2UZ8A

The crystal structure of p18, human translation elongation factor 1 epsilon 1
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
169
structure length
164
Chain Sequence
MAAAAELSLLEKSLGLSKGNKYSAQGERQIPVLQTNNGPSLMGLTTIAAHLVKQANKEYLLGSTAEEKAMVQQWLEYRVTQVDNDIHTLLMDLNSYLEDKVYLTGYNFTLADILLYYGLHRFIVDLTVQEKEKYLNVSRWFCHIQHYPGIRQHLSSVVFIKNRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Rna binding protein
molecule keywords EUKARYOTIC TRANSLATION ELONGATION FACTOR 1 EPSILON-1
publication title Determination of Three-Dimensional Structure and Residues of the Novel Tumor Suppressor Aimp3/P18 Required for the Interaction with Atm.
pubmed doi rcsb
source organism Homo sapiens
total genus 49
structure length 164
sequence length 169
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-04-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00043 GST_C Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 2uz8A02
3.40.30.90 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2uz8A01
5ECKB 3TGZA 4KSMA 3IK9A 5ELGA 4ECBA 4I97A 1V2AA 5GSTA 3LYPA 4YQMA 2VD0A 4IJIA 2HSNB 3UAPA 2PVQA 3IC8A 4GSNA 4BVYA 2CVDA 5ECNB 4OFMA 3CSIA 1TDIA 5G5FA 4ECIA 5J41A 1VF3A 3AY8A 7GSSA 4YQUA 1BAYA 1TW9A 3SWLA 1YJ6A 4KE3A 1ZL9A 2DC5A 1G6WA 4ZB9A 3Q19A 3CBUA 3LG6A 2LJRA 4PNFA 3P8WA 4BVXA 3IR4A 4G0KA 5A4VA 3IBHA 1LJRA 4EXJA 1AQWA 4BVYB 1BG5A 2F8FA 1PN9A 1OYJA 13GSA 1EEMA 2R5GA 4IW9A 5LD0A 1G7OA 2PBJA 3G7IA 3HKRA 4JEDA 1HNBA 3GSSA 3FY7A 1GULA 3M1GA 4EC0A 5HFKA 1K0DA 1M9BA 3KXOA 5IQYA 4HI7A 1EV4A 1MD4A 3U6VA 3GX0A 4ZB8A 3GTUA 5F05A 2GLRA 4HZ2A 5AIXA 3FR9A 1GUHA 2HSMA 2AHEA 4IQAA 1XWGA 3Q18A 3R2QA 5AGYA 4IQ1A 2VCVA 3FR3A 5EL8A 4ACSA 2C4JA 4Q5NA 4TOPA 1YY7A 2VCZA 3GSTA 3GTUB 2GSQA 2X64A 1C72A 4MPGA 4ZB6A 2GSRA 3F63A 5D9XA 2ON5A 3M3MA 3ZFBA 8GSSA 1PX7A 3FRCA 1YKCA 2N5FA 1GSEA 2VCQA 4J2FA 5KEJA 4HOJA 5DJMA 5ECIB 2IL3A 3Q74A 4PUAA 1GTBA 3QAGA 1F3AA 1PL1A 4KGIA 5ECLB 3HJOA 1IYIA 5B7CA 1K0MA 5DQSA 3QAWA 2HQTA 4ZBDA 2FNOA 1YQ1A 2YCDA 1B4PA 4YH2A 3D0ZA 1K0OA 2C80A 4YAPA 2VD1A 1GSUA 3VWXA 4F0CA 5ELAA 4EDYA 1TU8A 2DSAA 5DDLA 1GSDA 1PA3A 1U88A 2CZ3A 5F0GA 1GUMA 4MF5A 3CSHA 1FW1A 3W8SA 4ISDA 1A0FA 2WRTA 5FWGA 4GF0A 1K0AA 2C3NA 1M0UA 4HZ4A 5DALA 2CAIA 1PGTA 2V6KA 3ZMLA 1U3IA 3KJYA 4KAEA 3VK9A 4ZXGA 4KF9A 4Q5RA 1RK4A 4MPFA 22GSA 3TOUA 4PNGA 2WS2A 3LJRA 12GSA 1OE7A 3MDKA 5A5KA 2VCTA 4USSA 2WDUA 5D9WA 1LBKA 2A2RA 4PQIA 4ZBAA 1K0NA 3UBLA 1Y6EA 1GNWA 1OKTA 4G0LA 5ECOB 17GSA 1USBA 5GZZB 3VPQA 2PMTA 5DALB 1MD3A 1JLVA 3G7JA 3M0FA 4L8EA 4IELA 5F07A 3EE2A 3LXZA 1Q4JA 4G0IA 4K0GA 4BVXB 1ML6A 4BL7A 1GWCA 2ON7A 5DCGA 1XW5A 1MTCA 1VF2A 4PQHA 3KTLA 5ECMB 3KM6A 3QR6A 3UBKA 1PKZA 2AAWA 2A2SA 1GSYA 4GCIA 1EOGA 3HJMA 1OE8A 2HRKA 3ERFA 1K3YA 3I6AA 3F6DA 2D2ZA 5DJLA 1KBNA 10GSA 3VI7A 1GNEA 5LCZA 3ZFLA 1BYEA 3F6FA 5JCWA 1AQXA 3VI5A 3VURA 1AW9A 4RI7A 2HSMB 4MF6A 1EOHA 4G9HA 1R5AA 5EY6A 3WD6A 1GTAA 3UVHA 1NHYA 1DUGA 3N5OA 5J4UA 3PGTA 1EV9A 3TOTA 2PGTA 4E8HA 3IE3A 2YV7A 4GSSA 3RBTA 1K0BA 1GSSA 4F03A 4WR5A 2OADA 3I69A 3LQ7A 4RI6A 2GSSA 5D9TA 4ECJA 5FHIA 5A4UA 3IK7A 4PXOA 4EDZA 4IS0A 1VF1A 4WR4A 5F8BA 3L0HA 4GLTA 3CRTA 3DGQA 4Q5FA 1UA5A 2NTOA 3GURA 4N0VA 4ZBBA 1GSFA 5JCUA 4K0NA 1TU7A 1YDKA 5BMUA 1AXDA 1VF4A 2GTUA 4IKHA 5EVOA 3DD3A 20GSA 3M8NA 1PKWA 2C3TA 3LYKA 6GSXA 3VPTA 4KDUA 2GSTA 1B48A 4PTSA 1FHEA 4KH7A 4KX4A 1JLWA 3LFLA 1GTUA 4HJ2A 4ID0A 4DEJA 3ERGA 5D9VA 4CHSA 1BX9A 1PL2A 2AB6A 3GH6A 2R4VA 2VO4A 1F3BA 3QAVA 4FQUA 6GSSA 1G6YA 4L5LA 4MDCA 5AN1A 18GSA 1M9AA 5ECHB 4F0BA 1GUKA 3MAKA 3O76A 4O7HA 4MZWA 4E8EA 1E6BA 5GSSA 1XWKA 2WB9A 19GSA 1PX6A 3UARA 3LXTA 3PPUA 5G5EA 4IBPA 4KDXA 3NIVA 1GLPA 1GSQA 4OFTA 2OA7A 2WJUA 3O3TA 1JZRA 3KMNA 1B8XA 1PD21 4MK3A 4PX1A 5AISA 2C8UA 2IMKA 1K3OA 1HNAA 4PURA 3LSZA 1V40A 3BBYA 3VLNA 4PGTA 1AQVA 4JBBA 2CZ2A 2CAQA 4MP4A 5ECRB 2FHEA 2VCWA 3PR8A 4NHZA 9GSSA 4YQVA 4ECCA 2JL4A 4GTUA 4EE0A 2GDRA 3GUSA 1N2AA 4G10A 4OFNA 2HNLA 2CA8A 4AGSA 2C3QA 1GTIA 3CRUA 4G19A 4BL7B 1M99A 2VCXA 4YAVA 3WYWA 2R6KA 5J5NA 5ECPB 5DAKA 3FR6A 4Q5QA 4NAXA 1K3LA 2IMIA 1K0CA 3N9JA 3ZMKA 3H1NA 4GSTA 1PMTA 6GSYA 1IYHA 4NHWA 4O92A 4QQ7A 2HRKB 5FT3A 4IGJA 2OACA 2J9HA 4LMVA 5ECQB 5ECSA 1ZGNA 1F2EA 6GSVA 3KMOA 3P90A 5D73A 11GSA 1HQOA 1XW6A 2F3MA 6GSTA 1GLQA 3ISOA 5DAKB 4L5OA 4LMWA 3FYGA 3C8EA 16GSA 2YV9A 2PERA 3R3EA 4JZQA 4IVFA 2UZ8A 5A4WA 3EINA 1Z9HA 14GSA 6GSWA 1U87A 5F06A 4MF7A 5AIVA 6GSUA 2R3XA 4OMVA 3CSJA 1HNCA 2HRAA 4KDYA
chains in the Genus database with same CATH superfamily
3TGZA 4ZL7A 1NSWA 2OKAA 1SL1B 2TRCP 4I6XA 1ZCPA 4N30A 2YJHA 3LYPA 2WGRA 3IC8A 2NDOA 5G5FA 3HA9A 3FZ4A 3D22A 3GRXA 3WT2A 2WCIA 1EP8A 3GN3A 1ZL9A 4XS1A 2DC5A 1G6WA 2MMOA 5KN2A 3CTFA 3CBUA 1F6MC 3TUEA 3HZ4A 3LG6A 3W8JA 5IMAA 3P8WA 1QK8A 3IR4A 1LJRA 4EXJA 2PWJA 4HU7A 2F8FA 1EEMA 2AYTA 2GQMA 2PBJA 2CVBA 4V1Ap 3QPMA 1DSBA 5C04A 5HFKA 3HZ8A 4KW6A 1THXA 2QKEA 4HI7A 3IPZA 4PUFC 3GX0A 4ZB8A 5F05A 3TCOA 1R26A 2L4CA 1GUHA 2FD3A 1SKWB 1R5PA 2E7PA 3R2QA 3EVIA 5AGYA 4IQ1A 3IV4A 1B9XC 4JR4A 4ACSA 2C4JA 2IFQB 3RPPA 1OC8A 5CRWA 4ZB6A 1C72A 2I81A 4J57E 1AAZA 3KEBA 4FH8A 2N5FA 1GSEA 4KA0A 5JWRB 3ZRDA 3TKRA 3QFBC 2PU9C 2X8CA 4TR3A 2LEGA 3Q74A 1ZZYA 1F3AA 5A1NA 5G1LA 4QMKA 4KGIA 3KD0A 2WZ9A 3HJOA 2X8HA 2M46A 1ERVA 2F8AA 5DQSA 1EEJA 1J9BA 3HY2A 5D96A 4AJ7A 4ZBDA 3GMFA 1SVOA 4ML1A 2B1KA 2DIYA 3ZIVA 1B4PA 4AF2A 2WULA 2LRCA 2HSYA 2VD1A 5E4WA 1SENA 2O5VA 1XW9A 1Z6MA 1DE1A 4EDYA 1Z7RA 1GSDA 2R0GA 2CZ3A 2LJKA 3HCZA 3L9UA 4NMUA 5FWGA 4GF0A 4X1UA 5L71A 1K0AA 5DALA 4PQ1A 1U3IA 3KJYA 4KAEA 4YKFA 2JSZA 2P5RA 2DJ3A 3FHKA 5DBQA 3TOUA 5JWOB 2O85A 5A5KA 4USSA 2PVOC 5D9WA 5J40A 3BJ5A 1GNWA 1OKTA 4IJ3A 3CMIA 5ECOB 4NPBA 1TRUA 17GSA 2VOCA 5GZZB 1ERTA 2H19A 3LORA 1JLVA 1WJKA 1XZOA 2FWEA 3U5RE 1SKRB 5F07A 4TN8A 1ZYQB 1Q4JA 3C7MA 1GWCA 5DCGA 1MTCA 5ECMB 1X5EA 2X4AA 2FCHA 3IXRA 5G30A 1GSYA 1N8JA 5G1KA 1EOGA 2HRKA 3WGEA 1OC9A 2D2ZA 2IMEA 1SJIA 2XBIA 3UJ1A 3VI7A 1RW1A 1XOAA 2TIRA 4WBJA 2GT5A 1TOFA 1T1VA 4MF6A 1SD9A 2AV4A 2K8SA 5EY6A 1OAZA 5J4UA 4MH3A 3PGTA 1ACVA 5LNKe 1EV9A 4PHZC 3I43A 4HUAA 2YV7A 1S3AA 4F03A 1QGVA 4WKWA 2P5QA 3LQ7A 4RI6A 4ECJA 5A4UA 3IK7A 3MSZA 3CRTA 2IMFA 2X99A 4ZBBA 2FWFA 3DXBA 5JCUA 2QA1A 1V98A 1AXDA 4IKHA 2GTUA 3CQFA 4AJ6A 3IHGA 20GSA 3M8NA 1PKWA 4KDUA 2GSTA 1FAAA 3HXSA 2H71A 2YANA 1GTUA 2DJ1A 4JU5A 1M2BA 4ID0A 3EURA 5GAND 1BX9A 2AB6A 2H8LA 4ZB7A 5BMUB 3L78A 6GSSA 2MZCA 2HE3A 4K8MA 5AN1A 3CTGA 2CVKA 2GZZA 2HZFA 4FIWA 1O85A 3C73A 4D73A 4LA1A 1YVLA 1PX6A 1FB0A 3PPUA 2IMDA 5HR1A 5J4YA 5IMCA 1U6TA 5KOXA 2XHFA 2B5XA 1QQ2A 2LKUA 2EIRA 2OA7A 1JZRA 1JZWA 3KMNA 4PX1A 1QXHA 4GQFA 2IMKA 2BJXA 5IOWA 2LS5A 3QD9A 1JHBA 3KH7A 3DMLA 3VWUA 2CAQA 5ECRB 2G2QA 4WF5A 3P2AA 3UOMA 3GUSA 4TR4A 1ZOFA 4FXYP 2C3QA 1GTIA 3CRUA 4G19A 2R6KA 1RQMA 5J9BA 5DAKA 4Q5QA 2R0CA 1H75A 2JACA 1YF1A 4O92A 3DVXA 2HRKB 5FT3A 5JWQB 4IGJA 5ID2B 2J9HA 4TR1A 2V32A 3BCIA 6GSVA 3KMOA 1SJZA 5D73A 1H4OA 11GSA 1HQOA 6GSTA 2LSTA 2CT6A 2H6ZA 3O6TA 4LMWA 3FYGA 3LW9A 2H0GA 2PERA 3EINA 3DYRA 1TJDA 14GSA 4NWYA 5F06A 4N0ZA 5AIVA 2B3SA 2R3XA 2HRAA 4KDYA 3ME7A 1YEWC 4KSMA 1ZMAA 5GAPD 2HYXA 4I97A 4OO4A 3TKQA 3QCPA 1EZKA 2VD0A 1EGRA 3UAPA 2PVQA 1NW2A 4A5PA 3WT1A 2YZHA 2O36A 4XCSA 1FVKA 1SU9A 1A2LA 1TDIA 5J41A 3AY8A 7GSSA 4YQUA 2HZEB 3UMAA 4KCEA 2LNTA 3SWLA 4WETA 5CRGA 4WF4A 4HEA2 2FUG2 1AIUA 2LJRA 4PNFA 4IP1A 4BVXA 4G0KA 2OE3A 1X5CA 3VWVA 3GL3A 5DVBA 3TJKA 1BG5A 2V6OA 1PN9A 2KOKA 13GSA 2R5GA 3VWWA 5LD0A 2NVLA 3HKRA 4JEDA 1HNBA 5B6NA 2IFQA 2P31A 1TI3A 2LV3A 4NV2A 1K0DA 1M9BA 2H1GA 3KXOA 1BG1A 1MD4A 4OCEA 3M9JA 3GKKA 3UL3A 4PI0C 1XWBA 3A2VA 3HVVA 3ZVJD 2HSMA 4KSOA 1I1IP 2H6XA 3KZQA 5C00A 3EC3A 3A2WA 5IPHA 3EMXA 2VCZA 2WZSA 1SK0A 4FYUA 2X64A 1SYRA 4K5RA 