4HDEA 4XS6A 3PINA 1J0FA 4MF5A 2I81A 1WWJA 4WR4A 3LXZA 1MD4A 2VLUA 2CV4A 3Q18A 3GRXA 3PGTA 3CSIA 1VF3A 1EGOA 3RBTA 5BMUA 1SJZA 1MTCA 2V6KA 2WJUA 2MMZA 1VF1A 2IJYA 2L59A 2R0PA 4TR4A 1T4YA 3VWUA 3IAS2 4TR1B 4J2FA 5F07A 3PH9A 4NV5A 2HYXA 1LJRA 2ON5A 4KCEA 1ZMAA 4ZB7A 1GUKA 1ACVA 1XWKA 1W89A 4MCUA 1X9WB 1K0MA 2IMDA 2X49A 4TXOB 2F3MA 3D4TA 4V2LA 1A0RP 4TKYA 2A2PA 2PERA 3GN3A 4GRFA 2WB9A 5ELAA 4CY6A 3RHCA 1EV9A 2K8SA 2GVPA 4BIKA 5A4VA 1GSQA 1EWXA 1OE7A 4QL7A 4L5OA 3MNGA 3PPUA 3IK9A 4AGSA 4PUFC 3GFKA 1Y25A 2FUG2 2CVBA 1OKTA 3US3A 5FWGA 4IVFA 2DBCA 1E2YA 3LJRA 5J9BA 4DVCA 2H1BA 1TXXA 1GSYA 3HD5A 3EC3A 2MBTA 18GSA 1HNAA 3M9KA 1OYJA 3F9UA 4F82A 4KSMA 1GNWA 4F2IA 4MK3A 3LQ7A 5CRDA 6GSYA 4L0UA 3ZVJD 4K7OA 2YZHA 3HA9A 2FWGA 3TKPA 1G6YA 2CVDA 5A1NB
chains in the Genus database with same CATH topology
2YV7A 1EZKA 5HFGA 2LTKA 2YWNA 1Y6EA 5DDLA 2PPTA 1A0FA 2H19A 5A5HA 1V58A 1UC7A 2HRKB 3ZVJA 3APOA 3H1NA 4MF6A 1M2BA 1S3AA 2JU5A 2D2ZA 2B1LA 3MYDA 4DSSA 4G10A 3QAGA 5ENUA 1ABAA 2L6DA 6GSTA 3Q6OA 2HSHA 1Q98A 1JHBA 3HVVA 3C8EA 4ECCA 2VOCA 1GSSA 3G9BA 5CRGA 1XBSA 3EYTA 1K0CA 1Y1UA 4XRDA 5IMZA 3DKSA 2YCDA 3UMAA 2DIZA 2R4VA 1T1VA 2RM6A 4I97A 1ON4A 2KHPA 2X99A 2IMFA 2FA4A 3QPMA 3QAWA 3TJGA 1TJDA 3QAVA 3GIXA 1Z6NA 2PVQA 4HQZA 2H6ZA 2C3TA 4GQFA 4HUAA 3P2AA 4E8EA 2H30A 1R4WA 4POBA 5D73A 1B9XC 3A3TA 4X0XA 4EXJA 3IRAA 4BL7A 4AJ8A 4IP1A 3RDWA 1TRSA 4W66A 4TW5A 4MF7A 2WULA 2L4QA 5A4WA 2VCQA 3KEBA 2LSTA 5ECOB 3HDCA 4OWYA 3LG6A 1SK0A 3GSTA 4IJIA 2B3SA 1TDIA 2RM5A 5J3RA 3ZZXA 1QFNA 1YEXA 1ERUA 1LU4A 3QCPA 2LV3A 19GSA 1XVQA 4WBRD 3EU3A 4K9ZA 2K6VA 2LRCA 4LMWA 3M3MA 4KDYA 1JZWA 3FR6A 2M80A 4O7HA 4PQHA 3ZREA 4KX4A 2OACA 2RUFA 4K2XA 5CYYA 3MDKA 5KOWA 3FR3A 2V41A 5D96A 2VL3A 2WRTA 1U87A 4MJBA 1BQ7A 4RQRA 2GSRA 2YJHA 4MLYA 4EDYA 1OC8A 2QA1A 4D73B 2L4CA 4PUAA 3TRXA 2GSSA 1THOA 2VO4A 1RW1A 3DYRA 4FYUA 3LW9A 2ES7A 4HS1A 1QK8A 4EIQA 1YY7A 2QKEA 3GL3A 3FZ9A 3RPNA 1AAZA 2OADA 5D9TA 5J4UA 3H93A 1GP1A 2HZEB 1GULA 3DWVA 1X5DA 3F4RA 3TJKA 1WE0A 3LSZA 4ZBAA 5L71A 4MZCA 2X8CA 1GUHA 3F3RA 2GLRA 1RK4A 1PX7A 1TKDB 1F3AA 1PRXA 4DEJA 4KSOA 4Z2RA 3VLNA 1R7HA 4ZIJA 1SYRA 3GH6A 3D22A 2H6YA 3TU3B 3GUSA 1O8WA 5BRTA 1J9BA 2YWOA 5IOXA 3GA4A 2JZSA 2B1KA 4F9ZA 3J7Yb 1TI3A 2DKHA 5EPFA 1UVZA 4H86A 2GQMA 1XW9A 1BG5A 5DAKA 4XCSA 5DJMA 4IHUA 1M7TA 2HSNB 2H8LA 4RUVA 4K7IA 2VD0A 2OE3A 4OFMA 5J47A 3NZNA 2MMAA 4KW6A 2XPEA 1F37A 2G0FA 1B4QA 2VCVA 3DVXA 4EO3A 4MZWA 2REMA 1TU7A 3D6IA 2H1AA 1O8XA 3GYKA 4WXTA 1SL0B 2B5XA 2YJ7A 3KTLA 3H79A 2RLIA 1TXUA 2HSYA 3KCMA 4WETA 5AISA 2C1YA 2FWEA 5ECQB 4YAVA 1S3CA 1U3AA 2EFHA 3C73A 2OBKA 1TK5B 1GTBA 1AUCA 1N25A 2LQOA 2WFCA 2C4JA 1ERWA 4GCIA 2CVKA 1CQGA 1YKAA 2LEGA 14GSA 5AIXA 1WPIA 2VD1A 2K18A 3QFAC 3S9FA 3CMIA 1FVJA 1X9SB 3GKNA 4JU5A 1U88A 4FO5A 1T8EB 3D5JA 1T7PB 2QSIA 2QA2A 1DE1A 5JWQB 1OC9B 5G1KA 4Z2UA 3M9JA 2LJRA 2P5QA 4MZBA 5IMDA 1O7UA 4NMUA 4K5RA 3GNJA 4KGIA 4GSNA 4HZ2A 3FEUA 5G30A 2LNTA 4GSTA 2HXKA 2EC4A 4ECJA 1QUWA 4IQAA 3KH7A 1YF1A 1EV4A 2I9HA 1V2AA 3TKSE 3M1GA 1Z6MA 4N0VA 2GT6A 4MMMA 5ECNB 5GZZB 5DJLA 5ECPB 3VI7A 3PR8A 3GTUB 1F6MC 4G01A 3BOAA 1A2LA 3L78A 5EL8A 2H66A 3FMWA 5HR3A 4N3ZA 4FH8A 2KLXA 2BTOT 2PU9C 4OCEA 5JWOB 4ML6A 3A5IA 2JADA 2VM1A 4HEA2 3VWWA 1X5CA 3UJ1A 4LA1A 5DCHA 3QFBC 2JL4A 1A8LA 2V32A 2FWHA 4TR1A 2VIMA 3ZRDA 4NAXA 1XOBA 2AJQB 2H73A 1AXDA 2K9FA 2MBSA 2J9HA 3M8NA 5ELGA 3EE2A 3TDGA 2TRXA 4K1FA 3TRPA 3E3EA 2FGXA 2C3NA 4TXOA 3IA1A 4ECIA 1EOHA 4ZXGA 3A2VA 3GX0A 5ECKB 5C00A 4OMVA 1GSFA 5H5SA 2C0FA 2K8VA 4OFTA 8GSSA 1ILOA 5KN3A 5H5QA 4YH2A 4NHZA 1X0RA 4KCAA 5KN0A 3ISOA 1JZDA 3IV4A 1S3DA 1SD8A 5DVBA 2GSTA 1ERVA 3HVXA 3EURA 4HQSA 4QL9A 2P5RA 4EC0A 1PL1A 4JR6A 2EFEA 4V2NA 1ZOFA 5IQYA 3ZTLA 1G7EA 2IWTA 5CREA 5D9XA 1HNBA 1B4PA 1XWGA 1USBA 3ERGA 1YKCA 3TKRA 3WGDA 3GH9A 5J4YA 2O7KA 5IPGA 5A4UA 3VPQA 3ME7A 3W8JA 3KGKA 1DSBA 5HFKA 5GAPD 6GSSA 2DC5A 4AF2A 2VCWA 5A1NA 2L6CA 5D9VA 4WEYA 3C1SA 4Q5RA 2O85A 3HZ8A 4IQ1A 1IYIA 2A4HA 5ECMB 3HZ4A 1TI1A 1XWAA 1QGVA 2O89A 2HRKA 1FB6A 3ED3A 4BA7A 5IIZA 4MJCA 1FO5A 4O5RA 2LRTA 4QQ7A 1XVWA 2FA8A 4I2UA 3WYWA 3VURA 1K3OA 3CRTA 1K3YA 2DSAA 4N30A 4TOPA 4MABA 1DE2A 1V98A 3HXSA 1PKWA 2H72A 4NWYA 4EKZA 1Q4JA 1LBKA 1PQNA 5JCGA 4X43A 4TRXA 5ECHB 2YN1A 4KNDA 1C72A 2YPMA 2V1MA 1AQXA 5F06A 2HFDA 3IDVA 3WD6A 4MJEA 2WZ9A 1E6BA 4PTSA 4ZL9A 3C71A 4CHSA 1QQ2A 3UARA 4KB3A 1GTAA 1FG4A 3ME8A 3QOUA 2AAWA 2VCXA 4MNNA 3F6FA 2DIYA 3FRCA 1GUMA 1BEDA 4MA9A 4RQXA 4GXZA 3TKQA 2YNXA 4Q5QA 4GLTA 2C8UA 5A5KA 3DVWA 4FYBA 4PURA 4LLRA 2CZ2A 2OKAA 1W4VA 4X4JA 2GQKA 1ML6A 5B6NA 2IPAA 1K0BA 1A24A 1O85A 1PSQA 2C0DA 1X9MB 5CNWA 2JZRA 2PVOC 4MPGA 1Z9HA 3VI5A 3LGCA 22GSA 3R2QA 4OO4A 17GSA 2AUVA 4PNFA 1WIKA 4ULXA 4IKHA 4ZILA 2GZYA 5ID2B 3FR9A 2A4VA 2H0IA 3EWLA 5ECRB 4ILFA 1X5EA 4XS4B 3UAPA 5J5NA 5EVOA 3KH9A 4BPYA 6GSXA 4OO5A 2DJJA 1Z7RA 3ZL5A 1FB0A 1URMA 4I6XA 1XXUA 4PQIA 3FW2A 2GT5A 5ABRA 2WGRA 3ZFBA 2MMOA 3ZIVA 5IO2A 3GHAA 5G5FA 3APSA 5DQYA 3HJOA 3FZ4A 1M2DA 4D73A 5DQSA 4GSSA 4KAEA 3F0IA 1I9DA 5G5EA 2HT9A 4G19A 2OJLA 3I6AA 4EDZA 2LJAA 3WGEA 1B48A 1RQMA 4ZB6A 3MIXA 3A2XA 3UVTA 3CTFA 3GKMA 4K5SA 1KNGA 1NW2A 3IHGA 2C0GA 4TR0A 3IBHA 3LYKA 2HZEA 1SK1A 4F03A 1HD2A 3IXRA 1CQHA 1TOFA 2DJ1A 2HNLA 3DIEA 1QXHA 1GLPA 20GSA 2WS2A 1EEMA 4NXIA 3I9V2 1ERTA 1BAYA 1O73A 3CBUA 1ST9A 16GSA 4BVXB 2GS3A 5E4WA 3E0UA 4K8MA 1FVKA 2V6OA 3LORA 4POKA 4XS1A 1F3BA 3HJMA 3FZAA 1JLWA 5F0GA 5IMFA 3IOSA 3DMLA 5DALB 4TVEA 4NHWA 4FIWA 1SKRB 3AY8A 3O3TA 6GSVA 1GSUA 1AQVA 3HCZA 1SU9A 4BWQA 3ZMKA 2GZZA 2HSNA 7GSSA 4Z7XA 3MAKA 2N5AA 1R26A 2N5FA 2KOKA 4XHMA 1A2JA 1VF2A 2R0CA 4K2DA 2O87A 5H5RA 4TXVA 1R5AA 3TGZA 3I69A 3W8SA 1AQWA 5COHA 4KH7A 5LD0A 4F0BA 3P7XA 4J56E 1PD21 2H0GA 4KUNA 5CO3A 4BVYB 1PGTA 3Q19A 4EVMA 1K0OA 4KF9A 1KBNA 1PKZA 1M99A 4KDUA 2KP1A 2LRNA 1ZZYA 2BMXA 4GTUA 4TN8A 4ZBDA 1ZGNA 1ZYNA 2DJ3A 3ZITA 2C80A 5INYA 2FD3A 2H75A 4LMVA 4NPBA 4MDCA 3RPPA 5JWRB 5IM9A 2AHEA 2PWJA 3EMPA 6GSWA 2HRFA 4KDXA 4EIPA 3MWHA 2CQ9A 1TK0B 1JFUA 3APQA 1SVOA 2KP2A 2OA7A 3F3QA 4O5QA 3N5OA 4FQUA 4MH3A 2NDOA 3LEFA 5HQPA 3VWVA 4ACSA 3G7IA 2ZCTA 3LFLA 1OC9A 2CAQA 4ISDA 2IFQB 4JR4A 2E0QA 4G2EA 3ZLPA 2A2RA 2XHFA 3CRUA 1OE8A 4AKGA 5IMVA 1UN2A 4K7NA 4K6XA 2I1UA 2IMEA 4EUYA 4IP6A 2LQQA 3F8UA 1M0UA 2GGTA 5IPHA 3FK8A 1KTEA 5D93A 4YKGA 1NSWA 2CT6A 1NM3A 4HU7A 2ON7A 1F2EA 3A2WA 2QC7A 5A34B 1I5GA 3J7Yk 2E7PA 2HQTA 3GTUA 1TRVA 2VCTA 1ZYEA 1MDJA 3LXTA 2H76A 3O76A 2XBIA 3IK7A 3UVHA 4YAPA 2VL9A 4QMKA 4N0ZA 1U3IA 3QD9A 2AB6A 1IYHA 4LL1B 1MDKA 1GNEA 1EOGA 1B9YC 3IC4A 4OFNA 4PX1A 3OR5A 5DCGA 3D0ZA 2JZTA 2BJXA 3U6VA 4GWRA 1PX6A 4Q5FA 4USSA 3VWXA 4IW9A 5F8BA 1T00A 1G0TA 3I43A 3DD3A 2H70A 2VLVA 5EY6A 5KOXA 2L5OA 1SJIA 1TK8B 4O5UA 1FHEA 1FAAA 3VFIA 2V2GA 1Z5YE 2HSMB 2M72A 1O81A 4V1Ag 3TOUA 3L9VA 1BG1A 4MP4A 3CSJA 3GV1A 2B5YA 6GSUA 2G2QA 2E2MA 3KMOA 5ECIB 4ML1A 11GSA 3JCML 3BJ5A 3HY2A 13GSA 4RI6A 2R5GA 2EIOA 4O92A 5J40A 3EINA 1QMVA 2X8HA 3ERFA 2VUPA 1V57A 1XCCA 2B7JA 2H0HA 2EFDA 2FNOA 3DRNA 1YVLA 2IN3A 3HKRA 2R3XA 1OAZA 2IMKA 3UL3A 5BMUB 1VF4A 1U6TA 3F4TA 5ECLB 2UV8G 4HU9A 4LL4B 3IC8A 3FY7A 2R37A 1FOVA 3L9UA 3HVSA 4G9HA 4ZB9A 