4IELA

Crystal structure of a glutathione s-transferase family protein from burkholderia ambifaria, target efi-507141, with bound glutathione
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
208
structure length
198
Chain Sequence
SMLHILGKIPSINVRKVLWLCTELNLPFEQEDWGDPAYLALNPNGLVPVIKDDGFVLWESNTIIRYLANRYGGDALYPAEPQARARVDQWIDWQGSDLNRSWVGAFLGLVRKHQDPAAIAQSIAGWTKHMQVLNAQLEATGAFVAGDHFTLADIPIGLSVNRWFGTPFEHPDFPAAKRYIERLATREGFKQYAGSANP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Glutathione S-transferase, N-terminal domain protein
publication title Crystal structure of a glutathione s-transferase family protein from burkholderia ambifaria, target efi-507141, with bound glutathione
rcsb
source organism Burkholderia ambifaria
total genus 69
structure length 198
sequence length 208
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-12-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13417 GST_N_3 Glutathione S-transferase, N-terminal domain
A PF14497 GST_C_3 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 4ielA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4ielA01
5F07A 3BBYA 1J08A 5ID2B 2DMMA 4MJEA 2WFCA 3KCMA 4BWSA 2AB6A 2VCTA 3MNGA 1N8JA 2H01A 2L59A 5FWGA 3VLNA 2FHEA 3HA9A 1HNCA 1SYXA 1YF1A 3IAS2 1DUGA 1ML6A 4K7IA 2GVPA 3PR8A 3VWXA 1OC8A 4LL1B 1MDKA 4NHZA 2MBSA 3RPPA 3C1RA 1OVNA 3APSA 4IP1A 4EVMA 4ZBAA 3N9JA 4XS4A 3IC4A 2GSTA 5D93A 3GX0A 3WT2A 5DVBA 1OKDA 4E8HA 1ZCPA 4NMUA 5F0GA 4K2DA 1O85A 5D73A 1Z9HA 3APQA 2F8AA 3E9JB 3LYKA 3WT1A 3J7Yk 1PX6A 4GQFA 3IA1A 1QFNA 4RI7A 5CRDA 4HJ2A 3C71A 1RK4A 3ZTLA 5J9BA 4TN8A 4IJ3A 3V1WA 4I5QA 5KN0A 1EOGA 1LBKA 4Q5QA 2R4VA 4JU5A 2CT6A 2XBQA 1M99A 3HZ4A 5G5EA 2D2ZA 4IQ1A 4XIHA 1GLPA 5G1KA 5D9TA 3TKRA 4DEJA 2HRAA 