4I5QA 2GSRA 2B6MA 2L5OA 3ZFBA 1W4VA 3GA4A 3FRCA 2VCQA 2HRFA 2J23A 3K8NA 5DJMA 3FZ5A 2C0DA 5HR0A 3QAGA 1PL1A 5IMDA 5ECLB 4TR1B 3EU4A 2YNXA 1K0MA 3QAWA 2L5LA 2FNOA 4MLYA 2LQOA 1YQ1A 1X9WB 2YCDA 5CYYA 1K0OA 4NXIA 1GSUA 2O89A 3Q6OA 4F0CA 5IO0A 2AJQB 5DDLA 1PA3A 1U88A 2O87A 4GRFA 3IC4A 2GZPA 4K7OA 3A2XA 3P7XA 3L9SA 3W8SA 1HYUA 2WVXB 2LUSA 2E2GA 1AC1A 1PN0A 2C3NA 2HRNA 2ZUPA 3BD2A 2CAIA 5A34A 2R37A 5G31A 2FY6A 4MPFA 3C1RA 12GSA 3FEUA 5HR2A 1ZYPA 2NBSA 3F3QA 1M3JA 5IOXA 2WDUA 2M80A 4ZIJA 4PQIA 1K0NA 1BJXA 3GV1A 3VPQA 2GVPA 2OBKA 2JU5A 3F0IA 3G7JA 3M0FA 3F4TA 3TDGA 2XPEA 4ZILA 1E2YA 4BVXB 2ON7A 4MJCA 4PQHA 3E0UA 4CW9A 2A2SA 2BMXA 4GCIA 3HJMA 2A2PA 1K3YA 3I6AA 1I9DA 2EIOA 5DJLA 3NOFA 10GSA 3DVWA 1GNEA 5D8IA 3GKNA 2K9FA 1BYEA 1Q98A 2YZUA 3F6FA 1Y1UA 5JCWA 3TU3B 1WOUA 2HSMB 4O5QA 1EOHA 1OC3A 3WD6A 1DUGA 4XRAA 2PGTA 1FOHA 2FWGA 2ZCTA 3ZIJA 4WR5A 1SD8A 4E68A 2VIMA 2GSSA 5FHIA 1BQ7A 5ABRA 4RQXA 4PXOA 3ERWA 1VF1A 4WR4A 2H75A 4FYBA 3L0HA 1A0RP 3DGQA 4K5SA 1UA5A 1UN2A 5BMUA 5CRHA 5EVOA 2H72A 2WW0A 3F3RA 2C3TA 2H76A 4X43A 1QFNA 2ZNMA 1TRVA 2RUFA 4PTSA 3GKMA 1JLWA 3HVXA 3LFLA 1S3RA 2QC7A 4X4JA 5B6MA 2GZYA 4HSCX 5IPGA 3GH6A 2VO4A 2L6CA 5HR3A 1F9MA 2HFDA 3F9UA 4L5LA 2VKZG 4MDCA 3HMJG 3US3A 5ECHB 1TRSA 3O76A 3JCML 4O7HA 1X9SB 1E6BA 2A4VA 2IN3A 5GSSA 2VM2A 5ENUA 4BIKA 1X0RA 4XS4B 1JFUA 4ICYA 1A8LA 2DKHA 3LXTA 4KDXA 1O8XA 4POKA 5A34B 1GSQA 1T4YA 4OFTA 2WJUA 3O3TA 4XS6A 1SKSB 5AISA 5J47A 1T3BA 1BF5A 4W66A 1K3OA 4IHUA 3ED3A 4O32A 3EPTA 1EWXA 5CNWA 4PGTA 1VGLA 4XIHA 4JBBA 5IMFA 1O73A 2FHEA 3RPNA 1SL0B 5ID2A 2OT3A 4ECCA 4G10A 1N2AA 5INYA 2HNLA 3TB2A 4KCAA 4DSQA 1KEBA 3WGXA 1QMVA 5ECPB 3FR6A 4NAXA 1K0CA 3ZMKA 3ZL5A 1PMTA 4NHWA 3QMXA 4G01A 2DBCA 2MMNA 3D5JA 4LMVA 5ECQB 2KHPA 4I2UA 3L4NA 4BPYA 1BEDA 2F3MA 1XWAA 4V2NA 3ZREA 4MZCA 1OVNA 2VLUA 4L0UA 3C8EA 2K8VA 3GX8A 3RDWA 2OJLA 4JZQA 2NPBA 4G2EA 4GWRA 4IVFA 2UZ8A 5A4WA 4HU9A 6GSWA 2QSIA 3DWVA 4TRXA 1XPVA 4OMVA 3HYPA 2HZEA 2JADA 3EYTA 4HS1A 4K6XA 3RHBA 4LL1B 3IAM2 3G7YA 1WWJA 2LRNA 5CP1A 3IK9A 5ELGA 4ECBA 3UVTA 3RAZA 1S3DA 2HT9A 4FO5A 4GXZA 2CVDA 5ECNB 4ECIA 1VF3A 5IIZA 1BAYA 1SVLA 4Z7XA 1YJ6A 2GQLA 1T7PB 1M2DA 1HD2A 4ZL9A 3RGBC 3Q19A 2E0QA 4Z2UA 3TJFA 2ALBA 1TTZA 3RHCA 1X9MB 2WW2A 1OKDA 2DLXA 1A24A 3GL5A 4BVYB 2XPDA 4XRDA 4I2TA 4JR6A 1OYJA 3D6IA 4RQRA 3FZ9A 1G7OA 3G7IA 4CY8A 1NHOA 3M1GA 3IDVA 2RLIA 3GNJA 2GLRA 4HZ2A 5AIXA 2CX4A 3FR9A 2LNSA 3TRXA 1JZDA 2AHEA 3H4KA 4IQAA 3ME8A 3CHXC 4MA9A 1XWGA 3Q18A 4QL7A 3MYDA 5KN1A 4DSSB 5EL8A 3CYNA 4TOPA 2VAFA 4Z2TA 3GTUB 4MPGA 3NZNA 2ON5A 3M3MA 3F8UA 3IAS2 8GSSA 3TJGA 4TR0A 2X49A 3TKSA 4XHMA 2V2GA 5KEJA 3J7Yb 4EVMA 2IL3A 4PUAA 4K9ZA 1TI1A 2JZSA 4O5RA 1J08A 3EU3A 2UV8G 2HQTA 1T8EB 1G7EA 2H01A 2XC2A 2WVXA 1XXUA 1R7HA 3D0ZA 2C80A 2B5EA 2C0EA 4AKHA 3VWXA 4OO5A 5ELAA 4IP6A 1CQHA 3D21A 1O6JA 1GUMA 1M2AA 4MF5A 2LTKA 5HFIA 1FW1A 4ISDA 2WRTA 2ES7A 3FKFA 4OD7A 2RUEA 1M0UA 4HZ4A 1XIYA 1S4BP 4EUYA 1URMA 1PGTA 2V6KA 3ZMLA 3VK9A 4KF9A 4Q5RA 1RK4A 4F2IA 2L4QA 1OE7A 3F4SA 3TKPA 4K7NA 1LBKA 2A2RA 3UBLA 4JRRA 2MBTA 3L9VA 4TW5A 4Z2RA 2VL9A 4V2LA 1MD3A 2O3EA 4YKGA 2H1DA 3J7Yk 1TK8B 2H0IA 5J3RA 4IELA 3EE2A 5IMZA 4G0IA 4K0GA 2N5AA 4BL7A 4H86A 3IHQA 2VL3A 1XW5A 1VF2A 2O7KA 2XBQA 4JE1A 3HHVA 3ERFA 2H1AA 2MYGA 1WIKA 2L59A 5KOWA 1F37A 3TJBA 5LCZA 2DIZA 2DMLA 3ZFLA 4POLA 3SBCA 4MJBA 2I1UA 3VI5A 2P0GA 4RI7A 3FK8A 5H5RA 4XTSA 3M9KA 4G9HA 1R5AA 5H5QA 4MMMA 1O7UA 5H5SA 2QGVA 2LJAA 1GTAA 3UVHA 1NHYA 3N5OA 2C0FA 4I8BA 4EO3A 2RM6A 4HQSA 2YWOA 1K0BA 2EC4A 2I3YA 1GSSA 3CWGA 5KN3A 1EGOA 2OADA 4ML6A 5D9TA 4P3YB 2I4AA 4IS0A 5F8BA 4GLTA 2NTOA 3TKSE 3VFIA 4N0VA 1TU7A 1YDKA 4BA7A 1O81A 1X5DA 2LQQA 3LYKA 5DCHA 4EL1A 1B48A 2AUVA 4AJ8A 1ERWA 2FA4A 1FHEA 4KH7A 1UVZA 2K6VA 2EFDA 4XS4A 3ERGA 5D9VA 1AUCA 1MDIA 4CHSA 1PL2A 4V1Ag 5CO3A 4MJEA 3QAVA 4FQUA 1Y25A 1G6YA 2FWHA 4OWYA 4WXTA 18GSA 1M9AA 3ZITA 2H70A 3MAKA 3KP9A 1XWKA 2WB9A 5J9CA 2WW1A 4BWQA 3UARA 5G5EA 3H93A 4IBPA 1A2JA 3NIVA 4O5UA 1YEXA 4TKYA 4QL9A 2MBSA 1VRSD 4N11A 1M3IA 3ZLPA 1PD21 1Z7PA 3BCKA 4PURA 2H74A 3LSZA 1SYXA 1V40A 1I5GA 3GH9A 3BBYA 3TRPA 1XFLA 5IO2A 2QA2A 3KH9A 4MP4A 3RFRC 2VCWA 1XVQA 4X0XA 1SJ6A 2X8GA 4EKZA 3PR8A 1YF0A 5G2ZA 4YQVA 1TRWA 4KUNA 4GTUA 1YZXA 5E59A 4OFNA 4AGSA 3KTBA 2H6YA 3IRAA 4BL7B 4TXOB 4YAVA 3WYWA 1PSQA 2N5BA 4F9ZA 2VLVA 2MMAA 4OCFA 1MDJA 2KLXA 4GSTA 2B1LA 4RUVA 1IYHA 2I9HA 2GQKA 4HJMA 4QQ7A 1Z3EA 2OACA 2YWNA 1DE2A 5ECSA 1ZGNA 1F2EA 4CDOA 3KIJA 1B9YC 1XW6A 1NM3A 1GLQA 3ISOA 1O8WA 1PQNA 1GP1A 4GDFA 4FYCA 3FMWA 2YV9A 3R3EA 1Z9HA 4K2XA 2B7KA 2YOIA 4ILFA 3BOAA 1U87A 1A23A 6GSUA 1KTEA 1ST9A 1MDKA 3APQA 5ECKB 2RIIA 5CREA 1V2AA 5GSTA 3A5IA 4YQMA 4IJIA 4N3ZA 2HSNB 2JZRA 2OE1A 2YN1A 4GSNA 3KP8A 3HD5A 4BVYA 4OFMA 3C71A 2K18A 3CSIA 3KGKA 2OE0A 5IM9A 2HSHA 3GIXA 1TW9A 3LGCA 4KE3A 1V9WA 2DJ0A 5JCGA 4ZB9A 3H8QA 2EFCA 4LLRA 2KP1A 3IOSA 5A4VA 5COHA 3IBHA 1AQWA 1U3AA 2G0FA 3ZZXA 2V41A 3W6GA 1YEPA 2PPTA 3I9V2 4K7IA 4IW9A 5HFGA 4DSSA 3GSSA 3FY7A 1GULA 4EC0A 3TJJA 4PI2C 5IQYA 3UEMA 1EV4A 3U6VA 4HQZA 3GTUA 1ZYNA 3DEXA 1WMJA 3V1WA 4CY6A 2C1YA 2F51A 2H73A 3F4RA 4MNNA 1B4QA 2GS3A 3A3TA 4ZL8A 1SK1A 3D4TA 2VCVA 3FR3A 4Q5NA 4ULXA 1YY7A 4AKGA 1LU4A 3GSTA 1KNGA 5CAXA 4DVCA 2GSQA 3F63A 5D9XA 5HQPA 2R0PA 1GRXA 1XG8A 1PX7A 1YKCA 2DKIA 3HJPA 4J2FA 5EPFA 4HOJA 2IPAA 2LRTA 5ECIB 2EFHA 1GTBA 1TK0B 1IYIA 5B7CA 3LEFA 3MWHA 3EMPA 4YH2A 1PFOA 4YAPA 5IMVA 2FA8A 3DIEA 5CRDA 5B8BA 1TU8A 5A1NB 2DSAA 2JSYA 1V57A 5F0GA 2HXKA 3CSHA 2VUPA 1Z5YE 1EP7A 2IJYA 1THOA 4F82A 2YJ7A 3DKSA 1A0FA 2A4HA 1SVMA 3HVSA 3MIXA 2R2JA 2L6DA 2YWMA 3GHAA 1ABAA 1Z6NA 4KB3A 4ZXGA 1FG4A 1DBYA 3MNGA 3QOUA 22GSA 1ILOA 4PNGA 4EF0A 2WS2A 3LJRA 3FZAA 2EIQA 3MDKA 4POBA 3EWLA 2VCTA 2FLSA 4MZBA 4ZBAA 2E2MA 1Y6EA 1FVJA 4G0LA 1USBA 2PMTA 5DALB 4AKXB 2JZTA 1TK5B 3QFAC 4L8EA 2WVYA 4J56E 3LXZA 1A8YA 3UIWA 1ML6A 2IIYA 3GKXA 4WEYA 3KTLA 2KP2A 3KM6A 4WBRD 4EIQA 1G0TA 3QR6A 3UBKA 1PKZA 4MJAA 2AAWA 2F9SA 1SL2B 2REMA 1OE8A 3F6DA 3LWAA 1KBNA 2C0GA 3DRNA 2BTOT 4K1FA 5B8AA 2IWTA 2VM1A 4GQCA 5BRTA 1XVWA 2H30A 1MEKA 2HLSA 5A5HA 2H66A 1AQXA 5DQYA 3VURA 4L0WA 1AW9A 4MCUA 3D4MA 4AI6A 2DJKA 4AKIA 2CQ9A 1XWCA 1S3CA 2YWIA 2WFCA 1ERUA 5J4VA 1WP0A 3TOTA 4E8HA 1FB6A 1OC9B 3IE3A 4GSSA 3RBTA 4KNDA 3S9FA 2M72A 3APSA 3I69A 2L57A 2H1BA 4EDZA 3ZYWA 4Q5FA 3GURA 1XCCA 1GSFA 2B5YA 4K0NA 2TRXA 2H0HA 1WE0A 4POMA 1VF4A 5D93A 3DD3A 1QUWA 1FO5A 6GSXA 3VPTA 2DMMA 1T00A 2WW3A 2VL2A 1JZOA 3APOA 3IA1A 2OBIA 4KX4A 4HJ2A 3HVNA 4DEJA 1FOVA 1R4WA 2R4VA 1M7TA 4MABA 3TKSC 3QDNA 2HI7A 1F3BA 2YP6A 3PINA 3PH9A 1SK2A 2FGXA 2H1LA 4F0BA 1GUKA 4TVEA 4N10A 4MZWA 4E8EA 19GSA 1N25A 1WRYA 2V1MA 1GLPA 3GYKA 1A2MA 3E9JB 1GL8A 5KN0A 2Z9SA 4TXOA 1B8XA 4MK3A 2VL2C 2C8UA 1WPIA 1HNAA 3ZTLA 4D73B 4LL4B 3VLNA 2MMZA 1AQVA 4NV5A 1UC7A 2CZ2A 2YPMA 4DSRA 1GH2A 4NHZA 9GSSA 3GFKA 2CV4A 3WGDA 2JL4A 1V58A 4EE0A 2GDRA 2CA8A 1TP9A 1M99A 2VCXA 5J5NA 1XBSA 1W89A 4HDEA 1K3LA 2VLTA 1ZYEA 2IMIA 1PRXA 2DJ2A 3E3EA 3H79A 3N9JA 4V2MA 3CXGA 3H1NA 6GSYA 2DJJA 2PUKC 4BWSA 2GGTA 3KCMA 2B7JA 1CQGA 1T4ZA 2GT6A 1XOBA 4IN0A 3P90A 3C1SA 2PN8A 5A5HB 2RM5A 5DAKB 4L5OA 3G9BA 1TKDB 3A5WA 2CX3A 16GSA 3OR5A 2O8VB 1J0FA 4K2DA 2EFEA 2HSNA 4EIPA 1YKAA 2KUCA 3FW2A 4MH2A 1ON4A 4TXVA 1TXXA 3TRQA 4MF7A 1TXUA 3ZVJA 3CSJA 2WVZA 1HNCA 3HDCA
chains in the Genus database with same CATH topology