1XWCA 4PQ1A 1YQ1A 3BCIA 3WT1A 2HI7A 2VL2C 2DKIA 4ID0A 3TUEA 1NHYA 2HZFA 5D9WA 1DUGA 3F6DA 1N2AA 4POMA 3TJJA 3CXGA 3C1RA 3IR4A 1SL2B 1PL2A 1OKDA 3BCKA 2PMTA 1OC3A 2X4AA 1SVLA 5AGYA 1G7OA 3VK9A 3HMJG 3U5RE 1JZRA 5J9CA 4WKWA 2R2JA 5LCZA 1YDKA 3DGQA 2HRAA 5B7CA 2GQLA 3ZYWA 1J08A 3GL5A 4JRRA 5FT3A 2NTOA 1HQOA 4PGTA 3NOFA 2J23A 2NVLA 1A23A 5GAND 2NPBA 5CAXA 2XPDA 1GSEA 1AC1A 3N9JA 5E59A 4AKIA 4EE0A 2DMLA 1XIYA 5KN2A 2VAFA 5AIVA 2GTUA 2GZPA 4A5PA 1M9BA 4V2MA 3FHKA 2B7KA 2H1GA 1KEBA 2NBSA 3F63A 1UA5A 1GWCA 1SVMA 5F05A 4HOJA 3QMXA 2YANA 3RHBA 2TIRA 3CWGA 5A5HB 1BYEA 4FYCA 2I3YA 2VCZA 2YWMA 2H1DA 2YOIA 2H6XA 4DSSB 3TB2A 1WMJA 2HLSA 1TRWA 5D8IA 1YZXA 5HR2A 3ZMLA 5IMCA 1GLQA 1ZCPA 2LJKA 2P0GA 2FCHA 2VL2A 3GMFA 4MPFA 1DBYA 4ECBA 1H4OA 2ZNMA 1XPVA 4G0KA 1PN9A 2E2GA 2YV9A 5ID2A 4L8EA 2N5BA 1SYXA 5B6MA 1M2AA 4XS4A 2AV4A 4E8HA 2JSZA 4ZBBA 1ZYPA 2C0EA 4N10A 3W6GA 3CYNA 1TW9A 3UEMA 3EU4A 3LYPA 5JCWA 4RI7A 4KA0A 3NIVA 3G7YA 2DMMA 2F51A 2FHEA 5AN1A 1WJKA 4YQUA 4JEDA 1EP7A 10GSA 4Z2TA 4BL7B 1JZOA 3QR6A 5B8BA 5DBQA 1AW9A 1F9MA 4G0IA 3TOTA 3GKKA 3UBLA 4IGJA 3E9JB 3GX8A 1XZOA 2GSQA 2MYGA 4WF5A 4OD7A 2CX3A 1TRUA 2OT3A 1SKWB 5J41A 1HYUA 1Z3EA 4EF0A 5KEJA 3CTGA 9GSSA 1GTIA 3KM6A 2EIQA 2VLTA 4KE3A 3KD0A 3KZQA 3TCOA 3MSZA 3BBYA 4GF0A 4HJ2A 2EFCA 4V1Ap 4CY8A 4O32A 1XW6A 1WP0A 2WDUA 4MH2A 3EMXA 1BJXA 3IPZA 1T3BA 2L57A 1SKSB 2JACA 5FHIA 3H4KA 3D21A 5GSSA 3QDNA 12GSA 3KP8A 3D4MA 1T4ZA 1YJ6A 2DLXA 1YEPA 3L0HA 4BVXA 1FOHA 4HI7A 4AKXB 2CX4A 2GDRA 3KP9A 1K0NA 3WT2A 4L0WA 3ERWA 2MMNA 2H71A 3FZ5A 3HYPA 3TRQA 2LUSA 2R6KA 5IMAA 1SENA 3IE3A 3FYGA 5DALA 4J57E 1FW1A 3GKXA 1XWBA 4TR3A 3TJBA 4I5QA 3VPTA 2X8GA 4ZL7A 1WOUA 2FY6A 1GRXA 2DJ2A 4I8BA 1TU8A 4AJ6A 2Z9SA 1AIUA 4ZB8A 2DJKA 1K3LA 3IAM2 1EEJA 1MDIA 3C7MA 5J4VA 1A8YA 1YF0A 4PNGA 1K0AA 2XBQA 1EP8A 3HJPA 4YKFA 2B6MA 2PGTA 2ZUPA 5ECSA 2UZ8A 3G7JA 1R5PA 2X64A 1JLVA 1WRYA 1N8JA 3A5WA 5HR1A 2ALBA 1B8XA 4AI6A 1TP9A 2EIRA 3Q74A 5CRWA 4BVYA 1GH2A 4GQCA 2AYTA 2TRCP 3DEXA 2M46A 3TKSC 3KTBA 2HE3A 4AKHA 5CRHA 1A2MA 2B5EA 1G6WA 3GSSA 4I2TA 2PN8A 4CDOA 4XIHA 2QGVA 2CA8A 4K0NA 4BWSA 3EPTA 4IBPA 3KJYA 3SWLA 4WF4A 1K0DA 3L4NA 3V1WA 3L9SA 5GSTA 2JSYA 3BD2A 1GL8A 2MZCA 2CZ3A 3FKFA 3EVIA 2LNSA 2YP6A 4IJ3A 4X1UA 2YWIA 5DAKB 4OCFA 1EGRA 1GTUA 4F0CA 1M9AA 2LKUA 3ZIJA 1V9WA 3UBKA 1ZL9A 3CSHA 4XRAA 4POLA 2IFQA 2XC2A 2IL3A 2A2SA 4WBJA 4EL1A 4PXOA 2PUKC 4YQVA 3WGXA 5CP1A 3P90A 2OE1A 4Q5NA 3IHQA 2IIYA 4ZL8A 4CW9A 2OE0A 2DJ0A 3HHVA 4IN0A 4L5LA 4HJMA 2CAIA 3LWAA 2H1LA 3UIWA 2YZUA 1BX9A 5G2ZA 4E68A 4JE1A 4N11A 5HR0A 2C3QA 2PBJA 4G0LA 5A34A 4JBBA 1XFLA 2O5VA 5C04A 5IOWA 2LS5A 1SK2A 2FLSA 4GDFA 1SJ6A 4DSRA 4JZQA 1BF5A 1NHOA 1ZYQB 1H75A 2F8FA 5HFIA 4MJAA 3TKSA 5B8AA 4YQMA 1PMTA 1Z7PA 3GURA 2R0GA 2RUEA 5IO0A 1SL1B 2IMIA 1MEKA 3KIJA 2O8VB 3ZFLA 4IELA 1VGLA 3R3EA 4HZ4A 2F9SA 1MD3A 3UOMA 1V40A 3TJFA 2I4AA 4P3YB 3RAZA 2H01A 3P8WA 1PN0A 1TTZA 4XTSA 3K8NA 2VKZG 2P31A 2HSMA 3SBCA 5JCUA 4AJ7A 2RIIA 2KUCA 4DSQA 1VRSD 5KN1A 3KMNA 4NV2A 3O6TA 5G1LA 1XW5A 5LNKe 3F4SA 4K0GA 2VM2A 2WCIA 1O6JA 2L5LA 2H74A 2FWFA 1HNCA 3M0FA 2HRNA 1THXA 3DXBA 3KXOA 1GSDA 5G31A 1OVNA 4ICYA 4IS0A 3H8QA 2F8AA 1XOAA 2OBIA 4WR5A 1PA3A 1SD9A 4HDEA 4XS6A 3PINA 1J0FA 4MF5A 2I81A 1WWJA 4WR4A 3LXZA 1MD4A 2VLUA 2CV4A 3Q18A 3GRXA 3PGTA 3CSIA 1VF3A 1EGOA 3RBTA 5BMUA 1SJZA 1MTCA 2V6KA 2WJUA 2MMZA 1VF1A 2IJYA 2L59A 2R0PA 4TR4A 1T4YA 3VWUA 3IAS2 4TR1B 4J2FA 5F07A 3PH9A 4NV5A 2HYXA 1LJRA 2ON5A 4KCEA 1ZMAA 4ZB7A 1GUKA 1ACVA 1XWKA 1W89A 4MCUA 1X9WB 1K0MA 2IMDA 2X49A 4TXOB 2F3MA 3D4TA 4V2LA 1A0RP 4TKYA 2A2PA 2PERA 3GN3A 4GRFA 2WB9A 5ELAA 4CY6A 3RHCA 1EV9A 2K8SA 2GVPA 5A4VA 1GSQA 1EWXA 1OE7A 4QL7A 4L5OA 3MNGA 3PPUA 3IK9A 4AGSA 4PUFC 3GFKA 1Y25A 2FUG2 2CVBA 1OKTA 3US3A 5FWGA 4IVFA 2DBCA 1E2YA 3LJRA 5J9BA 4DVCA 2H1BA 1TXXA 1GSYA 3HD5A 3EC3A 2MBTA 18GSA 1HNAA 3M9KA 1OYJA 3F9UA 4F82A 4KSMA 1GNWA 4F2IA 4MK3A 3LQ7A 5CRDA 6GSYA 4L0UA 3ZVJD 4K7OA 2YZHA 3HA9A 2FWGA 3TKPA 1G6YA 2CVDA 5A1NB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YV7 A;  1EZK A;  5HFG A;  2LTK A;  2YWN A;  1Y6E A;  5DDL A;  2PPT A;  1A0F A;  2H19 A;  1V58 A;  1UC7 A;  2HRK B;  3ZVJ A;  3APO A;  3H1N A;  4MF6 A;  1M2B A;  1S3A A;  2JU5 A;  2D2Z A;  2B1L A;  4DSS A;  4G10 A;  3QAG A;  5ENU A;  1ABA A;  2L6D A;  6GST A;  3Q6O A;  2HSH A;  1Q98 A;  1JHB A;  3HVV A;  3C8E A;  4ECC A;  2VOC A;  1GSS A;  3G9B A;  5CRG A;  1XBS A;  3EYT A;  1K0C A;  4XRD A;  5IMZ A;  3DKS A;  2YCD A;  3UMA A;  2DIZ A;  2R4V A;  1T1V A;  2RM6 A;  4I97 A;  1ON4 A;  2KHP A;  2X99 A;  2IMF A;  2FA4 A;  3QPM A;  3QAW A;  3TJG A;  1TJD A;  3QAV A;  3GIX A;  1Z6N A;  2PVQ A;  4HQZ A;  2H6Z A;  2C3T A;  4GQF A;  4HUA A;  3P2A A;  4E8E A;  2H30 A;  1R4W A;  4POB A;  5D73 A;  1B9X C;  3A3T A;  4X0X A;  4EXJ A;  3IRA A;  4BL7 A;  4AJ8 A;  4IP1 A;  3RDW A;  1TRS A;  4TW5 A;  4MF7 A;  2WUL A;  2L4Q A;  5A4W A;  2VCQ A;  3KEB A;  2LST A;  5ECO B;  3HDC A;  4OWY A;  3LG6 A;  1SK0 A;  3GST A;  4IJI A;  2B3S A;  1TDI A;  2RM5 A;  5J3R A;  3ZZX A;  1QFN A;  1YEX A;  1ERU A;  1LU4 A;  3QCP A;  2LV3 A;  19GS A;  1XVQ A;  4WBR D;  3EU3 A;  4K9Z A;  2K6V A;  2LRC A;  4LMW A;  3M3M A;  4KDY A;  1JZW A;  3FR6 A;  2M80 A;  4O7H A;  4PQH A;  3ZRE A;  4KX4 A;  2OAC A;  2RUF A;  5CYY A;  3MDK A;  3FR3 A;  2V41 A;  5D96 A;  2VL3 A;  2WRT A;  1U87 A;  4MJB A;  1BQ7 A;  4RQR A;  2GSR A;  2YJH A;  4MLY A;  4EDY A;  1OC8 A;  4D73 B;  2L4C A;  4PUA A;  3TRX A;  2GSS A;  1THO A;  2VO4 A;  1RW1 A;  3DYR A;  4FYU A;  2ES7 A;  4HS1 A;  1QK8 A;  1YY7 A;  2QKE A;  3GL3 A;  3FZ9 A;  3RPN A;  1AAZ A;  2OAD A;  5D9T A;  5J4U A;  3H93 A;  1GP1 A;  2HZE B;  1GUL A;  3DWV A;  1X5D A;  3F4R A;  3TJK A;  1WE0 A;  3LSZ A;  4ZBA A;  5L71 A;  4MZC A;  2X8C A;  1GUH A;  3F3R A;  2GLR A;  1RK4 A;  1PX7 A;  1TKD B;  1F3A A;  1PRX A;  4DEJ A;  4KSO A;  3VLN A;  1R7H A;  4ZIJ A;  1SYR A;  3GH6 A;  3D22 A;  2H6Y A;  3GUS A;  1O8W A;  1J9B A;  2YWO A;  5IOX A;  3GA4 A;  2JZS A;  2B1K A;  4F9Z A;  3J7Y b;  1TI3 A;  5EPF A;  1UVZ A;  4H86 A;  2GQM A;  1XW9 A;  1BG5 A;  5DAK A;  4XCS A;  5DJM A;  4IHU A;  1M7T A;  2HSN B;  2H8L A;  4RUV A;  4K7I A;  2VD0 A;  2OE3 A;  4OFM A;  3NZN A;  2MMA A;  4KW6 A;  2XPE A;  1F37 A;  2G0F A;  1B4Q A;  2VCV A;  3DVX A;  4EO3 A;  4MZW A;  2REM A;  1TU7 A;  3D6I A;  2H1A A;  1O8X A;  3GYK A;  4WXT A;  1SL0 B;  2B5X A;  2YJ7 A;  3KTL A;  3H79 A;  2RLI A;  2HSY A;  3KCM A;  4WET A;  5AIS A;  2C1Y A;  2FWE A;  5ECQ B;  4YAV A;  1S3C A;  1U3A A;  3C73 A;  2OBK A;  1TK5 B;  1GTB A;  1AUC A;  2LQO A;  2WFC A;  2C4J A;  1ERW A;  4GCI A;  2CVK A;  1CQG A;  1YKA A;  2LEG A;  14GS A;  5AIX A;  1WPI A;  2VD1 A;  2K18 A;  3QFA C;  3S9F A;  3CMI A;  1FVJ A;  1X9S B;  3GKN A;  4JU5 A;  1U88 A;  4FO5 A;  1T8E B;  3D5J A;  1T7P B;  2QSI A;  1DE1 A;  5JWQ B;  1OC9 B;  5G1K A;  3M9J A;  2LJR A;  2P5Q A;  4MZB A;  5IMD A;  1O7U A;  4NMU A;  3GNJ A;  4KGI A;  4GSN A;  4HZ2 A;  3FEU A;  5G30 A;  2LNT A;  4GST A;  2HXK A;  2EC4 A;  4ECJ A;  1QUW A;  4IQA A;  3KH7 A;  1YF1 A;  1EV4 A;  2I9H A;  