4PGTA 1XIYA 1X9WB 4HEA2 3W8JA 1X5CA 4MP4A 4G2EA 4OO5A 3IK9A 2FA4A 1F9MA 1THOA 2RUEA 3DD3A 4V1Ag 4EO3A 2GZYA 1I5GA 3VFIA 4K0NA 3EWLA 3ZLPA 5DQYA 5HR2A 2LJRA 3DVXA 2PN8A 1NM3A 2HZEB 3KTLA 1K3OA 2GLRA 1GTIA 3GA4A 2B5EA 3KH7A 4QL9A 5ECHB 4FO5A 3ZFBA 3TOTA 2X8CA 1HYUA 3TRQA 4N10A 1VGLA 2EIRA 1MDJA 4DSSA 1SKWB 4J57E 4ZB6A 1WIKA 4EKZA 1FOVA 2C3QA 1QK8A 1AQWA 2P5QA 1A2JA 1AUCA 1FB6A 3CSJA 4G19A 1BX9A 4G0KA 3TCOA 4XHMA 1V98A 4EDYA 3CMIA 2H75A 5FT3A 1ZYEA 3D0ZA 2IMKA 3PGTA 4XS4B 2DJ1A 2O89A 2F9SA 5F06A 5ECPB 1AQXA 1U3AA 2DJKA 4I2UA 1TRVA 3HD5A 1PD21 2AUVA 1BQ7A 2V2GA 1OYJA 4CHSA 4L8EA 3GN3A 5C04A 3IR4A 2P31A 14GSA 17GSA 4WR4A 2JACA 3FR9A 1FAAA 3ZMLA 1SKSB 2HXKA 1X9SB 2I1UA 5ECMB 1T3BA 2JSZA 2LQQA 3EMPA 1RW1A 4CW9A 1NHYA 2X64A 2CVKA 5H5RA 2KHPA 2TRCP 5D9WA 2REMA 2H0GA 2LUSA 5IOWA 4NV5A 2TRXA 3F6DA 2VAFA 3VK9A 1ERTA 3EMXA 1NW2A 4FH8A 4ZB9A 3KP8A 4O92A 4TVEA 1J9BA 4PTSA 3TJFA 3VWUA 4I8BA 2DJ2A 4G0LA 1MEKA 3DXBA 4GXZA 2EC4A 4MZWA 1AAZA 4PURA 1M0UA 1Z5YE 2LNSA 3EINA 1YQ1A 2EIQA 3GYKA 1GSUA 3CRUA 1SJIA 2V32A 3VURA 4KB3A 4KE3A 19GSA 4KNDA 6GSSA 4K6XA 4POLA 3F4RA 2CQ9A 2BTOT 2BMXA 1SK1A 3D6IA 3L0HA 1F3BA 1OC9A 3GMFA 1G7OA 4ZL9A 5AN1A 1GUKA 1B9YC 1BEDA 3I9V2 3O6TA 2I81A 1PRXA 2C3NA 4YQVA 4F03A 2EIOA 1U87A 1XW9A 5D8IA 2C4JA 4NWYA 4BVYA 2JU5A 3D22A 3FZAA 2DJ0A 4QL7A 4NHWA 3UBKA 4K0GA 3KEBA 2NDOA 3ZL5A 4ISDA 2GSQA 2B7JA 2H1BA 2K9FA 4TXOB 1A2LA 5ECSA 1ACVA 1HNAA 1MTCA 3ERGA 2H6XA 4BPYA 4KSOA 1GLQA 2MMNA 3HCZA 3C7MA 3I69A 1Z6NA 3C73A 4OFTA 1Z6MA 2QC7A 4XRAA 1U3IA 2YJ7A 3ZFLA 4JE1A 2GQMA 3QPMA 5KN2A 4XRDA 1A2MA 3PH9A 1X0RA 3QOUA 1GTUA 3HJOA 2VM2A 2HFDA 4ID0A 4O32A 5KEJA 2VLVA 3F3QA 3IRAA 1S3AA 5ECLB 3G7YA 3LXZA 8GSSA 2E2GA 4L5OA 3CBUA 3KJYA 1KNGA 3GKKA 2LJAA 3EU3A 2X8HA 5D9XA 2CZ2A 3MAKA 