3TGZA 4ZL7A 1NSWA 2OKAA 1SL1B 2TRCP 4I6XA 1ZCPA 4N30A 2YJHA 3LYPA 2WGRA 3IC8A 2NDOA 5G5FA 3HA9A 3FZ4A 3D22A 3GRXA 3WT2A 2WCIA 1EP8A 3GN3A 1ZL9A 4XS1A 2DC5A 1G6WA 2MMOA 5KN2A 3CTFA 3CBUA 1F6MC 3TUEA 3HZ4A 3LG6A 3W8JA 5IMAA 3P8WA 1QK8A 3IR4A 1LJRA 4EXJA 2PWJA 4HU7A 2F8FA 1EEMA 2AYTA 2GQMA 2PBJA 2CVBA 4V1Ap 3QPMA 1DSBA 5C04A 5HFKA 3HZ8A 4KW6A 1THXA 2QKEA 4HI7A 3IPZA 4PUFC 3GX0A 4ZB8A 5F05A 3TCOA 1R26A 2L4CA 1GUHA 2FD3A 1SKWB 1R5PA 2E7PA 3R2QA 3EVIA 5AGYA 4IQ1A 3IV4A 1B9XC 4JR4A 4ACSA 2C4JA 2IFQB 3RPPA 1OC8A 5CRWA 4ZB6A 1C72A 2I81A 4J57E 1AAZA 3KEBA 4FH8A 2N5FA 1GSEA 4KA0A 5JWRB 3ZRDA 3TKRA 3QFBC 2PU9C 2X8CA 4TR3A 2LEGA 3Q74A 1ZZYA 1F3AA 5A1NA 5G1LA 4QMKA 4KGIA 3KD0A 2WZ9A 3HJOA 2X8HA 2M46A 1ERVA 2F8AA 5DQSA 1EEJA 1J9BA 3HY2A 5D96A 4AJ7A 4ZBDA 3GMFA 1SVOA 4ML1A 2B1KA 2DIYA 3ZIVA 1B4PA 4AF2A 2WULA 2LRCA 2HSYA 2VD1A 5E4WA 1SENA 2O5VA 1XW9A 1Z6MA 1DE1A 4EDYA 1Z7RA 1GSDA 2R0GA 2CZ3A 2LJKA 3HCZA 3L9UA 4NMUA 5FWGA 4GF0A 4X1UA 5L71A 1K0AA 5DALA 4PQ1A 1U3IA 3KJYA 4KAEA 4YKFA 2JSZA 2P5RA 2DJ3A 3FHKA 5DBQA 3TOUA 5JWOB 2O85A 5A5KA 4USSA 2PVOC 5D9WA 5J40A 3BJ5A 1GNWA 1OKTA 4IJ3A 3CMIA 5ECOB 4NPBA 1TRUA 17GSA 2VOCA 5GZZB 1ERTA 2H19A 3LORA 1JLVA 1WJKA 1XZOA 2FWEA 3U5RE 1SKRB 5F07A 4TN8A 1ZYQB 1Q4JA 3C7MA 1GWCA 5DCGA 1MTCA 5ECMB 1X5EA 2X4AA 2FCHA 3IXRA 5G30A 1GSYA 1N8JA 5G1KA 1EOGA 2HRKA 3WGEA 1OC9A 2D2ZA 2IMEA 1SJIA 2XBIA 3UJ1A 3VI7A 1RW1A 1XOAA 2TIRA 4WBJA 2GT5A 1TOFA 1T1VA 4MF6A 1SD9A 2AV4A 2K8SA 5EY6A 1OAZA 5J4UA 4MH3A 3PGTA 1ACVA 5LNKe 1EV9A 3I43A 4HUAA 2YV7A 1S3AA 4F03A 1QGVA 4WKWA 2P5QA 3LQ7A 4RI6A 4ECJA 5A4UA 3IK7A 3MSZA 3CRTA 2IMFA 2X99A 4ZBBA 2FWFA 3DXBA 5JCUA 2QA1A 1V98A 1AXDA 4IKHA 2GTUA 4AJ6A 3IHGA 20GSA 3M8NA 1PKWA 4KDUA 2GSTA 1FAAA 3HXSA 2H71A 2YANA 1GTUA 2DJ1A 4JU5A 1M2BA 4ID0A 3EURA 5GAND 1BX9A 2AB6A 2H8LA 4ZB7A 5BMUB 3L78A 6GSSA 2MZCA 2HE3A 4K8MA 5AN1A 3CTGA 2CVKA 2GZZA 2HZFA 4FIWA 1O85A 3C73A 4D73A 4LA1A 1YVLA 1PX6A 1FB0A 3PPUA 2IMDA 5HR1A 5J4YA 5IMCA 1U6TA 5KOXA 2XHFA 2B5XA 1QQ2A 2LKUA 2EIRA 2OA7A 1JZRA 1JZWA 3KMNA 4PX1A 1QXHA 4GQFA 2IMKA 2BJXA 5IOWA 2LS5A 3QD9A 1JHBA 3KH7A 3DMLA 3VWUA 2CAQA 5ECRB 2G2QA 4WF5A 3P2AA 3UOMA 3GUSA 4TR4A 1ZOFA 2C3QA 1GTIA 3CRUA 4G19A 2R6KA 1RQMA 5J9BA 5DAKA 4Q5QA 2R0CA 1H75A 2JACA 1YF1A 4O92A 3DVXA 2HRKB 5FT3A 5JWQB 4IGJA 5ID2B 2J9HA 4TR1A 2V32A 3BCIA 6GSVA 3KMOA 1SJZA 5D73A 1H4OA 11GSA 1HQOA 6GSTA 2LSTA 2CT6A 2H6ZA 3O6TA 4LMWA 3FYGA 3LW9A 2H0GA 2PERA 3EINA 3DYRA 1TJDA 14GSA 4NWYA 5F06A 4N0ZA 5AIVA 2B3SA 2R3XA 2HRAA 4KDYA 3ME7A 4KSMA 1ZMAA 5GAPD 2HYXA 4I97A 4OO4A 3TKQA 3QCPA 1EZKA 2VD0A 1EGRA 3UAPA 2PVQA 1NW2A 4A5PA 3WT1A 2YZHA 4XCSA 1FVKA 1SU9A 1A2LA 1TDIA 5J41A 3AY8A 7GSSA 4YQUA 2HZEB 3UMAA 4KCEA 2LNTA 3SWLA 4WETA 5CRGA 4WF4A 4HEA2 2FUG2 1AIUA 2LJRA 4PNFA 4IP1A 4BVXA 4G0KA 2OE3A 1X5CA 3VWVA 3GL3A 5DVBA 3TJKA 1BG5A 2V6OA 1PN9A 2KOKA 13GSA 2R5GA 3VWWA 5LD0A 2NVLA 3HKRA 4JEDA 1HNBA 5B6NA 2IFQA 2P31A 1TI3A 2LV3A 4NV2A 1K0DA 1M9BA 2H1GA 3KXOA 1BG1A 1MD4A 4OCEA 3M9JA 3GKKA 3UL3A 3A2VA 1XWBA 3HVVA 3ZVJD 2HSMA 4KSOA 2H6XA 3KZQA 5C00A 3EC3A 3A2WA 5IPHA 3EMXA 2VCZA 1SK0A 4FYUA 2X64A 1SYRA 4K5RA 4I5QA 2GSRA 2B6MA 2L5OA 3ZFBA 1W4VA 3GA4A 3FRCA 2VCQA 2HRFA 2J23A 3K8NA 5DJMA 3FZ5A 2C0DA 5HR0A 3QAGA 1PL1A 5IMDA 5ECLB 4TR1B 3EU4A 2YNXA 1K0MA 3QAWA 2L5LA 2FNOA 4MLYA 2LQOA 1YQ1A 1X9WB 2YCDA 5CYYA 1K0OA 4NXIA 1GSUA 2O89A 3Q6OA 4F0CA 5IO0A 2AJQB 5DDLA 1PA3A 1U88A 2O87A 4GRFA 3IC4A 2GZPA 4K7OA 3A2XA 3P7XA 3L9SA 3W8SA 1HYUA 2LUSA 2E2GA 1AC1A 1PN0A 2C3NA 2HRNA 2ZUPA 3BD2A 2CAIA 5A34A 2R37A 5G31A 2FY6A 4MPFA 3C1RA 12GSA 3FEUA 5HR2A 1ZYPA 2NBSA 3F3QA 5IOXA 2WDUA 2M80A 4ZIJA 4PQIA 1K0NA 1BJXA 3GV1A 3VPQA 2GVPA 2OBKA 2JU5A 3F0IA 3G7JA 3M0FA 3F4TA 3TDGA 2XPEA 4ZILA 1E2YA 4BVXB 2ON7A 4MJCA 4PQHA 3E0UA 4CW9A 2A2SA 2BMXA 4GCIA 3HJMA 2A2PA 1K3YA 3I6AA 1I9DA 2EIOA 5DJLA 3NOFA 10GSA 3DVWA 1GNEA 5D8IA 3GKNA 2K9FA 1BYEA 1Q98A 2YZUA 3F6FA 1Y1UA 5JCWA 3TU3B 1WOUA 2HSMB 4O5QA 1EOHA 1OC3A 3WD6A 1DUGA 4XRAA 2PGTA 1FOHA 2FWGA 2ZCTA 3ZIJA 4WR5A 1SD8A 4E68A 2VIMA 2GSSA 5FHIA 1BQ7A 5ABRA 4RQXA 4PXOA 3ERWA 1VF1A 4WR4A 2H75A 4FYBA 3L0HA 1A0RP 3DGQA 4K5SA 1UA5A 1UN2A 5BMUA 5CRHA 5EVOA 2H72A 3F3RA 2C3TA 2H76A 4X43A 1QFNA 2ZNMA 1TRVA 2RUFA 4PTSA 3GKMA 1JLWA 3HVXA 3LFLA 2QC7A 4X4JA 5B6MA 2GZYA 5IPGA 3GH6A 2VO4A 2L6CA 5HR3A 1F9MA 2HFDA 3F9UA 4L5LA 2VKZG 4MDCA 3HMJG 3US3A 5ECHB 1TRSA 3O76A 3JCML 4O7HA 1X9SB 1E6BA 2A4VA 2IN3A 5GSSA 2VM2A 5ENUA 1X0RA 4XS4B 1JFUA 4ICYA 1A8LA 2DKHA 3LXTA 4KDXA 1O8XA 4POKA 5A34B 1GSQA 1T4YA 4OFTA 2WJUA 3O3TA 4XS6A 1SKSB 5AISA 5J47A 1T3BA 1BF5A 4W66A 1K3OA 4IHUA 3ED3A 4O32A 3EPTA 1EWXA 5CNWA 4PGTA 1VGLA 4XIHA 4JBBA 5IMFA 1O73A 2FHEA 3RPNA 1SL0B 5ID2A 2OT3A 4ECCA 4G10A 1N2AA 5INYA 2HNLA 3TB2A 4KCAA 4DSQA 1KEBA 3WGXA 1QMVA 5ECPB 3FR6A 4NAXA 1K0CA 3ZMKA 3ZL5A 1PMTA 4NHWA 3QMXA 4G01A 2DBCA 2MMNA 3D5JA 4LMVA 5ECQB 2KHPA 4I2UA 3L4NA 4BPYA 1BEDA 2F3MA 1XWAA 4V2NA 3ZREA 4MZCA 1OVNA 2VLUA 4L0UA 3C8EA 2K8VA 3GX8A 3RDWA 2OJLA 4JZQA 2NPBA 4G2EA 4GWRA 4IVFA 2UZ8A 5A4WA 4HU9A 6GSWA 2QSIA 3DWVA 4TRXA 1XPVA 4OMVA 3HYPA 2HZEA 2JADA 3EYTA 4HS1A 4K6XA 3RHBA 4LL1B 3IAM2 3G7YA 1WWJA 2LRNA 5CP1A 3IK9A 5ELGA 4ECBA 3UVTA 3RAZA 1S3DA 2HT9A 4FO5A 4GXZA 2CVDA 5ECNB 4ECIA 1VF3A 5IIZA 1BAYA 1SVLA 4Z7XA 1YJ6A 2GQLA 1T7PB 1M2DA 1HD2A 4ZL9A 3Q19A 2E0QA 4Z2UA 3TJFA 2ALBA 1TTZA 3RHCA 1X9MB 1OKDA 2DLXA 1A24A 3GL5A 4BVYB 2XPDA 4XRDA 4I2TA 4JR6A 1OYJA 3D6IA 4RQRA 3FZ9A 1G7OA 3G7IA 4CY8A 1NHOA 3M1GA 3IDVA 2RLIA 3GNJA 2GLRA 4HZ2A 5AIXA 2CX4A 3FR9A 2LNSA 3TRXA 1JZDA 2AHEA 3H4KA 4IQAA 3ME8A 4MA9A 1XWGA 3Q18A 4QL7A 3MYDA 5KN1A 4DSSB 5EL8A 3CYNA 4TOPA 2VAFA 4Z2TA 3GTUB 4MPGA 3NZNA 2ON5A 3M3MA 3F8UA 3IAS2 8GSSA 3TJGA 4TR0A 2X49A 3TKSA 4XHMA 2V2GA 5KEJA 3J7Yb 4EVMA 2IL3A 4PUAA 4K9ZA 1TI1A 2JZSA 4O5RA 1J08A 3EU3A 2UV8G 2HQTA 1T8EB 1G7EA 2H01A 2XC2A 1XXUA 1R7HA 3D0ZA 2C80A 2B5EA 2C0EA 4AKHA 3VWXA 4OO5A 5ELAA 4IP6A 1CQHA 3D21A 1O6JA 1GUMA 1M2AA 4MF5A 2LTKA 5HFIA 1FW1A 4ISDA 2WRTA 2ES7A 3FKFA 4OD7A 2RUEA 1M0UA 4HZ4A 1XIYA 4EUYA 1URMA 1PGTA 2V6KA 3ZMLA 3VK9A 4KF9A 4Q5RA 1RK4A 4F2IA 2L4QA 1OE7A 3F4SA 3TKPA 4K7NA 1LBKA 2A2RA 3UBLA 4JRRA 2MBTA 3L9VA 4TW5A 4Z2RA 2VL9A 4V2LA 1MD3A 4YKGA 2H1DA 3J7Yk 1TK8B 2H0IA 5J3RA 4IELA 3EE2A 5IMZA 4G0IA 4K0GA 2N5AA 4BL7A 4H86A 3IHQA 2VL3A 1XW5A 1VF2A 2O7KA 2XBQA 4JE1A 3HHVA 3ERFA 2H1AA 2MYGA 1WIKA 2L59A 5KOWA 1F37A 3TJBA 5LCZA 2DIZA 2DMLA 3ZFLA 4POLA 3SBCA 4MJBA 2I1UA 3VI5A 2P0GA 4RI7A 3FK8A 5H5RA 4XTSA 3M9KA 4G9HA 1R5AA 5H5QA 4MMMA 1O7UA 5H5SA 2QGVA 2LJAA 1GTAA 3UVHA 1NHYA 3N5OA 2C0FA 4I8BA 4EO3A 2RM6A 4HQSA 2YWOA 1K0BA 2EC4A 2I3YA 1GSSA 3CWGA 5KN3A 1EGOA 2OADA 4ML6A 5D9TA 4P3YB 2I4AA 4IS0A 5F8BA 4GLTA 2NTOA 3TKSE 3VFIA 4N0VA 1TU7A 1YDKA 4BA7A 1O81A 1X5DA 2LQQA 3LYKA 5DCHA 4EL1A 1B48A 2AUVA 4AJ8A 1ERWA 2FA4A 1FHEA 4KH7A 1UVZA 2K6VA 2EFDA 4XS4A 3ERGA 5D9VA 1AUCA 1MDIA 4CHSA 1PL2A 4V1Ag 5CO3A 4MJEA 3QAVA 4FQUA 1Y25A 1G6YA 2FWHA 4OWYA 4WXTA 18GSA 1M9AA 3ZITA 2H70A 3MAKA 3KP9A 1XWKA 2WB9A 5J9CA 4BWQA 3UARA 5G5EA 3H93A 4IBPA 1A2JA 3NIVA 4O5UA 1YEXA 4TKYA 4QL9A 2MBSA 1VRSD 4N11A 3ZLPA 1PD21 1Z7PA 3BCKA 4PURA 2H74A 3LSZA 1SYXA 1V40A 1I5GA 3GH9A 3BBYA 3TRPA 1XFLA 5IO2A 2QA2A 3KH9A 4MP4A 2VCWA 1XVQA 4X0XA 1SJ6A 2X8GA 4EKZA 3PR8A 1YF0A 5G2ZA 4YQVA 1TRWA 4KUNA 4GTUA 1YZXA 5E59A 4OFNA 4AGSA 3KTBA 2H6YA 3IRAA 4BL7B 4TXOB 4YAVA 3WYWA 1PSQA 2N5BA 4F9ZA 2VLVA 2MMAA 4OCFA 1MDJA 2KLXA 4GSTA 2B1LA 4RUVA 1IYHA 2I9HA 2GQKA 4HJMA 4QQ7A 1Z3EA 2OACA 2YWNA 1DE2A 5ECSA 1ZGNA 1F2EA 4CDOA 3KIJA 1B9YC 1XW6A 1NM3A 1GLQA 3ISOA 1O8WA 1PQNA 1GP1A 4GDFA 4FYCA 3FMWA 2YV9A 3R3EA 1Z9HA 4K2XA 2B7KA 2YOIA 4ILFA 3BOAA 1U87A 1A23A 6GSUA 1KTEA 1ST9A 1MDKA 3APQA 5ECKB 2RIIA 5CREA 1V2AA 5GSTA 3A5IA 4YQMA 4IJIA 4N3ZA 2HSNB 2JZRA 2OE1A 2YN1A 4GSNA 3KP8A 3HD5A 4BVYA 4OFMA 3C71A 2K18A 3CSIA 3KGKA 2OE0A 5IM9A 2HSHA 3GIXA 1TW9A 3LGCA 4KE3A 1V9WA 2DJ0A 5JCGA 4ZB9A 3H8QA 2EFCA 4LLRA 2KP1A 3IOSA 5A4VA 5COHA 3IBHA 1AQWA 1U3AA 2G0FA 3ZZXA 2V41A 3W6GA 1YEPA 2PPTA 3I9V2 4K7IA 4IW9A 5HFGA 4DSSA 3GSSA 3FY7A 1GULA 4EC0A 3TJJA 5IQYA 3UEMA 1EV4A 3U6VA 4HQZA 3GTUA 1ZYNA 3DEXA 1WMJA 3V1WA 4CY6A 