1V2A A;  3TKS E;  3M1G A;  1Z6M A;  4N0V A;  2GT6 A;  4MMM A;  5ECN B;  5GZZ B;  5DJL A;  5ECP B;  3VI7 A;  3PR8 A;  3GTU B;  1F6M C;  3BOA A;  1A2L A;  3L78 A;  5EL8 A;  2H66 A;  5HR3 A;  4FH8 A;  2KLX A;  2BTO T;  2PU9 C;  4OCE A;  5JWO B;  4ML6 A;  2JAD A;  2VM1 A;  4HEA 2;  3VWW A;  1X5C A;  3UJ1 A;  4LA1 A;  5DCH A;  3QFB C;  2JL4 A;  1A8L A;  2V32 A;  2FWH A;  4TR1 A;  2VIM A;  3ZRD A;  4NAX A;  1XOB A;  2AJQ B;  2H73 A;  1AXD A;  2K9F A;  2MBS A;  2J9H A;  3M8N A;  5ELG A;  3EE2 A;  3TDG A;  2TRX A;  4K1F A;  3TRP A;  3E3E A;  2FGX A;  2C3N A;  4TXO A;  3IA1 A;  4ECI A;  1EOH A;  4ZXG A;  3A2V A;  3GX0 A;  5ECK B;  5C00 A;  4OMV A;  1GSF A;  5H5S A;  2C0F A;  2K8V A;  4OFT A;  8GSS A;  1ILO A;  5KN3 A;  5H5Q A;  4YH2 A;  4NHZ A;  1X0R A;  4KCA A;  5KN0 A;  3ISO A;  1JZD A;  3IV4 A;  1S3D A;  1SD8 A;  5DVB A;  2GST A;  1ERV A;  3HVX A;  3EUR A;  4HQS A;  4QL9 A;  2P5R A;  4EC0 A;  1PL1 A;  4JR6 A;  4V2N A;  1ZOF A;  5IQY A;  3ZTL A;  1G7E A;  2IWT A;  5CRE A;  5D9X A;  1HNB A;  1B4P A;  1XWG A;  1USB A;  3ERG A;  1YKC A;  3TKR A;  3WGD A;  3GH9 A;  2O7K A;  5IPG A;  5A4U A;  3VPQ A;  3ME7 A;  3W8J A;  3KGK A;  1DSB A;  5HFK A;  5GAP D;  6GSS A;  2DC5 A;  4AF2 A;  2VCW A;  2L6C A;  5D9V A;  4WEY A;  3C1S A;  4Q5R A;  2O85 A;  3HZ8 A;  4IQ1 A;  1IYI A;  5ECM B;  3HZ4 A;  1TI1 A;  1XWA A;  1QGV A;  2O89 A;  2HRK A;  1FB6 A;  3ED3 A;  4BA7 A;  5IIZ A;  4MJC A;  1FO5 A;  4O5R A;  2LRT A;  4QQ7 A;  1XVW A;  2FA8 A;  4I2U A;  3WYW A;  3VUR A;  1K3O A;  3CRT A;  1K3Y A;  2DSA A;  4N30 A;  4TOP A;  4MAB A;  1DE2 A;  1V98 A;  3HXS A;  1PKW A;  2H72 A;  4NWY A;  4EKZ A;  1Q4J A;  1LBK A;  1PQN A;  5JCG A;  4X43 A;  4TRX A;  5ECH B;  2YN1 A;  4KND A;  1C72 A;  2YPM A;  2V1M A;  1AQX A;  5F06 A;  2HFD A;  3IDV A;  3WD6 A;  4MJE A;  2WZ9 A;  1E6B A;  4PTS A;  4ZL9 A;  3C71 A;  4CHS A;  1QQ2 A;  4KB3 A;  3UAR A;  1GTA A;  1FG4 A;  3ME8 A;  3QOU A;  2AAW A;  2VCX A;  3F6F A;  2DIY A;  3FRC A;  1GUM A;  1BED A;  4MA9 A;  4RQX A;  4GXZ A;  3TKQ A;  2YNX A;  4Q5Q A;  4GLT A;  2C8U A;  5A5K A;  3DVW A;  4FYB A;  4PUR A;  4LLR A;  2CZ2 A;  2OKA A;  1W4V A;  2GQK A;  1ML6 A;  5B6N A;  2IPA A;  1K0B A;  1A24 A;  1O85 A;  1PSQ A;  2C0D A;  1X9M B;  5CNW A;  2JZR A;  2PVO C;  4MPG A;  1Z9H A;  3VI5 A;  3LGC A;  22GS A;  3R2Q A;  4OO4 A;  17GS A;  2AUV A;  4PNF A;  1WIK A;  4ULX A;  4IKH A;  4ZIL A;  2GZY A;  5ID2 B;  3FR9 A;  2A4V A;  2H0I A;  3EWL A;  5ECR B;  4ILF A;  1X5E A;  4XS4 B;  3UAP A;  5J5N A;  5EVO A;  3KH9 A;  4BPY A;  6GSX A;  4OO5 A;  2DJJ A;  1Z7R A;  3ZL5 A;  1FB0 A;  1URM A;  4I6X A;  1XXU A;  4PQI A;  3FW2 A;  2GT5 A;  5ABR A;  2WGR A;  3ZFB A;  2MMO A;  3ZIV A;  5IO2 A;  3GHA A;  5G5F A;  3APS A;  5DQY A;  3HJO A;  3FZ4 A;  1M2D A;  4D73 A;  5DQS A;  4GSS A;  4KAE A;  3F0I A;  1I9D A;  5G5E A;  2HT9 A;  4G19 A;  2OJL A;  3I6A A;  4EDZ A;  2LJA A;  3WGE A;  1B48 A;  1RQM A;  4ZB6 A;  3A2X A;  3UVT A;  3CTF A;  3GKM A;  1KNG A;  1NW2 A;  2C0G A;  4TR0 A;  3IBH A;  3LYK A;  2HZE A;  1SK1 A;  4F03 A;  1HD2 A;  3IXR A;  1CQH A;  1TOF A;  2DJ1 A;  2HNL A;  3DIE A;  1QXH A;  1GLP A;  20GS A;  2WS2 A;  1EEM A;  4NXI A;  3I9V 2;  1ERT A;  1BAY A;  1O73 A;  3CBU A;  1ST9 A;  16GS A;  4BVX B;  2GS3 A;  5E4W A;  3E0U A;  4K8M A;  1FVK A;  2V6O A;  3LOR A;  4POK A;  4XS1 A;  1F3B A;  3HJM A;  3FZA A;  1JLW A;  5F0G A;  5IMF A;  3IOS A;  3DML A;  5DAL B;  4TVE A;  4NHW A;  4FIW A;  1SKR B;  3AY8 A;  3O3T A;  6GSV A;  1GSU A;  1AQV A;  3HCZ A;  1SU9 A;  4BWQ A;  3ZMK A;  2GZZ A;  7GSS A;  4Z7X A;  3MAK A;  2N5A A;  1R26 A;  2N5F A;  2KOK A;  4XHM A;  1A2J A;  1VF2 A;  4K2D A;  2O87 A;  5H5R A;  4TXV A;  1R5A A;  3TGZ A;  3I69 A;  3W8S A;  1AQW A;  5COH A;  4KH7 A;  5LD0 A;  4F0B A;  3P7X A;  4J56 E;  1PD2 1;  2H0G A;  4KUN A;  5CO3 A;  4BVY B;  1PGT A;  3Q19 A;  4EVM A;  1K0O A;  4KF9 A;  1KBN A;  1PKZ A;  1M99 A;  4KDU A;  2KP1 A;  2LRN A;  1ZZY A;  2BMX A;  4GTU A;  4TN8 A;  4ZBD A;  1ZGN A;  2DJ3 A;  3ZIT A;  2C80 A;  5INY A;  2FD3 A;  2H75 A;  4LMV A;  4NPB A;  4MDC A;  3RPP A;  5JWR B;  5IM9 A;  2AHE A;  2PWJ A;  3EMP A;  6GSW A;  2HRF A;  4KDX A;  3MWH A;  2CQ9 A;  1TK0 B;  1JFU A;  3APQ A;  2KP2 A;  2OA7 A;  3F3Q A;  3N5O A;  4FQU A;  4MH3 A;  2NDO A;  3LEF A;  5HQP A;  3VWV A;  4ACS A;  3G7I A;  2ZCT A;  3LFL A;  1OC9 A;  2CAQ A;  4ISD A;  2IFQ B;  4JR4 A;  2E0Q A;  4G2E A;  3ZLP A;  2A2R A;  2XHF A;  3CRU A;  1OE8 A;  5IMV A;  1UN2 A;  4K7N A;  4K6X A;  2I1U A;  2IME A;  4EUY A;  4IP6 A;  2LQQ A;  3F8U A;  1M0U A;  2GGT A;  5IPH A;  3FK8 A;  1KTE A;  5D93 A;  1NSW A;  2CT6 A;  1NM3 A;  4HU7 A;  2ON7 A;  1F2E A;  3A2W A;  2QC7 A;  1I5G A;  3J7Y k;  2E7P A;  2HQT A;  3GTU A;  1TRV A;  2VCT A;  1ZYE A;  1MDJ A;  3LXT A;  2H76 A;  3O76 A;  2XBI A;  3IK7 A;  3UVH A;  4YAP A;  2VL9 A;  4N0Z A;  1U3I A;  3QD9 A;  2AB6 A;  1IYH A;  4LL1 B;  1MDK A;  1GNE A;  1EOG A;  1B9Y C;  3IC4 A;  4OFN A;  4PX1 A;  3OR5 A;  5DCG A;  3D0Z A;  2JZT A;  2BJX A;  3U6V A;  4GWR A;  1PX6 A;  4Q5F A;  4USS A;  3VWX A;  4IW9 A;  5F8B A;  1T00 A;  1G0T A;  3I43 A;  3DD3 A;  2H70 A;  2VLV A;  5EY6 A;  2L5O A;  1SJI A;  1TK8 B;  1FHE A;  1FAA A;  3VFI A;  2V2G A;  1Z5Y E;  2HSM B;  2M72 A;  1O81 A;  4V1A g;  3TOU A;  3L9V A;  4MP4 A;  3CSJ A;  3GV1 A;  2B5Y A;  6GSU A;  2G2Q A;  2E2M A;  3KMO A;  5ECI B;  4ML1 A;  11GS A;  3JCM L;  3BJ5 A;  3HY2 A;  13GS A;  4RI6 A;  2R5G A;  2EIO A;  4O92 A;  3EIN A;  1QMV A;  2X8H A;  3ERF A;  2VUP A;  1V57 A;  1XCC A;  2B7J A;  2H0H A;  3DRN A;  2FNO A;  2IN3 A;  3HKR A;  2R3X A;  1OAZ A;  2IMK A;  3UL3 A;  1U6T A;  1VF4 A;  3F4T A;  4HU9 A;  5ECL B;  4LL4 B;  3IC8 A;  3FY7 A;  2R37 A;  1FOV A;  3L9U A;  3HVS A;  4G9H A;  4ZB9 A;  1XWC A;  4PQ1 A;  1YQ1 A;  3BCI A;  3WT1 A;  2HI7 A;  2VL2 C;  4ID0 A;  3TUE A;  1NHY A;  2HZF A;  5D9W A;  1DUG A;  3F6D A;  1N2A A;  4POM A;  3TJJ A;  3C1R A;  3CXG A;  3IR4 A;  1SL2 B;  1PL2 A;  1OKD A;  3BCK A;  2PMT A;  1OC3 A;  5AGY A;  1G7O A;  3VK9 A;  3U5R E;  1JZR A;  5J9C A;  4WKW A;  2R2J A;  5LCZ A;  1YDK A;  3DGQ A;  2HRA A;  5B7C A;  2GQL A;  3ZYW A;  1J08 A;  3GL5 A;  4JRR A;  5FT3 A;  2NTO A;  1HQO A;  4PGT A;  3NOF A;  2J23 A;  2NVL A;  1A23 A;  5GAN D;  2NPB A;  5CAX A;  2XPD A;  1GSE A;  1AC1 A;  3N9J A;  5E59 A;  4EE0 A;  2DML A;  1XIY A;  5KN2 A;  2VAF A;  5AIV A;  2GTU A;  2GZP A;  1M9B A;  4V2M A;  3FHK A;  2B7K A;  2H1G A;  1KEB A;  2NBS A;  3F63 A;  1UA5 A;  1GWC A;  5F05 A;  4HOJ A;  3QMX A;  2YAN A;  3RHB A;  2TIR A;  1BYE A;  4FYC A;  2I3Y A;  2VCZ A;  2YWM A;  2H1D A;  2YOI A;  2H6X A;  4DSS B;  3TB2 A;  1WMJ A;  2HLS A;  1TRW A;  5D8I A;  1YZX A;  5HR2 A;  3ZML A;  5IMC A;  1GLQ A;  1ZCP A;  2LJK A;  2P0G A;  2FCH A;  2VL2 A;  3GMF A;  4MPF A;  1DBY A;  4ECB A;  1H4O A;  2ZNM A;  1XPV A;  4G0K A;  1PN9 A;  2E2G A;  2YV9 A;  5ID2 A;  4L8E A;  2N5B A;  1SYX A;  5B6M A;  1M2A A;  4XS4 A;  2AV4 A;  4E8H A;  2JSZ A;  4ZBB A;  2C0E A;  4N10 A;  3W6G A;  