2H66A 2K8SA 1TU8A 3GL5A 5E59A 4BA7A 2IMDA 3C8EA 3ZVJA 2HRFA 1W4VA 3GRXA 3HVSA 5IMDA 6GSTA 3RHBA 3ZZXA 4HZ4A 4FYBA 1JLVA 1OAZA 2PVOC 3ED3A 4I2TA 3P90A 1XWCA 2M80A 3F6FA 1XWBA 2IMFA 2DIYA 4ILFA 1Y25A 3GSSA 2DMLA 5JCWA 3VI7A 3CTGA 3ME7A 4DSQA 4P3YB 5G31A 3LEFA 4AJ7A 3LGCA 4EXJA 2N5FA 1TTZA 3FYGA 3TKPA 2R6KA 3HHVA 4POBA 4PX1A 4GQCA 1ON4A 2ALBA 2B5YA 2GS3A 4N0ZA 5AISA 2H6ZA 1K0CA 2A2RA 2DJ3A 1GNEA 1URMA 2X99A 2VM1A 4IW9A 2B1LA 2AAWA 3ISOA 2WS2A 2DLXA 3DMLA 3HJMA 3LWAA 1U6TA 3F63A 3DYRA 22GSA 2GZZA 1IYIA 3QAVA 5KN1A 1MD3A 2HZEA 2RUFA 3L78A 2E7PA 3ZITA 4ZIJA 1VF3A 1A8YA 1JZRA 3GKNA 5BMUA 3UL3A 2X8GA 5AIXA 4MPGA 2I9HA 3R2QA 3EVIA 3Q6OA 2CVDA 2AYTA 5F05A 1A0RP 2MMAA 5DCHA 4MF7A 1MDIA 2VLTA 1H75A 2PVQA 5JWQB 5F8BA 4ACSA 2P0GA 3FKFA 1XVWA 2JZTA 4ML6A 4RQXA 1G6YA 3NOFA 3TRXA 2GTUA 1T00A 1CQGA 5ELGA 4GSNA 1A24A 2HLSA 1DE2A 4LL4B 1GSYA 3MWHA 4BL7A 4PQHA 1NHOA 1Z7RA 2MMOA 2H19A 2XPEA 3I43A 2WGRA 1YJ6A 1QQ2A 2LRTA 5JWRB 1SKRB 4JEDA 2B6MA 1WMJA 3G9BA 2H8LA 4X0XA 1EEMA 3D5JA 2H0HA 1TP9A 1E2YA 2LS5A 5FHIA 1O6JA 2V1MA 4WXTA 3IK7A 4EDZA 1JZDA 2L5LA 3LSZA 5IMAA 4MF5A 2O87A 4O5RA 4MDCA 3F9UA 3CSHA 2FWGA 1SK0A 4G9HA 2CVBA 2FWEA 3ZVJD 3GH9A 3M8NA 2K18A 2O85A 3Q18A 3N5OA 4AGSA 4DVCA 4RQRA 2N5BA 4KW6A 2C0GA 4ECJA 3WGDA 2QSIA 2YWNA 2YWOA 4MCUA 1WOUA 2LTKA 2H0IA 2K6VA 3G7IA 3EU4A 2WB9A 2H72A 2YV7A 2YZUA 1T4ZA 3KD0A 3PPUA 4TR0A 3GV1A 3GFKA 2WRTA 1GSEA 3H1NA 1O81A 4YAPA 5EVOA 3TJJA 1UVZA 3GKMA 2V6OA 1XZOA 4KCAA 2LKUA 5CYYA 1TRUA 2L6DA 1SJ6A 1AIUA 3BD2A 3US3A 2C8UA 4WBJA 3KMNA 1GSSA 1VF4A 2FNOA 4O7HA 1ERUA 1O73A 2YWIA 4FQUA 2RM5A 1JZOA 3A2XA 2KLXA 3UVHA 2XBIA 3KTBA 4ZL7A 1SENA 2FWHA 2DSAA 3TKSE 2NPBA 1K3YA 3P7XA 2H30A 4EC0A 2HE3A 2YNXA 2J9HA 1EV9A 3L4NA 1FW1A 4TXOA 3KH9A 2AJQB 4V2NA 1G6WA 3FW2A 