2C1YA 2F51A 2H73A 3F4RA 4MNNA 1B4QA 2GS3A 3A3TA 4ZL8A 1SK1A 3D4TA 2VCVA 3FR3A 4Q5NA 4ULXA 1YY7A 4AKGA 1LU4A 3GSTA 1KNGA 5CAXA 4DVCA 2GSQA 3F63A 5D9XA 5HQPA 2R0PA 1GRXA 1PX7A 1YKCA 2DKIA 3HJPA 4J2FA 5EPFA 4HOJA 2IPAA 2LRTA 5ECIB 2EFHA 1GTBA 1TK0B 1IYIA 5B7CA 3LEFA 3MWHA 3EMPA 4YH2A 4YAPA 5IMVA 2FA8A 3DIEA 5CRDA 5B8BA 1TU8A 5A1NB 2DSAA 2JSYA 1V57A 5F0GA 2HXKA 3CSHA 2VUPA 1Z5YE 1EP7A 2IJYA 1THOA 4F82A 2YJ7A 3DKSA 1A0FA 2A4HA 1SVMA 3HVSA 3MIXA 2R2JA 2L6DA 2YWMA 3GHAA 1ABAA 1Z6NA 4KB3A 4ZXGA 1FG4A 1DBYA 3MNGA 3QOUA 22GSA 1ILOA 4PNGA 4EF0A 2WS2A 3LJRA 3FZAA 2EIQA 3MDKA 4POBA 3EWLA 2VCTA 2FLSA 4MZBA 4ZBAA 2E2MA 1Y6EA 1FVJA 4G0LA 1USBA 2PMTA 5DALB 4AKXB 2JZTA 1TK5B 3QFAC 4L8EA 4J56E 3LXZA 1A8YA 3UIWA 1ML6A 2IIYA 3GKXA 4WEYA 3KTLA 2KP2A 3KM6A 4WBRD 4EIQA 1G0TA 3QR6A 3UBKA 1PKZA 4MJAA 2AAWA 2F9SA 1SL2B 2REMA 1OE8A 3F6DA 3LWAA 1KBNA 2C0GA 3DRNA 2BTOT 4K1FA 5B8AA 2IWTA 2VM1A 4GQCA 5BRTA 1XVWA 2H30A 1MEKA 2HLSA 5A5HA 2H66A 1AQXA 5DQYA 3VURA 4L0WA 1AW9A 4MCUA 3D4MA 4AI6A 2DJKA 4AKIA 2CQ9A 1XWCA 1S3CA 2YWIA 2WFCA 1ERUA 5J4VA 1WP0A 3TOTA 4E8HA 1FB6A 1OC9B 3IE3A 4GSSA 3RBTA 4KNDA 3S9FA 2M72A 3APSA 3I69A 2L57A 2H1BA 4EDZA 3ZYWA 4Q5FA 3GURA 1XCCA 1GSFA 2B5YA 4K0NA 2TRXA 2H0HA 1WE0A 4POMA 1VF4A 5D93A 3DD3A 1QUWA 1FO5A 6GSXA 3VPTA 2DMMA 1T00A 2VL2A 1JZOA 3APOA 3IA1A 2OBIA 4KX4A 4HJ2A 4DEJA 1FOVA 1R4WA 2R4VA 1M7TA 4MABA 3TKSC 3QDNA 2HI7A 1F3BA 2YP6A 3PINA 3PH9A 1SK2A 2FGXA 2H1LA 4F0BA 1GUKA 4TVEA 4N10A 4MZWA 4E8EA 19GSA 1N25A 1WRYA 2V1MA 1GLPA 3GYKA 1A2MA 3E9JB 1GL8A 5KN0A 2Z9SA 4TXOA 1B8XA 4MK3A 2VL2C 2C8UA 1WPIA 1HNAA 3ZTLA 4D73B 4LL4B 3VLNA 2MMZA 1AQVA 4NV5A 1UC7A 2CZ2A 2YPMA 4DSRA 1GH2A 4NHZA 9GSSA 3GFKA 2CV4A 3WGDA 2JL4A 1V58A 4EE0A 2GDRA 2CA8A 1TP9A 1M99A 2VCXA 5J5NA 1XBSA 1W89A 4HDEA 1K3LA 2VLTA 1ZYEA 2IMIA 1PRXA 2DJ2A 3E3EA 3H79A 3N9JA 4V2MA 3CXGA 3H1NA 6GSYA 2DJJA 2PUKC 4BWSA 2GGTA 3KCMA 2B7JA 1CQGA 1T4ZA 2GT6A 1XOBA 4IN0A 3P90A 3C1SA 2PN8A 5A5HB 2RM5A 5DAKB 4L5OA 3G9BA 1TKDB 3A5WA 2CX3A 16GSA 3OR5A 2O8VB 1J0FA 4K2DA 2EFEA 2HSNA 4EIPA 1YKAA 2KUCA 3FW2A 4MH2A 1ON4A 4TXVA 1TXXA 3TRQA 4MF7A 1TXUA 3ZVJA 3CSJA 1HNCA 3HDCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5ECK B;  3TGZ A;  4KSM A;  3IK9 A;  5ELG A;  4ECB A;  4I97 A;  1V2A A;  5GST A;  3LYP A;  4YQM A;  2VD0 A;  4IJI A;  2HSN B;  3UAP A;  2PVQ A;  3IC8 A;  4GSN A;  4BVY A;  2CVD A;  5ECN B;  4OFM A;  3CSI A;  1TDI A;  5G5F A;  4ECI A;  5J41 A;  1VF3 A;  3AY8 A;  7GSS A;  4YQU A;  1BAY A;  1TW9 A;  3SWL A;  1YJ6 A;  4KE3 A;  1ZL9 A;  2DC5 A;  1G6W A;  4ZB9 A;  3Q19 A;  3CBU A;  3LG6 A;  2LJR A;  4PNF A;  3P8W A;  4BVX A;  3IR4 A;  4G0K A;  5A4V A;  3IBH A;  1LJR A;  4EXJ A;  1AQW A;  4BVY B;  1BG5 A;  2F8F A;  1PN9 A;  1OYJ A;  13GS A;  1EEM A;  2R5G A;  4IW9 A;  5LD0 A;  1G7O A;  2PBJ A;  3G7I A;  3HKR A;  4JED A;  1HNB A;  3GSS A;  3FY7 A;  1GUL A;  3M1G A;  4EC0 A;  5HFK A;  1K0D A;  1M9B A;  3KXO A;  5IQY A;  4HI7 A;  1EV4 A;  1MD4 A;  3U6V A;  3GX0 A;  4ZB8 A;  3GTU A;  5F05 A;  2GLR A;  4HZ2 A;  5AIX A;  3FR9 A;  1GUH A;  2HSM A;  2AHE A;  4IQA A;  1XWG A;  3Q18 A;  3R2Q A;  5AGY A;  4IQ1 A;  2VCV A;  3FR3 A;  5EL8 A;  4ACS A;  2C4J A;  4Q5N A;  4TOP A;  1YY7 A;  2VCZ A;  3GST A;  3GTU B;  2GSQ A;  2X64 A;  1C72 A;  4MPG A;  4ZB6 A;  2GSR A;  3F63 A;  5D9X A;  2ON5 A;  3M3M A;  3ZFB A;  8GSS A;  1PX7 A;  3FRC A;  1YKC A;  2N5F A;  1GSE A;  2VCQ A;  4J2F A;  5KEJ A;  4HOJ A;  5DJM A;  5ECI B;  2IL3 A;  3Q74 A;  4PUA A;  1GTB A;  3QAG A;  1F3A A;  1PL1 A;  4KGI A;  5ECL B;  3HJO A;  1IYI A;  5B7C A;  1K0M A;  5DQS A;  3QAW A;  2HQT A;  4ZBD A;  2FNO A;  1YQ1 A;  2YCD A;  1B4P A;  4YH2 A;  3D0Z A;  1K0O A;  2C80 A;  4YAP A;  2VD1 A;  1GSU A;  3VWX A;  4F0C A;  5ELA A;  4EDY A;  1TU8 A;  2DSA A;  5DDL A;  1GSD A;  1PA3 A;  1U88 A;  2CZ3 A;  5F0G A;  1GUM A;  4MF5 A;  3CSH A;  1FW1 A;  3W8S A;  4ISD A;  1A0F A;  2WRT A;  5FWG A;  4GF0 A;  1K0A A;  2C3N A;  1M0U A;  4HZ4 A;  5DAL A;  2CAI A;  1PGT A;  2V6K A;  3ZML A;  1U3I A;  3KJY A;  4KAE A;  3VK9 A;  4ZXG A;  4KF9 A;  4Q5R A;  1RK4 A;  4MPF A;  22GS A;  3TOU A;  4PNG A;  2WS2 A;  3LJR A;  12GS A;  1OE7 A;  3MDK A;  5A5K A;  2VCT A;  4USS A;  2WDU A;  5D9W A;  1LBK A;  2A2R A;  4PQI A;  4ZBA A;  1K0N A;  3UBL A;  1Y6E A;  1GNW A;  1OKT A;  4G0L A;  5ECO B;  17GS A;  1USB A;  5GZZ B;  3VPQ A;  2PMT A;  5DAL B;  1MD3 A;  1JLV A;  3G7J A;  3M0F A;  4L8E A;  4IEL A;  5F07 A;  3EE2 A;  3LXZ A;  1Q4J A;  4G0I A;  4K0G A;  4BVX B;  1ML6 A;  4BL7 A;  1GWC A;  2ON7 A;  5DCG A;  1XW5 A;  1MTC A;  1VF2 A;  4PQH A;  3KTL A;  5ECM B;  3KM6 A;  3QR6 A;  3UBK A;  1PKZ A;  2AAW A;  2A2S A;  1GSY A;  4GCI A;  1EOG A;  3HJM A;  1OE8 A;  2HRK A;  3ERF A;  1K3Y A;  3I6A A;  3F6D A;  2D2Z A;  5DJL A;  1KBN A;  10GS A;  3VI7 A;  1GNE A;  5LCZ A;  3ZFL A;  1BYE A;  3F6F A;  5JCW A;  1AQX A;  3VI5 A;  3VUR A;  1AW9 A;  4RI7 A;  2HSM B;  4MF6 A;  1EOH A;  4G9H A;  1R5A A;  5EY6 A;  3WD6 A;  1GTA A;  3UVH A;  1NHY A;  1DUG A;  3N5O A;  5J4U A;  3PGT A;  1EV9 A;  3TOT A;  2PGT A;  4E8H A;  3IE3 A;  2YV7 A;  4GSS A;  3RBT A;  1K0B A;  1GSS A;  4F03 A;  4WR5 A;  2OAD A;  3I69 A;  3LQ7 A;  4RI6 A;  2GSS A;  5D9T A;  4ECJ A;  5FHI A;  5A4U A;  3IK7 A;  4PXO A;  4EDZ A;  4IS0 A;  1VF1 A;  4WR4 A;  5F8B A;  3L0H A;  4GLT A;  3CRT A;  3DGQ A;  4Q5F A;  1UA5 A;  2NTO A;  3GUR A;  4N0V A;  4ZBB A;  1GSF A;  5JCU A;  4K0N A;  1TU7 A;  1YDK A;  5BMU A;  1AXD A;  1VF4 A;  2GTU A;  4IKH A;  5EVO A;  3DD3 A;  20GS A;  3M8N A;  1PKW A;  2C3T A;  3LYK A;  6GSX A;  3VPT A;  4KDU A;  2GST A;  1B48 A;  4PTS A;  1FHE A;  4KH7 A;  4KX4 A;  1JLW A;  3LFL A;  1GTU A;  4HJ2 A;  4ID0 A;  4DEJ A;  3ERG A;  5D9V A;  4CHS A;  1BX9 A;  1PL2 A;  2AB6 A;  3GH6 A;  2R4V A;  2VO4 A;  1F3B A;  3QAV A;  4FQU A;  6GSS A;  1G6Y A;  4L5L A;  4MDC A;  5AN1 A;  18GS A;  1M9A A;  5ECH B;  4F0B A;  1GUK A;  3MAK A;  3O76 A;  4O7H A;  4MZW A;  4E8E A;  1E6B A;  5GSS A;  1XWK A;  2WB9 A;  19GS A;  1PX6 A;  3UAR A;  3LXT A;  3PPU A;  5G5E A;  4IBP A;  4KDX A;  3NIV A;  1GLP A;  1GSQ A;  4OFT A;  2OA7 A;  2WJU A;  3O3T A;  1JZR A;  3KMN A;  1B8X A;  1PD2 1;  4MK3 A;  4PX1 A;  5AIS A;  2C8U A;  2IMK A;  1K3O A;  1HNA A;  4PUR A;  3LSZ A;  1V40 A;  3BBY A;  3VLN A;  4PGT A;  1AQV A;  4JBB A;  2CZ2 A;  2CAQ A;  4MP4 A;  5ECR B;  2FHE A;  2VCW A;  3PR8 A;  4NHZ A;  9GSS A;  4YQV A;  4ECC A;  2JL4 A;  4GTU A;  4EE0 A;  2GDR A;  3GUS A;  1N2A A;  4G10 A;  4OFN A;  2HNL A;  2CA8 A;  4AGS A;  2C3Q A;  1GTI A;  3CRU A;  4G19 A;  4BL7 B;  1M99 A;  2VCX A;  4YAV A;  3WYW A;  2R6K A;  5J5N A;  5ECP B;  5DAK A;  3FR6 A;  4Q5Q A;  4NAX A;  1K3L A;  2IMI A;  1K0C A;  3N9J A;  3ZMK A;  3H1N A;  4GST A;  1PMT A;  6GSY A;  1IYH A;  4NHW A;  4O92 A;  4QQ7 A;  2HRK B;  5FT3 A;  4IGJ A;  2OAC A;  2J9H A;  4LMV A;  5ECQ B;  5ECS A;  1ZGN A;  1F2E A;  6GSV A;  3KMO A;  3P90 A;  5D73 A;  11GS A;  1HQO A;  1XW6 A;  2F3M A;  6GST A;  1GLQ A;  3ISO A;  5DAK B;  4L5O A;  4LMW A;  3FYG A;  3C8E A;  16GS A;  2YV9 A;  2PER A;  3R3E A;  4JZQ A;  4IVF A;  2UZ8 A;  5A4W A;  3EIN A;  1Z9H A;  14GS A;  6GSW A;  1U87 A;  5F06 A;  4MF7 A;  5AIV A;  6GSU A;  2R3X A;  4OMV A;  3CSJ A;  1HNC A;  2HRA A;  4KDY A; 
#chains in the Genus database with same CATH topology
 3TGZ A;  4ZL7 A;  1NSW A;  2OKA A;  1SL1 B;  2TRC P;  4I6X A;  1ZCP A;  4N30 A;  2YJH A;  3LYP A;  2WGR A;  3IC8 A;  2NDO A;  5G5F A;  3HA9 A;  3FZ4 A;  3D22 A;  3GRX A;  3WT2 A;  2WCI A;  1EP8 A;  3GN3 A;  1ZL9 A;  4XS1 A;  2DC5 A;  1G6W A;  2MMO A;  5KN2 A;  3CTF A;  3CBU A;  1F6M C;  3TUE A;  3HZ4 A;  3LG6 A;  3W8J A;  5IMA A;  3P8W A;  1QK8 A;  3IR4 A;  1LJR A;  4EXJ A;  2PWJ A;  4HU7 A;  2F8F A;  1EEM A;  2AYT A;  2GQM A;  2PBJ A;  2CVB A;  4V1A p;  3QPM A;  1DSB A;  5C04 A;  5HFK A;  3HZ8 A;  4KW6 A;  1THX A;  2QKE A;  4HI7 A;  3IPZ A;  4PUF C;  3GX0 A;  4ZB8 A;  5F05 A;  3TCO A;  1R26 A;  2L4C A;  1GUH A;  2FD3 A;  1SKW B;  1R5P A;  2E7P A;  3R2Q A;  3EVI A;  5AGY A;  4IQ1 A;  3IV4 A;  1B9X C;  4JR4 A;  4ACS A;  2C4J A;  2IFQ B;  3RPP A;  1OC8 A;  5CRW A;  4ZB6 A;  1C72 A;  2I81 A;  4J57 E;  1AAZ A;  3KEB A;  4FH8 A;  2N5F A;  1GSE A;  4KA0 A;  5JWR B;  3ZRD A;  3TKR A;  3QFB C;  2PU9 C;  2X8C A;  4TR3 A;  2LEG A;  3Q74 A;  1ZZY A;  1F3A A;  5A1N A;  5G1L A;  4QMK A;  4KGI A;  3KD0 A;  2WZ9 A;  3HJO A;  2X8H A;  2M46 A;  1ERV A;  2F8A A;  5DQS A;  1EEJ A;  1J9B A;  3HY2 A;  5D96 A;  4AJ7 A;  4ZBD A;  3GMF A;  1SVO A;  4ML1 A;  2B1K A;  2DIY A;  3ZIV A;  1B4P A;  4AF2 A;  2WUL A;  2LRC A;  2HSY A;  2VD1 A;  5E4W A;  1SEN A;  2O5V A;  1XW9 A;  1Z6M A;  1DE1 A;  4EDY A;  1Z7R A;  1GSD A;  2R0G A;  2CZ3 A;  2LJK A;  3HCZ A;  3L9U A;  4NMU A;  5FWG A;  4GF0 A;  4X1U A;  5L71 A;  1K0A A;  5DAL A;  4PQ1 A;  1U3I A;  3KJY A;  4KAE A;  4YKF A;  2JSZ A;  2P5R A;  2DJ3 A;  3FHK A;  5DBQ A;  3TOU A;  5JWO B;  2O85 A;  5A5K A;  4USS A;  2PVO C;  5D9W A;  5J40 A;  3BJ5 A;  1GNW A;  1OKT A;  4IJ3 A;  3CMI A;  5ECO B;  4NPB A;  1TRU A;  17GS A;  2VOC A;  5GZZ B;  1ERT A;  2H19 A;  3LOR A;  1JLV A;  1WJK A;  1XZO A;  2FWE A;  3U5R E;  1SKR B;  5F07 A;  4TN8 A;  1ZYQ B;  1Q4J A;  3C7M A;  1GWC A;  5DCG A;  1MTC A;  5ECM B;  1X5E A;  2X4A A;  2FCH A;  3IXR A;  5G30 A;  1GSY A;  1N8J A;  5G1K A;  1EOG A;  2HRK A;  3WGE A;  1OC9 A;  2D2Z A;  2IME A;  1SJI A;  2XBI A;  3UJ1 A;  3VI7 A;  1RW1 A;  1XOA A;  2TIR A;  4WBJ A;  2GT5 A;  1TOF A;  1T1V A;  4MF6 A;  1SD9 A;  2AV4 A;  2K8S A;  5EY6 A;  1OAZ A;  5J4U A;  4MH3 A;  3PGT A;  1ACV A;  5LNK e;  1EV9 A;  4PHZ C;  3I43 A;  4HUA A;  2YV7 A;  1S3A A;  4F03 A;  1QGV A;  4WKW A;  2P5Q A;  3LQ7 A;  4RI6 A;  4ECJ A;  5A4U A;  3IK7 A;  3MSZ A;  3CRT A;  2IMF A;  2X99 A;  4ZBB A;  2FWF A;  3DXB A;  5JCU A;  2QA1 A;  1V98 A;  1AXD A;  4IKH A;  2GTU A;  3CQF A;  4AJ6 A;  3IHG A;  20GS A;  3M8N A;  1PKW A;  4KDU A;  2GST A;  1FAA A;  3HXS A;  2H71 A;  2YAN A;  1GTU A;  2DJ1 A;  4JU5 A;  1M2B A;  4ID0 A;  3EUR A;  5GAN D;  1BX9 A;  2AB6 A;  2H8L A;  4ZB7 A;  5BMU B;  3L78 A;  6GSS A;  2MZC A;  2HE3 A;  4K8M A;  5AN1 A;  3CTG A;  2CVK A;  2GZZ A;  2HZF A;  4FIW A;  1O85 A;  3C73 A;  4D73 A;  4LA1 A;  1YVL A;  1PX6 A;  1FB0 A;  3PPU A;  2IMD A;  5HR1 A;  5J4Y A;  5IMC A;  1U6T A;  5KOX A;  2XHF A;  2B5X A;  1QQ2 A;  2LKU A;  2EIR A;  2OA7 A;  1JZR A;  1JZW A;  3KMN A;  4PX1 A;  1QXH A;  4GQF A;  2IMK A;  2BJX A;  5IOW A;  2LS5 A;  3QD9 A;  1JHB A;  3KH7 A;  3DML A;  3VWU A;  2CAQ A;  5ECR B;  2G2Q A;  4WF5 A;  3P2A A;  3UOM A;  3GUS A;  4TR4 A;  1ZOF A;  4FXY P;  2C3Q A;  1GTI A;  3CRU A;  4G19 A;  2R6K A;  1RQM A;  5J9B A;  5DAK A;  4Q5Q A;  2R0C A;  1H75 A;  2JAC A;  1YF1 A;  4O92 A;  3DVX A;  2HRK B;  5FT3 A;  5JWQ B;  4IGJ A;  5ID2 B;  2J9H A;  4TR1 A;  2V32 A;  3BCI A;  6GSV A;  3KMO A;  1SJZ A;  5D73 A;  1H4O A;  11GS A;  1HQO A;  6GST A;  2LST A;  2CT6 A;  2H6Z A;  3O6T A;  4LMW A;  3FYG A;  3LW9 A;  2H0G A;  2PER A;  3EIN A;  3DYR A;  1TJD A;  14GS A;  4NWY A;  5F06 A;  4N0Z A;  5AIV A;  2B3S A;  2R3X A;  2HRA A;  4KDY A;  3ME7 A;  1YEW C;  4KSM A;  1ZMA A;  5GAP D;  2HYX A;  4I97 A;  4OO4 A;  3TKQ A;  3QCP A;  1EZK A;  2VD0 A;  1EGR A;  3UAP A;  2PVQ A;  1NW2 A;  4A5P A;  3WT1 A;  2YZH A;  2O36 A;  4XCS A;  1FVK A;  1SU9 A;  1A2L A;  1TDI A;  5J41 A;  3AY8 A;  7GSS A;  4YQU A;  2HZE B;  3UMA A;  4KCE A;  2LNT A;  3SWL A;  4WET A;  5CRG A;  4WF4 A;  4HEA 2;  2FUG 2;  1AIU A;  2LJR A;  4PNF A;  4IP1 A;  4BVX A;  4G0K A;  2OE3 A;  1X5C A;  3VWV A;  3GL3 A;  5DVB A;  3TJK A;  1BG5 A;  2V6O A;  1PN9 A;  2KOK A;  13GS A;  2R5G A;  3VWW A;  5LD0 A;  2NVL A;  3HKR A;  4JED A;  1HNB A;  5B6N A;  2IFQ A;  2P31 A;  1TI3 A;  2LV3 A;  4NV2 A;  1K0D A;  1M9B A;  2H1G A;  3KXO A;  1BG1 A;  1MD4 A;  4OCE A;  3M9J A;  3GKK A;  3UL3 A;  4PI0 C;  1XWB A;  3A2V A;  3HVV A;  3ZVJ D;  2HSM A;  4KSO A;  1I1I P;  2H6X A;  3KZQ A;  5C00 A;  3EC3 A;  3A2W A;  5IPH A;  3EMX A;  2VCZ A;  2WZS A;  1SK0 A;  4FYU A;  2X64 A;  1SYR A;  4K5R A;  4I5Q A;  2GSR A;  2B6M A;  2L5O A;  3ZFB A;  1W4V A;  3GA4 A;  3FRC A;  2VCQ A;  2HRF A;  2J23 A;  3K8N A;  5DJM A;  3FZ5 A;  2C0D A;  5HR0 A;  3QAG A;  1PL1 A;  5IMD A;  5ECL B;  4TR1 B;  3EU4 A;  2YNX A;  1K0M A;  3QAW A;  2L5L A;  2FNO A;  4MLY A;  2LQO A;  1YQ1 A;  1X9W B;  2YCD A;  5CYY A;  1K0O A;  4NXI A;  1GSU A;  2O89 A;  3Q6O A;  4F0C A;  5IO0 A;  2AJQ B;  5DDL A;  1PA3 A;  1U88 A;  2O87 A;  4GRF A;  3IC4 A;  2GZP A;  4K7O A;  3A2X A;  3P7X A;  3L9S A;  3W8S A;  1HYU A;  2WVX B;  2LUS A;  2E2G A;  1AC1 A;  1PN0 A;  2C3N A;  2HRN A;  2ZUP A;  3BD2 A;  2CAI A;  5A34 A;  2R37 A;  5G31 A;  2FY6 A;  4MPF A;  3C1R A;  12GS A;  3FEU A;  5HR2 A;  1ZYP A;  2NBS A;  3F3Q A;  1M3J A;  5IOX A;  2WDU A;  2M80 A;  4ZIJ A;  4PQI A;  1K0N A;  1BJX A;  3GV1 A;  3VPQ A;  2GVP A;  2OBK A;  2JU5 A;  3F0I A;  3G7J A;  3M0F A;  3F4T A;  3TDG A;  2XPE A;  4ZIL A;  1E2Y A;  4BVX B;  2ON7 A;  4MJC A;  4PQH A;  3E0U A;  4CW9 A;  2A2S A;  2BMX A;  4GCI A;  3HJM A;  2A2P A;  1K3Y A;  3I6A A;  1I9D A;  2EIO A;  5DJL A;  3NOF A;  10GS A;  3DVW A;  1GNE A;  5D8I A;  3GKN A;  2K9F A;  1BYE A;  1Q98 A;  2YZU A;  3F6F A;  1Y1U A;  5JCW A;  3TU3 B;  1WOU A;  2HSM B;  4O5Q A;  1EOH A;  1OC3 A;  3WD6 A;  1DUG A;  4XRA A;  2PGT A;  1FOH A;  2FWG A;  2ZCT A;  3ZIJ A;  4WR5 A;  1SD8 A;  4E68 A;  2VIM A;  2GSS A;  5FHI A;  1BQ7 A;  5ABR A;  4RQX A;  4PXO A;  3ERW A;  1VF1 A;  4WR4 A;  2H75 A;  4FYB A;  3L0H A;  1A0R P;  3DGQ A;  4K5S A;  1UA5 A;  1UN2 A;  5BMU A;  5CRH A;  5EVO A;  2H72 A;  2WW0 A;  3F3R A;  2C3T A;  2H76 A;  4X43 A;  1QFN A;  2ZNM A;  1TRV A;  2RUF A;  4PTS A;  3GKM A;  1JLW A;  3HVX A;  3LFL A;  1S3R A;  2QC7 A;  4X4J A;  5B6M A;  2GZY A;  4HSC X;  5IPG A;  3GH6 A;  2VO4 A;  2L6C A;  5HR3 A;  1F9M A;  2HFD A;  3F9U A;  4L5L A;  2VKZ G;  4MDC A;  3HMJ G;  3US3 A;  5ECH B;  1TRS A;  3O76 A;  3JCM L;  4O7H A;  1X9S B;  1E6B A;  2A4V A;  2IN3 A;  5GSS A;  2VM2 A;  5ENU A;  4BIK A;  1X0R A;  4XS4 B;  1JFU A;  4ICY A;  1A8L A;  2DKH A;  3LXT A;  4KDX A;  1O8X A;  4POK A;  5A34 B;  1GSQ A;  1T4Y A;  4OFT A;  2WJU A;  3O3T A;  4XS6 A;  1SKS B;  5AIS A;  5J47 A;  1T3B A;  1BF5 A;  4W66 A;  1K3O A;  4IHU A;  3ED3 A;  4O32 A;  3EPT A;  1EWX A;  5CNW A;  4PGT A;  1VGL A;  4XIH A;  4JBB A;  5IMF A;  1O73 A;  2FHE A;  3RPN A;  1SL0 B;  5ID2 A;  2OT3 A;  4ECC A;  4G10 A;  1N2A A;  5INY A;  2HNL A;  3TB2 A;  4KCA A;  4DSQ A;  1KEB A;  3WGX A;  1QMV A;  5ECP B;  3FR6 A;  4NAX A;  1K0C A;  3ZMK A;  3ZL5 A;  1PMT A;  4NHW A;  3QMX A;  4G01 A;  2DBC A;  2MMN A;  3D5J A;  4LMV A;  5ECQ B;  2KHP A;  4I2U A;  3L4N A;  4BPY A;  1BED A;  2F3M A;  1XWA A;  4V2N A;  3ZRE A;  4MZC A;  1OVN A;  2VLU A;  4L0U A;  3C8E A;  2K8V A;  3GX8 A;  3RDW A;  2OJL A;  4JZQ A;  2NPB A;  4G2E A;  4GWR A;  4IVF A;  2UZ8 A;  5A4W A;  4HU9 A;  6GSW A;  2QSI A;  3DWV A;  4TRX A;  1XPV A;  4OMV A;  3HYP A;  2HZE A;  2JAD A;  3EYT A;  4HS1 A;  4K6X A;  3RHB A;  4LL1 B;  3IAM 2;  3G7Y A;  1WWJ A;  2LRN A;  5CP1 A;  3IK9 A;  5ELG A;  4ECB A;  3UVT A;  3RAZ A;  1S3D A;  2HT9 A;  4FO5 A;  4GXZ A;  2CVD A;  5ECN B;  4ECI A;  1VF3 A;  5IIZ A;  1BAY A;  1SVL A;  4Z7X A;  1YJ6 A;  2GQL A;  1T7P