3CYN A;  1TW9 A;  3UEM A;  3EU4 A;  3LYP A;  5JCW A;  4RI7 A;  4KA0 A;  3NIV A;  3G7Y A;  2DMM A;  2F51 A;  2FHE A;  5AN1 A;  1WJK A;  4YQU A;  4JED A;  1EP7 A;  10GS A;  4BL7 B;  1JZO A;  3QR6 A;  5B8B A;  5DBQ A;  1AW9 A;  1F9M A;  4G0I A;  3TOT A;  3GKK A;  3UBL A;  4IGJ A;  3E9J B;  3GX8 A;  1XZO A;  2GSQ A;  2MYG A;  4WF5 A;  4OD7 A;  2CX3 A;  1TRU A;  1SKW B;  5J41 A;  1HYU A;  1Z3E A;  4EF0 A;  5KEJ A;  3CTG A;  9GSS A;  1GTI A;  3KM6 A;  2EIQ A;  2VLT A;  4KE3 A;  3KD0 A;  3KZQ A;  3TCO A;  3MSZ A;  3BBY A;  4GF0 A;  4HJ2 A;  4V1A p;  4O32 A;  1XW6 A;  1WP0 A;  2WDU A;  4MH2 A;  3EMX A;  1BJX A;  3IPZ A;  1T3B A;  2L57 A;  1SKS B;  2JAC A;  5FHI A;  3H4K A;  3D21 A;  5GSS A;  3QDN A;  12GS A;  3KP8 A;  3D4M A;  1T4Z A;  1YJ6 A;  2DLX A;  1YEP A;  3L0H A;  4BVX A;  4HI7 A;  2CX4 A;  2GDR A;  3KP9 A;  1K0N A;  3WT2 A;  4L0W A;  3ERW A;  2MMN A;  2H71 A;  3FZ5 A;  3HYP A;  3TRQ A;  2LUS A;  2R6K A;  5IMA A;  1SEN A;  3IE3 A;  3FYG A;  5DAL A;  4J57 E;  1FW1 A;  3GKX A;  1XWB A;  4TR3 A;  3TJB A;  4I5Q A;  3VPT A;  2X8G A;  4ZL7 A;  1WOU A;  2FY6 A;  1GRX A;  2DJ2 A;  4I8B A;  1TU8 A;  4AJ6 A;  2Z9S A;  1AIU A;  4ZB8 A;  2DJK A;  1K3L A;  3IAM 2;  1EEJ A;  1MDI A;  3C7M A;  1A8Y A;  1YF0 A;  4PNG A;  1K0A A;  2XBQ A;  1EP8 A;  3HJP A;  2B6M A;  2PGT A;  2ZUP A;  5ECS A;  2UZ8 A;  3G7J A;  1R5P A;  2X64 A;  1JLV A;  1WRY A;  1N8J A;  3A5W A;  5HR1 A;  2ALB A;  1B8X A;  1TP9 A;  2EIR A;  3Q74 A;  5CRW A;  4BVY A;  1GH2 A;  4GQC A;  2AYT A;  2TRC P;  3DEX A;  2M46 A;  3TKS C;  3KTB A;  2HE3 A;  5CRH A;  1A2M A;  2B5E A;  1G6W A;  3GSS A;  4I2T A;  2PN8 A;  4CDO A;  4XIH A;  2QGV A;  2CA8 A;  4K0N A;  4BWS A;  4IBP A;  3KJY A;  3SWL A;  4WF4 A;  1K0D A;  3L4N A;  3V1W A;  3L9S A;  5GST A;  2JSY A;  3BD2 A;  1GL8 A;  2MZC A;  2CZ3 A;  3FKF A;  3EVI A;  2LNS A;  2YP6 A;  4IJ3 A;  4X1U A;  2YWI A;  5DAK B;  4OCF A;  1EGR A;  1GTU A;  4F0C A;  1M9A A;  2LKU A;  3ZIJ A;  1V9W A;  3UBK A;  1ZL9 A;  3CSH A;  4XRA A;  4POL A;  2IFQ A;  2XC2 A;  2IL3 A;  2A2S A;  4WBJ A;  4EL1 A;  4PXO A;  2PUK C;  4YQV A;  3WGX A;  5CP1 A;  3P90 A;  2OE1 A;  4Q5N A;  3IHQ A;  2IIY A;  4ZL8 A;  4CW9 A;  2OE0 A;  2DJ0 A;  3HHV A;  4IN0 A;  4L5L A;  4HJM A;  2CAI A;  3LWA A;  3UIW A;  2YZU A;  1BX9 A;  5G2Z A;  4JE1 A;  4N11 A;  5HR0 A;  2C3Q A;  2PBJ A;  4G0L A;  4JBB A;  1XFL A;  5C04 A;  5IOW A;  2LS5 A;  1SK2 A;  2FLS A;  1SJ6 A;  4DSR A;  4JZQ A;  1NHO A;  1ZYQ B;  1H75 A;  2F8F A;  5HFI A;  4MJA A;  3TKS A;  5B8A A;  4YQM A;  1PMT A;  1Z7P A;  3GUR A;  1SL1 B;  2RUE A;  5IO0 A;  2IMI A;  1MEK A;  3KIJ A;  2O8V B;  3ZFL A;  4IEL A;  1VGL A;  3R3E A;  4HZ4 A;  2F9S A;  1MD3 A;  3UOM A;  1V40 A;  3TJF A;  2I4A A;  4P3Y B;  3RAZ A;  2H01 A;  3P8W A;  1TTZ A;  4XTS A;  3K8N A;  2P31 A;  2HSM A;  3SBC A;  5JCU A;  4AJ7 A;  2RII A;  2KUC A;  4DSQ A;  1VRS D;  5KN1 A;  3KMN A;  4NV2 A;  3O6T A;  5G1L A;  1XW5 A;  5LNK e;  3F4S A;  4K0G A;  2VM2 A;  2WCI A;  1O6J A;  2L5L A;  2H74 A;  2FWF A;  1HNC A;  3M0F A;  2HRN A;  1THX A;  3DXB A;  3KXO A;  1GSD A;  5G31 A;  1OVN A;  4IS0 A;  3H8Q A;  2F8A A;  1XOA A;  2OBI A;  4WR5 A;  1PA3 A;  1SD9 A;  4HDE A;  4XS6 A;  3PIN A;  1J0F A;  4MF5 A;  2I81 A;  1WWJ A;  4WR4 A;  3LXZ A;  1MD4 A;  2VLU A;  2CV4 A;  3Q18 A;  3GRX A;  3PGT A;  3CSI A;  1VF3 A;  1EGO A;  3RBT A;  5BMU A;  1SJZ A;  1MTC A;  2V6K A;  2WJU A;  2MMZ A;  1VF1 A;  2IJY A;  2L59 A;  4TR4 A;  1T4Y A;  3VWU A;  3IAS 2;  4TR1 B;  4J2F A;  5F07 A;  3PH9 A;  4NV5 A;  2HYX A;  1LJR A;  2ON5 A;  4KCE A;  1ZMA A;  1GUK A;  1ACV A;  1XWK A;  1W89 A;  4MCU A;  1X9W B;  1K0M A;  2IMD A;  4TXO B;  2F3M A;  3D4T A;  4V2L A;  1A0R P;  4TKY A;  2PER A;  3GN3 A;  4GRF A;  2WB9 A;  5ELA A;  3RHC A;  1EV9 A;  2K8S A;  2GVP A;  5A4V A;  1GSQ A;  1EWX A;  1OE7 A;  4QL7 A;  4L5O A;  3MNG A;  3PPU A;  3IK9 A;  4AGS A;  4PUF C;  3GFK A;  1Y25 A;  2FUG 2;  2CVB A;  1OKT A;  3US3 A;  5FWG A;  4IVF A;  2DBC A;  1E2Y A;  3LJR A;  5J9B A;  4DVC A;  2H1B A;  1TXX A;  1GSY A;  3HD5 A;  3EC3 A;  2MBT A;  18GS A;  1HNA A;  3M9K A;  1OYJ A;  3F9U A;  4F82 A;  4KSM A;  1GNW A;  4F2I A;  4MK3 A;  3LQ7 A;  5CRD A;  6GSY A;  4L0U A;  3ZVJ D;  4K7O A;  2YZH A;  3HA9 A;  2FWG A;  3TKP A;  1G6Y A;  2CVD A; 
#chains in the Genus database with same CATH topology
 2YV7 A;  1EZK A;  5HFG A;  2LTK A;  2YWN A;  1Y6E A;  5DDL A;  2PPT A;  1A0F A;  2H19 A;  5A5H A;  1V58 A;  1UC7 A;  2HRK B;  3ZVJ A;  3APO A;  3H1N A;  4MF6 A;  1M2B A;  1S3A A;  2JU5 A;  2D2Z A;  2B1L A;  3MYD A;  4DSS A;  4G10 A;  3QAG A;  5ENU A;  1ABA A;  1M3J A;  2L6D A;  6GST A;  3Q6O A;  2HSH A;  1Q98 A;  1JHB A;  3HVV A;  3C8E A;  4ECC A;  2VOC A;  1GSS A;  3G9B A;  5CRG A;  1XBS A;  3EYT A;  1K0C A;  1Y1U A;  4XRD A;  5IMZ A;  3DKS A;  2YCD A;  3UMA A;  2DIZ A;  2R4V A;  1T1V A;  2RM6 A;  4I97 A;  1ON4 A;  2KHP A;  2X99 A;  2IMF A;  2FA4 A;  3QPM A;  3QAW A;  3TJG A;  1TJD A;  3QAV A;  3GIX A;  1Z6N A;  2PVQ A;  4HQZ A;  2H6Z A;  2C3T A;  4GQF A;  4HUA A;  3RFR C;  3P2A A;  4E8E A;  2H30 A;  1R4W A;  4POB A;  5D73 A;  1B9X C;  3A3T A;  4X0X A;  4EXJ A;  3IRA A;  4BL7 A;  4AJ8 A;  4IP1 A;  3RDW A;  1TRS A;  4W66 A;  4TW5 A;  4MF7 A;  2WUL A;  2L4Q A;  5A4W A;  2VCQ A;  3KEB A;  2LST A;  3RGB C;  5ECO B;  3HDC A;  4OWY A;  3LG6 A;  1SK0 A;  3GST A;  4IJI A;  2B3S A;  1TDI A;  2RM5 A;  5J3R A;  3ZZX A;  1QFN A;  1YEX A;  1ERU A;  1LU4 A;  3QCP A;  2LV3 A;  19GS A;  1XVQ A;  4WBR D;  3EU3 A;  4K9Z A;  2K6V A;  2LRC A;  4LMW A;  3M3M A;  4KDY A;  1JZW A;  3FR6 A;  2M80 A;  4O7H A;  4PQH A;  3ZRE A;  4KX4 A;  2OAC A;  2RUF A;  4K2X A;  5CYY A;  3MDK A;  5KOW A;  3FR3 A;  2V41 A;  5D96 A;  2VL3 A;  2WRT A;  1U87 A;  3CQF A;  4MJB A;  1BQ7 A;  4RQR A;  2GSR A;  2YJH A;  4MLY A;  4EDY A;  1OC8 A;  2QA1 A;  4D73 B;  2L4C A;  4PUA A;  3TRX A;  2GSS A;  1THO A;  2VO4 A;  1RW1 A;  3DYR A;  4FYU A;  3LW9 A;  2ES7 A;  4HS1 A;  1QK8 A;  4EIQ A;  1YY7 A;  2QKE A;  3GL3 A;  3FZ9 A;  3RPN A;  2WVY A;  1AAZ A;  2OAD A;  5D9T A;  5J4U A;  3H93 A;  1GP1 A;  2HZE B;  1GUL A;  3DWV A;  1X5D A;  3F4R A;  3TJK A;  1WE0 A;  3LSZ A;  4ZBA A;  5L71 A;  4MZC A;  2X8C A;  1GUH A;  3F3R A;  2GLR A;  1RK4 A;  1PX7 A;  1TKD B;  1F3A A;  1PRX A;  4DEJ A;  4KSO A;  4Z2R A;  3VLN A;  1R7H A;  4HSC X;  4ZIJ A;  1SYR A;  3GH6 A;  3D22 A;  2H6Y A;  3TU3 B;  3GUS A;  1O8W A;  5BRT A;  2WW1 A;  1J9B A;  2YWO A;  5IOX A;  3GA4 A;  2JZS A;  2B1K A;  4F9Z A;  3J7Y b;  1TI3 A;  2DKH A;  5EPF A;  1UVZ A;  4H86 A;  2GQM A;  1XW9 A;  1BG5 A;  5DAK A;  4XCS A;  5DJM A;  4IHU A;  1M7T A;  2HSN B;  2H8L A;  4RUV A;  4K7I A;  2VD0 A;  2OE3 A;  4OFM A;  5J47 A;  3NZN A;  2MMA A;  4KW6 A;  2XPE A;  1F37 A;  2G0F A;  1B4Q A;  2VCV A;  3DVX A;  4EO3 A;  4MZW A;  2REM A;  1TU7 A;  3D6I A;  2H1A A;  1O8X A;  3GYK A;  4WXT A;  1SL0 B;  2B5X A;  2YJ7 A;  3KTL A;  3H79 A;  2RLI A;  1TXU A;  2HSY A;  3KCM A;  4WET A;  5AIS A;  2C1Y A;  2FWE A;  5ECQ B;  4YAV A;  1S3C