1BG5A 1QGVA 5G5FA 2WCIA 4TR4A 2B5XA 4AJ6A 3KGKA 3TDGA 4F82A 4BL7B 2YOIA 5DAKA 3EE2A 2G2QA 2VLUA 4PQIA 2L4QA 3L9UA 3F3RA 1KBNA 3Q19A 3DWVA 2YPMA 1MD4A 5IIZA 4KAEA 2VL2A 3F0IA 2KP2A 2VCVA 2K8VA 2LEGA 3IBHA 2GQKA 5EL8A 4MH3A 1DSBA 4TOPA 1R7HA 4KUNA 3UEMA 2H70A 5B7CA 2VD1A 2FWFA 1SYRA 2IMIA 4WF5A 4WKWA 5G1LA 1YEXA 4Z7XA 3GSTA 3C1SA 2XHFA 2DIZA 2HNLA 2OBKA 1PGTA 3QFBC 1F2EA 3LXTA 4IP6A 4V2LA 4TRXA 4KGIA 5IO2A 3UIWA 1ZL9A 2OACA 5CRHA 1TK5B 4MJBA 5LNKe 1K0OA 5DJMA 1SU9A 4XS6A 2VUPA 3QMXA 2AV4A 3UAPA 5GSSA 3RPNA 4J56E 4POMA 4EE0A 5LD0A 2JZSA 2CA8A 3PINA 2DBCA 5B6MA 2KUCA 1T1VA 1VRSD 2LQOA 5ECOB 4YAVA 2P5RA 1F6MC 4EL1A 20GSA 1U88A 3I6AA 1XCCA 4MLYA 1OE8A 2H71A 1K0NA 3HVXA 3U5RE 2MZCA 2HSYA 1M2BA 4GRFA 3KXOA 1M2DA 2JADA 5IOXA 2IMEA 13GSA 1YEPA 3GHAA 3DKSA 7GSSA 2GDRA 3L9VA 5HFGA 1XPVA 2O7KA 2RLIA 2VL3A 3WGXA 2LSTA 4I97A 1B8XA 4KA0A 1S3DA 4H86A 3A2WA 3WD6A 2HRKB 3LG6A 1XFLA 2KOKA 5DAKB 3W6GA 4LMVA 5INYA 4MH2A 4LA1A 5HFIA 1GUHA 2ES7A 1V2AA 4KCEA 11GSA 3QDNA 2F8FA 3G7JA 5A5KA 5IO0A 1K0DA 4IHUA 2R5GA 2HYXA 4HQSA 2UZ8A 2PU9C 5E4WA 3R3EA 1TOFA 3FK8A 5JCUA 2A2SA 4JBBA 3HXSA 1RQMA 4F0CA 1F37A 1HNBA 2I4AA 3U6VA 2HSMA 3L9SA 3MDKA 2IPAA 1DBYA 4WF4A 3K8NA 1XBSA 1ILOA 2H74A 5A4VA 2FA8A 3EC3A 3SBCA 5J5NA 2IFQA 4JR4A 2C0FA 2RM6A 1H4OA 5DQSA 1PQNA 4GSSA 1V40A 5DCGA 2H1AA 2V6KA 4F0BA 1FVKA 3GURA 2YZHA 2YANA 2FGXA 3KP9A 1VF1A 4FIWA 2NTOA 3IOSA 5H5SA 4F2IA 5A4WA 4EF0A 5CP1A 4YQUA 5B6NA 3DVWA 5JWOB 3LORA 2GZPA 4KSMA 3IXRA 4ZB8A 3JCML 1FHEA 3HYPA 3GX8A 1A0FA 4BWQA 4USSA 3LYPA 4E8EA 3F4SA 4POKA 3J7Yb 1NSWA 5ECIB 4ZBDA 3CRTA 4KH7A 1EP8A 2ZNMA 4NV2A 3FY7A 4GSTA 1SK2A 2M46A 4IGJA 2NVLA 1QMVA 2OJLA 4JZQA 16GSA 5J4UA 2VCWA 3LQ7A 5A4UA 2V41A 4IQAA 3VPQA 2IL3A 5LCZA 1OC3A 4N30A 3FR3A 2NBSA 4MA9A 