B;  1M2D A;  1HD2 A;  4ZL9 A;  3RGB C;  3Q19 A;  2E0Q A;  4Z2U A;  3TJF A;  2ALB A;  1TTZ A;  3RHC A;  1X9M B;  2WW2 A;  1OKD A;  2DLX A;  1A24 A;  3GL5 A;  4BVY B;  2XPD A;  4XRD A;  4I2T A;  4JR6 A;  1OYJ A;  3D6I A;  4RQR A;  3FZ9 A;  1G7O A;  3G7I A;  4CY8 A;  1NHO A;  3M1G A;  3IDV A;  2RLI A;  3GNJ A;  2GLR A;  4HZ2 A;  5AIX A;  2CX4 A;  3FR9 A;  2LNS A;  3TRX A;  1JZD A;  2AHE A;  3H4K A;  4IQA A;  3ME8 A;  3CHX C;  4MA9 A;  1XWG A;  3Q18 A;  4QL7 A;  3MYD A;  5KN1 A;  4DSS B;  5EL8 A;  3CYN A;  4TOP A;  2VAF A;  4Z2T A;  3GTU B;  4MPG A;  3NZN A;  2ON5 A;  3M3M A;  3F8U A;  3IAS 2;  8GSS A;  3TJG A;  4TR0 A;  2X49 A;  3TKS A;  4XHM A;  2V2G A;  5KEJ A;  3J7Y b;  4EVM A;  2IL3 A;  4PUA A;  4K9Z A;  1TI1 A;  2JZS A;  4O5R A;  1J08 A;  3EU3 A;  2UV8 G;  2HQT A;  1T8E B;  1G7E A;  2H01 A;  2XC2 A;  2WVX A;  1XXU A;  1R7H A;  3D0Z A;  2C80 A;  2B5E A;  2C0E A;  4AKH A;  3VWX A;  4OO5 A;  5ELA A;  4IP6 A;  1CQH A;  3D21 A;  1O6J A;  1GUM A;  1M2A A;  4MF5 A;  2LTK A;  5HFI A;  1FW1 A;  4ISD A;  2WRT A;  2ES7 A;  3FKF A;  4OD7 A;  2RUE A;  1M0U A;  4HZ4 A;  1XIY A;  1S4B P;  4EUY A;  1URM A;  1PGT A;  2V6K A;  3ZML A;  3VK9 A;  4KF9 A;  4Q5R A;  1RK4 A;  4F2I A;  2L4Q A;  1OE7 A;  3F4S A;  3TKP A;  4K7N A;  1LBK A;  2A2R A;  3UBL A;  4JRR A;  2MBT A;  3L9V A;  4TW5 A;  4Z2R A;  2VL9 A;  4V2L A;  1MD3 A;  2O3E A;  4YKG A;  2H1D A;  3J7Y k;  1TK8 B;  2H0I A;  5J3R A;  4IEL A;  3EE2 A;  5IMZ A;  4G0I A;  4K0G A;  2N5A A;  4BL7 A;  4H86 A;  3IHQ A;  2VL3 A;  1XW5 A;  1VF2 A;  2O7K A;  2XBQ A;  4JE1 A;  3HHV A;  3ERF A;  2H1A A;  2MYG A;  1WIK A;  2L59 A;  5KOW A;  1F37 A;  3TJB A;  5LCZ A;  2DIZ A;  2DML A;  3ZFL A;  4POL A;  3SBC A;  4MJB A;  2I1U A;  3VI5 A;  2P0G A;  4RI7 A;  3FK8 A;  5H5R A;  4XTS A;  3M9K A;  4G9H A;  1R5A A;  5H5Q A;  4MMM A;  1O7U A;  5H5S A;  2QGV A;  2LJA A;  1GTA A;  3UVH A;  1NHY A;  3N5O A;  2C0F A;  4I8B A;  4EO3 A;  2RM6 A;  4HQS A;  2YWO A;  1K0B A;  2EC4 A;  2I3Y A;  1GSS A;  3CWG A;  5KN3 A;  1EGO A;  2OAD A;  4ML6 A;  5D9T A;  4P3Y B;  2I4A A;  4IS0 A;  5F8B A;  4GLT A;  2NTO A;  3TKS E;  3VFI A;  4N0V A;  1TU7 A;  1YDK A;  4BA7 A;  1O81 A;  1X5D A;  2LQQ A;  3LYK A;  5DCH A;  4EL1 A;  1B48 A;  2AUV A;  4AJ8 A;  1ERW A;  2FA4 A;  1FHE A;  4KH7 A;  1UVZ A;  2K6V A;  2EFD A;  4XS4 A;  3ERG A;  5D9V A;  1AUC A;  1MDI A;  4CHS A;  1PL2 A;  4V1A g;  5CO3 A;  4MJE A;  3QAV A;  4FQU A;  1Y25 A;  1G6Y A;  2FWH A;  4OWY A;  4WXT A;  18GS A;  1M9A A;  3ZIT A;  2H70 A;  3MAK A;  3KP9 A;  1XWK A;  2WB9 A;  5J9C A;  2WW1 A;  4BWQ A;  3UAR A;  5G5E A;  3H93 A;  4IBP A;  1A2J A;  3NIV A;  4O5U A;  1YEX A;  4TKY A;  4QL9 A;  2MBS A;  1VRS D;  4N11 A;  1M3I A;  3ZLP A;  1PD2 1;  1Z7P A;  3BCK A;  4PUR A;  2H74 A;  3LSZ A;  1SYX A;  1V40 A;  1I5G A;  3GH9 A;  3BBY A;  3TRP A;  1XFL A;  5IO2 A;  2QA2 A;  3KH9 A;  4MP4 A;  3RFR C;  2VCW A;  1XVQ A;  4X0X A;  1SJ6 A;  2X8G A;  4EKZ A;  3PR8 A;  1YF0 A;  5G2Z A;  4YQV A;  1TRW A;  4KUN A;  4GTU A;  1YZX A;  5E59 A;  4OFN A;  4AGS A;  3KTB A;  2H6Y A;  3IRA A;  4BL7 B;  4TXO B;  4YAV A;  3WYW A;  1PSQ A;  2N5B A;  4F9Z A;  2VLV A;  2MMA A;  4OCF A;  1MDJ A;  2KLX A;  4GST A;  2B1L A;  4RUV A;  1IYH A;  2I9H A;  2GQK A;  4HJM A;  4QQ7 A;  1Z3E A;  2OAC A;  2YWN A;  1DE2 A;  5ECS A;  1ZGN A;  1F2E A;  4CDO A;  3KIJ A;  1B9Y C;  1XW6 A;  1NM3 A;  1GLQ A;  3ISO A;  1O8W A;  1PQN A;  1GP1 A;  4GDF A;  4FYC A;  3FMW A;  2YV9 A;  3R3E A;  1Z9H A;  4K2X A;  2B7K A;  2YOI A;  4ILF A;  3BOA A;  1U87 A;  1A23 A;  6GSU A;  1KTE A;  1ST9 A;  1MDK A;  3APQ A;  5ECK B;  2RII A;  5CRE A;  1V2A A;  5GST A;  3A5I A;  4YQM A;  4IJI A;  4N3Z A;  2HSN B;  2JZR A;  2OE1 A;  2YN1 A;  4GSN A;  3KP8 A;  3HD5 A;  4BVY A;  4OFM A;  3C71 A;  2K18 A;  3CSI A;  3KGK A;  2OE0 A;  5IM9 A;  2HSH A;  3GIX A;  1TW9 A;  3LGC A;  4KE3 A;  1V9W A;  2DJ0 A;  5JCG A;  4ZB9 A;  3H8Q A;  2EFC A;  4LLR A;  2KP1 A;  3IOS A;  5A4V A;  5COH A;  3IBH A;  1AQW A;  1U3A A;  2G0F A;  3ZZX A;  2V41 A;  3W6G A;  1YEP A;  2PPT A;  3I9V 2;  4K7I A;  4IW9 A;  5HFG A;  4DSS A;  3GSS A;  3FY7 A;  1GUL A;  4EC0 A;  3TJJ A;  4PI2 C;  5IQY A;  3UEM A;  1EV4 A;  3U6V A;  4HQZ A;  3GTU A;  1ZYN A;  3DEX A;  1WMJ A;  3V1W A;  4CY6 A;  2C1Y A;  2F51 A;  2H73 A;  3F4R A;  4MNN A;  1B4Q A;  2GS3 A;  3A3T A;  4ZL8 A;  1SK1 A;  3D4T A;  2VCV A;  3FR3 A;  4Q5N A;  4ULX A;  1YY7 A;  4AKG A;  1LU4 A;  3GST A;  1KNG A;  5CAX A;  4DVC A;  2GSQ A;  3F63 A;  5D9X A;  5HQP A;  2R0P A;  1GRX A;  1XG8 A;  1PX7 A;  1YKC A;  2DKI A;  3HJP A;  4J2F A;  5EPF A;  4HOJ A;  2IPA A;  2LRT A;  5ECI B;  2EFH A;  1GTB A;  1TK0 B;  1IYI A;  5B7C A;  3LEF A;  3MWH A;  3EMP A;  4YH2 A;  1PFO A;  4YAP A;  5IMV A;  2FA8 A;  3DIE A;  5CRD A;  5B8B A;  1TU8 A;  5A1N B;  2DSA A;  2JSY A;  1V57 A;  5F0G A;  2HXK A;  3CSH A;  2VUP A;  1Z5Y E;  1EP7 A;  2IJY A;  1THO A;  4F82 A;  2YJ7 A;  3DKS A;  1A0F A;  2A4H A;  1SVM A;  3HVS A;  3MIX A;  2R2J A;  2L6D A;  2YWM A;  3GHA A;  1ABA A;  1Z6N A;  4KB3 A;  4ZXG A;  1FG4 A;  1DBY A;  3MNG A;  3QOU A;  22GS A;  1ILO A;  4PNG A;  4EF0 A;  2WS2 A;  3LJR A;  3FZA A;  2EIQ A;  3MDK A;  4POB A;  3EWL A;  2VCT A;  2FLS A;  4MZB A;  4ZBA A;  2E2M A;  1Y6E A;  1FVJ A;  4G0L A;  1USB A;  2PMT A;  5DAL B;  4AKX B;  2JZT A;  1TK5 B;  3QFA C;  4L8E A;  2WVY A;  4J56 E;  3LXZ A;  1A8Y A;  3UIW A;  1ML6 A;  2IIY A;  3GKX A;  4WEY A;  3KTL A;  2KP2 A;  3KM6 A;  4WBR D;  4EIQ A;  1G0T A;  3QR6 A;  3UBK A;  1PKZ A;  4MJA A;  2AAW A;  2F9S A;  1SL2 B;  2REM A;  1OE8 A;  3F6D A;  3LWA A;  1KBN A;  2C0G A;  3DRN A;  2BTO T;  4K1F A;  5B8A A;  2IWT A;  2VM1 A;  4GQC A;  5BRT A;  1XVW A;  2H30 A;  1MEK A;  2HLS A;  5A5H A;  2H66 A;  1AQX A;  5DQY A;  3VUR A;  4L0W A;  1AW9 A;  4MCU A;  3D4M A;  4AI6 A;  2DJK A;  4AKI A;  2CQ9 A;  1XWC A;  1S3C A;  2YWI A;  2WFC A;  1ERU A;  5J4V A;  1WP0 A;  3TOT A;  4E8H A;  1FB6 A;  1OC9 B;  3IE3 A;  4GSS A;  3RBT A;  4KND A;  3S9F A;  2M72 A;  3APS A;  3I69 A;  2L57 A;  2H1B A;  4EDZ A;  3ZYW A;  4Q5F A;  3GUR A;  1XCC A;  1GSF A;  2B5Y A;  4K0N A;  2TRX A;  2H0H A;  1WE0 A;  4POM A;  1VF4 A;  5D93 A;  3DD3 A;  1QUW A;  1FO5 A;  6GSX A;  3VPT A;  2DMM A;  1T00 A;  2WW3 A;  2VL2 A;  1JZO A;  3APO A;  3IA1 A;  2OBI A;  4KX4 A;  4HJ2 A;  3HVN A;  4DEJ A;  1FOV A;  1R4W A;  2R4V A;  1M7T A;  4MAB A;  3TKS C;  3QDN A;  2HI7 A;  1F3B A;  2YP6 A;  3PIN A;  3PH9 A;  1SK2 A;  2FGX A;  2H1L A;  4F0B A;  1GUK A;  4TVE A;  4N10 A;  4MZW A;  4E8E A;  19GS A;  1N25 A;  1WRY A;  2V1M A;  1GLP A;  3GYK A;  1A2M A;  3E9J B;  1GL8 A;  5KN0 A;  2Z9S A;  4TXO A;  1B8X A;  4MK3 A;  2VL2 C;  2C8U A;  1WPI A;  1HNA A;  3ZTL A;  4D73 B;  4LL4 B;  3VLN A;  2MMZ A;  1AQV A;  4NV5 A;  1UC7 A;  2CZ2 A;  2YPM A;  4DSR A;  1GH2 A;  4NHZ A;  9GSS A;  3GFK A;  2CV4 A;  3WGD A;  2JL4 A;  1V58 A;  4EE0 A;  2GDR A;  2CA8 A;  1TP9 A;  1M99 A;  2VCX A;  5J5N A;  1XBS A;  1W89 A;  4HDE A;  1K3L A;  2VLT A;  1ZYE A;  2IMI A;  1PRX A;  2DJ2 A;  3E3E A;  3H79 A;  3N9J A;  4V2M A;  3CXG A;  3H1N A;  6GSY A;  2DJJ A;  2PUK C;  4BWS A;  2GGT A;  3KCM A;  2B7J A;  1CQG A;  1T4Z A;  2GT6 A;  1XOB A;  4IN0 A;  3P90 A;  3C1S A;  2PN8 A;  5A5H B;  2RM5 A;  5DAK B;  4L5O A;  3G9B A;  1TKD B;  3A5W A;  2CX3 A;  16GS A;  3OR5 A;  2O8V B;  1J0F A;  4K2D A;  2EFE A;  2HSN A;  4EIP A;  1YKA A;  2KUC A;  3FW2 A;  4MH2 A;  1ON4 A;  4TXV A;  1TXX A;  3TRQ A;  4MF7 A;  1TXU A;  3ZVJ A;  3CSJ A;  2WVZ A;  1HNC A;  3HDC A; 
#chains in the Genus database with same CATH homology
