2UZ8A

The crystal structure of p18, human translation elongation factor 1 epsilon 1
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
169
structure length
164
Chain Sequence
MAAAAELSLLEKSLGLSKGNKYSAQGERQIPVLQTNNGPSLMGLTTIAAHLVKQANKEYLLGSTAEEKAMVQQWLEYRVTQVDNDIHTLLMDLNSYLEDKVYLTGYNFTLADILLYYGLHRFIVDLTVQEKEKYLNVSRWFCHIQHYPGIRQHLSSVVFIKNRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords EUKARYOTIC TRANSLATION ELONGATION FACTOR 1 EPSILON-1
publication title Determination of Three-Dimensional Structure and Residues of the Novel Tumor Suppressor Aimp3/P18 Required for the Interaction with Atm.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein
total genus 49
structure length 164
sequence length 169
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-04-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00043 GST_C Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 2uz8A02
3.40.30.90 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2uz8A01
5ELGA 1K0BA 4BL7A 1OYJA 1FW1A 5D73A 3KM6A 4YQVA 1HNCA 4MPGA 1U88A 2C4JA 4IW9A 2J9HA 4ECJA 1GTAA 3WD6A 4GSTA 4E8HA 1TDIA 1TU7A 1AQVA 4PUAA 4PNFA 4KSMA 5IQYA 1M99A 3L0HA 3HJOA 4JBBA 2C3QA 5ECNB 1BX9A 1GTUA 2AB6A 2CA8A 4IQAA 1GUKA 5G5EA 4MF5A 4K0GA 5FHIA 4KGIA 5DAKA 5GZZB 1YJ6A 2CAIA 3FR3A 1M9BA 1TW9A 2VD0A 3DGQA 3IBHA 5ECQB 3Q74A 1EV4A 4HZ2A 2YV9A 3VPQA 1JZRA 5A4UA 1B48A 1YY7A 4ZBBA 1HNBA 2CAQA 4KAEA 1M9AA 1PN9A 20GSA 3IK7A 3FR9A 1VF4A 4OFTA 4IVFA 1F3AA 4MP4A 4HJ2A 4NAXA 5A4VA 1K0AA 5EL8A 1NHYA 4YAVA 11GSA 1K3LA 4TOPA 1AQWA 3VLNA 4HZ4A 3LSZA 5ECHB 3UBKA 1IYHA 4IGJA 5FT3A 1K0DA 3SWLA 2PBJA 4PURA 4RI6A 2VCTA 2UZ8A 1GWCA 4EXJA 1GSSA 2HRKB 2N5FA 17GSA 1F3BA 3W8SA 1PX7A 4E8EA 1PMTA 3PR8A 4Q5NA 10GSA 3LG6A 5HFKA 3LJRA 2HSNB 5DDLA 5A4WA 3H1NA 4YH2A 1MTCA 2PMTA 1GSEA 4BVXA 3VPTA 2ON5A 4ZB6A 1GSDA 4G0IA 2CZ3A 4OFNA 2GTUA 1AQXA 1EOGA 4GTUA 4PTSA 1VF2A 4PGTA 1GSUA 4MDCA 3AY8A 4L8EA 3CBUA 1PKZA 3EINA 3I69A 16GSA 1F2EA 1GTBA 1BYEA 5F05A 3I6AA 1FHEA 5ECKB 3GTUB 2GSRA 3O76A 2V6KA 5AIXA 4PQHA 2IMKA 2IMIA 3M0FA 5F07A 3R3EA 4J2FA 3CSHA 4EDZA 1GNWA 5JCUA 5AN1A 1K0MA 3GUSA 4DEJA 4NHZA 4PXOA 4K0NA 3DD3A 5ECLB 5DCGA 1K3YA 1AXDA 1XWKA 3UBLA 3PPUA 1Q4JA 3LXTA 3TOUA 2ON7A 1JLVA 4BVYA 2WRTA 5ECPB 3BBYA 5GSSA 4ZB8A 2HSMA 2FHEA 4FQUA 4EDYA 3HJMA 4YQMA 3QAWA 4KH7A 4GCIA 3Q19A 1MD4A 2A2SA 3N9JA 2DC5A 1YKCA 5LCZA 2C8UA 5ECSA 3CSIA 1GTIA 2HNLA 2R3XA 5JCWA 3IE3A 4QQ7A 2AHEA 2D2ZA 1HQOA 4KE3A 4ZXGA 4ACSA 1EOHA 2C3TA 3F63A 4GSNA 4KDUA 1YDKA 4LMVA 2VCVA 3KJYA 1JLWA 2GSQA 2VCXA 3QAVA 3GURA 4L5OA 4PQIA 4USSA 1OE8A 2VCWA 4JZQA 1N2AA 2F8FA 4F0BA 2WJUA 1GLPA 3P8WA 19GSA 1PX6A 3LYKA 4AGSA 2A2RA 5GSTA 5EVOA 3MAKA 3LQ7A 1VF1A 3HKRA 3G7IA 2R6KA 1PD21 4MK3A 4F03A 1K0NA 2FNOA 4KF9A 1G7OA 3ERFA 4G9HA 5ECIB 4BVXB 3KTLA 3IK9A 7GSSA 4Q5RA 2PERA 4ID0A 5BMUA 14GSA 3C8EA 1IYIA 3PGTA 1E6BA 3ISOA 1GNEA 9GSSA 3GH6A 2X64A 3VURA 2HRKA 1M0UA 3G7JA 3KMNA 3F6FA 3KMOA 3QR6A 4HI7A 3NIVA 4IS0A 4EE0A 3TGZA 4BL7B 6GSUA 2GDRA 3MDKA 2WS2A 5DALA 4ISDA 3U6VA 6GSWA 18GSA 1V2AA 3R2QA 4PX1A 2WB9A 3GSSA 3M3MA 3GSTA 1ML6A 1XW6A 2DSAA 5LD0A 6GSYA 4BVYB 3M1GA 1GUHA 4JEDA 5DJMA 3CRTA 1B8XA 4ECBA 3P90A 4ZBAA 1UA5A 4ECCA 2R4VA 4CHSA 4F0CA 1B4PA 4GSSA 2LJRA 5ECMB 4NHWA 1ZGNA 1G6YA 4G0LA 2PVQA 5DAKB 1ZL9A 3GTUA 4IBPA 2CZ2A 3O3TA 3FY7A 1K0CA 3ERGA 1GULA 3VI7A 2WDUA 1C72A 3UARA 3LXZA 5AIVA 3F6DA 1KBNA 5AGYA 5D9XA 3M8NA 4O7HA 1USBA 3Q18A 5DQSA 5J5NA 2OADA 3ZFLA 5D9VA 4Q5QA 4PNGA 1LBKA 1HNAA 3D0ZA 3IR4A 1MD3A 5F8BA 5G5FA 4YAPA 4O92A 3GX0A 3WYWA 5J4UA 4MZWA 4ZBDA 5EY6A 3IC8A 3VWXA 1YQ1A 1BG5A 2OACA 1U87A 1V40A 3VI5A 5D9WA 1EV9A 3ZMLA 2VO4A 3KXOA 12GSA 1LJRA 4WR4A 2GSTA 2OA7A 1A0FA 22GSA 3UVHA 13GSA 4KDYA 1G6WA 4L5LA 2R5GA 3RBTA 5KEJA 4EC0A 1PGTA 5A5KA 1XWGA 2PGTA 2VCQA 2VCZA 4GF0A 3TOTA 2GSSA 4ECIA 3FR6A 1U3IA 1DUGA 5J41A 1AW9A 1GSYA 1GUMA 3CSJA 2YCDA 4IQ1A 5FWGA 1GLQA 2GLRA 3LYPA 1VF3A 1K3OA 3ZFBA 5F0GA 5ECOB 5D9TA 1BAYA 1PA3A 3FYGA 4HOJA 4Q5FA 1EEMA 6GSTA 3UAPA 1K0OA 1GSQA 3FRCA 5DALB 4LMWA 1TU8A 5F06A 2HRAA 4MF6A 4IKHA 3ZMKA 3EE2A 2C3NA 1PL1A 4G0KA 1XW5A 4RI7A 4MPFA 1R5AA 4KX4A 5B7CA 3QAGA 2IL3A 1Y6EA 4YQUA 8GSSA 4IJIA 4I97A 3LFLA 4G10A 1Z9HA 2AAWA 2HQTA 4KDXA 2NTOA 5AISA 1PKWA 3CRUA 2C80A 3N5OA 4MF7A 4OFMA 5DJLA 3VK9A 2CVDA 1OE7A 5ELAA 2F3MA 4IELA 6GSXA 4GLTA 1RK4A 4G19A 2JL4A 4OMVA 2VD1A 2HSMB 2YV7A 1OKTA 4WR5A 1GSFA 4N0VA 4ZB9A 5ECRB 1PL2A 6GSSA 6GSVA
chains in the Genus database with same CATH superfamily
3VFIA 1K0BA 5H5QA 4EKZA 1A8LA 2KP2A 4TXOB 1M2DA 2C4JA 4ML1A 3WD6A 2X8HA 4GSTA 4E8HA 4ML6A 2AV4A 4PNFA 2YNXA 5DBQA 1F37A 2IIYA 3GIXA 1O73A 2IMFA 1BX9A 3EMXA 3IV4A 3HJPA 3EMPA 1YZXA 3RAZA 5FHIA 1Z5YE 2V6OA 1YJ6A 1SYXA 2DJ2A 2CAIA 2LV3A 1M9BA 3DGQA 2OE3A 2XPDA 1XWCA 2H30A 2YV9A 4W66A 3VPQA 1JZRA 1YY7A 5KN3A 20GSA 3IK7A 4MH2A 4GDFA 1XOBA 1JHBA 4NAXA 1H4OA 5A4VA 2I1UA 1K0AA 5EL8A 2C1YA 1A0RP 1AQWA 3TJJA 5KN0A 4HZ4A 3LSZA 5IM9A 5INYA 4IGJA 4LA1A 2HZEB 3KIJA 2UZ8A 3A5IA 4KNDA 3M9KA 2HRKB 4AJ6A 3W8SA 2WW2A 4Q5NA 2FY6A 1YEWC 4BWSA 2ZNMA 4TXVA 4K6XA 2HSNB 3DMLA 2BMXA 2MMZA 2HSYA 4XHMA 1PN0A 4NXIA 4MJCA 4OD7A 2FGXA 2NBSA 3L9SA 2ON5A 2GT6A 3EWLA 4ZL8A 4G0IA 4TR4A 4GWRA 4PTSA 1T7PB 1VF2A 2DJ1A 4MDCA 3GNJA 4L8EA 3CBUA 2REMA 1PKZA 3IPZA 1AAZA 1F2EA 1GTBA 1BYEA 1S3DA 4GQCA 5ECKB 4V2LA 4MLYA 3O76A 5AIXA 1SD8A 2IMKA 2IMIA 1RW1A 2K8SA 4EDZA 3FZ9A 4JR4A 4KB3A 3D21A 2WW1A 3DRNA 4HU9A 4K2DA 1T4ZA 1GH2A 4NHZA 4PXOA 2RUFA 4MJEA 3GRXA 3A2XA 5DCGA 1XWKA 1UVZA 2QSIA 4GQFA 1Q4JA 3TOUA 2ON7A 3E9JB 1R7HA 2MYGA 1NW2A 4N0ZA 2DIZA 2HSMA 4K7IA 3I43A 4JE1A 3HJMA 3QAWA 4KH7A 2DMLA 2QA2A 2XBIA 2DC5A 4AKIA 2L57A 2C8UA 3D6IA 1GTIA 2FCHA 1QK8A 4HDEA 2HNLA 2R3XA 3IE3A 2V32A 2O5VA 1OC8A 5HR2A 4F9ZA 2D2ZA 4KE3A 2L5OA 5A1NA 1AIUA 1XXUA 4OO4A 2HRNA 1EOHA 4DSSA 3ZL5A 3RGBC 3GL3A 2OKAA 2I81A 2PPTA 3HVXA 4LMVA 4DSRA 2JZTA 1JLWA 1KTEA 5JWQB 3IOSA 4GRFA 1SL2B 2WFCA 4PQIA 2QA1A 2H19A 4JZQA 1SVMA 1N25A 4F0BA 1GLPA 1PX6A 2BTOT 5CREA 2QC7A 3MAKA 3H4KA 2VL2C 1CQHA 1FB0A 2UV8G 4A5PA 2EFHA 2JU5A 1RQMA 1PSQA 1K0NA 2IFQA 4G9HA 1JZDA 2O3EA 1DBYA 4BVXB 2HRFA 3IK9A 3TJBA 7GSSA 1B9YC 2TRXA 4H86A 3C8EA 1O85A 2B6MA 2LRTA 1Q98A 9GSSA 2X64A 2TRCP 3J7Yk 3QR6A 5HR3A 4FYCA 4IS0A 4X4JA 3IHGA 5HFGA 4BL7B 2WS2A 5DALA 4ISDA 1TTZA 3FEUA 6GSWA 1V2AA 3TKRA 3UMAA 2OT3A 2LKUA 3ZTLA 2ALBA 2CVKA 3HCZA 4XRAA 2B5EA 5E59A 1GUHA 1VGLA 1B8XA 4ECBA 4ZBAA 4F0CA 1B4PA 2C0FA 4NHWA 1ZL9A 1X5CA 3GTUA 1SENA 1W4VA 2MZCA 1K0CA 2WDUA 1V58A 1ZYPA 3WGXA 3MSZA 3Q18A 5J5NA 2R0PA 2P5QA 5HR1A 1R5PA 1T00A 1LBKA 3GKKA 5G5FA 4WF4A 4O92A 3F4SA 5J4UA 4MZWA 4ZBDA 5CYYA 4TR1B 2VIMA 2WVZA 2VOCA 4MH3A 1B4QA 3VI5A 3GFKA 1LJRA 3APQA 1EP8A 2GSTA 3C71A 22GSA 3BD2A 13GSA 4RQRA 1TRVA 2R0CA 2R5GA 4EC0A 4ILFA 1XWGA 2VCQA 2VCZA 1OC9A 4V1Ag 5G30A 4ECIA 1MDKA 2YWIA 2H8LA 5J41A 1AW9A 1ERUA 5BMUB 2IPAA 4EVMA 4OCFA 1I9DA 2K6VA 3ZFBA 5F0GA 5ECOB 1OAZA 1BAYA 2H70A 1PA3A 3FYGA 1Z6NA 3DVXA 4PUFC 3D4MA 6GSTA 3JCML 3FRCA 5E4WA 1KNGA 4MF6A 3ZVJA 3ZMKA 3GV1A 1PL1A 3GKXA 4Z7XA 1SL0B 3RPNA 4WETA 2WZ9A 3TKQA 1Y6EA 1H75A 1M2AA 4I2UA 2VL2A 1ZOFA 4G10A 1XPVA 2NTOA 5AISA 1BEDA 5DJLA 2CVDA 1OE7A 5ELAA 2F3MA 2B1LA 4MZBA 4G19A 2K8VA 2YV7A 4WR5A 2O89A 3F4TA 1EP7A 1SK1A 5CRHA 1HNCA 4IW9A 5IMFA 3UIWA 1GTAA 2OJLA 3MNGA 1TI1A 2N5BA 1MEKA 4OWYA 4JBBA 2VL3A 2QKEA 3HZ8A 4RUVA 1TRUA 2AB6A 4DVCA 3PINA 4MF5A 2RM5A 1A2MA 3A5WA 4AKXB 2H72A 1TW9A 3IBHA 2IWTA 1V57A 2JSYA 3QMXA 1EV4A 4HZ2A 3TU3B 1TK5B 2O7KA 1N8JA 4ZBBA 5A5HB 2CAQA 2JADA 2YWMA 1A2LA 3FR9A 4OFTA 5J4YA 2YP6A 4HJ2A 4HU7A 3NOFA 3CTGA 3HVVA 4K2XA 5HFIA 1NHYA 4YAVA 11GSA 1TK8B 1K3LA 4TOPA 2WCIA 3UBKA 3C7MA 5KOXA 1K0DA 2GZZA 2F8AA 1ABAA 2VCTA 4Z2UA 4EL1A 1SKWB 1XVQA 3FZ4A 1GWCA 