A;  1U3A A;  2EFH A;  3C73 A;  2OBK A;  1TK5 B;  1GTB A;  1AUC A;  1N25 A;  2LQO A;  2WFC A;  2C4J A;  1ERW A;  4GCI A;  2CVK A;  1CQG A;  1YKA A;  2LEG A;  14GS A;  5AIX A;  1WPI A;  2VD1 A;  2K18 A;  3QFA C;  3S9F A;  3CMI A;  1FVJ A;  1X9S B;  3GKN A;  4JU5 A;  1U88 A;  4FO5 A;  1T8E B;  3D5J A;  1T7P B;  2QSI A;  2QA2 A;  1DE1 A;  5JWQ B;  1OC9 B;  5G1K A;  4Z2U A;  3M9J A;  2LJR A;  2P5Q A;  4MZB A;  5IMD A;  1O7U A;  4NMU A;  2O36 A;  4K5R A;  3GNJ A;  4KGI A;  4GSN A;  4HZ2 A;  3FEU A;  5G30 A;  3HVN A;  2LNT A;  4GST A;  2HXK A;  2EC4 A;  4ECJ A;  1QUW A;  4IQA A;  3KH7 A;  1YF1 A;  1EV4 A;  2I9H A;  1V2A A;  3TKS E;  3M1G A;  1Z6M A;  4N0V A;  2GT6 A;  4MMM A;  5ECN B;  5GZZ B;  5DJL A;  5ECP B;  3VI7 A;  3PR8 A;  3GTU B;  1F6M C;  4G01 A;  3BOA A;  1A2L A;  3L78 A;  5EL8 A;  2H66 A;  3FMW A;  5HR3 A;  4N3Z A;  4FH8 A;  2KLX A;  2BTO T;  2PU9 C;  4OCE A;  5JWO B;  4ML6 A;  3A5I A;  2JAD A;  2VM1 A;  4HEA 2;  3VWW A;  1X5C A;  3UJ1 A;  4LA1 A;  5DCH A;  3QFB C;  2JL4 A;  1A8L A;  2V32 A;  2FWH A;  4TR1 A;  2VIM A;  3ZRD A;  4NAX A;  1XOB A;  2AJQ B;  2H73 A;  1AXD A;  2K9F A;  2MBS A;  2J9H A;  3M8N A;  5ELG A;  3EE2 A;  3TDG A;  2TRX A;  4K1F A;  3TRP A;  3E3E A;  2FGX A;  2C3N A;  4TXO A;  3IA1 A;  4ECI A;  1EOH A;  4ZXG A;  3A2V A;  3GX0 A;  5ECK B;  5C00 A;  4OMV A;  1GSF A;  5H5S A;  2C0F A;  2K8V A;  4OFT A;  8GSS A;  1ILO A;  5KN3 A;  5H5Q A;  4YH2 A;  4NHZ A;  2O3E A;  1X0R A;  4KCA A;  5KN0 A;  3ISO A;  1JZD A;  3IV4 A;  1S3D A;  1SD8 A;  5DVB A;  2GST A;  1ERV A;  3HVX A;  3EUR A;  4HQS A;  4QL9 A;  2P5R A;  4EC0 A;  1PL1 A;  4JR6 A;  2EFE A;  4V2N A;  1ZOF A;  5IQY A;  3ZTL A;  1G7E A;  2IWT A;  5CRE A;  5D9X A;  1HNB A;  1B4P A;  1XWG A;  4PI2 C;  1USB A;  3ERG A;  1YKC A;  3TKR A;  3WGD A;  3GH9 A;  5J4Y A;  2O7K A;  5IPG A;  5A4U A;  3VPQ A;  3ME7 A;  3W8J A;  3KGK A;  1DSB A;  5HFK A;  5GAP D;  6GSS A;  2DC5 A;  4AF2 A;  2VCW A;  5A1N A;  2L6C A;  5D9V A;  4WEY A;  3C1S A;  4Q5R A;  2O85 A;  3HZ8 A;  4IQ1 A;  1IYI A;  2A4H A;  5ECM B;  3HZ4 A;  1TI1 A;  1XWA A;  1QGV A;  2O89 A;  2HRK A;  1FB6 A;  3ED3 A;  4BA7 A;  5IIZ A;  4MJC A;  1FO5 A;  4O5R A;  2LRT A;  4QQ7 A;  1XVW A;  2FA8 A;  4I2U A;  3WYW A;  3VUR A;  1K3O A;  3CRT A;  1K3Y A;  2DSA A;  4N30 A;  4TOP A;  4MAB A;  1DE2 A;  1V98 A;  3HXS A;  1PKW A;  2H72 A;  4NWY A;  4EKZ A;  1Q4J A;  1LBK A;  1PQN A;  5JCG A;  4X43 A;  4TRX A;  5ECH B;  2YN1 A;  4KND A;  1C72 A;  2YPM A;  2V1M A;  1AQX A;  5F06 A;  2HFD A;  3IDV A;  3WD6 A;  4MJE A;  2WZ9 A;  1E6B A;  4PTS A;  4ZL9 A;  3C71 A;  4CHS A;  1QQ2 A;  3UAR A;  4KB3 A;  1GTA A;  1FG4 A;  3ME8 A;  3QOU A;  2AAW A;  2VCX A;  4MNN A;  3F6F A;  2DIY A;  3FRC A;  1GUM A;  1BED A;  4MA9 A;  4RQX A;  4GXZ A;  3TKQ A;  2YNX A;  4Q5Q A;  4GLT A;  2C8U A;  5A5K A;  3DVW A;  4FYB A;  4PUR A;  4LLR A;  2CZ2 A;  2OKA A;  1W4V A;  4X4J A;  2GQK A;  1ML6 A;  5B6N A;  2IPA A;  1K0B A;  1A24 A;  1O85 A;  1PSQ A;  2C0D A;  1X9M B;  5CNW A;  2JZR A;  2PVO C;  4MPG A;  1Z9H A;  3VI5 A;  3LGC A;  22GS A;  3R2Q A;  4OO4 A;  17GS A;  2AUV A;  4PNF A;  1WIK A;  4ULX A;  4IKH A;  4ZIL A;  2GZY A;  5ID2 B;  3FR9 A;  2A4V A;  2H0I A;  3EWL A;  5ECR B;  4ILF A;  1X5E A;  4XS4 B;  3UAP A;  5J5N A;  5EVO A;  3KH9 A;  4BPY A;  6GSX A;  4OO5 A;  2DJJ A;  1Z7R A;  3ZL5 A;  1FB0 A;  1URM A;  4I6X A;  1XXU A;  4PQI A;  3FW2 A;  2GT5 A;  5ABR A;  2WGR A;  3ZFB A;  4PHZ C;  2MMO A;  3ZIV A;  5IO2 A;  3GHA A;  5G5F A;  3APS A;  5DQY A;  3HJO A;  3FZ4 A;  1M2D A;  4D73 A;  5DQS A;  4GSS A;  4KAE A;  3F0I A;  1I9D A;  5G5E A;  2HT9 A;  4G19 A;  2OJL A;  3I6A A;  4EDZ A;  2LJA A;  3WGE A;  1B48 A;  1RQM A;  4ZB6 A;  3MIX A;  3A2X A;  3UVT A;  3CTF A;  3GKM A;  4K5S A;  1KNG A;  1NW2 A;  3IHG A;  2C0G A;  4TR0 A;  3IBH A;  3LYK A;  2HZE A;  1SK1 A;  4F03 A;  1HD2 A;  3IXR A;  1CQH A;  1TOF A;  2DJ1 A;  2HNL A;  3DIE A;  1QXH A;  1GLP A;  20GS A;  2WS2 A;  1EEM A;  4NXI A;  3I9V 2;  1ERT A;  1BAY A;  1O73 A;  3CBU A;  1ST9 A;  16GS A;  4BVX B;  2GS3 A;  5E4W A;  3E0U A;  4K8M A;  1FVK A;  2V6O A;  3LOR A;  4POK A;  4XS1 A;  1F3B A;  2WW3 A;  3HJM A;  3FZA A;  1JLW A;  5F0G A;  5IMF A;  3IOS A;  1S3R A;  3DML A;  5DAL B;  4TVE A;  4NHW A;  4FIW A;  1SKR B;  3AY8 A;  3O3T A;  6GSV A;  1GSU A;  1AQV A;  3HCZ A;  1SU9 A;  4BWQ A;  3ZMK A;  2GZZ A;  2HSN A;  7GSS A;  4Z7X A;  3MAK A;  2N5A A;  1R26 A;  2N5F A;  2KOK A;  4XHM A;  1A2J A;  1VF2 A;  2R0C A;  4K2D A;  2O87 A;  5H5R A;  4TXV A;  1R5A A;  3TGZ A;  3I69 A;  3W8S A;  1AQW A;  5COH A;  1S4B P;  4KH7 A;  5LD0 A;  4F0B A;  3P7X A;  4J56 E;  1PD2 1;  2H0G A;  4KUN A;  5CO3 A;  4BVY B;  1PGT A;  3Q19 A;  4EVM A;  1K0O A;  4KF9 A;  1KBN A;  1PKZ A;  1M99 A;  4KDU A;  2KP1 A;  2WZS A;  2LRN A;  1ZZY A;  2BMX A;  1M3I A;  4GTU A;  4TN8 A;  4ZBD A;  1ZGN A;  1ZYN A;  2DJ3 A;  3ZIT A;  2C80 A;  5INY A;  2FD3 A;  2H75 A;  4LMV A;  4NPB A;  4MDC A;  3RPP A;  2WVX B;  5JWR B;  5IM9 A;  2AHE A;  2PWJ A;  3EMP A;  6GSW A;  2HRF A;  4KDX A;  4EIP A;  3MWH A;  2CQ9 A;  1TK0 B;  1JFU A;  3APQ A;  1SVO A;  2KP2 A;  2OA7 A;  3F3Q A;  4O5Q A;  3N5O A;  4FQU A;  4MH3 A;  2NDO A;  3LEF A;  5HQP A;  3VWV A;  4ACS A;  3G7I A;  2WVZ A;  2ZCT A;  3LFL A;  1OC9 A;  2CAQ A;  4ISD A;  2IFQ B;  4JR4 A;  2E0Q A;  4G2E A;  3ZLP A;  2A2R A;  2XHF A;  3CRU A;  1OE8 A;  4AKG A;  5IMV A;  1UN2 A;  4K7N A;  4K6X A;  2I1U A;  2IME A;  4EUY A;  1XG8 A;  4IP6 A;  2LQQ A;  3F8U A;  1M0U A;  2GGT A;  5IPH A;  3FK8 A;  1KTE A;  5D93 A;  4YKG A;  1NSW A;  2CT6 A;  1NM3 A;  4HU7 A;  2ON7 A;  1F2E A;  3A2W A;  2QC7 A;  5A34 B;  1I5G A;  3J7Y k;  2E7P A;  2HQT A;  3GTU A;  1TRV A;  2VCT A;  1ZYE A;  1MDJ A;  3LXT A;  2H76 A;  3O76 A;  1I1I P;  2XBI A;  3IK7 A;  3UVH A;  4YAP A;  2VL9 A;  4QMK A;  4N0Z A;  1U3I A;  3QD9 A;  2AB6 A;  1IYH A;  4LL1 B;  1MDK A;  1GNE A;  1EOG A;  1B9Y C;  3CHX C;  3IC4 A;  4OFN A;  4PX1 A;  3OR5 A;  5DCG A;  3D0Z A;  2JZT A;  2BJX A;  3U6V A;  4GWR A;  1PX6 A;  4Q5F A;  4USS A;  3VWX A;  4IW9 A;  5F8B A;  1T00 A;  1G0T A;  3I43 A;  3DD3 A;  2H70 A;  2VLV A;  5EY6 A;  5KOX A;  2L5O A;  1SJI A;  1TK8 B;  4O5U A;  1FHE A;  1FAA A;  3VFI A;  2V2G A;  1Z5Y E;  2HSM B;  2M72 A;  1O81 A;  4V1A g;  3TOU A;  3L9V A;  1BG1 A;  4MP4 A;  3CSJ A;  3GV1 A;  2B5Y A;  6GSU A;  2G2Q A;  2E2M A;  3KMO A;  5ECI B;  4ML1 A;  11GS A;  3JCM L;  3BJ5 A;  3HY2 A;  13GS A;  1YEW C;  4RI6 A;  2R5G A;  2EIO A;  4O92 A;  5J40 A;  3EIN A;  1QMV A;  2X8H A;  3ERF A;  2VUP A;  1V57 A;  1XCC A;  2B7J A;  2H0H A;  2EFD A;  2FNO A;  3DRN A;  1YVL A;  2IN3 A;  3HKR A;  2R3X A;  2WW0 A;  1OAZ A;  2IMK A;  3UL3 A;  5BMU B;  1VF4 A;  1U6T A;  3F4T A;  5ECL B;  2UV8 G;  4HU9 A;  4LL4 B;  3IC8 A;  3FY7 A;  2R37 A;  1FOV A;  3L9U A;  3HVS A;  4G9H A;  4ZB9 A;  1XWC A;  4PQ1 A;  1YQ1 A;  3BCI A;  3WT1 A;  2HI7 A;  2VL2 C;  2DKI A;  4ID0 A;  3TUE A;  1NHY A;  2HZF A;  5D9W A;  1DUG A;  3F6D A;  1N2A A;  4POM A;  3TJJ A;  3CXG A;  