 3TGZ A;  4ZL7 A;  1NSW A;  2OKA A;  1SL1 B;  2TRC P;  4I6X A;  1ZCP A;  4N30 A;  2YJH A;  3LYP A;  2WGR A;  3IC8 A;  2NDO A;  5G5F A;  3HA9 A;  3FZ4 A;  3D22 A;  3GRX A;  3WT2 A;  2WCI A;  1EP8 A;  3GN3 A;  1ZL9 A;  4XS1 A;  2DC5 A;  1G6W A;  2MMO A;  5KN2 A;  3CTF A;  3CBU A;  1F6M C;  3TUE A;  3HZ4 A;  3LG6 A;  3W8J A;  5IMA A;  3P8W A;  1QK8 A;  3IR4 A;  1LJR A;  4EXJ A;  2PWJ A;  4HU7 A;  2F8F A;  1EEM A;  2AYT A;  2GQM A;  2PBJ A;  2CVB A;  4V1A p;  3QPM A;  1DSB A;  5C04 A;  5HFK A;  3HZ8 A;  4KW6 A;  1THX A;  2QKE A;  4HI7 A;  3IPZ A;  4PUF C;  3GX0 A;  4ZB8 A;  5F05 A;  3TCO A;  1R26 A;  2L4C A;  1GUH A;  2FD3 A;  1SKW B;  1R5P A;  2E7P A;  3R2Q A;  3EVI A;  5AGY A;  4IQ1 A;  3IV4 A;  1B9X C;  4JR4 A;  4ACS A;  2C4J A;  2IFQ B;  3RPP A;  1OC8 A;  5CRW A;  4ZB6 A;  1C72 A;  2I81 A;  4J57 E;  1AAZ A;  3KEB A;  4FH8 A;  2N5F A;  1GSE A;  4KA0 A;  5JWR B;  3ZRD A;  3TKR A;  3QFB C;  2PU9 C;  2X8C A;  4TR3 A;  2LEG A;  3Q74 A;  1ZZY A;  1F3A A;  5A1N A;  5G1L A;  4QMK A;  4KGI A;  3KD0 A;  2WZ9 A;  3HJO A;  2X8H A;  2M46 A;  1ERV A;  2F8A A;  5DQS A;  1EEJ A;  1J9B A;  3HY2 A;  5D96 A;  4AJ7 A;  4ZBD A;  3GMF A;  1SVO A;  4ML1 A;  2B1K A;  2DIY A;  3ZIV A;  1B4P A;  4AF2 A;  2WUL A;  2LRC A;  2HSY A;  2VD1 A;  5E4W A;  1SEN A;  2O5V A;  1XW9 A;  1Z6M A;  1DE1 A;  4EDY A;  1Z7R A;  1GSD A;  2R0G A;  2CZ3 A;  2LJK A;  3HCZ A;  3L9U A;  4NMU A;  5FWG A;  4GF0 A;  4X1U A;  5L71 A;  1K0A A;  5DAL A;  4PQ1 A;  1U3I A;  3KJY A;  4KAE A;  4YKF A;  2JSZ A;  2P5R A;  2DJ3 A;  3FHK A;  5DBQ A;  3TOU A;  5JWO B;  2O85 A;  5A5K A;  4USS A;  2PVO C;  5D9W A;  5J40 A;  3BJ5 A;  1GNW A;  1OKT A;  4IJ3 A;  3CMI A;  5ECO B;  4NPB A;  1TRU A;  17GS A;  2VOC A;  5GZZ B;  1ERT A;  2H19 A;  3LOR A;  1JLV A;  1WJK A;  1XZO A;  2FWE A;  3U5R E;  1SKR B;  5F07 A;  4TN8 A;  1ZYQ B;  1Q4J A;  3C7M A;  1GWC A;  5DCG A;  1MTC A;  5ECM B;  1X5E A;  2X4A A;  2FCH A;  3IXR A;  5G30 A;  1GSY A;  1N8J A;  5G1K A;  1EOG A;  2HRK A;  3WGE A;  1OC9 A;  2D2Z A;  2IME A;  1SJI A;  2XBI A;  3UJ1 A;  3VI7 A;  1RW1 A;  1XOA A;  2TIR A;  4WBJ A;  2GT5 A;  1TOF A;  1T1V A;  4MF6 A;  1SD9 A;  2AV4 A;  2K8S A;  5EY6 A;  1OAZ A;  5J4U A;  4MH3 A;  3PGT A;  1ACV A;  5LNK e;  1EV9 A;  3I43 A;  4HUA A;  2YV7 A;  1S3A A;  4F03 A;  1QGV A;  4WKW A;  2P5Q A;  3LQ7 A;  4RI6 A;  4ECJ A;  5A4U A;  3IK7 A;  3MSZ A;  3CRT A;  2IMF A;  2X99 A;  4ZBB A;  2FWF A;  3DXB A;  5JCU A;  2QA1 A;  1V98 A;  1AXD A;  4IKH A;  2GTU A;  4AJ6 A;  3IHG A;  20GS A;  3M8N A;  1PKW A;  4KDU A;  2GST A;  1FAA A;  3HXS A;  2H71 A;  2YAN A;  1GTU A;  2DJ1 A;  4JU5 A;  1M2B A;  4ID0 A;  3EUR A;  5GAN D;  1BX9 A;  2AB6 A;  2H8L A;  4ZB7 A;  5BMU B;  3L78 A;  6GSS A;  2MZC A;  2HE3 A;  4K8M A;  5AN1 A;  3CTG A;  2CVK A;  2GZZ A;  2HZF A;  4FIW A;  1O85 A;  3C73 A;  4D73 A;  4LA1 A;  1YVL A;  1PX6 A;  1FB0 A;  3PPU A;  2IMD A;  5HR1 A;  5J4Y A;  5IMC A;  1U6T A;  5KOX A;  2XHF A;  2B5X A;  1QQ2 A;  2LKU A;  2EIR A;  2OA7 A;  1JZR A;  1JZW A;  3KMN A;  4PX1 A;  1QXH A;  4GQF A;  2IMK A;  2BJX A;  5IOW A;  2LS5 A;  3QD9 A;  1JHB A;  3KH7 A;  3DML A;  3VWU A;  2CAQ A;  5ECR B;  2G2Q A;  4WF5 A;  3P2A A;  3UOM A;  3GUS A;  4TR4 A;  1ZOF A;  2C3Q A;  1GTI A;  3CRU A;  4G19 A;  2R6K A;  1RQM A;  5J9B A;  5DAK A;  4Q5Q A;  2R0C A;  1H75 A;  2JAC A;  1YF1 A;  4O92 A;  3DVX A;  2HRK B;  5FT3 A;  5JWQ B;  4IGJ A;  5ID2 B;  2J9H A;  4TR1 A;  2V32 A;  3BCI A;  6GSV A;  3KMO A;  1SJZ A;  5D73 A;  1H4O A;  11GS A;  1HQO A;  6GST A;  2LST A;  2CT6 A;  2H6Z A;  3O6T A;  4LMW A;  3FYG A;  3LW9 A;  2H0G A;  2PER A;  3EIN A;  3DYR A;  1TJD A;  14GS A;  4NWY A;  5F06 A;  4N0Z A;  5AIV A;  2B3S A;  2R3X A;  2HRA A;  4KDY A;  3ME7 A;  4KSM A;  1ZMA A;  5GAP D;  2HYX A;  4I97 A;  4OO4 A;  3TKQ A;  3QCP A;  1EZK A;  2VD0 A;  1EGR A;  3UAP A;  2PVQ A;  1NW2 A;  4A5P A;  3WT1 A;  2YZH A;  4XCS A;  1FVK A;  1SU9 A;  1A2L A;  1TDI A;  5J41 A;  3AY8 A;  7GSS A;  4YQU A;  2HZE B;  3UMA A;  4KCE A;  2LNT A;  3SWL A;  4WET A;  5CRG A;  4WF4 A;  4HEA 2;  2FUG 2;  1AIU A;  2LJR A;  4PNF A;  4IP1 A;  4BVX A;  4G0K A;  2OE3 A;  1X5C A;  3VWV A;  3GL3 A;  5DVB A;  3TJK A;  1BG5 A;  2V6O A;  1PN9 A;  2KOK A;  13GS A;  2R5G A;  3VWW A;  5LD0 A;  2NVL A;  3HKR A;  4JED A;  1HNB A;  5B6N A;  2IFQ A;  2P31 A;  1TI3 A;  2LV3 A;  4NV2 A;  1K0D A;  1M9B A;  2H1G A;  3KXO A;  1BG1 A;  1MD4 A;  4OCE A;  3M9J A;  3GKK A;  3UL3 A;  3A2V A;  1XWB A;  3HVV A;  3ZVJ D;  2HSM A;  4KSO A;  2H6X A;  3KZQ A;  5C00 A;  3EC3 A;  3A2W A;  5IPH A;  3EMX A;  2VCZ A;  1SK0 A;  4FYU A;  2X64 A;  1SYR A;  4K5R A;  4I5Q A;  2GSR A;  2B6M A;  2L5O A;  3ZFB A;  1W4V A;  3GA4 A;  3FRC A;  2VCQ A;  2HRF A;  2J23 A;  3K8N A;  5DJM A;  3FZ5 A;  2C0D A;  5HR0 A;  3QAG A;  1PL1 A;  5IMD A;  5ECL B;  4TR1 B;  3EU4 A;  2YNX A;  1K0M A;  3QAW A;  2L5L A;  2FNO A;  4MLY A;  2LQO A;  1YQ1 A;  1X9W B;  2YCD A;  5CYY A;  1K0O A;  4NXI A;  1GSU A;  2O89 A;  3Q6O A;  4F0C A;  5IO0 A;  2AJQ B;  5DDL A;  1PA3 A;  1U88 A;  2O87 A;  4GRF A;  3IC4 A;  2GZP A;  4K7O A;  3A2X A;  3P7X A;  3L9S A;  3W8S A;  1HYU A;  2LUS A;  2E2G A;  1AC1 A;  1PN0 A;  2C3N A;  2HRN A;  2ZUP A;  3BD2 A;  2CAI A;  5A34 A;  2R37 A;  5G31 A;  2FY6 A;  4MPF A;  3C1R A;  12GS A;  3FEU A;  5HR2 A;  1ZYP A;  2NBS A;  3F3Q A;  5IOX A;  2WDU A;  2M80 A;  4ZIJ A;  4PQI A;  1K0N A;  1BJX A;  3GV1 A;  3VPQ A;  2GVP A;  2OBK A;  2JU5 A;  3F0I A;  3G7J A;  3M0F A;  3F4T A;  3TDG A;  2XPE A;  4ZIL A;  1E2Y A;  4BVX B;  2ON7 A;  4MJC A;  4PQH A;  3E0U A;  4CW9 A;  2A2S A;  2BMX A;  4GCI A;  3HJM A;  2A2P A;  1K3Y A;  3I6A A;  1I9D A;  2EIO A;  5DJL A;  3NOF A;  10GS A;  3DVW A;  1GNE A;  5D8I A;  3GKN A;  2K9F A;  1BYE A;  1Q98 A;  2YZU A;  3F6F A;  1Y1U A;  5JCW A;  3TU3 B;  1WOU A;  2HSM B;  4O5Q A;  1EOH A;  1OC3 A;  3WD6 A;  1DUG A;  4XRA A;  2PGT A;  1FOH A;  2FWG A;  2ZCT A;  3ZIJ A;  4WR5 A;  1SD8 A;  4E68 A;  2VIM A;  2GSS A;  5FHI A;  1BQ7 A;  5ABR A;  4RQX A;  4PXO A;  3ERW A;  1VF1 A;  4WR4 A;  2H75 A;  4FYB A;  3L0H A;  1A0R P;  3DGQ A;  4K5S A;  1UA5 A;  1UN2 A;  5BMU A;  5CRH A;  5EVO A;  2H72 A;  3F3R A;  2C3T A;  2H76 A;  4X43 A;  1QFN A;  2ZNM A;  1TRV A;  2RUF A;  4PTS A;  3GKM A;  1JLW A;  3HVX A;  3LFL A;  2QC7 A;  4X4J A;  5B6M A;  2GZY A;  5IPG A;  3GH6 A;  2VO4 A;  2L6C A;  5HR3 A;  1F9M A;  2HFD A;  3F9U A;  4L5L A;  2VKZ G;  4MDC A;  3HMJ G;  3US3 A;  5ECH B;  1TRS A;  3O76 A;  3JCM L;  4O7H A;  1X9S B;  1E6B A;  2A4V A;  2IN3 A;  5GSS A;  2VM2 A;  5ENU A;  1X0R A;  4XS4 B;  1JFU A;  4ICY A;  1A8L A;  2DKH A;  3LXT A;  4KDX A;  1O8X A;  4POK A;  5A34 B;  1GSQ A;  1T4Y A;  4OFT A;  2WJU A;  3O3T A;  4XS6 A;  1SKS B;  5AIS A;  5J47 A;  1T3B A;  1BF5 A;  4W66 A;  1K3O A;  4IHU A;  3ED3 A;  4O32 A;  3EPT A;  1EWX A;  5CNW A;  4PGT A;  1VGL A;  4XIH A;  4JBB A;  5IMF A;  1O73 A;  2FHE A;  3RPN A;  1SL0 B;  5ID2 A;  2OT3 A;  4ECC A;  4G10 A;  1N2A A;  5INY A;  2HNL A;  3TB2 A;  4KCA A;  4DSQ A;  1KEB A;  3WGX A;  1QMV A;  5ECP B;  3FR6 A;  4NAX A;  1K0C A;  3ZMK A;  3ZL5 A;  1PMT A;  4NHW A;  3QMX A;  4G01 A;  2DBC A;  2MMN A;  3D5J A;  4LMV A;  5ECQ B;  2KHP A;  4I2U A;  3L4N A;  4BPY A;  1BED A;  2F3M A;  1XWA A;  4V2N A;  3ZRE A;  4MZC A;  1OVN A;  2VLU A;  4L0U A;  3C8E A;  2K8V A;  3GX8 A;  3RDW A;  2OJL A;  4JZQ A;  2NPB A;  4G2E A;  4GWR A;  4IVF A;  2UZ8 A;  5A4W A;  4HU9 A;  6GSW A;  2QSI A;  3DWV A;  4TRX A;  1XPV A;  4OMV A;  3HYP A;  2HZE A;  2JAD A;  3EYT A;  4HS1 A;  4K6X A;  3RHB A;  4LL1 B;  3IAM 2;  3G7Y A;  1WWJ A;  2LRN A;  5CP1 A;  3IK9 A;  