4EXJA 2N5FA 3VWWA 2DJKA 4E8EA 3PR8A 2HSHA 3LW9A 3LG6A 4LL1B 4XS4A 1FOVA 3KH7A 4HEA2 3M9JA 3LJRA 5DDLA 4YH2A 1T3BA 2PMTA 1S3CA 4ZILA 1EOGA 4D73A 4CDOA 1UN2A 4POLA 2X49A 3AY8A 3DWVA 3EINA 4ZL9A 2M72A 5F05A 1TK0B 4X43A 4FIWA 2GSRA 2Z9SA 2L6DA 3LORA 4J57E 3M0FA 1NM3A 5IO0A 3CSHA 1GNWA 4L0WA 1NSWA 2XBQA 5D96A 3TJKA 1K0MA 1J9BA 3OR5A 2YN1A 3LXTA 2WRTA 5GSSA 2IMEA 2FHEA 1G7EA 4QMKA 5J3RA 2H0HA 4Z2TA 1MD4A 3N9JA 5D93A 2HI7A 3ME7A 5JCWA 2B5YA 3UVTA 1ZMAA 3TJGA 5CO3A 4QL7A 3L9VA 3IHQA 4ZXGA 3ZZXA 4KDUA 1O7UA 2I4AA 3BCIA 3KJYA 2GSQA 2VCXA 2M80A 2GGTA 1QXHA 1N2AA 2F8FA 2WJUA 19GSA 3LYKA 4K1FA 1XIYA 3G7IA 1EGOA 1PD21 4WKWA 3FHKA 3E0UA 2G0FA 2FNOA 3ERFA 3J7Yb 3GN3A 2EC4A 2MBSA 5JCGA 2KOKA 5LNKe 4ID0A 14GSA 3PGTA 2DIYA 2YANA 1GNEA 4V1Ap 3CWGA 1ILOA 2HZEA 1TI3A 1WRYA 2HRKA 3WT1A 3TKPA 1Z3EA 3S9FA 1ACVA 3KMNA 2DJ3A 1QQ2A 5CRGA 4HI7A 3KGKA 4IHUA 2F9SA 3ZYWA 4TR3A 3U6VA 4O32A 2LS5A 4O5UA 3HDCA 18GSA 2WB9A 1ON4A 4YKFA 2HFDA 1ML6A 3A2VA 2PUKC 3GL5A 6GSYA 1FVKA 3M1GA 2TIRA 5IOWA 3CRTA 1ERTA 1PFOA 2H1AA 2H1LA 2LJRA 2OBKA 4N10A 4G0LA 5DAKB 1VRSD 4AF2A 4F82A 2MMAA 1SJZA 4TRXA 3RPPA 3O3TA 1BF5A 1G0TA 1C72A 3LXZA 5AIVA 1WE0A 3EU4A 5D9XA 2I3YA 3M8NA 1USBA 4KSOA 5ID2A 5A1NB 2HT9A 5G31A 2OADA 1S3AA 4DSSB 5IMCA 4PNGA 1HNAA 1SKSB 1X9MB 3ERWA 2KP1A 4YAPA 4POKA 3WYWA 3UOMA 2NDOA 3EURA 1U87A 3HXSA 5D9WA 1EV9A 1V9WA 2VO4A 1R4WA 3KXOA 12GSA 2P5RA 3UEMA 5B8AA 1YKAA 4G01A 1GL8A 2JZRA 2FA8A 4G2EA 3KEBA 1YF0A 2JSZA 2IFQB 1GRXA 2IJYA 2H1DA 3QOUA 4TKYA 3FR6A 1U3IA 2GVPA 1GUMA 3D22A 4IQ1A 2F51A 1URMA 1YEXA 2GLRA 3LYPA 3DXBA 2EFEA 1SJIA 5C04A 3WGEA 3GH9A 1K3OA 4AJ7A 2H76A 4TVEA 2XHFA 2XPEA 5DALB 1TU8A 2GT5A 5F06A 3FZ5A 3EE2A 2C3NA 2H75A 2R37A 4G0KA 1A24A 2DJ0A 5H5SA 3GKMA 1QGVA 4RI7A 3DKSA 4XS1A 4KCEA 4KX4A 4MA9A 8GSSA 3LFLA 4KDXA 2HQTA 4MF7A 5L71A 5A34A 2FWFA 6GSXA 3LWAA 4GLTA 1RK4A 2VD1A 4HQSA 1OKTA 2G2QA 1PL2A 6GSVA 4BIKA 1R26A 2H6ZA 4BL7A 1OYJA 4NWYA 1JFUA 1FW1A 5D73A 4YQVA 4MPGA 1PQNA 2J9HA 4MMMA 1TDIA 3DYRA 1AQVA 2E2MA 3HY2A 5IQYA 1M99A 3DVWA 3L0HA 4KW6A 5ECNB 2EIRA 2LJAA 4IQAA 1GUKA 1ZYQB 1DE2A 4KGIA 1M7TA 2H1BA 2VD0A 1XCCA 1XG8A 2DLXA 4K7NA 3TKSC 1GP1A 3WGDA 4TR0A 4PI2C 1B48A 1JZOA 3KP8A 1HNBA 1HYUA 1WWJA 4L0UA 3TCOA 4EIQA 4BWQA 5IPHA 4KAEA 1M9AA 1PN9A 4OO5A 1OC9B 2GS3A 3D4TA 1VF4A 4IVFA 1F3AA 3EC3A 5H5RA 1V98A 1MDIA 1WIKA 1T1VA 5ECHB 5G2ZA 4F2IA 1IYHA 5FT3A 3DEXA 4PURA 1XFLA 5ABRA 2H0GA 1ZYNA 2A2PA 1BG1A 5IMAA 1PMTA 2N5AA 10GSA 1O81A 2HZFA 2VLTA 4AJ8A 2P31A 3HHVA 5HFKA 3HA9A 4GXZA 1MTCA 4XTSA 5J9BA 1GSEA 4EF0A 3VPTA 3W8JA 2LJKA 3CXGA 4ZB6A 1FAAA 3H93A 4OFNA 4AI6A 1Z7RA 1AQXA 4GTUA 2RUEA 4PGTA 3ZIVA 1S3RA 1OC3A 1SYRA 1YVLA 3I69A 16GSA 1SVLA 3TRQA 3TRXA 2V6KA 4PQHA 2E0QA 4POMA 1WPIA 1AC1A 5F07A 5G1LA 3R3EA 4J2FA 2R2JA 3CQFA 2DJJA 2ZCTA 5JCUA 2H0IA 5AN1A 2FWEA 4BA7A 3GUSA 4WXTA 3APSA 2NVLA 2WVXB 3KP9A 4LLRA 2GQLA 1K3YA 3TJFA 3ZITA 1AXDA 1B9XC 3UBLA 4FO5A 2PWJA 1JLVA 4BVYA 3A3TA 3ZLPA 2WW3A 5ECPB 3BBYA 2V2GA 4EDYA 4YQMA 3K8NA 4GCIA 2A2SA 1YKCA 5IMDA 2RM6A 4IP6A 5ECSA 1MDJA 3CSIA 2O36A 5JWRB 3H8QA 3DIEA 4QQ7A 4K7OA 3TRPA 2OBIA 5IPGA 1TXXA 1HQOA 2NPBA 2O85A 3ME8A 3GA4A 2C3TA 3EYTA 1YEPA 2LQOA 5J47A 2VCVA 3H79A 3QAVA 4I5QA 3GURA 4L5OA 1OE8A 4HS1A 3P8WA 3RFRC 5A5HA 2MBTA 4XS4B 5GSTA 5EVOA 3LQ7A 1VF1A 3HKRA 2R6KA 1Z7PA 3QD9A 1ZYEA 4MK3A 3TKSA 1THXA 2KLXA 3KTLA 1A2JA 3ZRDA 4Q5RA 4D73B 2PERA 1UC7A 3ISOA 3EPTA 2H6YA 2X99A 1T8EB 3VURA 3F6FA 3GHAA 3KMOA 5J40A 3NIVA 1QUWA 2YJHA 4EE0A 3TGZA 3HD5A 4CY8A 2GDRA 2OE1A 3MDKA 1XWBA 4K5SA 4HUAA 4MJAA 3HVSA 2ZUPA 3GSSA 3M3MA 3E3EA 3GSTA 5IMVA 3IDVA 1XW6A 2WVYA 1SD9A 2LQQA 1SVOA 4JEDA 3F3RA 4CW9A 2LNSA 1EZKA 1UA5A 4ECCA 2VM1A 1E2YA 4GSSA 2C0DA 1ZGNA 1G6YA 3KCMA 5B8BA 4WBJA 1ERWA 3HVNA 4V2MA 2CZ2A 3ED3A 1A8YA 3FY7A 3ZREA 1FOHA 2B7JA 3QPMA 2WW0A 3VI7A 1X5DA 2DKHA 4TXOA 4WBRD 3F6DA 5AGYA 4K5RA 2KHPA 2YOIA 5DQSA 1SK0A 1XZOA 5D9VA 4IJ3A 5C00A 1TRSA 1LU4A 2YWOA 3D0ZA 1OKDA 4O5QA 5G1KA 4TN8A 3C73A 1M2BA 1X5EA 1BQ7A 3US3A 5EY6A 2OACA 2E2GA 1T4YA 3ZMLA 2PVOC 4WR4A 3TKSE 2CT6A 2OA7A 3UVHA 4QL9A 4FYUA 2YJ7A 1I1IP 2A4VA 2V41A 1FB6A 2GSSA 3UJ1A 2H01A 3W6GA 1DUGA 1QFNA 5IIZA 3FW2A 3CSJA 2BJXA 2YCDA 1NHOA 4ICYA 4KA0A 5FWGA 2FD3A 3VWUA 5CRWA 1GLQA 3KD0A 5COHA 1Y25A 5CP1A 5B6MA 5IO2A 4O5RA 4WF5A 2AUVA 4KUNA 4Q5FA 5IOXA 3MIXA 3UAPA 1K0OA 1QMVA 4LMWA 4HSCX 1JZWA 2B7KA 2HRAA 2EIOA 2H1GA 1ZZYA 2DBCA 1XW5A 2HSNA 5B7CA 2ES7A 3FZAA 2LSTA 4IJIA 1XWAA 4N3ZA 1X0RA 1Z9HA 2AAWA 3A2WA 2AJQB 3N5OA 2C80A 4Z2RA 5HR0A 3GYKA 3EU3A 1TJDA 1TP9A 1AUCA 2EIQA 2JL4A 2VAFA 2LTKA 2HSMB 4TW5A 4HJMA 3IAM2 2HYXA 4N0VA 2LUSA 5ECRB 6GSSA 2LEGA 5ELGA 1SKRB 2CX4A 4IN0A 3MYDA 3KM6A 1U88A 2HXKA 2C0EA 4ECJA 5ID2B 4YKGA 4PQ1A 4DSQA 1TU7A 1XVWA 2M46A 4PUAA 4JRRA 4KSMA 4N11A 4NMUA 3HJOA 2C3QA 1FG4A 2YZUA 1GTUA 3CMIA 2CA8A 5G5EA 4K0GA 5GZZB 5DAKA 5B6NA 3FR3A 1XOAA 2JZSA 1YF1A 5ECQB 3Q74A 2WGRA 1O6JA 1DE1A 5A4UA 1SJ6A 4X1UA 2PN8A 2CVBA 3FK8A 3UL3A 3KH9A 4FYBA 1FO5A 5GAPD 3V1WA 1Y1UA 3TDGA 4MP4A 4FH8A 3F3QA 5CAXA 5JWOB 3C1RA 1WJKA 3VLNA 2R0GA 5D8IA 5IMZA 2IN3A 3P7XA 2HLSA 3ZVJD 1PRXA 3SWLA 1X9WB 2PBJA 4RI6A 2LRCA 1TXUA 1GSSA 17GSA 1F3BA 1F6MC 1PX7A 3L78A 5DVBA 2H74A 2RIIA 1THOA 1WP0A 1M3IA 2FUG2 2O8VB 3F9UA 3IXRA 2L5LA 4OCEA 4I2TA 5A4WA 3H1NA 3C1SA 2MMNA 4JR6A 4BVXA 2YPMA 4HQZA 1GSDA 5A34B 2CZ3A 2V1MA 2GTUA 5HQPA 1GSUA 2K9FA 2EFCA 3I6AA 1FHEA 1XBSA 2KUCA 3GTUB 4J56E 3IC4A 4BPYA 3G7YA 2HE3A 1J0FA 4ZL7A 4MJBA 2LNTA 3SBCA 4N30A 2AYTA 4DEJA 3RHBA 4K0NA 3DD3A 5ECLB 3WT2A 2L6CA 3EVIA 2B3SA 3PPUA 2X8GA 4ZB7A 2K18A 4ZB8A 2VKZG 2L59A 2OE0A 4FQUA 3L4NA 2GQKA 3Q19A 1S4BP 1A23A 3VWVA 4IP1A 3CHXC 5LCZA 5DCHA 1CQGA 3F0IA 2AHEA 3QFBC 1U6TA 3FMWA 2CQ9A 4JU5A 2X8CA 2DKIA 3QCPA 4ACSA 3NZNA 3F63A 3APOA 4GSNA 3FKFA 3IAS2 5EPFA 5J4VA 2RLIA 1TOFA 1YDKA 4ULXA 2H66A 1DSBA 3RHCA 4AKGA 3QFAC 1ZCPA 4EIPA 3RDWA 1TRWA 1KEBA 4TR1A 4WEYA 4USSA 3GKNA 2VCWA 4XCSA 2PU9C 1SU9A 4AGSA 5J9CA 2A2RA 3CTFA 4FXYP 5BRTA 3KTBA 1FVJA 2MMOA 4NV2A 4F03A 4KF9A 1G7OA 5ECIB 3MWHA 2GZYA 2CV4A 5CRDA 3HMJG 3O6TA 2IMDA 3TUEA 2A4HA 5BMUA 2FWGA 5DQYA 1U3AA 1IYIA 1SL1B 1E6BA 2E7PA 3BJ5A 1X9SB 3GH6A 3GX8A 1M0UA 4PI0C 3G7JA 4NPBA 4MCUA 3ZIJA 1SK2A 2H6XA 2VLUA 3BOAA 1J08A 6GSUA 4XS6A 3I9V2 2L4CA 3U5RE 3PH9A 3F4RA 5KOWA 4P3YB 2EFDA 3R2QA 4PX1A 3L9UA 4XRDA 4NV5A 4I8BA 3Q6OA 1OVNA 2VM2A 2DSAA 1W89A 4ZIJA 5LD0A 4BVYB 1XW9A 5DJMA 3P90A 4RQXA 2VUPA 5KN2A 2R4VA 4CHSA 5ECMB 2B1KA 2GZPA 2PVQA 3F8UA 4IBPA 2CX3A 3ERGA 1GULA 3UARA 3IRAA 1KBNA 1M3JA 4O7HA 2P0GA 4EUYA 1BJXA 3KZQA 3LEFA 2WVXA 3ZFLA 2FLSA 4Q5QA 3IA1A 4I6XA 4E68A 2H73A 2XC2A 2I9HA 3IR4A 1TKDB 1MD3A 5F8BA 2VL9A 3LGCA 4MABA 3GX0A 2DMMA 2VLVA 3IC8A 2O87A 3VWXA 1YQ1A 1BG5A 1V40A 1EGRA 3QDNA 2YZHA 5GAND 1F9MA 1ERVA 1EEJA 5ENUA 1A0FA 4KDYA 3BCKA 3HZ4A 1G6WA 4MNNA 5KN1A 4L5LA 3RBTA 5KEJA 1PGTA 5A5KA 4XIHA 2PGTA 4V2NA 4GF0A 4POBA 3TOTA 4PHZC 4AKHA 4K8MA 2WZSA 2FWHA 4X0XA 1GSYA 2H71A 2J23A 4CY6A 2B5XA 2X4AA 2QGVA 1VF3A 4LL4B 1WMJA 2JACA 2GQMA 5D9TA 1Z6MA 1EWXA 4HOJA 4KCAA 1O8XA 1EEMA 1WOUA 1GSQA 4MZCA 3TB2A 4IKHA 2LRNA 1HD2A 3G9BA 4MPFA 1R5AA 2WULA 3GMFA 3QAGA 2IL3A 4YQUA 2YWNA 4EO3A 4I97A 4K9ZA 3D5JA 3CYNA 1PKWA 3CRUA 4OFMA 3VK9A 3P2AA 4IELA 1ST9A 4OMVA 1I5GA 2FA4A 1GSFA 5CNWA 4ZB9A 2C0GA 2L4QA 3HYPA 1O8WA
chains in the Genus database with same CATH topology