3C1R A;  3IR4 A;  1SL2 B;  1PL2 A;  1OKD A;  3BCK A;  2PMT A;  1OC3 A;  2X4A A;  1SVL A;  5AGY A;  1G7O A;  3VK9 A;  3HMJ G;  3U5R E;  1JZR A;  5J9C A;  4WKW A;  2R2J A;  5LCZ A;  1YDK A;  3DGQ A;  2HRA A;  5B7C A;  2GQL A;  3ZYW A;  1J08 A;  3GL5 A;  4JRR A;  5FT3 A;  2NTO A;  1HQO A;  4PGT A;  3NOF A;  2J23 A;  2NVL A;  1A23 A;  5GAN D;  2NPB A;  5CAX A;  2XPD A;  1GSE A;  1AC1 A;  3N9J A;  5E59 A;  4AKI A;  4EE0 A;  2DML A;  1XIY A;  5KN2 A;  2VAF A;  5AIV A;  2GTU A;  2GZP A;  4A5P A;  1M9B A;  4V2M A;  3FHK A;  2B7K A;  2H1G A;  1KEB A;  2NBS A;  3F63 A;  1UA5 A;  1GWC A;  1PFO A;  1SVM A;  5F05 A;  4HOJ A;  3QMX A;  2YAN A;  3RHB A;  2TIR A;  3CWG A;  5A5H B;  1BYE A;  4FYC A;  2I3Y A;  2VCZ A;  2YWM A;  2H1D A;  2YOI A;  2H6X A;  4DSS B;  3TB2 A;  1WMJ A;  2HLS A;  1TRW A;  5D8I A;  1YZX A;  5HR2 A;  3ZML A;  5IMC A;  1GLQ A;  1ZCP A;  2LJK A;  2P0G A;  2FCH A;  2VL2 A;  3GMF A;  4MPF A;  1DBY A;  4ECB A;  1H4O A;  2ZNM A;  1XPV A;  4G0K A;  1PN9 A;  2E2G A;  2YV9 A;  5ID2 A;  4L8E A;  2N5B A;  1SYX A;  5B6M A;  1M2A A;  4XS4 A;  2AV4 A;  4E8H A;  2JSZ A;  4ZBB A;  1ZYP A;  2C0E A;  4N10 A;  3W6G A;  3CYN A;  1TW9 A;  4PI0 C;  3UEM A;  3EU4 A;  3LYP A;  5JCW A;  4RI7 A;  4KA0 A;  3NIV A;  3G7Y A;  2DMM A;  2F51 A;  2FHE A;  5AN1 A;  1WJK A;  4YQU A;  4JED A;  4FXY P;  1EP7 A;  10GS A;  4Z2T A;  4BL7 B;  1JZO A;  3QR6 A;  5B8B A;  5DBQ A;  1AW9 A;  1F9M A;  4G0I A;  3TOT A;  3GKK A;  3UBL A;  4IGJ A;  3E9J B;  3GX8 A;  1XZO A;  2GSQ A;  2MYG A;  4WF5 A;  4OD7 A;  2CX3 A;  1TRU A;  2OT3 A;  1SKW B;  5J41 A;  1HYU A;  1Z3E A;  4EF0 A;  5KEJ A;  3CTG A;  9GSS A;  1GTI A;  3KM6 A;  2EIQ A;  2VLT A;  4KE3 A;  3KD0 A;  3KZQ A;  3TCO A;  3MSZ A;  3BBY A;  4GF0 A;  4HJ2 A;  2EFC A;  4V1A p;  4CY8 A;  4O32 A;  1XW6 A;  1WP0 A;  2WDU A;  4MH2 A;  3EMX A;  1BJX A;  3IPZ A;  1T3B A;  2L57 A;  1SKS B;  2JAC A;  5FHI A;  3H4K A;  3D21 A;  5GSS A;  3QDN A;  12GS A;  3KP8 A;  3D4M A;  1T4Z A;  1YJ6 A;  2DLX A;  1YEP A;  3L0H A;  4BVX A;  1FOH A;  4HI7 A;  4AKX B;  2CX4 A;  2GDR A;  3KP9 A;  1K0N A;  3WT2 A;  4L0W A;  3ERW A;  2MMN A;  2H71 A;  3FZ5 A;  3HYP A;  3TRQ A;  2LUS A;  2R6K A;  5IMA A;  1SEN A;  3IE3 A;  3FYG A;  5DAL A;  4J57 E;  1FW1 A;  3GKX A;  1XWB A;  4TR3 A;  3TJB A;  4I5Q A;  3VPT A;  2X8G A;  4ZL7 A;  1WOU A;  2FY6 A;  1GRX A;  2DJ2 A;  4I8B A;  1TU8 A;  4AJ6 A;  2Z9S A;  1AIU A;  4ZB8 A;  2WW2 A;  2DJK A;  1K3L A;  3IAM 2;  1EEJ A;  1MDI A;  3C7M A;  5J4V A;  1A8Y A;  1YF0 A;  4PNG A;  1K0A A;  2XBQ A;  1EP8 A;  3HJP A;  4YKF A;  2B6M A;  2PGT A;  2ZUP A;  5ECS A;  2UZ8 A;  3G7J A;  1R5P A;  2X64 A;  1JLV A;  1WRY A;  1N8J A;  3A5W A;  5HR1 A;  2ALB A;  1B8X A;  4AI6 A;  1TP9 A;  2EIR A;  3Q74 A;  5CRW A;  4BVY A;  1GH2 A;  4GQC A;  2AYT A;  2TRC P;  3DEX A;  2M46 A;  3TKS C;  3KTB A;  2HE3 A;  4AKH A;  5CRH A;  1A2M A;  2B5E A;  1G6W A;  3GSS A;  4I2T A;  2PN8 A;  4CDO A;  4XIH A;  2QGV A;  2CA8 A;  4K0N A;  4BWS A;  3EPT A;  4IBP A;  3KJY A;  2WVX A;  3SWL A;  1K0D A;  4WF4 A;  3L4N A;  3V1W A;  3L9S A;  5GST A;  2JSY A;  3BD2 A;  1GL8 A;  2MZC A;  2CZ3 A;  3FKF A;  3EVI A;  2LNS A;  2YP6 A;  4IJ3 A;  4X1U A;  2YWI A;  5DAK B;  4OCF A;  1EGR A;  1GTU A;  4F0C A;  1M9A A;  2LKU A;  3ZIJ A;  1V9W A;  3UBK A;  1ZL9 A;  3CSH A;  4XRA A;  4POL A;  2IFQ A;  2XC2 A;  2IL3 A;  2A2S A;  4WBJ A;  4EL1 A;  4PXO A;  2PUK C;  4YQV A;  3WGX A;  5CP1 A;  3P90 A;  2OE1 A;  4Q5N A;  3IHQ A;  2IIY A;  4ZL8 A;  4CW9 A;  2OE0 A;  2DJ0 A;  3HHV A;  4IN0 A;  4L5L A;  4HJM A;  2CAI A;  3LWA A;  2H1L A;  3UIW A;  2YZU A;  1BX9 A;  5G2Z A;  4E68 A;  4JE1 A;  4N11 A;  5HR0 A;  2C3Q A;  2PBJ A;  4G0L A;  5A34 A;  4JBB A;  1XFL A;  2O5V A;  5C04 A;  5IOW A;  2LS5 A;  1SK2 A;  2FLS A;  4GDF A;  1SJ6 A;  4DSR A;  4JZQ A;  1BF5 A;  1NHO A;  1ZYQ B;  1H75 A;  2F8F A;  5HFI A;  4MJA A;  3TKS A;  5B8A A;  4YQM A;  1PMT A;  1Z7P A;  3GUR A;  2R0G A;  2RUE A;  5IO0 A;  1SL1 B;  2IMI A;  1MEK A;  3KIJ A;  2O8V B;  3ZFL A;  4IEL A;  1VGL A;  3R3E A;  4HZ4 A;  2F9S A;  1MD3 A;  3UOM A;  1V40 A;  3TJF A;  2I4A A;  4P3Y B;  3RAZ A;  2H01 A;  3P8W A;  1PN0 A;  1TTZ A;  4XTS A;  3K8N A;  2VKZ G;  2P31 A;  2HSM A;  3SBC A;  5JCU A;  4AJ7 A;  2RII A;  2KUC A;  4DSQ A;  1VRS D;  5KN1 A;  3KMN A;  4NV2 A;  3O6T A;  5G1L A;  1XW5 A;  5LNK e;  3F4S A;  4K0G A;  2VM2 A;  2WCI A;  1O6J A;  2L5L A;  2H74 A;  2FWF A;  1HNC A;  3M0F A;  2HRN A;  1THX A;  3DXB A;  3KXO A;  1GSD A;  5G31 A;  1OVN A;  4ICY A;  4IS0 A;  3H8Q A;  2F8A A;  1XOA A;  2OBI A;  4WR5 A;  1PA3 A;  1SD9 A;  4HDE A;  4XS6 A;  3PIN A;  1J0F A;  4MF5 A;  2I81 A;  1WWJ A;  4WR4 A;  3LXZ A;  1MD4 A;  2VLU A;  2CV4 A;  3Q18 A;  3GRX A;  3PGT A;  3CSI A;  1VF3 A;  1EGO A;  3RBT A;  5BMU A;  1SJZ A;  1MTC A;  2V6K A;  2WJU A;  2MMZ A;  1VF1 A;  2IJY A;  2L59 A;  2R0P A;  4TR4 A;  1T4Y A;  3VWU A;  3IAS 2;  4TR1 B;  4J2F A;  5F07 A;  3PH9 A;  4NV5 A;  2HYX A;  1LJR A;  2ON5 A;  4KCE A;  1ZMA A;  4ZB7 A;  1GUK A;  1ACV A;  1XWK A;  1W89 A;  4MCU A;  1X9W B;  1K0M A;  2IMD A;  2X49 A;  4TXO B;  2F3M A;  3D4T A;  4V2L A;  1A0R P;  4TKY A;  2A2P A;  2PER A;  3GN3 A;  4GRF A;  2WB9 A;  5ELA A;  4CY6 A;  3RHC A;  1EV9 A;  2K8S A;  2GVP A;  4BIK A;  5A4V A;  1GSQ A;  1EWX A;  1OE7 A;  4QL7 A;  4L5O A;  3MNG A;  3PPU A;  3IK9 A;  4AGS A;  4PUF C;  3GFK A;  1Y25 A;  2FUG 2;  2CVB A;  1OKT A;  3US3 A;  5FWG A;  4IVF A;  2DBC A;  1E2Y A;  3LJR A;  5J9B A;  4DVC A;  2H1B A;  1TXX A;  1GSY A;  3HD5 A;  3EC3 A;  2MBT A;  18GS A;  1HNA A;  3M9K A;  1OYJ A;  3F9U A;  4F82 A;  4KSM A;  1GNW A;  4F2I A;  4MK3 A;  3LQ7 A;  5CRD A;  6GSY A;  4L0U A;  3ZVJ D;  4K7O A;  2YZH A;  3HA9 A;  2FWG A;  3TKP A;  1G6Y A;  2CVD A;  5A1N B; 
#chains in the Genus database with same CATH homology
 2YV7 A;  1EZK A;  5HFG A;  2LTK A;  2YWN A;  1Y6E A;  5DDL A;  2PPT A;  1A0F A;  2H19 A;  5A5H A;  1V58 A;  1UC7 A;  2HRK B;  3ZVJ A;  3APO A;  3H1N A;  4MF6 A;  1M2B A;  1S3A A;  2JU5 A;  2D2Z A;  2B1L A;  3MYD A;  4DSS A;  4G10 A;  3QAG A;  5ENU A;  1ABA A;  2L6D A;  6GST A;  3Q6O A;  2HSH A;  1Q98 A;  1JHB A;  3HVV A;  3C8E A;  4ECC A;  2VOC A;  1GSS A;  3G9B A;  5CRG A;  1XBS A;  3EYT A;  1K0C A;  1Y1U A;  4XRD A;  5IMZ A;  3DKS A;  2YCD A;  3UMA A;  2DIZ A;  2R4V A;  1T1V A;  2RM6 A;  4I97 A;  1ON4 A;  2KHP A;  2X99 A;  2IMF A;  2FA4 A;  3QPM A;  3QAW A;  3TJG A;  1TJD A;  3QAV A;  3GIX A;  1Z6N A;  2PVQ A;  4HQZ A;  2H6Z A;  2C3T A;  4GQF A;  4HUA A;  3P2A A;  4E8E A;  2H30 A;  1R4W A;  4POB A;  5D73 A;  1B9X C;  3A3T A;  4X0X A;  4EXJ A;  3IRA A;  4BL7 A;  4AJ8 A;  4IP1 A;  3RDW A;  1TRS A;  4W66 A;  4TW5 A;  4MF7 A;  2WUL A;  2L4Q A;  5A4W A;  2VCQ A;  3KEB A;  2LST A;  5ECO B;  3HDC A;  4OWY A;  3LG6 A;  1SK0 A;  3GST A;  4IJI A;  2B3S A;  1TDI A;  2RM5 A;  5J3R A;  3ZZX A;  1QFN A;  1YEX A;  1ERU A;  1LU4 A;  3QCP A;  2LV3 A;  19GS A;  1XVQ A;  4WBR D;  3EU3 A;  4K9Z A;  2K6V A;  2LRC A;  4LMW A;  3M3M A;  4KDY A;  