2WDUA 4XCSA 4GTUA 5L71A 1CQHA 2Z9SA 2R37A 2LV3A 3MSZA 3ZREA 3IDVA 3M3MA 2FLSA 3APOA 2PBJA 2WULA 4I6XA 1XVQA 4BVXA 1AC1A 1GTAA 4NAXA 2RIIA 3A3TA 4ZXGA 3UVTA 2ZCTA 2OE0A 5GSTA 2C0DA 1TK8B 2ZUPA 3WYWA 4ECCA 2L57A 1A8LA 3E0UA 5G30A 1T7PB 1GWCA 3GH6A 4JRRA 5CNWA 4GLTA 4RI6A 2L6CA 3FR6A 1HQOA 3M1GA 4D73A 1R4WA 2VL2C 5J9CA 2CZ3A 2HI7A 2OE1A 4K9ZA 2GQLA 2PWJA 2VO4A 1FO5A 4ZL8A 2YWMA 1XOAA 2F3MA 2YN1A 3F8UA 4LMWA 2HSMB 5IQYA 3VWWA 4EUYA 4OFMA 1ZMAA 4Q5FA 1V57A 1XW6A 2B3SA 2VCXA 1R26A 1X5EA 2IFQB 5HR0A 3VI5A 1PA3A 5H5QA 1PKWA 1UC7A 2H73A 4TR1A 4Q5RA 1EWXA 3CSIA 4K1FA 3M9JA 1WJKA 1K3LA 3W8SA 2CAQA 5ECKB 3GKXA 1M9AA 2HT9A 5IPHA 6GSUA 5IMFA 1TRWA 1SL2B 4WEYA 5D96A 1B4PA 4NPBA 4PNFA 1WWJA 3UBLA 2L4CA 3ZIVA 2CX3A 3QR6A 2VOCA 5IMZA 3ME8A 1GSFA 1PKZA 2FY6A 2H1GA 3D4TA 1SJZA 3A5WA 4MK3A 3FEUA 3TKSA 3ZIJA 1T8EB 4LLRA 2DC5A 1OKTA 5CREA 1GTBA 4G0IA 2ON7A 5AIVA 4G10A 2F51A 3TGZA 1ZGNA 5JCGA 4MJAA 3BCIA 5IMCA 3HKRA 2QGVA 1WP0A 4KDYA 2HSNB 4OWYA 1YKAA 1X9MB 3OR5A 4CDOA 4GCIA 3TRPA 1M7TA 1N2AA 1GRXA 3HY2A 1XWGA 1TRSA 1UN2A 1B9XC 3IAM2 3TJGA 4TR3A 4L0UA 4HU7A 1X5DA 4PUFC 1B48A 1GH2A 2R3XA 2HSHA 4V1Ap 5GAPD 2GT5A 4HOJA 4BVXB 2A4VA 1HD2A 4PXOA 4MABA 3ZRDA 3EURA 3M9KA 1SL0B 3IE3A 3H93A 4PUAA 3P2AA 2DJJA 4KX4A 2MMZA 4HDEA 3HJPA 3UOMA 1AXDA 2H6YA 3EYTA 1TI3A 5IMVA 3ERFA 1ZYQB 4D73B 2C80A 1AQVA 1KEBA 2LJKA 5EY6A 2OADA 2O8VB 5ELAA 9GSSA 3TJBA 1GULA 3VWVA 2CV4A 4QQ7A 1VF2A 1O8XA 3ERWA 4YQMA 1E6BA 1M2AA 1O7UA 1XOBA 4RUVA 2JZRA 5D9VA 1G7EA 3UMAA 5GAND 3Q74A 4MMMA 2KP1A 3TUEA 3CYNA 1TK0B 1THXA 1YF0A 2XC2A 5ABRA 2HRKA 4TR1B 3UARA 1EEJA 1GP1A 3H8QA 4GWRA 3KMOA 1PMTA 1R5AA 1EZKA 1ST9A 10GSA 4XTSA 3HVVA 4KDXA 3FZ5A 3IV4A 4HZ2A 2FUG2 3LJRA 4X1UA 5J41A 1QXHA 3QCPA 1GSQA 4HUAA 6GSYA 3DGQA 1T4YA 2OE3A 3O3TA 