3VFIA 1K0BA 5H5QA 4EKZA 1A8LA 2KP2A 4TXOB 1M2DA 2C4JA 4ML1A 3WD6A 2X8HA 4GSTA 4E8HA 4ML6A 2AV4A 4PNFA 2YNXA 5DBQA 1F37A 2IIYA 3GIXA 1O73A 2IMFA 1BX9A 3EMXA 3IV4A 3HJPA 3EMPA 1YZXA 3RAZA 5FHIA 1Z5YE 2V6OA 1YJ6A 1SYXA 2DJ2A 2CAIA 2LV3A 1M9BA 3DGQA 2OE3A 2XPDA 1XWCA 2H30A 2YV9A 4W66A 3VPQA 1JZRA 1YY7A 5KN3A 20GSA 3IK7A 4MH2A 4GDFA 1XOBA 1JHBA 4NAXA 1H4OA 5A4VA 2I1UA 1K0AA 5EL8A 2C1YA 1A0RP 1AQWA 3TJJA 5KN0A 4HZ4A 3LSZA 5IM9A 5INYA 4IGJA 4LA1A 2HZEB 3KIJA 2UZ8A 3A5IA 4KNDA 3M9KA 2HRKB 4AJ6A 3W8SA 4Q5NA 2FY6A 4BWSA 2ZNMA 4TXVA 4K6XA 2HSNB 3DMLA 2BMXA 2MMZA 2HSYA 4XHMA 1PN0A 4NXIA 4MJCA 4OD7A 2FGXA 2NBSA 3L9SA 2ON5A 2GT6A 3EWLA 4ZL8A 4G0IA 4TR4A 4GWRA 4PTSA 1T7PB 1VF2A 2DJ1A 4MDCA 3GNJA 4L8EA 3CBUA 2REMA 1PKZA 3IPZA 1AAZA 1F2EA 1GTBA 1BYEA 1S3DA 4GQCA 5ECKB 4V2LA 4MLYA 3O76A 5AIXA 1SD8A 2IMKA 2IMIA 1RW1A 2K8SA 4EDZA 3FZ9A 4JR4A 4KB3A 3D21A 3DRNA 4HU9A 4K2DA 1T4ZA 1GH2A 4NHZA 4PXOA 2RUFA 4MJEA 3GRXA 3A2XA 5DCGA 1XWKA 1UVZA 2QSIA 4GQFA 1Q4JA 3TOUA 2ON7A 3E9JB 1R7HA 2MYGA 1NW2A 4N0ZA 2DIZA 2HSMA 4K7IA 3I43A 4JE1A 3HJMA 3QAWA 4KH7A 2DMLA 2QA2A 2XBIA 2DC5A 4AKIA 2L57A 2C8UA 3D6IA 1GTIA 2FCHA 1QK8A 4HDEA 2HNLA 2R3XA 3IE3A 2V32A 2O5VA 1OC8A 5HR2A 4F9ZA 2D2ZA 4KE3A 2L5OA 5A1NA 1AIUA 1XXUA 4OO4A 2HRNA 1EOHA 4DSSA 3ZL5A 3GL3A 2OKAA 2I81A 2PPTA 3HVXA 4LMVA 4DSRA 2JZTA 1JLWA 1KTEA 5JWQB 3IOSA 4GRFA 1SL2B 2WFCA 4PQIA 2QA1A 2H19A 4JZQA 1SVMA 1N25A 4F0BA 1GLPA 1PX6A 2BTOT 5CREA 2QC7A 3MAKA 3H4KA 2VL2C 1CQHA 1FB0A 2UV8G 4A5PA 2EFHA 2JU5A 1RQMA 1PSQA 1K0NA 2IFQA 4G9HA 1JZDA 1DBYA 4BVXB 2HRFA 3IK9A 3TJBA 7GSSA 1B9YC 2TRXA 4H86A 3C8EA 1O85A 2B6MA 2LRTA 1Q98A 9GSSA 2X64A 2TRCP 3J7Yk 3QR6A 5HR3A 4FYCA 4IS0A 4X4JA 3IHGA 5HFGA 4BL7B 2WS2A 5DALA 4ISDA 1TTZA 3FEUA 6GSWA 1V2AA 3TKRA 3UMAA 2OT3A 2LKUA 3ZTLA 2ALBA 2CVKA 3HCZA 4XRAA 2B5EA 5E59A 1GUHA 1VGLA 1B8XA 4ECBA 4ZBAA 4F0CA 1B4PA 2C0FA 4NHWA 1ZL9A 1X5CA 3GTUA 1SENA 1W4VA 2MZCA 1K0CA 2WDUA 1V58A 1ZYPA 3WGXA 3MSZA 3Q18A 5J5NA 2R0PA 2P5QA 5HR1A 1R5PA 1T00A 1LBKA 3GKKA 5G5FA 4WF4A 4O92A 3F4SA 5J4UA 4MZWA 4ZBDA 5CYYA 4TR1B 2VIMA 2VOCA 4MH3A 1B4QA 3VI5A 3GFKA 1LJRA 3APQA 1EP8A 2GSTA 3C71A 22GSA 3BD2A 13GSA 4RQRA 1TRVA 2R0CA 2R5GA 4EC0A 4ILFA 1XWGA 2VCQA 2VCZA 1OC9A 4V1Ag 5G30A 4ECIA 1MDKA 2YWIA 2H8LA 5J41A 1AW9A 1ERUA 5BMUB 2IPAA 4EVMA 4OCFA 1I9DA 2K6VA 3ZFBA 5F0GA 5ECOB 1OAZA 1BAYA 2H70A 1PA3A 3FYGA 1Z6NA 3DVXA 4PUFC 3D4MA 6GSTA 3JCML 3FRCA 5E4WA 1KNGA 4MF6A 3ZVJA 3ZMKA 3GV1A 1PL1A 3GKXA 4Z7XA 1SL0B 3RPNA 4WETA 2WZ9A 3TKQA 1Y6EA 1H75A 1M2AA 4I2UA 2VL2A 1ZOFA 4G10A 1XPVA 2NTOA 5AISA 1BEDA 5DJLA 2CVDA 1OE7A 5ELAA 2F3MA 2B1LA 4MZBA 4G19A 2K8VA 2YV7A 4WR5A 2O89A 3F4TA 1EP7A 1SK1A 5CRHA 1HNCA 4IW9A 5IMFA 3UIWA 1GTAA 2OJLA 3MNGA 1TI1A 2N5BA 1MEKA 4OWYA 4JBBA 2VL3A 2QKEA 3HZ8A 4RUVA 1TRUA 2AB6A 4DVCA 3PINA 4MF5A 2RM5A 1A2MA 3A5WA 4AKXB 2H72A 1TW9A 3IBHA 2IWTA 1V57A 2JSYA 3QMXA 1EV4A 4HZ2A 3TU3B 1TK5B 2O7KA 1N8JA 4ZBBA 5A5HB 2CAQA 2JADA 2YWMA 1A2LA 3FR9A 4OFTA 5J4YA 2YP6A 4HJ2A 4HU7A 3NOFA 3CTGA 3HVVA 4K2XA 5HFIA 1NHYA 4YAVA 11GSA 1TK8B 1K3LA 4TOPA 2WCIA 3UBKA 3C7MA 5KOXA 1K0DA 2GZZA 2F8AA 1ABAA 2VCTA 4Z2UA 4EL1A 1SKWB 1XVQA 3FZ4A 1GWCA 4EXJA 2N5FA 3VWWA 2DJKA 4E8EA 3PR8A 2HSHA 3LW9A 3LG6A 4LL1B 4XS4A 1FOVA 3KH7A 4HEA2 3M9JA 3LJRA 5DDLA 4YH2A 1T3BA 2PMTA 1S3CA 4ZILA 1EOGA 4D73A 4CDOA 1UN2A 4POLA 2X49A 3AY8A 3DWVA 3EINA 4ZL9A 2M72A 5F05A 1TK0B 4X43A 4FIWA 2GSRA 2Z9SA 2L6DA 3LORA 4J57E 3M0FA 1NM3A 5IO0A 3CSHA 1GNWA 4L0WA 1NSWA 2XBQA 5D96A 3TJKA 1K0MA 1J9BA 3OR5A 2YN1A 3LXTA 2WRTA 5GSSA 2IMEA 2FHEA 1G7EA 4QMKA 5J3RA 2H0HA 4Z2TA 1MD4A 3N9JA 5D93A 2HI7A 3ME7A 5JCWA 2B5YA 3UVTA 1ZMAA 3TJGA 5CO3A 4QL7A 3L9VA 3IHQA 4ZXGA 3ZZXA 4KDUA 1O7UA 2I4AA 3BCIA 3KJYA 2GSQA 2VCXA 2M80A 2GGTA 1QXHA 1N2AA 2F8FA 2WJUA 19GSA 3LYKA 4K1FA 1XIYA 3G7IA 1EGOA 1PD21 4WKWA 3FHKA 3E0UA 2G0FA 2FNOA 3ERFA 3J7Yb 3GN3A 2EC4A 2MBSA 5JCGA 2KOKA 5LNKe 4ID0A 14GSA 3PGTA 2DIYA 2YANA 1GNEA 4V1Ap 3CWGA 1ILOA 2HZEA 1TI3A 1WRYA 2HRKA 3WT1A 3TKPA 1Z3EA 3S9FA 1ACVA 3KMNA 2DJ3A 1QQ2A 5CRGA 4HI7A 3KGKA 4IHUA 2F9SA 3ZYWA 4TR3A 3U6VA 4O32A 2LS5A 4O5UA 3HDCA 18GSA 2WB9A 1ON4A 4YKFA 2HFDA 1ML6A 3A2VA 2PUKC 3GL5A 6GSYA 1FVKA 3M1GA 2TIRA 5IOWA 3CRTA 1ERTA 2H1AA 2H1LA 2LJRA 2OBKA 4N10A 4G0LA 5DAKB 1VRSD 4AF2A 4F82A 2MMAA 1SJZA 4TRXA 3RPPA 3O3TA 1BF5A 1G0TA 1C72A 3LXZA 5AIVA 1WE0A 3EU4A 5D9XA 2I3YA 3M8NA 1USBA 4KSOA 5ID2A 5A1NB 2HT9A 5G31A 2OADA 1S3AA 4DSSB 5IMCA 4PNGA 1HNAA 1SKSB 1X9MB 3ERWA 2KP1A 4YAPA 4POKA 3WYWA 3UOMA 2NDOA 3EURA 1U87A 3HXSA 5D9WA 1EV9A 1V9WA 2VO4A 1R4WA 3KXOA 12GSA 2P5RA 3UEMA 5B8AA 1YKAA 4G01A 1GL8A 2JZRA 2FA8A 4G2EA 3KEBA 1YF0A 2JSZA 2IFQB 1GRXA 2IJYA 2H1DA 3QOUA 4TKYA 3FR6A 1U3IA 2GVPA 1GUMA 3D22A 4IQ1A 2F51A 1URMA 1YEXA 2GLRA 3LYPA 3DXBA 2EFEA 1SJIA 5C04A 3WGEA 3GH9A 1K3OA 4AJ7A 2H76A 4TVEA 2XHFA 2XPEA 5DALB 1TU8A 2GT5A 5F06A 3FZ5A 3EE2A 2C3NA 2H75A 2R37A 4G0KA 1A24A 2DJ0A 5H5SA 3GKMA 1QGVA 4RI7A 3DKSA 4XS1A 4KCEA 4KX4A 4MA9A 8GSSA 3LFLA 4KDXA 2HQTA 4MF7A 5L71A 5A34A 2FWFA 6GSXA 3LWAA 4GLTA 1RK4A 2VD1A 4HQSA 1OKTA 2G2QA 1PL2A 6GSVA 1R26A 2H6ZA 4BL7A 1OYJA 4NWYA 1JFUA 1FW1A 5D73A 4YQVA 4MPGA 1PQNA 2J9HA 4MMMA 1TDIA 3DYRA 1AQVA 2E2MA 3HY2A 5IQYA 1M99A 3DVWA 3L0HA 4KW6A 5ECNB 2EIRA 2LJAA 4IQAA 1GUKA 1ZYQB 1DE2A 4KGIA 1M7TA 2H1BA 2VD0A 1XCCA 2DLXA 4K7NA 3TKSC 1GP1A 3WGDA 4TR0A 1B48A 1JZOA 3KP8A 1HNBA 1HYUA 1WWJA 4L0UA 3TCOA 4EIQA 4BWQA 5IPHA 4KAEA 1M9AA 1PN9A 4OO5A 1OC9B 2GS3A 3D4TA 1VF4A 4IVFA 1F3AA 3EC3A 5H5RA 1V98A 1MDIA 1WIKA 1T1VA 5ECHB 5G2ZA 4F2IA 1IYHA 5FT3A 3DEXA 4PURA 1XFLA 5ABRA 2H0GA 1ZYNA 2A2PA 1BG1A 5IMAA 1PMTA 2N5AA 10GSA 1O81A 2HZFA 2VLTA 4AJ8A 2P31A 3HHVA 5HFKA 3HA9A 4GXZA 1MTCA 4XTSA 5J9BA 1GSEA 4EF0A 3VPTA 3W8JA 2LJKA 3CXGA 4ZB6A 1FAAA 3H93A 4OFNA 4AI6A 1Z7RA 1AQXA 4GTUA 2RUEA 4PGTA 3ZIVA 1OC3A 1SYRA 1YVLA 3I69A 16GSA 1SVLA 3TRQA 3TRXA 2V6KA 4PQHA 2E0QA 4POMA 1WPIA 1AC1A 5F07A 5G1LA 3R3EA 4J2FA 2R2JA 2DJJA 2ZCTA 5JCUA 2H0IA 5AN1A 2FWEA 4BA7A 3GUSA 4WXTA 3APSA 2NVLA 3KP9A 4LLRA 2GQLA 1K3YA 3TJFA 3ZITA 1AXDA 1B9XC 3UBLA 4FO5A 2PWJA 1JLVA 4BVYA 3A3TA 3ZLPA 5ECPB 3BBYA 2V2GA 4EDYA 4YQMA 3K8NA 4GCIA 2A2SA 1YKCA 5IMDA 2RM6A 4IP6A 5ECSA 1MDJA 3CSIA 5JWRB 3H8QA 3DIEA 4QQ7A 4K7OA 3TRPA 2OBIA 5IPGA 1TXXA 1HQOA 2NPBA 2O85A 3ME8A 3GA4A 2C3TA 3EYTA 1YEPA 2LQOA 5J47A 2VCVA 3H79A 3QAVA 4I5QA 3GURA 4L5OA 1OE8A 4HS1A 3P8WA 5A5HA 2MBTA 4XS4B 5GSTA 5EVOA 3LQ7A 1VF1A 3HKRA 2R6KA 1Z7PA 3QD9A 1ZYEA 4MK3A 3TKSA 1THXA 2KLXA 3KTLA 1A2JA 3ZRDA 4Q5RA 4D73B 2PERA 1UC7A 3ISOA 3EPTA 2H6YA 2X99A 1T8EB 3VURA 3F6FA 3GHAA 3KMOA 5J40A 3NIVA 1QUWA 2YJHA 4EE0A 3TGZA 3HD5A 4CY8A 2GDRA 2OE1A 3MDKA 1XWBA 4K5SA 4HUAA 4MJAA 3HVSA 2ZUPA 3GSSA 3M3MA 3E3EA 3GSTA 5IMVA 3IDVA 1XW6A 1SD9A 2LQQA 1SVOA 4JEDA 3F3RA 4CW9A 2LNSA 1EZKA 1UA5A 4ECCA 2VM1A 1E2YA 4GSSA 2C0DA 1ZGNA 1G6YA 3KCMA 5B8BA 4WBJA 1ERWA 4V2MA 2CZ2A 3ED3A 1A8YA 3FY7A 3ZREA 1FOHA 2B7JA 3QPMA 3VI7A 1X5DA 2DKHA 4TXOA 4WBRD 3F6DA 5AGYA 4K5RA 2KHPA 2YOIA 5DQSA 1SK0A 1XZOA 5D9VA 4IJ3A 5C00A 1TRSA 1LU4A 2YWOA 3D0ZA 1OKDA 4O5QA 5G1KA 4TN8A 3C73A 1M2BA 1X5EA 1BQ7A 3US3A 5EY6A 2OACA 2E2GA 1T4YA 3ZMLA 2PVOC 4WR4A 3TKSE 2CT6A 2OA7A 3UVHA 4QL9A 4FYUA 2YJ7A 2A4VA 2V41A 1FB6A 2GSSA 3UJ1A 2H01A 3W6GA 1DUGA 1QFNA 5IIZA 3FW2A 3CSJA 2BJXA 2YCDA 1NHOA 4ICYA 4KA0A 5FWGA 2FD3A 3VWUA 5CRWA 1GLQA 3KD0A 5COHA 1Y25A 5CP1A 5B6MA 5IO2A 4O5RA 4WF5A 2AUVA 4KUNA 4Q5FA 5IOXA 3MIXA 3UAPA 1K0OA 1QMVA 4LMWA 1JZWA 2B7KA 2HRAA 2EIOA 2H1GA 1ZZYA 2DBCA 1XW5A 2HSNA 5B7CA 2ES7A 3FZAA 2LSTA 4IJIA 1XWAA 4N3ZA 1X0RA 1Z9HA 2AAWA 3A2WA 2AJQB 3N5OA 2C80A 4Z2RA 5HR0A 3GYKA 3EU3A 1TJDA 1TP9A 1AUCA 2EIQA 2JL4A 2VAFA 2LTKA 2HSMB 4TW5A 4HJMA 3IAM2 2HYXA 4N0VA 2LUSA 5ECRB 6GSSA 2LEGA 5ELGA 1SKRB 2CX4A 4IN0A 3MYDA 3KM6A 1U88A 2HXKA 2C0EA 4ECJA 5ID2B 4YKGA 4PQ1A 4DSQA 1TU7A 1XVWA 2M46A 4PUAA 4JRRA 4KSMA 4N11A 4NMUA 3HJOA 2C3QA 1FG4A 2YZUA 1GTUA 3CMIA 2CA8A 5G5EA 4K0GA 5GZZB 5DAKA 5B6NA 3FR3A 1XOAA 2JZSA 1YF1A 5ECQB 3Q74A 2WGRA 1O6JA 1DE1A 5A4UA 1SJ6A 4X1UA 2PN8A 2CVBA 3FK8A 3UL3A 3KH9A 4FYBA 1FO5A 5GAPD 3V1WA 1Y1UA 3TDGA 4MP4A 4FH8A 3F3QA 5CAXA 5JWOB 3C1RA 1WJKA 3VLNA 2R0GA 5D8IA 5IMZA 