1JZW A;  3FR6 A;  2M80 A;  4O7H A;  4PQH A;  3ZRE A;  4KX4 A;  2OAC A;  2RUF A;  4K2X A;  5CYY A;  3MDK A;  5KOW A;  3FR3 A;  2V41 A;  5D96 A;  2VL3 A;  2WRT A;  1U87 A;  4MJB A;  1BQ7 A;  4RQR A;  2GSR A;  2YJH A;  4MLY A;  4EDY A;  1OC8 A;  2QA1 A;  4D73 B;  2L4C A;  4PUA A;  3TRX A;  2GSS A;  1THO A;  2VO4 A;  1RW1 A;  3DYR A;  4FYU A;  3LW9 A;  2ES7 A;  4HS1 A;  1QK8 A;  4EIQ A;  1YY7 A;  2QKE A;  3GL3 A;  3FZ9 A;  3RPN A;  1AAZ A;  2OAD A;  5D9T A;  5J4U A;  3H93 A;  1GP1 A;  2HZE B;  1GUL A;  3DWV A;  1X5D A;  3F4R A;  3TJK A;  1WE0 A;  3LSZ A;  4ZBA A;  5L71 A;  4MZC A;  2X8C A;  1GUH A;  3F3R A;  2GLR A;  1RK4 A;  1PX7 A;  1TKD B;  1F3A A;  1PRX A;  4DEJ A;  4KSO A;  4Z2R A;  3VLN A;  1R7H A;  4ZIJ A;  1SYR A;  3GH6 A;  3D22 A;  2H6Y A;  3TU3 B;  3GUS A;  1O8W A;  5BRT A;  1J9B A;  2YWO A;  5IOX A;  3GA4 A;  2JZS A;  2B1K A;  4F9Z A;  3J7Y b;  1TI3 A;  2DKH A;  5EPF A;  1UVZ A;  4H86 A;  2GQM A;  1XW9 A;  1BG5 A;  5DAK A;  4XCS A;  5DJM A;  4IHU A;  1M7T A;  2HSN B;  2H8L A;  4RUV A;  4K7I A;  2VD0 A;  2OE3 A;  4OFM A;  5J47 A;  3NZN A;  2MMA A;  4KW6 A;  2XPE A;  1F37 A;  2G0F A;  1B4Q A;  2VCV A;  3DVX A;  4EO3 A;  4MZW A;  2REM A;  1TU7 A;  3D6I A;  2H1A A;  1O8X A;  3GYK A;  4WXT A;  1SL0 B;  2B5X A;  2YJ7 A;  3KTL A;  3H79 A;  2RLI A;  1TXU A;  2HSY A;  3KCM A;  4WET A;  5AIS A;  2C1Y A;  2FWE A;  5ECQ B;  4YAV A;  1S3C A;  1U3A A;  2EFH A;  3C73 A;  2OBK A;  1TK5 B;  1GTB A;  1AUC A;  1N25 A;  2LQO A;  2WFC A;  2C4J A;  1ERW A;  4GCI A;  2CVK A;  1CQG A;  1YKA A;  2LEG A;  14GS A;  5AIX A;  1WPI A;  2VD1 A;  2K18 A;  3QFA C;  3S9F A;  3CMI A;  1FVJ A;  1X9S B;  3GKN A;  4JU5 A;  1U88 A;  4FO5 A;  1T8E B;  3D5J A;  1T7P B;  2QSI A;  2QA2 A;  1DE1 A;  5JWQ B;  1OC9 B;  5G1K A;  4Z2U A;  3M9J A;  2LJR A;  2P5Q A;  4MZB A;  5IMD A;  1O7U A;  4NMU A;  4K5R A;  3GNJ A;  4KGI A;  4GSN A;  4HZ2 A;  3FEU A;  5G30 A;  2LNT A;  4GST A;  2HXK A;  2EC4 A;  4ECJ A;  1QUW A;  4IQA A;  3KH7 A;  1YF1 A;  1EV4 A;  2I9H A;  1V2A A;  3TKS E;  3M1G A;  1Z6M A;  4N0V A;  2GT6 A;  4MMM A;  5ECN B;  5GZZ B;  5DJL A;  5ECP B;  3VI7 A;  3PR8 A;  3GTU B;  1F6M C;  4G01 A;  3BOA A;  1A2L A;  3L78 A;  5EL8 A;  2H66 A;  3FMW A;  5HR3 A;  4N3Z A;  4FH8 A;  2KLX A;  2BTO T;  2PU9 C;  4OCE A;  5JWO B;  4ML6 A;  3A5I A;  2JAD A;  2VM1 A;  4HEA 2;  3VWW A;  1X5C A;  3UJ1 A;  4LA1 A;  5DCH A;  3QFB C;  2JL4 A;  1A8L A;  2V32 A;  2FWH A;  4TR1 A;  2VIM A;  3ZRD A;  4NAX A;  1XOB A;  2AJQ B;  2H73 A;  1AXD A;  2K9F A;  2MBS A;  2J9H A;  3M8N A;  5ELG A;  3EE2 A;  3TDG A;  2TRX A;  4K1F A;  3TRP A;  3E3E A;  2FGX A;  2C3N A;  4TXO A;  3IA1 A;  4ECI A;  1EOH A;  4ZXG A;  3A2V A;  3GX0 A;  5ECK B;  5C00 A;  4OMV A;  1GSF A;  5H5S A;  2C0F A;  2K8V A;  4OFT A;  8GSS A;  1ILO A;  5KN3 A;  5H5Q A;  4YH2 A;  4NHZ A;  1X0R A;  4KCA A;  5KN0 A;  3ISO A;  1JZD A;  3IV4 A;  1S3D A;  1SD8 A;  5DVB A;  2GST A;  1ERV A;  3HVX A;  3EUR A;  4HQS A;  4QL9 A;  2P5R A;  4EC0 A;  1PL1 A;  4JR6 A;  2EFE A;  4V2N A;  1ZOF A;  5IQY A;  3ZTL A;  1G7E A;  2IWT A;  5CRE A;  5D9X A;  1HNB A;  1B4P A;  1XWG A;  1USB A;  3ERG A;  1YKC A;  3TKR A;  3WGD A;  3GH9 A;  5J4Y A;  2O7K A;  5IPG A;  5A4U A;  3VPQ A;  3ME7 A;  3W8J A;  3KGK A;  1DSB A;  5HFK A;  5GAP D;  6GSS A;  2DC5 A;  4AF2 A;  2VCW A;  5A1N A;  2L6C A;  5D9V A;  4WEY A;  3C1S A;  4Q5R A;  2O85 A;  3HZ8 A;  4IQ1 A;  1IYI A;  2A4H A;  5ECM B;  3HZ4 A;  1TI1 A;  1XWA A;  1QGV A;  2O89 A;  2HRK A;  1FB6 A;  3ED3 A;  4BA7 A;  5IIZ A;  4MJC A;  1FO5 A;  4O5R A;  2LRT A;  4QQ7 A;  1XVW A;  2FA8 A;  4I2U A;  3WYW A;  3VUR A;  1K3O A;  3CRT A;  1K3Y A;  2DSA A;  4N30 A;  4TOP A;  4MAB A;  1DE2 A;  1V98 A;  3HXS A;  1PKW A;  2H72 A;  4NWY A;  4EKZ A;  1Q4J A;  1LBK A;  1PQN A;  5JCG A;  4X43 A;  4TRX A;  5ECH B;  2YN1 A;  4KND A;  1C72 A;  2YPM A;  2V1M A;  1AQX A;  5F06 A;  2HFD A;  3IDV A;  3WD6 A;  4MJE A;  2WZ9 A;  1E6B A;  4PTS A;  4ZL9 A;  3C71 A;  4CHS A;  1QQ2 A;  3UAR A;  4KB3 A;  1GTA A;  1FG4 A;  3ME8 A;  3QOU A;  2AAW A;  2VCX A;  4MNN A;  3F6F A;  2DIY A;  3FRC A;  1GUM A;  1BED A;  4MA9 A;  4RQX A;  4GXZ A;  3TKQ A;  2YNX A;  4Q5Q A;  4GLT A;  2C8U A;  5A5K A;  3DVW A;  4FYB A;  4PUR A;  4LLR A;  2CZ2 A;  2OKA A;  1W4V A;  4X4J A;  2GQK A;  1ML6 A;  5B6N A;  2IPA A;  1K0B A;  1A24 A;  1O85 A;  1PSQ A;  2C0D A;  1X9M B;  5CNW A;  2JZR A;  2PVO C;  4MPG A;  1Z9H A;  3VI5 A;  3LGC A;  22GS A;  3R2Q A;  4OO4 A;  17GS A;  2AUV A;  4PNF A;  1WIK A;  4ULX A;  4IKH A;  4ZIL A;  2GZY A;  5ID2 B;  3FR9 A;  2A4V A;  2H0I A;  3EWL A;  5ECR B;  4ILF A;  1X5E A;  4XS4 B;  3UAP A;  5J5N A;  5EVO A;  3KH9 A;  4BPY A;  6GSX A;  4OO5 A;  2DJJ A;  1Z7R A;  3ZL5 A;  1FB0 A;  1URM A;  4I6X A;  1XXU A;  4PQI A;  3FW2 A;  2GT5 A;  5ABR A;  2WGR A;  3ZFB A;  2MMO A;  3ZIV A;  5IO2 A;  3GHA A;  5G5F A;  3APS A;  5DQY A;  3HJO A;  3FZ4 A;  1M2D A;  4D73 A;  5DQS A;  4GSS A;  4KAE A;  3F0I A;  1I9D A;  5G5E A;  2HT9 A;  4G19 A;  2OJL A;  3I6A A;  4EDZ A;  2LJA A;  3WGE A;  1B48 A;  1RQM A;  4ZB6 A;  3MIX A;  3A2X A;  3UVT A;  3CTF A;  3GKM A;  4K5S A;  1KNG A;  1NW2 A;  3IHG A;  2C0G A;  4TR0 A;  3IBH A;  3LYK A;  2HZE A;  1SK1 A;  4F03 A;  1HD2 A;  3IXR A;  1CQH A;  1TOF A;  2DJ1 A;  2HNL A;  3DIE A;  1QXH A;  1GLP A;  20GS A;  2WS2 A;  1EEM A;  4NXI A;  3I9V 2;  1ERT A;  1BAY A;  1O73 A;  3CBU A;  1ST9 A;  16GS A;  4BVX B;  2GS3 A;  5E4W A;  3E0U A;  4K8M A;  1FVK A;  2V6O A;  3LOR A;  4POK A;  4XS1 A;  1F3B A;  3HJM A;  3FZA A;  1JLW A;  5F0G A;  5IMF A;  3IOS A;  3DML A;  5DAL B;  4TVE A;  4NHW A;  4FIW A;  1SKR B;  3AY8 A;  3O3T A;  6GSV A;  1GSU A;  1AQV A;  3HCZ A;  1SU9 A;  4BWQ A;  3ZMK A;  2GZZ A;  2HSN A;  7GSS A;  4Z7X A;  3MAK A;  2N5A A;  1R26 A;  2N5F A;  2KOK A;  4XHM A;  1A2J A;  1VF2 A;  2R0C A;  4K2D A;  2O87 A;  5H5R A;  4TXV A;  1R5A A;  3TGZ A;  3I69 A;  3W8S A;  1AQW A;  5COH A;  4KH7 A;  5LD0 A;  4F0B A;  3P7X A;  4J56 E;  1PD2 1;  2H0G A;  4KUN A;  5CO3 A;  4BVY B;  1PGT A;  3Q19 A;  4EVM A;  1K0O A;  4KF9 A;  1KBN A;  1PKZ A;  1M99 A;  4KDU A;  2KP1 A;  2LRN A;  1ZZY A;  2BMX A;  4GTU A;  4TN8 A;  4ZBD A;  1ZGN A;  1ZYN A;  2DJ3 A;  3ZIT A;  2C80 A;  5INY A;  2FD3 A;  2H75 A;  4LMV A;  4NPB A;  4MDC A;  3RPP A;  5JWR B;  5IM9 A;  2AHE A;  2PWJ A;  3EMP A;  6GSW A;  2HRF A;  4KDX A;  4EIP A;  3MWH A;  2CQ9 A;  1TK0 B;  1JFU A;  3APQ A;  1SVO A;  2KP2 A;  2OA7 A;  3F3Q A;  4O5Q A;  3N5O A;  4FQU A;  4MH3 A;  2NDO A;  3LEF A;  5HQP A;  3VWV A;  4ACS A;  3G7I A;  2ZCT A;  3LFL A;  1OC9 A;  2CAQ A;  4ISD A;  2IFQ B;  4JR4 A;  2E0Q A;  4G2E A;  3ZLP A;  2A2R A;  2XHF A;  3CRU A;  1OE8 A;  4AKG A;  5IMV A;  1UN2 A;  4K7N A;  4K6X A;  2I1U A;  2IME A;  4EUY A;  4IP6 A;  2LQQ A;  3F8U A;  1M0U A;  2GGT A;  5IPH A;  3FK8 A;  1KTE A;  5D93 A;  4YKG A;  1NSW A;  2CT6 A;  1NM3 A;  4HU7 A;  2ON7 A;  1F2E A;  3A2W A;  2QC7 A;  5A34 B;  1I5G A;  3J7Y k;  2E7P A;  2HQT A;  3GTU A;  1TRV A;  2VCT A;  1ZYE A;  1MDJ A;  3LXT A;  2H76 A;  3O76 A;  2XBI A;  3IK7 A;  3UVH A;  4YAP A;  2VL9 A;  4QMK A;  4N0Z A;  1U3I A;  3QD9 A;  2AB6 A;  1IYH A;  4LL1 B;  1MDK A;  1GNE A;  1EOG A;  1B9Y C;  3IC4 A;  4OFN A;  4PX1 A;  3OR5 A;  5DCG A;  3D0Z A;  2JZT A;  2BJX A;  3U6V A;  4GWR A;  1PX6 A;  4Q5F A;  4USS A;  3VWX A;  4IW9 A;  5F8B A;  1T00 A;  1G0T A;  3I43 A;  3DD3 A;  2H70 A;  2VLV A;  5EY6 A;  5KOX A;  2L5O A;  1SJI A;  1TK8 B;  4O5U A;  1FHE A;  1FAA A;  3VFI A;  2V2G A;  1Z5Y E;  2HSM B;  2M72 A;  1O81 A;  4V1A g;  3TOU A;  3L9V A;  1BG1 A;  4MP4 A;  3CSJ A;  3GV1 A;  2B5Y A;  6GSU A;  2G2Q A;  2E2M A;  3KMO A;  5ECI B;  4ML1 A;  11GS A;  3JCM L;  3BJ5 A;  3HY2 A;  13GS A;  4RI6 A;  2R5G A;  2EIO A;  4O92 A;  5J40 A;  3EIN A;  1QMV A;  2X8H A;  3ERF A;  2VUP A;  1V57 A;  1XCC A;  2B7J A;  2H0H A;  2EFD A;  2FNO A;  3DRN A;  1YVL A;  2IN3 A;  3HKR A;  2R3X A;  1OAZ A;  2IMK A;  3UL3 A;  5BMU B;  1VF4 A;  1U6T A;  3F4T A;  5ECL B;  2UV8 G;  4HU9 A;  4LL4 B;  3IC8 A;  3FY7 A;  2R37 A;  1FOV A;  3L9U A;  3HVS A;  4G9H A;  4ZB9 A;  1XWC A;  4PQ1 A;  1YQ1 A;  3BCI A;  3WT1 A;  2HI7 A;  2VL2 C;  2DKI A;  4ID0 A;  3TUE A;  1NHY A;  2HZF A;  5D9W A;  1DUG A;  3F6D A;  1N2A A;  4POM A;  3TJJ A;  3CXG A;  3C1R A;  3IR4 A;  1SL2 B;  1PL2 A;  1OKD A;  3BCK A;  2PMT A;  1OC3 A;  2X4A A;  1SVL A;  5AGY A;  1G7O A;  3VK9 A;  3HMJ G;  3U5R E;  1JZR A;  5J9C A;  4WKW A;  2R2J A;  5LCZ A;  1YDK A;  3DGQ A;  2HRA A;  5B7C A;  2GQL A;  3ZYW A;  1J08 A;  3GL5 A;  4JRR A;  5FT3 A;  2NTO A;  1HQO A;  4PGT A;  3NOF A;  2J23 A;  2NVL A;  1A23 A;  5GAN D;  2NPB A;  5CAX A;  2XPD A;  1GSE A;  1AC1 A;  3N9J A;  5E59 A;  4AKI A;  4EE0 A;  2DML A;  1XIY A;  5KN2 A;  2VAF A;  5AIV A;  2GTU A;  2GZP A;  4A5P A;  1M9B A;  4V2M A;  3FHK A;  2B7K A;  2H1G A;  1KEB A;  2NBS A;  3F63 A;  1UA5 A;  1GWC A;  1SVM A;  5F05 A;  4HOJ A;  3QMX A;  2YAN A;  3RHB A;  2TIR A;  3CWG A;  5A5H B;  1BYE A;  4FYC A;  2I3Y A;  2VCZ A;  2YWM A;  2H1D A;  2YOI A;  2H6X A;  4DSS B;  3TB2 A;  1WMJ A;  2HLS A;  1TRW A;  5D8I A;  1YZX A;  5HR2 A;  3ZML A;  5IMC A;  1GLQ A;  1ZCP A;  2LJK A;  2P0G A;  2FCH A;  2VL2 A;  3GMF A;  4MPF A;  1DBY A;  4ECB A;  1H4O A;  2ZNM A;  1XPV A;  4G0K A;  1PN9 A;  2E2G A;  2YV9 A;  5ID2 A;  4L8E A;  2N5B A;  1SYX A;  5B6M A;  1M2A A;  4XS4 A;  2AV4 A;  4E8H A;  2JSZ A;  4ZBB A;  1ZYP A;  2C0E A;  4N10 A;  3W6G A;  3CYN A;  1TW9 A;  3UEM A;  3EU4 A;  3LYP A;  5JCW A;  4RI7 A;  4KA0 A;  3NIV A;  3G7Y A;  2DMM A;  2F51 A;  2FHE A;  5AN1 A;  1WJK A;  4YQU A;  4JED A;  1EP7 A;  10GS A;  4Z2T A;  4BL7 B;  1JZO A;  3QR6 A;  5B8B A;  5DBQ A;  1AW9 A;  1F9M A;  4G0I A;  3TOT A;  3GKK A;  3UBL A;  4IGJ A;  3E9J B;  3GX8 A;  1XZO A;  2GSQ A;  2MYG A;  4WF5 A;  4OD7 A;  2CX3 A;  1TRU A;  2OT3 A;  1SKW B;  5J41 A;  1HYU A;  1Z3E A;  4EF0 A;  5KEJ A;  3CTG A;  9GSS A;  1GTI A;  3KM6 A;  2EIQ A;  2VLT A;  4KE3 A;  3KD0 A;  3KZQ A;  3TCO A;  3MSZ A;  3BBY A;  4GF0 A;  4HJ2 A;  2EFC A;  4V1A p;  4CY8 A;  4O32 A;  1XW6 A;  1WP0 A;  2WDU A;  4MH2 A;  3EMX A;  1BJX A;  3IPZ A;  1T3B A;  2L57 A;  1SKS B;  2JAC A;  5FHI A;  3H4K A;  3D21 A;  5GSS A;  3QDN A;  12GS A;  3KP8 A;  3D4M A;  1T4Z A;  1YJ6 A;  2DLX A;  1YEP A;  3L0H A;  4BVX A;  1FOH A;  4HI7 A;  4AKX B;  2CX4 A;  2GDR A;  3KP9 A;  1K0N A;  3WT2 A;  4L0W A;  3ERW A;  2MMN A;  2H71 A;  3FZ5 A;  3HYP A;  3TRQ A;  2LUS A;  2R6K A;  5IMA A;  1SEN A;  3IE3 A;  3FYG A;  5DAL A;  4J57 E;  1FW1 A;  3GKX A;  1XWB A;  4TR3 A;  3TJB A;  4I5Q A;  3VPT A;  2X8G A;  4ZL7 A;  1WOU A;  2FY6 A;  1GRX A;  2DJ2 A;  4I8B A;  1TU8 A;  4AJ6 A;  2Z9S A;  1AIU A;  4ZB8 A;  2DJK A;  1K3L A;  3IAM 2;  1EEJ A;  1MDI A;  3C7M A;  5J4V A;  1A8Y A;  1YF0 A;  4PNG A;  1K0A A;  2XBQ A;  1EP8 A;  3HJP A;  4YKF A;  2B6M A;  2PGT A;  2ZUP A;  5ECS A;  2UZ8 A;  3G7J A;  1R5P A;  2X64 A;  1JLV A;  1WRY A;  1N8J A;  3A5W A;  5HR1 A;  2ALB A;  1B8X A;  4AI6 A;  1TP9 A;  2EIR A;  3Q74 A;  5CRW A;  4BVY A;  1GH2 A;  4GQC A;  2AYT A;  2TRC P;  3DEX A;  2M46 A;  3TKS C;  3KTB A;  2HE3 A;  4AKH A;  5CRH A;  1A2M A;  2B5E A;  1G6W A;  3GSS A;  4I2T A;  2PN8 A;  4CDO A;  4XIH A;  2QGV A;  2CA8 A;  4K0N A;  4BWS A;  3EPT A;  4IBP A;  3KJY A;  3SWL A;  4WF4 A;  1K0D A;  3L4N A;  3V1W A;  3L9S A;  5GST A;  2JSY A;  3BD2 A;  1GL8 A;  2MZC A;  2CZ3 A;  3FKF A;  3EVI A;  2LNS A;  2YP6 A;  4IJ3 A;  4X1U A;  2YWI A;  5DAK B;  4OCF A;  1EGR A;  1GTU A;  4F0C A;  1M9A A;  2LKU A;  3ZIJ A;  1V9W A;  3UBK A;  1ZL9 A;  3CSH A;  4XRA A;  4POL A;  2IFQ A;  2XC2 A;  2IL3 A;  2A2S A;  4WBJ A;  4EL1 A;  4PXO A;  2PUK C;  4YQV A;  3WGX A;  5CP1 A;  3P90 A;  2OE1 A;  4Q5N A;  3IHQ A;  2IIY A;  4ZL8 A;  4CW9 A;  2OE0 A;  2DJ0 A;  3HHV A;  4IN0 A;  4L5L A;  4HJM A;  2CAI A;  3LWA A;  2H1L A;  3UIW A;  2YZU A;  1BX9 A;  5G2Z A;  4E68 A;  4JE1 A;  4N11 A;  5HR0 A;  2C3Q A;  2PBJ A;  4G0L A;  5A34 A;  4JBB A;  1XFL A;  2O5V A;  5C04 A;  5IOW A;  2LS5 A;  1SK2 A;  2FLS A;  4GDF A;  1SJ6 A;  4DSR A;  4JZQ A;  1BF5 A;  1NHO A;  1ZYQ B;  1H75 A;  2F8F A;  5HFI A;  4MJA A;  3TKS A;  5B8A A;  4YQM A;  1PMT A;  1Z7P A;  3GUR A;  2R0G A;  2RUE A;  5IO0 A;  1SL1 B;  2IMI A;  1MEK A;  3KIJ A;  2O8V B;  3ZFL A;  4IEL A;  1VGL A;  3R3E A;  4HZ4 A;  2F9S A;  1MD3 A;  3UOM A;  1V40 A;  3TJF A;  2I4A A;  4P3Y B;  3RAZ A;  2H01 A;  3P8W A;  1PN0 A;  1TTZ A;  4XTS A;  3K8N A;  2VKZ G;  2P31 A;  2HSM A;  3SBC A;  5JCU A;  4AJ7 A;  2RII A;  2KUC A;  4DSQ A;  1VRS D;  5KN1 A;  3KMN A;  4NV2 A;  3O6T A;  5G1L A;  1XW5 A;  5LNK e;  3F4S A;  4K0G A;  2VM2 A;  2WCI A;  1O6J A;  2L5L A;  2H74 A;  2FWF A;  1HNC A;  3M0F A;  2HRN A;  1THX A;  3DXB A;  3KXO A;  1GSD A;  5G31 A;  1OVN A;  4ICY A;  4IS0 A;  3H8Q A;  2F8A A;  1XOA A;  2OBI A;  4WR5 A;  1PA3 A;  1SD9 A;  4HDE A;  4XS6 A;  3PIN A;  1J0F A;  4MF5 A;  2I81 A;  1WWJ A;  4WR4 A;  3LXZ A;  1MD4 A;  2VLU A;  2CV4 A;  3Q18 A;  3GRX A;  3PGT A;  3CSI A;  1VF3 A;  1EGO A;  3RBT A;  5BMU A;  1SJZ A;  1MTC A;  2V6K A;  2WJU A;  2MMZ A;  1VF1 A;  2IJY A;  2L59 A;  2R0P A;  4TR4 A;  1T4Y A;  3VWU A;  3IAS 2;  4TR1 B;  4J2F A;  5F07 A;  3PH9 A;  4NV5 A;  2HYX A;  1LJR A;  2ON5 A;  4KCE A;  1ZMA A;  4ZB7 A;  1GUK A;  1ACV A;  1XWK A;  1W89 A;  4MCU A;  1X9W B;  1K0M A;  2IMD A;  2X49 A;  4TXO B;  2F3M A;  3D4T A;  4V2L A;  1A0R P;  4TKY A;  2A2P A;  2PER A;  3GN3 A;  4GRF A;  2WB9 A;  5ELA A;  4CY6 A;  3RHC A;  1EV9 A;  2K8S A;  2GVP A;  5A4V A;  1GSQ A;  1EWX A;  1OE7 A;  4QL7 A;  4L5O A;  3MNG A;  3PPU A;  3IK9 A;  4AGS A;  4PUF C;  3GFK A;  1Y25 A;  2FUG 2;  2CVB A;  1OKT A;  3US3 A;  5FWG A;  4IVF A;  2DBC A;  1E2Y A;  3LJR A;  5J9B A;  4DVC A;  2H1B A;  1TXX A;  1GSY A;  3HD5 A;  3EC3 A;  2MBT A;  18GS A;  1HNA A;  3M9K A;  1OYJ A;  3F9U A;  4F82 A;  4KSM A;  1GNW A;  4F2I A;  4MK3 A;  3LQ7 A;  5CRD A;  6GSY A;  4L0U A;  3ZVJ D;  4K7O A;  2YZH A;  3HA9 A;  2FWG A;  3TKP A;  1G6Y A;  2CVD A;  5A1N B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...