3NZNA 2PGTA 1M9BA 2IWTA 5B8BA 1FB0A 3D21A 4J2FA 4WR5A 1TXXA 2E0QA 4F9ZA 4IS0A 1DE1A 3SWLA 1BAYA 4DSRA 3IHQA 3BJ5A 3CTFA 1WE0A 3F4TA 4K8MA 5AGYA 1XWAA 3HDCA 2H76A 3GL3A 2VD0A 4JR6A 5IPGA 4IKHA 3E3EA 3QFAC 3GTUA 1JZWA 1I9DA 4AF2A 2XPDA 4Q5NA 1YKCA 1FVJA 4IJIA 4HS1A 4N0VA 1GSDA 1PN9A 3DIEA 3O76A 4OFNA 2IJYA 5CRWA 2N5AA 1ERVA 4FYUA 4KF9A 5B8AA 2GSRA 3UJ1A 2B7KA 5HQPA 2CX4A 5DJLA 2LNTA 1W89A 1JFUA 5CO3A 2VCZA 5HR1A 2I3YA 4IN0A 5DDLA 2IN3A 3DEXA 1USBA 1LU4A 1GNWA 1PSQA 1EOHA 1UA5A 2FD3A 1YZXA 2C1YA 5DALA 5HFKA 2GT6A 1XXUA 3TKQA 4ZILA 4OO4A 3TB2A 4OMVA 2GGTA 1XW5A 2YV9A 4HJMA 4ECBA 1K0MA 2OBIA 4TKYA 4ULXA 3ZYWA 1Z7PA 4XS1A 3AY8A 3H79A 1WPIA 4DSSB 3KM6A 3RAZA 5ECRB 3P8WA 2BJXA 1ZOFA 4K7NA 4TW5A 4L5LA 3DRNA 1EGOA 4MPFA 1A23A 2FCHA 3GNJA 5ENUA 1IYHA 2M72A 4MZCA 5J3RA 2R2JA 1O8WA 3FZ9A 2CAIA 3FRCA 1FG4A 2HZFA 3FHKA 2L5OA 2LRNA 4IELA 1EP7A 1ERWA 18GSA 4HU9A 2VL9A 4WBRD 2MYGA 1AW9A 1PX7A 4PNGA 2YP6A 2IIYA 3H4KA 1YDKA 4OCFA 2J23A 1YY7A 3HZ8A 3QAWA 2OA7A 1TKDB 2OKAA 1R5PA 5ID2A 1Q4JA 2VCQA 1Z3EA 4V2MA 3FZ4A 1OE7A 12GSA 2PMTA 3TKSC 4IVFA 5KN3A 2H1DA 3KZQA 1TDIA 2G0FA 1J0FA 4ML1A 3QAGA 4YH2A 2ON5A 3A2VA 1SD8A 3GTUB 5DBQA 3BCKA 1BJXA 1Y6EA 2YCDA 4PQ1A 4OCEA 1SD9A 5CRGA 5C00A 3BOAA 4L0WA 3LFLA 4TXVA 2PERA 3D4MA 3GUSA 6GSVA 4HQZA 6GSXA 3S9FA 4GF0A 3TJKA 1XWKA 1JLWA 3RDWA 2QKEA 2E2MA 6GSWA 1QUWA 5ECQB 3IPZA 4MZBA 5DALB 1V58A 1LJRA 1C72A 2C3TA 2WJUA 1S3CA 1JHBA 3KIJA 2LRCA 1EGRA 1PL1A 1WRYA 5HR3A 4HI7A 1TW9A 1GL8A 5GZZB 3IC8A 1GUMA 2TIRA 4AJ8A 5CAXA 4ZBBA 3GIXA 1OC9B 3QD9A 4NXIA 4MJCA 1K0AA 2GSSA 4ECIA 3TOUA 5IM9A 4FYCA 2PUKC 1F3AA 2C0EA 4X43A 1BYEA 4N11A 2HRNA 2WZ9A 2PPTA 2AHEA 3WGEA 1G0TA 1V9WA 4BVYB 1TI1A 1Q98A 3RBTA 2B1KA 3CXGA 5ECNB 1ABAA 4WETA 2MBTA 2JSYA 4K7OA 1SL1B 4KDUA 3VPTA 2YJHA 2JL4A 1B4QA 4IBPA 4OD7A 5EPFA 3RHCA 1TJDA 1KTEA 4MF6A 3NIVA 5G2ZA 2HQTA 2VIMA 1PL2A 1ZZYA 1EV4A 3M0FA 1TU7A 3ZMKA 5COHA 1K0BA