2IN3A 3P7XA 2HLSA 3ZVJD 1PRXA 3SWLA 1X9WB 2PBJA 4RI6A 2LRCA 1TXUA 1GSSA 17GSA 1F3BA 1F6MC 1PX7A 3L78A 5DVBA 2H74A 2RIIA 1THOA 1WP0A 2FUG2 2O8VB 3F9UA 3IXRA 2L5LA 4OCEA 4I2TA 5A4WA 3H1NA 3C1SA 2MMNA 4JR6A 4BVXA 2YPMA 4HQZA 1GSDA 5A34B 2CZ3A 2V1MA 2GTUA 5HQPA 1GSUA 2K9FA 2EFCA 3I6AA 1FHEA 1XBSA 2KUCA 3GTUB 4J56E 3IC4A 4BPYA 3G7YA 2HE3A 1J0FA 4ZL7A 4MJBA 2LNTA 3SBCA 4N30A 2AYTA 4DEJA 3RHBA 4K0NA 3DD3A 5ECLB 3WT2A 2L6CA 3EVIA 2B3SA 3PPUA 2X8GA 4ZB7A 2K18A 4ZB8A 2VKZG 2L59A 2OE0A 4FQUA 3L4NA 2GQKA 3Q19A 1A23A 3VWVA 4IP1A 5LCZA 5DCHA 1CQGA 3F0IA 2AHEA 3QFBC 1U6TA 3FMWA 2CQ9A 4JU5A 2X8CA 2DKIA 3QCPA 4ACSA 3NZNA 3F63A 3APOA 4GSNA 3FKFA 3IAS2 5EPFA 5J4VA 2RLIA 1TOFA 1YDKA 4ULXA 2H66A 1DSBA 3RHCA 4AKGA 3QFAC 1ZCPA 4EIPA 3RDWA 1TRWA 1KEBA 4TR1A 4WEYA 4USSA 3GKNA 2VCWA 4XCSA 2PU9C 1SU9A 4AGSA 5J9CA 2A2RA 3CTFA 5BRTA 3KTBA 1FVJA 2MMOA 4NV2A 4F03A 4KF9A 1G7OA 5ECIB 3MWHA 2GZYA 2CV4A 5CRDA 3HMJG 3O6TA 2IMDA 3TUEA 2A4HA 5BMUA 2FWGA 5DQYA 1U3AA 1IYIA 1SL1B 1E6BA 2E7PA 3BJ5A 1X9SB 3GH6A 3GX8A 1M0UA 3G7JA 4NPBA 4MCUA 3ZIJA 1SK2A 2H6XA 2VLUA 3BOAA 1J08A 6GSUA 4XS6A 3I9V2 2L4CA 3U5RE 3PH9A 3F4RA 5KOWA 4P3YB 2EFDA 3R2QA 4PX1A 3L9UA 4XRDA 4NV5A 4I8BA 3Q6OA 1OVNA 2VM2A 2DSAA 1W89A 4ZIJA 5LD0A 4BVYB 1XW9A 5DJMA 3P90A 4RQXA 2VUPA 5KN2A 2R4VA 4CHSA 5ECMB 2B1KA 2GZPA 2PVQA 3F8UA 4IBPA 2CX3A 3ERGA 1GULA 3UARA 3IRAA 1KBNA 4O7HA 2P0GA 4EUYA 1BJXA 3KZQA 3LEFA 3ZFLA 2FLSA 4Q5QA 3IA1A 4I6XA 4E68A 2H73A 2XC2A 2I9HA 3IR4A 1TKDB 1MD3A 5F8BA 2VL9A 3LGCA 4MABA 3GX0A 2DMMA 2VLVA 3IC8A 2O87A 3VWXA 1YQ1A 1BG5A 1V40A 1EGRA 3QDNA 2YZHA 5GAND 1F9MA 1ERVA 1EEJA 5ENUA 1A0FA 4KDYA 3BCKA 3HZ4A 1G6WA 4MNNA 5KN1A 4L5LA 3RBTA 5KEJA 1PGTA 5A5KA 4XIHA 2PGTA 4V2NA 4GF0A 4POBA 3TOTA 4AKHA 4K8MA 2FWHA 4X0XA 1GSYA 2H71A 2J23A 4CY6A 2B5XA 2X4AA 2QGVA 1VF3A 4LL4B 1WMJA 2JACA 2GQMA 5D9TA 1Z6MA 1EWXA 4HOJA 4KCAA 1O8XA 1EEMA 1WOUA 1GSQA 4MZCA 3TB2A 4IKHA 2LRNA 1HD2A 3G9BA 4MPFA 1R5AA 2WULA 3GMFA 3QAGA 2IL3A 4YQUA 2YWNA 4EO3A 4I97A 4K9ZA 3D5JA 3CYNA 1PKWA 3CRUA 4OFMA 3VK9A 3P2AA 4IELA 1ST9A 4OMVA 1I5GA 2FA4A 1GSFA 5CNWA 4ZB9A 2C0GA 2L4QA 3HYPA 1O8WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5ELG A;  1K0B A;  4BL7 A;  1OYJ A;  1FW1 A;  5D73 A;  3KM6 A;  4YQV A;  1HNC A;  4MPG A;  1U88 A;  2C4J A;  4IW9 A;  2J9H A;  4ECJ A;  1GTA A;  3WD6 A;  4GST A;  4E8H A;  1TDI A;  1TU7 A;  1AQV A;  4PUA A;  4PNF A;  4KSM A;  5IQY A;  1M99 A;  3L0H A;  3HJO A;  4JBB A;  2C3Q A;  5ECN B;  1BX9 A;  1GTU A;  2AB6 A;  2CA8 A;  4IQA A;  1GUK A;  5G5E A;  4MF5 A;  4K0G A;  5FHI A;  4KGI A;  5DAK A;  5GZZ B;  1YJ6 A;  2CAI A;  3FR3 A;  1M9B A;  1TW9 A;  2VD0 A;  3DGQ A;  3IBH A;  5ECQ B;  3Q74 A;  1EV4 A;  4HZ2 A;  2YV9 A;  3VPQ A;  1JZR A;  5A4U A;  1B48 A;  1YY7 A;  4ZBB A;  1HNB A;  2CAQ A;  4KAE A;  1M9A A;  1PN9 A;  20GS A;  3IK7 A;  3FR9 A;  1VF4 A;  4OFT A;  4IVF A;  1F3A A;  4MP4 A;  4HJ2 A;  4NAX A;  5A4V A;  1K0A A;  5EL8 A;  1NHY A;  4YAV A;  11GS A;  1K3L A;  4TOP A;  1AQW A;  3VLN A;  4HZ4 A;  3LSZ A;  5ECH B;  3UBK A;  1IYH A;  4IGJ A;  5FT3 A;  1K0D A;  3SWL A;  2PBJ A;  4PUR A;  4RI6 A;  2VCT A;  2UZ8 A;  1GWC A;  4EXJ A;  1GSS A;  2HRK B;  2N5F A;  17GS A;  1F3B A;  3W8S A;  1PX7 A;  4E8E A;  1PMT A;  3PR8 A;  4Q5N A;  10GS A;  3LG6 A;  5HFK A;  3LJR A;  2HSN B;  5DDL A;  5A4W A;  3H1N A;  4YH2 A;  1MTC A;  2PMT A;  1GSE A;  4BVX A;  3VPT A;  2ON5 A;  4ZB6 A;  1GSD A;  4G0I A;  2CZ3 A;  4OFN A;  2GTU A;  1AQX A;  1EOG A;  4GTU A;  4PTS A;  1VF2 A;  4PGT A;  1GSU A;  4MDC A;  3AY8 A;  4L8E A;  3CBU A;  1PKZ A;  3EIN A;  3I69 A;  16GS A;  1F2E A;  1GTB A;  1BYE A;  5F05 A;  3I6A A;  1FHE A;  5ECK B;  3GTU B;  2GSR A;  3O76 A;  2V6K A;  5AIX A;  4PQH A;  2IMK A;  2IMI A;  3M0F A;  5F07 A;  3R3E A;  4J2F A;  3CSH A;  4EDZ A;  1GNW A;  5JCU A;  5AN1 A;  1K0M A;  3GUS A;  4DEJ A;  4NHZ A;  4PXO A;  4K0N A;  3DD3 A;  5ECL B;  5DCG A;  1K3Y A;  1AXD A;  1XWK A;  3UBL A;  3PPU A;  1Q4J A;  3LXT A;  3TOU A;  2ON7 A;  1JLV A;  4BVY A;  2WRT A;  5ECP B;  3BBY A;  5GSS A;  4ZB8 A;  2HSM A;  2FHE A;  4FQU A;  4EDY A;  3HJM A;  4YQM A;  3QAW A;  4KH7 A;  4GCI A;  3Q19 A;  1MD4 A;  2A2S A;  3N9J A;  2DC5 A;  1YKC A;  5LCZ A;  2C8U A;  5ECS A;  3CSI A;  1GTI A;  2HNL A;  2R3X A;  5JCW A;  3IE3 A;  4QQ7 A;  2AHE A;  2D2Z A;  1HQO A;  4KE3 A;  4ZXG A;  4ACS A;  1EOH A;  2C3T A;  3F63 A;  4GSN A;  4KDU A;  1YDK A;  4LMV A;  2VCV A;  3KJY A;  1JLW A;  2GSQ A;  2VCX A;  3QAV A;  3GUR A;  4L5O A;  4PQI A;  4USS A;  1OE8 A;  2VCW A;  4JZQ A;  1N2A A;  2F8F A;  4F0B A;  2WJU A;  1GLP A;  3P8W A;  19GS A;  1PX6 A;  3LYK A;  4AGS A;  2A2R A;  5GST A;  5EVO A;  3MAK A;  3LQ7 A;  1VF1 A;  3HKR A;  3G7I A;  2R6K A;  1PD2 1;  4MK3 A;  4F03 A;  1K0N A;  2FNO A;  4KF9 A;  1G7O A;  3ERF A;  4G9H A;  5ECI B;  4BVX B;  3KTL A;  3IK9 A;  7GSS A;  4Q5R A;  2PER A;  4ID0 A;  5BMU A;  14GS A;  3C8E A;  1IYI A;  3PGT A;  1E6B A;  3ISO A;  1GNE A;  9GSS A;  3GH6 A;  2X64 A;  3VUR A;  2HRK A;  1M0U A;  3G7J A;  3KMN A;  3F6F A;  3KMO A;  3QR6 A;  4HI7 A;  3NIV A;  4IS0 A;  4EE0 A;  3TGZ A;  4BL7 B;  6GSU A;  2GDR A;  3MDK A;  2WS2 A;  5DAL A;  4ISD A;  3U6V A;  6GSW A;  18GS A;  1V2A A;  3R2Q A;  4PX1 A;  2WB9 A;  3GSS A;  3M3M A;  3GST A;  1ML6 A;  1XW6 A;  2DSA A;  5LD0 A;  6GSY A;  4BVY B;  3M1G A;  1GUH A;  4JED A;  5DJM A;  3CRT A;  1B8X A;  4ECB A;  3P90 A;  4ZBA A;  1UA5 A;  4ECC A;  2R4V A;  4CHS A;  4F0C A;  1B4P A;  4GSS A;  2LJR A;  5ECM B;  4NHW A;  1ZGN A;  1G6Y A;  4G0L A;  2PVQ A;  5DAK B;  1ZL9 A;  3GTU A;  4IBP A;  2CZ2 A;  3O3T A;  3FY7 A;  1K0C A;  3ERG A;  1GUL A;  3VI7 A;  2WDU A;  1C72 A;  3UAR A;  3LXZ A;  5AIV A;  3F6D A;  1KBN A;  5AGY A;  5D9X A;  3M8N A;  4O7H A;  1USB A;  3Q18 A;  5DQS A;  5J5N A;  2OAD A;  3ZFL A;  5D9V A;  4Q5Q A;  4PNG A;  1LBK A;  1HNA A;  3D0Z A;  3IR4 A;  1MD3 A;  5F8B A;  5G5F A;  4YAP A;  4O92 A;  3GX0 A;  3WYW A;  5J4U A;  4MZW A;  4ZBD A;  5EY6 A;  3IC8 A;  3VWX A;  1YQ1 A;  1BG5 A;  2OAC A;  1U87 A;  1V40 A;  3VI5 A;  5D9W A;  1EV9 A;  3ZML A;  2VO4 A;  3KXO A;  12GS A;  1LJR A;  4WR4 A;  2GST A;  2OA7 A;  1A0F A;  22GS A;  3UVH A;  13GS A;  4KDY A;  1G6W A;  4L5L A;  2R5G A;  3RBT A;  5KEJ A;  4EC0 A;  1PGT A;  5A5K A;  1XWG A;  2PGT A;  2VCQ A;  2VCZ A;  4GF0 A;  3TOT A;  2GSS A;  4ECI A;  3FR6 A;  1U3I A;  1DUG A;  5J41 A;  1AW9 A;  1GSY A;  1GUM A;  3CSJ A;  2YCD A;  4IQ1 A;  5FWG A;  1GLQ A;  2GLR A;  3LYP A;  1VF3 A;  1K3O A;  3ZFB A;  5F0G A;  5ECO B;  5D9T A;  1BAY A;  1PA3 A;  3FYG A;  4HOJ A;  4Q5F A;  1EEM A;  6GST A;  3UAP A;  1K0O A;  1GSQ A;  3FRC A;  5DAL B;  4LMW A;  1TU8 A;  5F06 A;  2HRA A;  4MF6 A;  4IKH A;  3ZMK A;  3EE2 A;  2C3N A;  1PL1 A;  4G0K A;  1XW5 A;  4RI7 A;  4MPF A;  1R5A A;  4KX4 A;  5B7C A;  3QAG A;  2IL3 A;  1Y6E A;  4YQU A;  8GSS A;  4IJI A;  4I97 A;  3LFL A;  4G10 A;  1Z9H A;  2AAW A;  2HQT A;  4KDX A;  2NTO A;  5AIS A;  1PKW A;  3CRU A;  2C80 A;  3N5O A;  4MF7 A;  4OFM A;  5DJL A;  3VK9 A;  2CVD A;  1OE7 A;  5ELA A;  2F3M A;  4IEL A;  6GSX A;  4GLT A;  1RK4 A;  4G19 A;  2JL4 A;  4OMV A;  2VD1 A;  2HSM B;  2YV7 A;  1OKT A;  4WR5 A;  1GSF A;  4N0V A;  4ZB9 A;  5ECR B;  1PL2 A;  6GSS A;  6GSV A; 
#chains in the Genus database with same CATH topology