5ELG A;  4ECB A;  3UVT A;  3RAZ A;  1S3D A;  2HT9 A;  4FO5 A;  4GXZ A;  2CVD A;  5ECN B;  4ECI A;  1VF3 A;  5IIZ A;  1BAY A;  1SVL A;  4Z7X A;  1YJ6 A;  2GQL A;  1T7P B;  1M2D A;  1HD2 A;  4ZL9 A;  3Q19 A;  2E0Q A;  4Z2U A;  3TJF A;  2ALB A;  1TTZ A;  3RHC A;  1X9M B;  1OKD A;  2DLX A;  1A24 A;  3GL5 A;  4BVY B;  2XPD A;  4XRD A;  4I2T A;  4JR6 A;  1OYJ A;  3D6I A;  4RQR A;  3FZ9 A;  1G7O A;  3G7I A;  4CY8 A;  1NHO A;  3M1G A;  3IDV A;  2RLI A;  3GNJ A;  2GLR A;  4HZ2 A;  5AIX A;  2CX4 A;  3FR9 A;  2LNS A;  3TRX A;  1JZD A;  2AHE A;  3H4K A;  4IQA A;  3ME8 A;  4MA9 A;  1XWG A;  3Q18 A;  4QL7 A;  3MYD A;  5KN1 A;  4DSS B;  5EL8 A;  3CYN A;  4TOP A;  2VAF A;  4Z2T A;  3GTU B;  4MPG A;  3NZN A;  2ON5 A;  3M3M A;  3F8U A;  3IAS 2;  8GSS A;  3TJG A;  4TR0 A;  2X49 A;  3TKS A;  4XHM A;  2V2G A;  5KEJ A;  3J7Y b;  4EVM A;  2IL3 A;  4PUA A;  4K9Z A;  1TI1 A;  2JZS A;  4O5R A;  1J08 A;  3EU3 A;  2UV8 G;  2HQT A;  1T8E B;  1G7E A;  2H01 A;  2XC2 A;  1XXU A;  1R7H A;  3D0Z A;  2C80 A;  2B5E A;  2C0E A;  4AKH A;  3VWX A;  4OO5 A;  5ELA A;  4IP6 A;  1CQH A;  3D21 A;  1O6J A;  1GUM A;  1M2A A;  4MF5 A;  2LTK A;  5HFI A;  1FW1 A;  4ISD A;  2WRT A;  2ES7 A;  3FKF A;  4OD7 A;  2RUE A;  1M0U A;  4HZ4 A;  1XIY A;  4EUY A;  1URM A;  1PGT A;  2V6K A;  3ZML A;  3VK9 A;  4KF9 A;  4Q5R A;  1RK4 A;  4F2I A;  2L4Q A;  1OE7 A;  3F4S A;  3TKP A;  4K7N A;  1LBK A;  2A2R A;  3UBL A;  4JRR A;  2MBT A;  3L9V A;  4TW5 A;  4Z2R A;  2VL9 A;  4V2L A;  1MD3 A;  4YKG A;  2H1D A;  3J7Y k;  1TK8 B;  2H0I A;  5J3R A;  4IEL A;  3EE2 A;  5IMZ A;  4G0I A;  4K0G A;  2N5A A;  4BL7 A;  4H86 A;  3IHQ A;  2VL3 A;  1XW5 A;  1VF2 A;  2O7K A;  2XBQ A;  4JE1 A;  3HHV A;  3ERF A;  2H1A A;  2MYG A;  1WIK A;  2L59 A;  5KOW A;  1F37 A;  3TJB A;  5LCZ A;  2DIZ A;  2DML A;  3ZFL A;  4POL A;  3SBC A;  4MJB A;  2I1U A;  3VI5 A;  2P0G A;  4RI7 A;  3FK8 A;  5H5R A;  4XTS A;  3M9K A;  4G9H A;  1R5A A;  5H5Q A;  4MMM A;  1O7U A;  5H5S A;  2QGV A;  2LJA A;  1GTA A;  3UVH A;  1NHY A;  3N5O A;  2C0F A;  4I8B A;  4EO3 A;  2RM6 A;  4HQS A;  2YWO A;  1K0B A;  2EC4 A;  2I3Y A;  1GSS A;  3CWG A;  5KN3 A;  1EGO A;  2OAD A;  4ML6 A;  5D9T A;  4P3Y B;  2I4A A;  4IS0 A;  5F8B A;  4GLT A;  2NTO A;  3TKS E;  3VFI A;  4N0V A;  1TU7 A;  1YDK A;  4BA7 A;  1O81 A;  1X5D A;  2LQQ A;  3LYK A;  5DCH A;  4EL1 A;  1B48 A;  2AUV A;  4AJ8 A;  1ERW A;  2FA4 A;  1FHE A;  4KH7 A;  1UVZ A;  2K6V A;  2EFD A;  4XS4 A;  3ERG A;  5D9V A;  1AUC A;  1MDI A;  4CHS A;  1PL2 A;  4V1A g;  5CO3 A;  4MJE A;  3QAV A;  4FQU A;  1Y25 A;  1G6Y A;  2FWH A;  4OWY A;  4WXT A;  18GS A;  1M9A A;  3ZIT A;  2H70 A;  3MAK A;  3KP9 A;  1XWK A;  2WB9 A;  5J9C A;  4BWQ A;  3UAR A;  5G5E A;  3H93 A;  4IBP A;  1A2J A;  3NIV A;  4O5U A;  1YEX A;  4TKY A;  4QL9 A;  2MBS A;  1VRS D;  4N11 A;  3ZLP A;  1PD2 1;  1Z7P A;  3BCK A;  4PUR A;  2H74 A;  3LSZ A;  1SYX A;  1V40 A;  1I5G A;  3GH9 A;  3BBY A;  3TRP A;  1XFL A;  5IO2 A;  2QA2 A;  3KH9 A;  4MP4 A;  2VCW A;  1XVQ A;  4X0X A;  1SJ6 A;  2X8G A;  4EKZ A;  3PR8 A;  1YF0 A;  5G2Z A;  4YQV A;  1TRW A;  4KUN A;  4GTU A;  1YZX A;  5E59 A;  4OFN A;  4AGS A;  3KTB A;  2H6Y A;  3IRA A;  4BL7 B;  4TXO B;  4YAV A;  3WYW A;  1PSQ A;  2N5B A;  4F9Z A;  2VLV A;  2MMA A;  4OCF A;  1MDJ A;  2KLX A;  4GST A;  2B1L A;  4RUV A;  1IYH A;  2I9H A;  2GQK A;  4HJM A;  4QQ7 A;  1Z3E A;  2OAC A;  2YWN A;  1DE2 A;  5ECS A;  1ZGN A;  1F2E A;  4CDO A;  3KIJ A;  1B9Y C;  1XW6 A;  1NM3 A;  1GLQ A;  3ISO A;  1O8W A;  1PQN A;  1GP1 A;  4GDF A;  4FYC A;  3FMW A;  2YV9 A;  3R3E A;  1Z9H A;  4K2X A;  2B7K A;  2YOI A;  4ILF A;  3BOA A;  1U87 A;  1A23 A;  6GSU A;  1KTE A;  1ST9 A;  1MDK A;  3APQ A;  5ECK B;  2RII A;  5CRE A;  1V2A A;  5GST A;  3A5I A;  4YQM A;  4IJI A;  4N3Z A;  2HSN B;  2JZR A;  2OE1 A;  2YN1 A;  4GSN A;  3KP8 A;  3HD5 A;  4BVY A;  4OFM A;  3C71 A;  2K18 A;  3CSI A;  3KGK A;  2OE0 A;  5IM9 A;  2HSH A;  3GIX A;  1TW9 A;  3LGC A;  4KE3 A;  1V9W A;  2DJ0 A;  5JCG A;  4ZB9 A;  3H8Q A;  2EFC A;  4LLR A;  2KP1 A;  3IOS A;  5A4V A;  5COH A;  3IBH A;  1AQW A;  1U3A A;  2G0F A;  3ZZX A;  2V41 A;  3W6G A;  1YEP A;  2PPT A;  3I9V 2;  4K7I A;  4IW9 A;  5HFG A;  4DSS A;  3GSS A;  3FY7 A;  1GUL A;  4EC0 A;  3TJJ A;  5IQY A;  3UEM A;  1EV4 A;  3U6V A;  4HQZ A;  3GTU A;  1ZYN A;  3DEX A;  1WMJ A;  3V1W A;  4CY6 A;  2C1Y A;  2F51 A;  2H73 A;  3F4R A;  4MNN A;  1B4Q A;  2GS3 A;  3A3T A;  4ZL8 A;  1SK1 A;  3D4T A;  2VCV A;  3FR3 A;  4Q5N A;  4ULX A;  1YY7 A;  4AKG A;  1LU4 A;  3GST A;  1KNG A;  5CAX A;  4DVC A;  2GSQ A;  3F63 A;  5D9X A;  5HQP A;  2R0P A;  1GRX A;  1PX7 A;  1YKC A;  2DKI A;  3HJP A;  4J2F A;  5EPF A;  4HOJ A;  2IPA A;  2LRT A;  5ECI B;  2EFH A;  1GTB A;  1TK0 B;  1IYI A;  5B7C A;  3LEF A;  3MWH A;  3EMP A;  4YH2 A;  4YAP A;  5IMV A;  2FA8 A;  3DIE A;  5CRD A;  5B8B A;  1TU8 A;  5A1N B;  2DSA A;  2JSY A;  1V57 A;  5F0G A;  2HXK A;  3CSH A;  2VUP A;  1Z5Y E;  1EP7 A;  2IJY A;  1THO A;  4F82 A;  2YJ7 A;  3DKS A;  1A0F A;  2A4H A;  1SVM A;  3HVS A;  3MIX A;  2R2J A;  2L6D A;  2YWM A;  3GHA A;  1ABA A;  1Z6N A;  4KB3 A;  4ZXG A;  1FG4 A;  1DBY A;  3MNG A;  3QOU A;  22GS A;  1ILO A;  4PNG A;  4EF0 A;  2WS2 A;  3LJR A;  3FZA A;  2EIQ A;  3MDK A;  4POB A;  3EWL A;  2VCT A;  2FLS A;  4MZB A;  4ZBA A;  2E2M A;  1Y6E A;  1FVJ A;  4G0L A;  1USB A;  2PMT A;  5DAL B;  4AKX B;  2JZT A;  1TK5 B;  3QFA C;  4L8E A;  4J56 E;  3LXZ A;  1A8Y A;  3UIW A;  1ML6 A;  2IIY A;  3GKX A;  4WEY A;  3KTL A;  2KP2 A;  3KM6 A;  4WBR D;  4EIQ A;  1G0T A;  3QR6 A;  3UBK A;  1PKZ A;  4MJA A;  2AAW A;  2F9S A;  1SL2 B;  2REM A;  1OE8 A;  3F6D A;  3LWA A;  1KBN A;  2C0G A;  3DRN A;  2BTO T;  4K1F A;  5B8A A;  2IWT A;  2VM1 A;  4GQC A;  5BRT A;  1XVW A;  2H30 A;  1MEK A;  2HLS A;  5A5H A;  2H66 A;  1AQX A;  5DQY A;  3VUR A;  4L0W A;  1AW9 A;  4MCU A;  3D4M A;  4AI6 A;  2DJK A;  4AKI A;  2CQ9 A;  1XWC A;  1S3C A;  2YWI A;  2WFC A;  1ERU A;  5J4V A;  1WP0 A;  3TOT A;  4E8H A;  1FB6 A;  1OC9 B;  3IE3 A;  4GSS A;  3RBT A;  4KND A;  3S9F A;  2M72 A;  3APS A;  3I69 A;  2L57 A;  2H1B A;  4EDZ A;  3ZYW A;  4Q5F A;  3GUR A;  1XCC A;  1GSF A;  2B5Y A;  4K0N A;  2TRX A;  2H0H A;  1WE0 A;  4POM A;  1VF4 A;  5D93 A;  3DD3 A;  1QUW A;  1FO5 A;  6GSX A;  3VPT A;  2DMM A;  1T00 A;  2VL2 A;  1JZO A;  3APO A;  3IA1 A;  2OBI A;  4KX4 A;  4HJ2 A;  4DEJ A;  1FOV A;  1R4W A;  2R4V A;  1M7T A;  4MAB A;  3TKS C;  3QDN A;  2HI7 A;  1F3B A;  2YP6 A;  3PIN A;  3PH9 A;  1SK2 A;  2FGX A;  2H1L A;  4F0B A;  1GUK A;  4TVE A;  4N10 A;  4MZW A;  4E8E A;  19GS A;  1N25 A;  1WRY A;  2V1M A;  1GLP A;  3GYK A;  1A2M A;  3E9J B;  1GL8 A;  5KN0 A;  2Z9S A;  4TXO A;  1B8X A;  4MK3 A;  2VL2 C;  2C8U A;  1WPI A;  1HNA A;  3ZTL A;  4D73 B;  4LL4 B;  3VLN A;  2MMZ A;  1AQV A;  4NV5 A;  1UC7 A;  2CZ2 A;  2YPM A;  4DSR A;  1GH2 A;  4NHZ A;  9GSS A;  3GFK A;  2CV4 A;  3WGD A;  2JL4 A;  1V58 A;  4EE0 A;  2GDR A;  2CA8 A;  1TP9 A;  1M99 A;  2VCX A;  5J5N A;  1XBS A;  1W89 A;  4HDE A;  1K3L A;  2VLT A;  1ZYE A;  2IMI A;  1PRX A;  2DJ2 A;  3E3E A;  3H79 A;  3N9J A;  4V2M A;  3CXG A;  3H1N A;  6GSY A;  2DJJ A;  2PUK C;  4BWS A;  2GGT A;  3KCM A;  2B7J A;  1CQG A;  1T4Z A;  2GT6 A;  1XOB A;  4IN0 A;  3P90 A;  3C1S A;  2PN8 A;  5A5H B;  2RM5 A;  5DAK B;  4L5O A;  3G9B A;  1TKD B;  3A5W A;  2CX3 A;  16GS A;  3OR5 A;  2O8V B;  1J0F A;  4K2D A;  2EFE A;  2HSN A;  4EIP A;  1YKA A;  2KUC A;  3FW2 A;  4MH2 A;  1ON4 A;  4TXV A;  1TXX A;  3TRQ A;  4MF7 A;  1TXU A;  3ZVJ A;  3CSJ A;  1HNC A;  3HDC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...