 3VFI A;  1K0B A;  5H5Q A;  4EKZ A;  1A8L A;  2KP2 A;  4TXO B;  1M2D A;  2C4J A;  4ML1 A;  3WD6 A;  2X8H A;  4GST A;  4E8H A;  4ML6 A;  2AV4 A;  4PNF A;  2YNX A;  5DBQ A;  1F37 A;  2IIY A;  3GIX A;  1O73 A;  2IMF A;  1BX9 A;  3EMX A;  3IV4 A;  3HJP A;  3EMP A;  1YZX A;  3RAZ A;  5FHI A;  1Z5Y E;  2V6O A;  1YJ6 A;  1SYX A;  2DJ2 A;  2CAI A;  2LV3 A;  1M9B A;  3DGQ A;  2OE3 A;  2XPD A;  1XWC A;  2H30 A;  2YV9 A;  4W66 A;  3VPQ A;  1JZR A;  1YY7 A;  5KN3 A;  20GS A;  3IK7 A;  4MH2 A;  4GDF A;  1XOB A;  1JHB A;  4NAX A;  1H4O A;  5A4V A;  2I1U A;  1K0A A;  5EL8 A;  2C1Y A;  1A0R P;  1AQW A;  3TJJ A;  5KN0 A;  4HZ4 A;  3LSZ A;  5IM9 A;  5INY A;  4IGJ A;  4LA1 A;  2HZE B;  3KIJ A;  2UZ8 A;  3A5I A;  4KND A;  3M9K A;  2HRK B;  4AJ6 A;  3W8S A;  2WW2 A;  4Q5N A;  2FY6 A;  1YEW C;  4BWS A;  2ZNM A;  4TXV A;  4K6X A;  2HSN B;  3DML A;  2BMX A;  2MMZ A;  2HSY A;  4XHM A;  1PN0 A;  4NXI A;  4MJC A;  4OD7 A;  2FGX A;  2NBS A;  3L9S A;  2ON5 A;  2GT6 A;  3EWL A;  4ZL8 A;  4G0I A;  4TR4 A;  4GWR A;  4PTS A;  1T7P B;  1VF2 A;  2DJ1 A;  4MDC A;  3GNJ A;  4L8E A;  3CBU A;  2REM A;  1PKZ A;  3IPZ A;  1AAZ A;  1F2E A;  1GTB A;  1BYE A;  1S3D A;  4GQC A;  5ECK B;  4V2L A;  4MLY A;  3O76 A;  5AIX A;  1SD8 A;  2IMK A;  2IMI A;  1RW1 A;  2K8S A;  4EDZ A;  3FZ9 A;  4JR4 A;  4KB3 A;  3D21 A;  2WW1 A;  3DRN A;  4HU9 A;  4K2D A;  1T4Z A;  1GH2 A;  4NHZ A;  4PXO A;  2RUF A;  4MJE A;  3GRX A;  3A2X A;  5DCG A;  1XWK A;  1UVZ A;  2QSI A;  4GQF A;  1Q4J A;  3TOU A;  2ON7 A;  3E9J B;  1R7H A;  2MYG A;  1NW2 A;  4N0Z A;  2DIZ A;  2HSM A;  4K7I A;  3I43 A;  4JE1 A;  3HJM A;  3QAW A;  4KH7 A;  2DML A;  2QA2 A;  2XBI A;  2DC5 A;  4AKI A;  2L57 A;  2C8U A;  3D6I A;  1GTI A;  2FCH A;  1QK8 A;  4HDE A;  2HNL A;  2R3X A;  3IE3 A;  2V32 A;  2O5V A;  1OC8 A;  5HR2 A;  4F9Z A;  2D2Z A;  4KE3 A;  2L5O A;  5A1N A;  1AIU A;  1XXU A;  4OO4 A;  2HRN A;  1EOH A;  4DSS A;  3ZL5 A;  3RGB C;  3GL3 A;  2OKA A;  2I81 A;  2PPT A;  3HVX A;  4LMV A;  4DSR A;  2JZT A;  1JLW A;  1KTE A;  5JWQ B;  3IOS A;  4GRF A;  1SL2 B;  2WFC A;  4PQI A;  2QA1 A;  2H19 A;  4JZQ A;  1SVM A;  1N25 A;  4F0B A;  1GLP A;  1PX6 A;  2BTO T;  5CRE A;  2QC7 A;  3MAK A;  3H4K A;  2VL2 C;  1CQH A;  1FB0 A;  2UV8 G;  4A5P A;  2EFH A;  2JU5 A;  1RQM A;  1PSQ A;  1K0N A;  2IFQ A;  4G9H A;  1JZD A;  2O3E A;  1DBY A;  4BVX B;  2HRF A;  3IK9 A;  3TJB A;  7GSS A;  1B9Y C;  2TRX A;  4H86 A;  3C8E A;  1O85 A;  2B6M A;  2LRT A;  1Q98 A;  9GSS A;  2X64 A;  2TRC P;  3J7Y k;  3QR6 A;  5HR3 A;  4FYC A;  4IS0 A;  4X4J A;  3IHG A;  5HFG A;  4BL7 B;  2WS2 A;  5DAL A;  4ISD A;  1TTZ A;  3FEU A;  6GSW A;  1V2A A;  3TKR A;  3UMA A;  2OT3 A;  2LKU A;  3ZTL A;  2ALB A;  2CVK A;  3HCZ A;  4XRA A;  2B5E A;  5E59 A;  1GUH A;  1VGL A;  1B8X A;  4ECB A;  4ZBA A;  4F0C A;  1B4P A;  2C0F A;  4NHW A;  1ZL9 A;  1X5C A;  3GTU A;  1SEN A;  1W4V A;  2MZC A;  1K0C A;  2WDU A;  1V58 A;  1ZYP A;  3WGX A;  3MSZ A;  3Q18 A;  5J5N A;  2R0P A;  2P5Q A;  5HR1 A;  1R5P A;  1T00 A;  1LBK A;  3GKK A;  5G5F A;  4WF4 A;  4O92 A;  3F4S A;  5J4U A;  4MZW A;  4ZBD A;  5CYY A;  4TR1 B;  2VIM A;  2WVZ A;  2VOC A;  4MH3 A;  1B4Q A;  3VI5 A;  3GFK A;  1LJR A;  3APQ A;  1EP8 A;  2GST A;  3C71 A;  22GS A;  3BD2 A;  13GS A;  4RQR A;  1TRV A;  2R0C A;  2R5G A;  4EC0 A;  4ILF A;  1XWG A;  2VCQ A;  2VCZ A;  1OC9 A;  4V1A g;  5G30 A;  4ECI A;  1MDK A;  2YWI A;  2H8L A;  5J41 A;  1AW9 A;  1ERU A;  5BMU B;  2IPA A;  4EVM A;  4OCF A;  1I9D A;  2K6V A;  3ZFB A;  5F0G A;  5ECO B;  1OAZ A;  1BAY A;  2H70 A;  1PA3 A;  3FYG A;  1Z6N A;  3DVX A;  4PUF C;  3D4M A;  6GST A;  3JCM L;  3FRC A;  5E4W A;  1KNG A;  4MF6 A;  3ZVJ A;  3ZMK A;  3GV1 A;  1PL1 A;  3GKX A;  4Z7X A;  1SL0 B;  3RPN A;  4WET A;  2WZ9 A;  3TKQ A;  1Y6E A;  1H75 A;  1M2A A;  4I2U A;  2VL2 A;  1ZOF A;  4G10 A;  1XPV A;  2NTO A;  5AIS A;  1BED A;  5DJL A;  2CVD A;  1OE7 A;  5ELA A;  2F3M A;  2B1L A;  4MZB A;  4G19 A;  2K8V A;  2YV7 A;  4WR5 A;  2O89 A;  3F4T A;  1EP7 A;  1SK1 A;  5CRH A;  1HNC A;  4IW9 A;  5IMF A;  3UIW A;  1GTA A;  2OJL A;  3MNG A;  1TI1 A;  2N5B A;  1MEK A;  4OWY A;  4JBB A;  2VL3 A;  2QKE A;  3HZ8 A;  4RUV A;  1TRU A;  2AB6 A;  4DVC A;  3PIN A;  4MF5 A;  2RM5 A;  1A2M A;  3A5W A;  4AKX B;  2H72 A;  1TW9 A;  3IBH A;  2IWT A;  1V57 A;  2JSY A;  3QMX A;  1EV4 A;  4HZ2 A;  3TU3 B;  1TK5 B;  2O7K A;  1N8J A;  4ZBB A;  5A5H B;  2CAQ A;  2JAD A;  2YWM A;  1A2L A;  3FR9 A;  4OFT A;  5J4Y A;  2YP6 A;  4HJ2 A;  4HU7 A;  3NOF A;  3CTG A;  3HVV A;  4K2X A;  5HFI A;  1NHY A;  4YAV A;  11GS A;  1TK8 B;  1K3L A;  4TOP A;  2WCI A;  3UBK A;  3C7M A;  5KOX A;  1K0D A;  2GZZ A;  2F8A A;  1ABA A;  2VCT A;  4Z2U A;  4EL1 A;  1SKW B;  1XVQ A;  3FZ4 A;  1GWC A;  4EXJ A;  2N5F A;  3VWW A;  2DJK A;  4E8E A;  3PR8 A;  2HSH A;  3LW9 A;  3LG6 A;  4LL1 B;  4XS4 A;  1FOV A;  3KH7 A;  4HEA 2;  3M9J A;  3LJR A;  5DDL A;  4YH2 A;  1T3B A;  2PMT A;  1S3C A;  4ZIL A;  1EOG A;  4D73 A;  4CDO A;  1UN2 A;  4POL A;  2X49 A;  3AY8 A;  3DWV A;  3EIN A;  4ZL9 A;  2M72 A;  5F05 A;  1TK0 B;  4X43 A;  4FIW A;  2GSR A;  2Z9S A;  2L6D A;  3LOR A;  4J57 E;  3M0F A;  1NM3 A;  5IO0 A;  3CSH A;  1GNW A;  4L0W A;  1NSW A;  2XBQ A;  5D96 A;  3TJK A;  1K0M A;  1J9B A;  3OR5 A;  2YN1 A;  3LXT A;  2WRT A;  5GSS A;  2IME A;  2FHE A;  1G7E A;  4QMK A;  5J3R A;  2H0H A;  4Z2T A;  1MD4 A;  3N9J A;  5D93 A;  2HI7 A;  3ME7 A;  5JCW A;  2B5Y A;  3UVT A;  1ZMA A;  3TJG A;  5CO3 A;  4QL7 A;  3L9V A;  3IHQ A;  4ZXG A;  3ZZX A;  4KDU A;  1O7U A;  2I4A A;  3BCI A;  3KJY A;  2GSQ A;  2VCX A;  2M80 A;  2GGT A;  1QXH A;  1N2A A;  2F8F A;  2WJU A;  19GS A;  3LYK A;  4K1F A;  1XIY A;  3G7I A;  1EGO A;  1PD2 1;  4WKW A;  3FHK A;  3E0U A;  2G0F A;  2FNO A;  3ERF A;  3J7Y b;  3GN3 A;  2EC4 A;  2MBS A;  5JCG A;  2KOK A;  5LNK e;  4ID0 A;  14GS A;  3PGT A;  2DIY A;  2YAN A;  1GNE A;  4V1A p;  3CWG A;  1ILO A;  2HZE A;  1TI3 A;  1WRY A;  2HRK A;  3WT1 A;  3TKP A;  1Z3E A;  3S9F A;  1ACV A;  3KMN A;  2DJ3 A;  1QQ2 A;  5CRG A;  4HI7 A;  3KGK A;  4IHU A;  2F9S A;  3ZYW A;  4TR3 A;  3U6V A;  4O32 A;  2LS5 A;  4O5U A;  3HDC A;  18GS A;  2WB9 A;  1ON4 A;  4YKF A;  2HFD A;  1ML6 A;  3A2V A;  2PUK C;  3GL5 A;  6GSY A;  1FVK A;  3M1G A;  2TIR A;  5IOW A;  3CRT A;  1ERT A;  1PFO A;  2H1A A;  2H1L A;  2LJR A;  2OBK A;  4N10 A;  4G0L A;  5DAK B;  1VRS D;  4AF2 A;  4F82 A;  2MMA A;  1SJZ A;  4TRX A;  3RPP A;  3O3T A;  1BF5 A;  1G0T A;  1C72 A;  3LXZ A;  5AIV A;  1WE0 A;  3EU4 A;  5D9X A;  2I3Y A;  3M8N A;  1USB A;  4KSO A;  5ID2 A;  5A1N B;  2HT9 A;  5G31 A;  2OAD A;  1S3A A;  4DSS B;  5IMC A;  4PNG A;  1HNA A;  1SKS B;  1X9M B;  3ERW A;  2KP1 A;  4YAP A;  4POK A;  3WYW A;  3UOM A;  2NDO A;  3EUR A;  1U87 A;  3HXS A;  5D9W A;  1EV9 A;  1V9W A;  2VO4 A;  1R4W A;  3KXO A;  12GS A;  2P5R A;  3UEM A;  5B8A A;  1YKA A;  4G01 A;  1GL8 A;  2JZR A;  2FA8 A;  4G2E A;  3KEB A;  1YF0 A;  2JSZ A;  2IFQ B;  1GRX A;  2IJY A;  2H1D A;  3QOU A;  4TKY A;  3FR6 A;  1U3I A;  2GVP A;  1GUM A;  3D22 A;  4IQ1 A;  2F51 A;  1URM A;  1YEX A;  2GLR A;  3LYP A;  3DXB A;  2EFE A;  1SJI A;  5C04 A;  3WGE A;  3GH9 A;  1K3O A;  4AJ7 A;  2H76 A;  4TVE A;  2XHF A;  2XPE A;  5DAL B;  1TU8 A;  2GT5 A;  5F06 A;  3FZ5 A;  3EE2 A;  2C3N A;  2H75 A;  2R37 A;  4G0K A;  1A24 A;  2DJ0 A;  5H5S A;  3GKM A;  1QGV A;  4RI7 A;  3DKS A;  4XS1 A;  4KCE A;  4KX4 A;  4MA9 A;  8GSS A;  3LFL A;  4KDX A;  2HQT A;  4MF7 A;  5L71 A;  5A34 A;  2FWF A;  6GSX A;  3LWA A;  4GLT A;  1RK4 A;  2VD1 A;  4HQS A;  1OKT A;  2G2Q A;  1PL2 A;  6GSV A;  4BIK A;  1R26 A;  2H6Z A;  4BL7 A;  1OYJ A;  4NWY A;  1JFU A;  1FW1 A;  5D73 A;  4YQV A;  4MPG A;  1PQN A;  2J9H A;  4MMM A;  1TDI A;  3DYR A;  1AQV A;  2E2M A;  3HY2 A;  5IQY A;  1M99 A;  3DVW A;  3L0H A;  4KW6 A;  5ECN B;  2EIR A;  2LJA A;  4IQA A;  1GUK A;  1ZYQ B;  1DE2 A;  4KGI A;  1M7T A;  2H1B A;  2VD0 A;  1XCC A;  1XG8 A;  2DLX A;  4K7N A;  3TKS C;  1GP1 A;  3WGD A;  4TR0 A;  4PI2 C;  1B48 A;  1JZO A;  3KP8 A;  1HNB A;  1HYU A;  1WWJ A;  4L0U A;  3TCO A;  4EIQ A;  4BWQ A;  5IPH A;  4KAE A;  1M9A A;  1PN9 A;  4OO5 A;  1OC9 B;  2GS3 A;  3D4T A;  1VF4 A;  4IVF A;  1F3A A;  3EC3 A;  5H5R A;  1V98 A;  1MDI A;  1WIK A;  1T1V A;  5ECH B;  5G2Z A;  4F2I A;  1IYH A;  5FT3 A;  3DEX A;  4PUR A;  1XFL A;  5ABR A;  2H0G A;  1ZYN A;  2A2P A;  1BG1 A;  5IMA A;  1PMT A;  2N5A A;  10GS A;  1O81 A;  2HZF A;  2VLT A;  4AJ8 A;  2P31 A;  3HHV A;  5HFK A;  3HA9 A;  4GXZ A;  1MTC A;  4XTS A;  5J9B A;  1GSE A;  4EF0 A;  3VPT A;  3W8J A;  2LJK A;  3CXG A;  4ZB6 A;  1FAA A;  3H93 A;  4OFN A;  4AI6 A;  1Z7R A;  1AQX A;  4GTU A;  2RUE A;  4PGT A;  3ZIV A;  1S3R A;  1OC3 A;  1SYR A;  1YVL A;  3I69 A;  16GS A;  1SVL A;  3TRQ A;  3TRX A;  2V6K A;  4PQH A;  2E0Q A;  4POM A;  1WPI A;  1AC1 A;  5F07 A;  5G1L A;  3R3E A;  4J2F A;  2R2J A;  3CQF A;  2DJJ A;  2ZCT A;  5JCU A;  2H0I A;  5AN1 A;  2FWE A;  4BA7 A;  3GUS A;  4WXT A;  3APS A;  2NVL A;  2WVX B;  3KP9 A;  4LLR A;  2GQL A;  1K3Y A;  3TJF A;  3ZIT A;  1AXD A;  1B9X C;  3UBL A;  4FO5 A;  2PWJ A;  1JLV A;  4BVY A;  3A3T A;  3ZLP A;  2WW3 A;  5ECP B;  3BBY A;  2V2G A;  4EDY A;  4YQM A;  3K8N A;  4GCI A;  2A2S A;  1YKC A;  5IMD A;  2RM6 A;  4IP6 A;  5ECS A;  1MDJ A;  3CSI A;  2O36 A;  5JWR B;  3H8Q A;  3DIE A;  4QQ7 A;  4K7O A;  3TRP A;  2OBI A;  5IPG A;  1TXX A;  1HQO A;  2NPB A;  2O85 A;  3ME8 A;  3GA4 A;  2C3T A;  3EYT A;  1YEP A;  2LQO A;  5J47 A;  2VCV A;  3H79 A;  3QAV A;  4I5Q A;  3GUR A;  4L5O A;  1OE8 A;  4HS1 A;  3P8W A;  3RFR C;  5A5H A;  2MBT A;  4XS4 B;  5GST A;  5EVO A;  3LQ7 A;  1VF1 A;  3HKR A;  2R6K A;  1Z7P A;  3QD9 A;  1ZYE A;  4MK3 A;  3TKS A;  1THX A;  2KLX A;  3KTL A;  1A2J A;  3ZRD A;  4Q5R A;  4D73 B;  2PER A;  1UC7 A;  3ISO A;  3EPT A;  2H6Y A;  2X99 A;  1T8E B;  3VUR A;  3F6F A;  3GHA A;  3KMO A;  5J40 A;  3NIV A;  1QUW A;  2YJH A;  4EE0 A;  3TGZ A;  3HD5 A;  4CY8 A;  2GDR A;  2OE1 A;  3MDK A;  1XWB A;  4K5S A;  4HUA A;  4MJA A;  3HVS A;  2ZUP A;  3GSS A;  3M3M A;  3E3E A;  3GST A;  5IMV A;  3IDV A;  1XW6 A;  2WVY A;  1SD9 A;  2LQQ A;  1SVO A;  4JED A;  3F3R A;  4CW9 A;  2LNS A;  1EZK A;  1UA5 A;  4ECC A;  2VM1 A;  1E2Y A;  4GSS A;  2C0D A;  1ZGN A;  1G6Y A;  3KCM A;  5B8B A;  4WBJ A;  1ERW A;  3HVN A;  4V2M A;  2CZ2 A;  3ED3 A;  1A8Y A;  3FY7 A;  3ZRE A;  1FOH A;  2B7J A;  3QPM A;  2WW0 A;  3VI7 A;  1X5D A;  2DKH A;  4TXO A;  4WBR D;  3F6D A;  5AGY A;  4K5R A;  2KHP A;  2YOI A;  5DQS A;  1SK0 A;  1XZO A;  5D9V A;  4IJ3 A;  5C00 A;  1TRS A;  1LU4 A;  2YWO A;  3D0Z A;  1OKD A;  4O5Q A;  5G1K A;  4TN8 A;  3C73 A;  1M2B A;  1X5E A;  1BQ7 A;  3US3 A;  5EY6 A;  2OAC A;  2E2G A;  1T4Y A;  3ZML A;  2PVO C;  4WR4 A;  3TKS E;  2CT6 A;  2OA7 A;  3UVH A;  4QL9 A;  4FYU A;  2YJ7 A;  1I1I P;  2A4V A;  2V41 A;  1FB6 A;  2GSS A;  3UJ1 A;  2H01 A;  3W6G A;  1DUG A;  1QFN A;  5IIZ A;  3FW2 A;  3CSJ A;  2BJX A;  2YCD A;  1NHO A;  4ICY A;  4KA0 A;  5FWG A;  2FD3 A;  3VWU A;  5CRW A;  1GLQ A;  3KD0 A;  5COH A;  1Y25 A;  5CP1 A;  5B6M A;  5IO2 A;  4O5R A;  4WF5 A;  2AUV A;  4KUN A;  4Q5F A;  5IOX A;  3MIX A;  3UAP A;  1K0O A;  1QMV A;  4LMW A;  4HSC X;  1JZW A;  2B7K A;  2HRA A;  2EIO A;  2H1G A;  1ZZY A;  2DBC A;  1XW5 A;  2HSN A;  5B7C A;  2ES7 A;  3FZA A;  2LST A;  4IJI A;  1XWA A;  4N3Z A;  1X0R A;  1Z9H A;  2AAW A;  3A2W A;  2AJQ B;  3N5O A;  2C80 A;  4Z2R A;  5HR0 A;  3GYK A;  3EU3 A;  1TJD A;  1TP9 A;  1AUC A;  2EIQ A;  2JL4 A;  2VAF A;  2LTK A;  2HSM B;  4TW5 A;  4HJM A;  3IAM 2;  2HYX A;  4N0V A;  2LUS A;  5ECR B;  6GSS A;  2LEG A;  5ELG A;  1SKR B;  2CX4 A;  4IN0 A;  3MYD A;  3KM6 A;  1U88 A;  2HXK A;  2C0E A;  4ECJ A;  5ID2 B;  4YKG A;  4PQ1 A;  4DSQ A;  1TU7 A;  1XVW A;  2M46 A;  4PUA A;  4JRR A;  4KSM A;  4N11 A;  4NMU A;  3HJO A;  2C3Q A;  1FG4 A;  2YZU A;  1GTU A;  3CMI A;  2CA8 A;  5G5E A;  4K0G A;  5GZZ B;  5DAK A;  5B6N A;  3FR3 A;  1XOA A;  2JZS A;  1YF1 A;  5ECQ B;  3Q74 A;  2WGR A;  1O6J A;  1DE1 A;  5A4U A;  1SJ6 A;  4X1U A;  2PN8 A;  2CVB A;  3FK8 A;  3UL3 A;  3KH9 A;  4FYB A;  1FO5 A;  5GAP D;  3V1W A;  1Y1U A;  3TDG A;  4MP4 A;  4FH8 A;  3F3Q A;  5CAX A;  5JWO B;  3C1R A;  1WJK A;  3VLN A;  2R0G A;  5D8I A;  5IMZ A;  2IN3 A;  3P7X A;  2HLS A;  3ZVJ D;  1PRX A;  3SWL A;  1X9W B;  2PBJ A;  4RI6 A;  2LRC A;  1TXU A;  1GSS A;  17GS A;  1F3B A;  1F6M C;  1PX7 A;  3L78 A;  5DVB A;  2H74 A;  2RII A;  1THO A;  1WP0 A;  1M3I A;  2FUG 2;  2O8V B;  3F9U A;  3IXR A;  2L5L A;  4OCE A;  4I2T A;  5A4W A;  3H1N A;  3C1S A;  2MMN A;  4JR6 A;  4BVX A;  2YPM A;  4HQZ A;  1GSD A;  5A34 B;  2CZ3 A;  2V1M A;  2GTU A;  5HQP A;  1GSU A;  2K9F A;  2EFC A;  3I6A A;  1FHE A;  1XBS A;  2KUC A;  3GTU B;  4J56 E;  3IC4 A;  4BPY A;  3G7Y A;  2HE3 A;  1J0F A;  4ZL7 A;  4MJB A;  2LNT A;  3SBC A;  4N30 A;  2AYT A;  4DEJ A;  3RHB A;  4K0N A;  3DD3 A;  5ECL B;  3WT2 A;  2L6C A;  3EVI A;  2B3S A;  3PPU A;  2X8G A;  4ZB7 A;  2K18 A;  4ZB8 A;  2VKZ G;  2L59 A;  2OE0 A;  4FQU A;  3L4N A;  2GQK A;  3Q19 A;  1S4B P;  1A23 A;  3VWV A;  4IP1 A;  3CHX C;  5LCZ A;  5DCH A;  1CQG A;  3F0I A;  2AHE A;  3QFB C;  1U6T A;  3FMW A;  2CQ9 A;  4JU5 A;  2X8C A;  2DKI A;  3QCP A;  4ACS A;  3NZN A;  3F63 A;  3APO A;  4GSN A;  3FKF A;  3IAS 2;  5EPF A;  5J4V A;  2RLI A;  1TOF A;  1YDK A;  4ULX A;  2H66 A;  1DSB A;  3RHC A;  4AKG A;  3QFA C;  1ZCP A;  4EIP A;  3RDW A;  1TRW A;  1KEB A;  4TR1 A;  4WEY A;  4USS A;  3GKN A;  2VCW A;  4XCS A;  2PU9 C;  1SU9 A;  4AGS A;  5J9C A;  2A2R A;  3CTF A;  4FXY P;  5BRT A;  3KTB A;  1FVJ A;  2MMO A;  4NV2 A;  4F03 A;  4KF9 A;  1G7O A;  5ECI B;  3MWH A;  2GZY A;  2CV4 A;  5CRD A;  3HMJ G;  3O6T A;  2IMD A;  3TUE A;  2A4H A;  5BMU A;  2FWG A;  5DQY A;  1U3A A;  1IYI A;  1SL1 B;  1E6B A;  2E7P A;  3BJ5 A;  1X9S B;  3GH6 A;  3GX8 A;  1M0U A;  4PI0 C;  3G7J A;  4NPB A;  4MCU A;  3ZIJ A;  1SK2 A;  2H6X A;  2VLU A;  3BOA A;  1J08 A;  6GSU A;  4XS6 A;  3I9V 2;  2L4C A;  3U5R E;  3PH9 A;  3F4R A;  5KOW A;  4P3Y B;  2EFD A;  3R2Q A;  4PX1 A;  3L9U A;  4XRD A;  4NV5 A;  4I8B A;  3Q6O A;  1OVN A;  2VM2 A;  2DSA A;  1W89 A;  4ZIJ A;  5LD0 A;  4BVY B;  1XW9 A;  5DJM A;  3P90 A;  4RQX A;  2VUP A;  5KN2 A;  2R4V A;  4CHS A;  5ECM B;  2B1K A;  2GZP A;  2PVQ A;  3F8U A;  4IBP A;  2CX3 A;  3ERG A;  1GUL A;  3UAR A;  3IRA A;  1KBN A;  1M3J A;  4O7H A;  2P0G A;  4EUY A;  1BJX A;  3KZQ A;  3LEF A;  2WVX A;  3ZFL A;  2FLS A;  4Q5Q A;  3IA1 A;  4I6X A;  4E68 A;  2H73 A;  2XC2 A;  2I9H A;  3IR4 A;  1TKD B;  1MD3 A;  5F8B A;  2VL9 A;  3LGC A;  4MAB A;  3GX0 A;  2DMM A;  2VLV A;  3IC8 A;  2O87 A;  3VWX A;  1YQ1 A;  1BG5 A;  1V40 A;  1EGR A;  3QDN A;  2YZH A;  5GAN D;  1F9M A;  1ERV A;  1EEJ A;  5ENU A;  1A0F A;  4KDY A;  3BCK A;  3HZ4 A;  1G6W A;  4MNN A;  5KN1 A;  4L5L A;  3RBT A;  5KEJ A;  1PGT A;  5A5K A;  4XIH A;  2PGT A;  4V2N A;  4GF0 A;  4POB A;  3TOT A;  4PHZ C;  4AKH A;  4K8M A;  2WZS A;  2FWH A;  4X0X A;  1GSY A;  2H71 A;  2J23 A;  4CY6 A;  2B5X A;  2X4A A;  2QGV A;  1VF3 A;  4LL4 B;  1WMJ A;  2JAC A;  2GQM A;  5D9T A;  1Z6M A;  1EWX A;  4HOJ A;  4KCA A;  1O8X A;  1EEM A;  1WOU A;  1GSQ A;  4MZC A;  3TB2 A;  4IKH A;  2LRN A;  1HD2 A;  3G9B A;  4MPF A;  1R5A A;  2WUL A;  3GMF A;  3QAG A;  2IL3 A;  4YQU A;  2YWN A;  4EO3 A;  4I97 A;  4K9Z A;  3D5J A;  3CYN A;  1PKW A;  3CRU A;  4OFM A;  3VK9 A;  3P2A A;  4IEL A;  1ST9 A;  4OMV A;  1I5G A;  2FA4 A;  1GSF A;  5CNW A;  4ZB9 A;  2C0G A;  2L4Q A;  3HYP A;  1O8W A; 
#chains in the Genus database with same CATH homology
 3VFI A;  1K0B A;  5H5Q A;  4EKZ A;  1A8L A;  2KP2 A;  4TXO B;  1M2D A;  2C4J A;  4ML1 A;  3WD6 A;  2X8H A;  4GST A;  4E8H A;  4ML6 A;  2AV4 A;  4PNF A;  2YNX A;  5DBQ A;  1F37 A;  2IIY A;  3GIX A;  1O73 A;  2IMF A;  1BX9 A;  3EMX A;  3IV4 A;  3HJP A;  3EMP A;  1YZX A;  3RAZ A;  5FHI A;  1Z5Y E;  2V6O A;  1YJ6 A;  1SYX A;  2DJ2 A;  2CAI A;  2LV3 A;  1M9B A;  3DGQ A;  2OE3 A;  2XPD A;  1XWC A;  2H30 A;  2YV9 A;  4W66 A;  3VPQ A;  1JZR A;  1YY7 A;  5KN3 A;  20GS A;  3IK7 A;  4MH2 A;  4GDF A;  1XOB A;  1JHB A;  4NAX A;  1H4O A;  5A4V A;  2I1U A;  1K0A A;  5EL8 A;  2C1Y A;  1A0R P;  1AQW A;  3TJJ A;  5KN0 A;  4HZ4 A;  3LSZ A;  5IM9 A;  5INY A;  4IGJ A;  4LA1 A;  2HZE B;  3KIJ A;  2UZ8 A;  3A5I A;  4KND A;  3M9K A;  2HRK B;  4AJ6 A;  3W8S A;  4Q5N A;  2FY6 A;  4BWS A;  2ZNM A;  4TXV A;  4K6X A;  2HSN B;  3DML A;  2BMX A;  2MMZ A;  2HSY A;  4XHM A;  1PN0 A;  4NXI A;  4MJC A;  4OD7 A;  2FGX A;  2NBS A;  3L9S A;  2ON5 A;  2GT6 A;  3EWL A;  4ZL8 A;  4G0I A;  4TR4 A;  4GWR A;  4PTS A;  1T7P B;  1VF2 A;  2DJ1 A;  4MDC A;  3GNJ A;  4L8E A;  3CBU A;  2REM A;  1PKZ A;  3IPZ A;  1AAZ A;  1F2E A;  1GTB A;  1BYE A;  1S3D A;  4GQC A;  5ECK B;  4V2L A;  4MLY A;  3O76 A;  5AIX A;  1SD8 A;  2IMK A;  2IMI A;  1RW1 A;  2K8S A;  4EDZ A;  3FZ9 A;  4JR4 A;  4KB3 A;  3D21 A;  3DRN A;  4HU9 A;  4K2D A;  1T4Z A;  1GH2 A;  4NHZ A;  4PXO A;  2RUF A;  4MJE A;  3GRX A;  3A2X A;  5DCG A;  1XWK A;  1UVZ A;  2QSI A;  4GQF A;  1Q4J A;  3TOU A;  2ON7 A;  3E9J B;  1R7H A;  2MYG A;  1NW2 A;  4N0Z A;  2DIZ A;  2HSM A;  4K7I A;  3I43 A;  4JE1 A;  3HJM A;  3QAW A;  4KH7 A;  2DML A;  2QA2 A;  2XBI A;  2DC5 A;  4AKI A;  2L57 A;  2C8U A;  3D6I A;  1GTI A;  2FCH A;  1QK8 A;  4HDE A;  2HNL A;  2R3X A;  3IE3 A;  2V32 A;  2O5V A;  1OC8 A;  5HR2 A;  4F9Z A;  2D2Z A;  4KE3 A;  2L5O A;  5A1N A;  1AIU A;  1XXU A;  4OO4 A;  2HRN A;  1EOH A;  4DSS A;  3ZL5 A;  3GL3 A;  2OKA A;  2I81 A;  2PPT A;  3HVX A;  4LMV A;  4DSR A;  2JZT A;  1JLW A;  1KTE A;  5JWQ B;  3IOS A;  4GRF A;  1SL2 B;  2WFC A;  4PQI A;  2QA1 A;  2H19 A;  4JZQ A;  1SVM A;  1N25 A;  4F0B A;  1GLP A;  1PX6 A;  2BTO T;  5CRE A;  2QC7 A;  3MAK A;  3H4K A;  2VL2 C;  1CQH A;  1FB0 A;  2UV8 G;  4A5P A;  2EFH A;  2JU5 A;  1RQM A;  1PSQ A;  1K0N A;  2IFQ A;  4G9H A;  1JZD A;  1DBY A;  4BVX B;  2HRF A;  3IK9 A;  3TJB A;  7GSS A;  1B9Y C;  2TRX A;  4H86 A;  3C8E A;  1O85 A;  2B6M A;  2LRT A;  1Q98 A;  9GSS A;  2X64 A;  2TRC P;  3J7Y k;  3QR6 A;  5HR3 A;  4FYC A;  4IS0 A;  4X4J A;  3IHG A;  5HFG A;  4BL7 B;  2WS2 A;  5DAL A;  4ISD A;  1TTZ A;  3FEU A;  6GSW A;  1V2A A;  3TKR A;  3UMA A;  2OT3 A;  2LKU A;  3ZTL A;  2ALB A;  2CVK A;  3HCZ A;  4XRA A;  2B5E A;  5E59 A;  1GUH A;  1VGL A;  1B8X A;  4ECB A;  4ZBA A;  4F0C A;  1B4P A;  2C0F A;  4NHW A;  1ZL9 A;  1X5C A;  3GTU A;  1SEN A;  1W4V A;  2MZC A;  1K0C A;  2WDU A;  1V58 A;  1ZYP A;  3WGX A;  3MSZ A;  3Q18 A;  5J5N A;  2R0P A;  2P5Q A;  5HR1 A;  1R5P A;  1T00 A;  1LBK A;  3GKK A;  5G5F A;  4WF4 A;  4O92 A;  3F4S A;  5J4U A;  4MZW A;  4ZBD A;  5CYY A;  4TR1 B;  2VIM A;  2VOC A;  4MH3 A;  1B4Q A;  3VI5 A;  3GFK A;  1LJR A;  3APQ A;  1EP8 A;  2GST A;  3C71 A;  22GS A;  3BD2 A;  13GS A;  4RQR A;  1TRV A;  2R0C A;  2R5G A;  4EC0 A;  4ILF A;  1XWG A;  2VCQ A;  2VCZ A;  1OC9 A;  4V1A g;  5G30 A;  4ECI A;  1MDK A;  2YWI A;  2H8L A;  5J41 A;  1AW9 A;  1ERU A;  5BMU B;  2IPA A;  4EVM A;  4OCF A;  1I9D A;  2K6V A;  3ZFB A;  5F0G A;  5ECO B;  1OAZ A;  1BAY A;  2H70 A;  1PA3 A;  3FYG A;  1Z6N A;  3DVX A;  4PUF C;  3D4M A;  6GST A;  3JCM L;  3FRC A;  5E4W A;  1KNG A;  4MF6 A;  3ZVJ A;  3ZMK A;  3GV1 A;  1PL1 A;  3GKX A;  4Z7X A;  1SL0 B;  3RPN A;  4WET A;  2WZ9 A;  3TKQ A;  1Y6E A;  1H75 A;  1M2A A;  4I2U A;  2VL2 A;  1ZOF A;  4G10 A;  1XPV A;  2NTO A;  5AIS A;  1BED A;  5DJL A;  2CVD A;  1OE7 A;  5ELA A;  2F3M A;  2B1L A;  4MZB A;  4G19 A;  2K8V A;  2YV7 A;  4WR5 A;  2O89 A;  3F4T A;  1EP7 A;  1SK1 A;  5CRH A;  1HNC A;  4IW9 A;  5IMF A;  3UIW A;  1GTA A;  2OJL A;  3MNG A;  1TI1 A;  2N5B A;  1MEK A;  4OWY A;  4JBB A;  2VL3 A;  2QKE A;  3HZ8 A;  4RUV A;  1TRU A;  2AB6 A;  4DVC A;  3PIN A;  4MF5 A;  2RM5 A;  1A2M A;  3A5W A;  4AKX B;  2H72 A;  1TW9 A;  3IBH A;  2IWT A;  1V57 A;  2JSY A;  3QMX A;  1EV4 A;  4HZ2 A;  3TU3 B;  1TK5 B;  2O7K A;  1N8J A;  4ZBB A;  5A5H B;  2CAQ A;  2JAD A;  2YWM A;  1A2L A;  3FR9 A;  4OFT A;  5J4Y A;  2YP6 A;  4HJ2 A;  4HU7 A;  3NOF A;  3CTG A;  3HVV A;  4K2X A;  5HFI A;  1NHY A;  4YAV A;  11GS A;  1TK8 B;  1K3L A;  4TOP A;  2WCI A;  3UBK A;  3C7M A;  5KOX A;  1K0D A;  2GZZ A;  2F8A A;  1ABA A;  2VCT A;  4Z2U A;  4EL1 A;  1SKW B;  1XVQ A;  3FZ4 A;  1GWC A;  4EXJ A;  2N5F A;  3VWW A;  2DJK A;  4E8E A;  3PR8 A;  2HSH A;  3LW9 A;  3LG6 A;  4LL1 B;  4XS4 A;  1FOV A;  3KH7 A;  4HEA 2;  3M9J A;  3LJR A;  5DDL A;  4YH2 A;  1T3B A;  2PMT A;  1S3C A;  4ZIL A;  1EOG A;  4D73 A;  4CDO A;  1UN2 A;  4POL A;  2X49 A;  3AY8 A;  3DWV A;  3EIN A;  4ZL9 A;  2M72 A;  5F05 A;  1TK0 B;  4X43 A;  4FIW A;  2GSR A;  2Z9S A;  2L6D A;  3LOR A;  4J57 E;  3M0F A;  1NM3 A;  5IO0 A;  3CSH A;  1GNW A;  4L0W A;  1NSW A;  2XBQ A;  5D96 A;  3TJK A;  1K0M A;  1J9B A;  3OR5 A;  2YN1 A;  3LXT A;  2WRT A;  5GSS A;  2IME A;  2FHE A;  1G7E A;  4QMK A;  5J3R A;  2H0H A;  4Z2T A;  1MD4 A;  3N9J A;  5D93 A;  2HI7 A;  3ME7 A;  5JCW A;  2B5Y A;  3UVT A;  1ZMA A;  3TJG A;  5CO3 A;  4QL7 A;  3L9V A;  3IHQ A;  4ZXG A;  3ZZX A;  4KDU A;  1O7U A;  2I4A A;  3BCI A;  3KJY A;  2GSQ A;  2VCX A;  2M80 A;  2GGT A;  1QXH A;  1N2A A;  2F8F A;  2WJU A;  19GS A;  3LYK A;  4K1F A;  1XIY A;  3G7I A;  1EGO A;  1PD2 1;  4WKW A;  3FHK A;  3E0U A;  2G0F A;  2FNO A;  3ERF A;  3J7Y b;  3GN3 A;  2EC4 A;  2MBS A;  5JCG A;  2KOK A;  5LNK e;  4ID0 A;  14GS A;  3PGT A;  2DIY A;  2YAN A;  1GNE A;  4V1A p;  3CWG A;  1ILO A;  2HZE A;  1TI3 A;  1WRY A;  2HRK A;  3WT1 A;  3TKP A;  1Z3E A;  3S9F A;  1ACV A;  3KMN A;  2DJ3 A;  1QQ2 A;  5CRG A;  4HI7 A;  3KGK A;  4IHU A;  2F9S A;  3ZYW A;  4TR3 A;  3U6V A;  4O32 A;  2LS5 A;  4O5U A;  3HDC A;  18GS A;  2WB9 A;  1ON4 A;  4YKF A;  2HFD A;  1ML6 A;  3A2V A;  2PUK C;  3GL5 A;  6GSY A;  1FVK A;  3M1G A;  2TIR A;  5IOW A;  3CRT A;  1ERT A;  2H1A A;  2H1L A;  2LJR A;  2OBK A;  4N10 A;  4G0L A;  5DAK B;  1VRS D;  4AF2 A;  4F82 A;  2MMA A;  1SJZ A;  4TRX A;  3RPP A;  3O3T A;  1BF5 A;  1G0T A;  1C72 A;  3LXZ A;  5AIV A;  1WE0 A;  3EU4 A;  5D9X A;  2I3Y A;  3M8N A;  1USB A;  4KSO A;  5ID2 A;  5A1N B;  2HT9 A;  5G31 A;  2OAD A;  1S3A A;  4DSS B;  5IMC A;  4PNG A;  1HNA A;  1SKS B;  1X9M B;  3ERW A;  2KP1 A;  4YAP A;  4POK A;  3WYW A;  3UOM A;  2NDO A;  3EUR A;  1U87 A;  3HXS A;  5D9W A;  1EV9 A;  1V9W A;  2VO4 A;  1R4W A;  3KXO A;  12GS A;  2P5R A;  3UEM A;  5B8A A;  1YKA A;  4G01 A;  1GL8 A;  2JZR A;  2FA8 A;  4G2E A;  3KEB A;  1YF0 A;  2JSZ A;  2IFQ B;  1GRX A;  2IJY A;  2H1D A;  3QOU A;  4TKY A;  3FR6 A;  1U3I A;  2GVP A;  1GUM A;  3D22 A;  4IQ1 A;  2F51 A;  1URM A;  1YEX A;  2GLR A;  3LYP A;  3DXB A;  2EFE A;  1SJI A;  5C04 A;  3WGE A;  3GH9 A;  1K3O A;  4AJ7 A;  2H76 A;  4TVE A;  2XHF A;  2XPE A;  5DAL B;  1TU8 A;  2GT5 A;  5F06 A;  3FZ5 A;  3EE2 A;  2C3N A;  2H75 A;  2R37 A;  4G0K A;  1A24 A;  2DJ0 A;  5H5S A;  3GKM A;  1QGV A;  4RI7 A;  3DKS A;  4XS1 A;  4KCE A;  4KX4 A;  4MA9 A;  8GSS A;  3LFL A;  4KDX A;  2HQT A;  4MF7 A;  5L71 A;  5A34 A;  2FWF A;  6GSX A;  3LWA A;  4GLT A;  1RK4 A;  2VD1 A;  4HQS A;  1OKT A;  2G2Q A;  1PL2 A;  6GSV A;  1R26 A;  2H6Z A;  4BL7 A;  1OYJ A;  4NWY A;  1JFU A;  1FW1 A;  5D73 A;  4YQV A;  4MPG A;  1PQN A;  2J9H A;  4MMM A;  1TDI A;  3DYR A;  1AQV A;  2E2M A;  3HY2 A;  5IQY A;  1M99 A;  3DVW A;  3L0H A;  4KW6 A;  5ECN B;  2EIR A;  2LJA A;  4IQA A;  1GUK A;  1ZYQ B;  1DE2 A;  4KGI A;  1M7T A;  2H1B A;  2VD0 A;  1XCC A;  2DLX A;  4K7N A;  3TKS C;  1GP1 A;  3WGD A;  4TR0 A;  1B48 A;  1JZO A;  3KP8 A;  1HNB A;  1HYU A;  1WWJ A;  4L0U A;  3TCO A;  4EIQ A;  4BWQ A;  5IPH A;  4KAE A;  1M9A A;  1PN9 A;  4OO5 A;  1OC9 B;  2GS3 A;  3D4T A;  1VF4 A;  4IVF A;  1F3A A;  3EC3 A;  5H5R A;  1V98 A;  1MDI A;  1WIK A;  1T1V A;  5ECH B;  5G2Z A;  4F2I A;  1IYH A;  5FT3 A;  3DEX A;  4PUR A;  1XFL A;  5ABR A;  2H0G A;  1ZYN A;  2A2P A;  1BG1 A;  5IMA A;  1PMT A;  2N5A A;  10GS A;  1O81 A;  2HZF A;  2VLT A;  4AJ8 A;  2P31 A;  3HHV A;  5HFK A;  3HA9 A;  4GXZ A;  1MTC A;  4XTS A;  5J9B A;  1GSE A;  4EF0 A;  3VPT A;  3W8J A;  2LJK A;  3CXG A;  4ZB6 A;  1FAA A;  3H93 A;  4OFN A;  4AI6 A;  1Z7R A;  1AQX A;  4GTU A;  2RUE A;  4PGT A;  3ZIV A;  1OC3 A;  1SYR A;  1YVL A;  3I69 A;  16GS A;  1SVL A;  3TRQ A;  3TRX A;  2V6K A;  4PQH A;  2E0Q A;  4POM A;  1WPI A;  1AC1 A;  5F07 A;  5G1L A;  3R3E A;  4J2F A;  2R2J A;  2DJJ A;  2ZCT A;  5JCU A;  2H0I A;  5AN1 A;  2FWE A;  4BA7 A;  3GUS A;  4WXT A;  3APS A;  2NVL A;  3KP9 A;  4LLR A;  2GQL A;  1K3Y A;  3TJF A;  3ZIT A;  1AXD A;  1B9X C;  3UBL A;  4FO5 A;  2PWJ A;  1JLV A;  4BVY A;  3A3T A;  3ZLP A;  5ECP B;  3BBY A;  2V2G A;  4EDY A;  4YQM A;  3K8N A;  4GCI A;  2A2S A;  1YKC A;  5IMD A;  2RM6 A;  4IP6 A;  5ECS A;  1MDJ A;  3CSI A;  5JWR B;  3H8Q A;  3DIE A;  4QQ7 A;  4K7O A;  3TRP A;  2OBI A;  5IPG A;  1TXX A;  1HQO A;  2NPB A;  2O85 A;  3ME8 A;  3GA4 A;  2C3T A;  3EYT A;  1YEP A;  2LQO A;  5J47 A;  2VCV A;  3H79 A;  3QAV A;  4I5Q A;  3GUR A;  4L5O A;  1OE8 A;  4HS1 A;  3P8W A;  5A5H A;  2MBT A;  4XS4 B;  5GST A;  5EVO A;  3LQ7 A;  1VF1 A;  3HKR A;  2R6K A;  1Z7P A;  3QD9 A;  1ZYE A;  4MK3 A;  3TKS A;  1THX A;  2KLX A;  3KTL A;  1A2J A;  3ZRD A;  4Q5R A;  4D73 B;  2PER A;  1UC7 A;  3ISO A;  3EPT A;  2H6Y A;  2X99 A;  1T8E B;  3VUR A;  3F6F A;  3GHA A;  3KMO A;  5J40 A;  3NIV A;  1QUW A;  2YJH A;  4EE0 A;  3TGZ A;  3HD5 A;  4CY8 A;  2GDR A;  2OE1 A;  3MDK A;  1XWB A;  4K5S A;  4HUA A;  4MJA A;  3HVS A;  2ZUP A;  3GSS A;  3M3M A;  3E3E A;  3GST A;  5IMV A;  3IDV A;  1XW6 A;  1SD9 A;  2LQQ A;  1SVO A;  4JED A;  3F3R A;  4CW9 A;  2LNS A;  1EZK A;  1UA5 A;  4ECC A;  2VM1 A;  1E2Y A;  4GSS A;  2C0D A;  1ZGN A;  1G6Y A;  3KCM A;  5B8B A;  4WBJ A;  1ERW A;  4V2M A;  2CZ2 A;  3ED3 A;  1A8Y A;  3FY7 A;  3ZRE A;  1FOH A;  2B7J A;  3QPM A;  3VI7 A;  1X5D A;  2DKH A;  4TXO A;  4WBR D;  3F6D A;  5AGY A;  4K5R A;  2KHP A;  2YOI A;  5DQS A;  1SK0 A;  1XZO A;  5D9V A;  4IJ3 A;  5C00 A;  1TRS A;  1LU4 A;  2YWO A;  3D0Z A;  1OKD A;  4O5Q A;  5G1K A;  4TN8 A;  3C73 A;  1M2B A;  1X5E A;  1BQ7 A;  3US3 A;  5EY6 A;  2OAC A;  2E2G A;  1T4Y A;  3ZML A;  2PVO C;  4WR4 A;  3TKS E;  2CT6 A;  2OA7 A;  3UVH A;  4QL9 A;  4FYU A;  2YJ7 A;  2A4V A;  2V41 A;  1FB6 A;  2GSS A;  3UJ1 A;  2H01 A;  3W6G A;  1DUG A;  1QFN A;  5IIZ A;  3FW2 A;  3CSJ A;  2BJX A;  2YCD A;  1NHO A;  4ICY A;  4KA0 A;  5FWG A;  2FD3 A;  3VWU A;  5CRW A;  1GLQ A;  3KD0 A;  5COH A;  1Y25 A;  5CP1 A;  5B6M A;  5IO2 A;  4O5R A;  4WF5 A;  2AUV A;  4KUN A;  4Q5F A;  5IOX A;  3MIX A;  3UAP A;  1K0O A;  1QMV A;  4LMW A;  1JZW A;  2B7K A;  2HRA A;  2EIO A;  2H1G A;  1ZZY A;  2DBC A;  1XW5 A;  2HSN A;  5B7C A;  2ES7 A;  3FZA A;  2LST A;  4IJI A;  1XWA A;  4N3Z A;  1X0R A;  1Z9H A;  2AAW A;  3A2W A;  2AJQ B;  3N5O A;  2C80 A;  4Z2R A;  5HR0 A;  3GYK A;  3EU3 A;  1TJD A;  1TP9 A;  1AUC A;  2EIQ A;  2JL4 A;  2VAF A;  2LTK A;  2HSM B;  4TW5 A;  4HJM A;  3IAM 2;  2HYX A;  4N0V A;  2LUS A;  5ECR B;  6GSS A;  2LEG A;  5ELG A;  1SKR B;  2CX4 A;  4IN0 A;  3MYD A;  3KM6 A;  1U88 A;  2HXK A;  2C0E A;  4ECJ A;  5ID2 B;  4YKG A;  4PQ1 A;  4DSQ A;  1TU7 A;  1XVW A;  2M46 A;  4PUA A;  4JRR A;  4KSM A;  4N11 A;  4NMU A;  3HJO A;  2C3Q A;  1FG4 A;  2YZU A;  1GTU A;  3CMI A;  2CA8 A;  5G5E A;  4K0G A;  5GZZ B;  5DAK A;  5B6N A;  3FR3 A;  1XOA A;  2JZS A;  1YF1 A;  5ECQ B;  3Q74 A;  2WGR A;  1O6J A;  1DE1 A;  5A4U A;  1SJ6 A;  4X1U A;  2PN8 A;  2CVB A;  3FK8 A;  3UL3 A;  3KH9 A;  4FYB A;  1FO5 A;  5GAP D;  3V1W A;  1Y1U A;  3TDG A;  4MP4 A;  4FH8 A;  3F3Q A;  5CAX A;  5JWO B;  3C1R A;  1WJK A;  3VLN A;  2R0G A;  5D8I A;  5IMZ A;  2IN3 A;  3P7X A;  2HLS A;  3ZVJ D;  1PRX A;  3SWL A;  1X9W B;  2PBJ A;  4RI6 A;  2LRC A;  1TXU A;  1GSS A;  17GS A;  1F3B A;  1F6M C;  1PX7 A;  3L78 A;  5DVB A;  2H74 A;  2RII A;  1THO A;  1WP0 A;  2FUG 2;  2O8V B;  3F9U A;  3IXR A;  2L5L A;  4OCE A;  4I2T A;  5A4W A;  3H1N A;  3C1S A;  2MMN A;  4JR6 A;  4BVX A;  2YPM A;  4HQZ A;  1GSD A;  5A34 B;  2CZ3 A;  2V1M A;  2GTU A;  5HQP A;  1GSU A;  2K9F A;  2EFC A;  3I6A A;  1FHE A;  1XBS A;  2KUC A;  3GTU B;  4J56 E;  3IC4 A;  4BPY A;  3G7Y A;  2HE3 A;  1J0F A;  4ZL7 A;  4MJB A;  2LNT A;  3SBC A;  4N30 A;  2AYT A;  4DEJ A;  3RHB A;  4K0N A;  3DD3 A;  5ECL B;  3WT2 A;  2L6C A;  3EVI A;  2B3S A;  3PPU A;  2X8G A;  4ZB7 A;  2K18 A;  4ZB8 A;  2VKZ G;  2L59 A;  2OE0 A;  4FQU A;  3L4N A;  2GQK A;  3Q19 A;  1A23 A;  3VWV A;  4IP1 A;  5LCZ A;  5DCH A;  1CQG A;  3F0I A;  2AHE A;  3QFB C;  1U6T A;  3FMW A;  2CQ9 A;  4JU5 A;  2X8C A;  2DKI A;  3QCP A;  4ACS A;  3NZN A;  3F63 A;  3APO A;  4GSN A;  3FKF A;  3IAS 2;  5EPF A;  5J4V A;  2RLI A;  1TOF A;  1YDK A;  4ULX A;  2H66 A;  1DSB A;  3RHC A;  4AKG A;  3QFA C;  1ZCP A;  4EIP A;  3RDW A;  1TRW A;  1KEB A;  4TR1 A;  4WEY A;  4USS A;  3GKN A;  2VCW A;  4XCS A;  2PU9 C;  1SU9 A;  4AGS A;  5J9C A;  2A2R A;  3CTF A;  5BRT A;  3KTB A;  1FVJ A;  2MMO A;  4NV2 A;  4F03 A;  4KF9 A;  1G7O A;  5ECI B;  3MWH A;  2GZY A;  2CV4 A;  5CRD A;  3HMJ G;  3O6T A;  2IMD A;  3TUE A;  2A4H A;  5BMU A;  2FWG A;  5DQY A;  1U3A A;  1IYI A;  1SL1 B;  1E6B A;  2E7P A;  3BJ5 A;  1X9S B;  3GH6 A;  3GX8 A;  1M0U A;  3G7J A;  4NPB A;  4MCU A;  3ZIJ A;  1SK2 A;  2H6X A;  2VLU A;  3BOA A;  1J08 A;  6GSU A;  4XS6 A;  3I9V 2;  2L4C A;  3U5R E;  3PH9 A;  3F4R A;  5KOW A;  4P3Y B;  2EFD A;  3R2Q A;  4PX1 A;  3L9U A;  4XRD A;  4NV5 A;  4I8B A;  3Q6O A;  1OVN A;  2VM2 A;  2DSA A;  1W89 A;  4ZIJ A;  5LD0 A;  4BVY B;  1XW9 A;  5DJM A;  3P90 A;  4RQX A;  2VUP A;  5KN2 A;  2R4V A;  4CHS A;  5ECM B;  2B1K A;  2GZP A;  2PVQ A;  3F8U A;  4IBP A;  2CX3 A;  3ERG A;  1GUL A;  3UAR A;  3IRA A;  1KBN A;  4O7H A;  2P0G A;  4EUY A;  1BJX A;  3KZQ A;  3LEF A;  3ZFL A;  2FLS A;  4Q5Q A;  3IA1 A;  4I6X A;  4E68 A;  2H73 A;  2XC2 A;  2I9H A;  3IR4 A;  1TKD B;  1MD3 A;  5F8B A;  2VL9 A;  3LGC A;  4MAB A;  3GX0 A;  2DMM A;  2VLV A;  3IC8 A;  2O87 A;  3VWX A;  1YQ1 A;  1BG5 A;  1V40 A;  1EGR A;  3QDN A;  2YZH A;  5GAN D;  1F9M A;  1ERV A;  1EEJ A;  5ENU A;  1A0F A;  4KDY A;  3BCK A;  3HZ4 A;  1G6W A;  4MNN A;  5KN1 A;  4L5L A;  3RBT A;  5KEJ A;  1PGT A;  5A5K A;  4XIH A;  2PGT A;  4V2N A;  4GF0 A;  4POB A;  3TOT A;  4AKH A;  4K8M A;  2FWH A;  4X0X A;  1GSY A;  2H71 A;  2J23 A;  4CY6 A;  2B5X A;  2X4A A;  2QGV A;  1VF3 A;  4LL4 B;  1WMJ A;  2JAC A;  2GQM A;  5D9T A;  1Z6M A;  1EWX A;  4HOJ A;  4KCA A;  1O8X A;  1EEM A;  1WOU A;  1GSQ A;  4MZC A;  3TB2 A;  4IKH A;  2LRN A;  1HD2 A;  3G9B A;  4MPF A;  1R5A A;  2WUL A;  3GMF A;  3QAG A;  2IL3 A;  4YQU A;  2YWN A;  4EO3 A;  4I97 A;  4K9Z A;  3D5J A;  3CYN A;  1PKW A;  3CRU A;  4OFM A;  3VK9 A;  3P2A A;  4IEL A;  1ST9 A;  4OMV A;  1I5G A;  2FA4 A;  1GSF A;  5CNW A;  4ZB9 A;  2C0G A;  2L4Q A;  3HYP A;  1O8W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...