chains in the Genus database with same CATH superfamily
5F07A 3BBYA 1J08A 5ID2B 2DMMA 4MJEA 2WFCA 3KCMA 4BWSA 2AB6A 2VCTA 3MNGA 1N8JA 2H01A 2L59A 5FWGA 4PHZC 3VLNA 2FHEA 3HA9A 1HNCA 2O5VA 1SYXA 1YF1A 3IAS2 1DUGA 1ML6A 4K7IA 2GVPA 3PR8A 3VWXA 1OC8A 4LL1B 1MDKA 4NHZA 2MBSA 3RPPA 3C1RA 1OVNA 3APSA 4IP1A 4EVMA 5J47A 4ZBAA 3N9JA 4XS4A 3IC4A 2GSTA 5D93A 3GX0A 3WT2A 5DVBA 1OKDA 4E8HA 1ZCPA 4NMUA 5F0GA 4K2DA 1O85A 5D73A 1Z9HA 3APQA 2F8AA 3E9JB 3LYKA 3WT1A 3J7Yk 1PX6A 4GQFA 3IA1A 2QA1A 1QFNA 2WVXA 4RI7A 5CRDA 5J4YA 4HJ2A 2O36A 3C71A 1RK4A 3ZTLA 5J9BA 4TN8A 4IJ3A 3V1WA 4I5QA 5KN0A 1EOGA 1LBKA 4Q5QA 2R4VA 4JU5A 2CT6A 2XBQA 1M99A 3HZ4A 3MIXA 5G5EA 2D2ZA 4IQ1A 4XIHA 1GLPA 5G1KA 2X4AA 5D9TA 3TKRA 4DEJA 2HRAA 4PGTA 1XIYA 1X9WB 4HEA2 3W8JA 1X5CA 4MP4A 4G2EA 4OO5A 3IK9A 2FA4A 1F9MA 1THOA 2RUEA 3DD3A 4V1Ag 4EO3A 2GZYA 5A1NB 1I5GA 3VFIA 4K0NA 4AKIA 3EWLA 4MNNA 3ZLPA 5DQYA 5HR2A 2LJRA 3DVXA 2PN8A 2VKZG 3LW9A 1NM3A 2HZEB 3KTLA 1K3OA 2GLRA 2WW2A 1GTIA 3GA4A 2B5EA 3KH7A 4QL9A 5ECHB 4FO5A 3ZFBA 3TOTA 2X8CA 1HYUA 3TRQA 4N10A 4ZB7A 1VGLA 2EIRA 1MDJA 4DSSA 1SKWB 4J57E 4ZB6A 1WIKA 4EKZA 2O3EA 1FOVA 2C3QA 1QK8A 2EFCA 1AQWA 2P5QA 1A2JA 1AUCA 1FB6A 3CSJA 4G19A 1BX9A 4G0KA 3TCOA 4XHMA 1V98A 4EDYA 3CMIA 4PI2C 2H75A 5FT3A 2H1LA 1ZYEA 3D0ZA 2IMKA 3PGTA 4XS4B 2DJ1A 2O89A 2F9SA 5F06A 5ECPB 1AQXA 1U3AA 2DJKA 4I2UA 4EIPA 1TRVA 3HD5A 1PD21 2AUVA 1BQ7A 2V2GA 1OYJA 4CHSA 4L8EA 3GN3A 5C04A 3IR4A 2P31A 4FXYP 14GSA 17GSA 4WR4A 2JACA 3FR9A 1FAAA 3ZMLA 1SKSB 2HXKA 1X9SB 2I1UA 5ECMB 1T3BA 2JSZA 2LQQA 3EMPA 1RW1A 4CW9A 1NHYA 2X64A 2CVKA 5H5RA 2KHPA 2TRCP 5D9WA 2REMA 2H0GA 2LUSA 5IOWA 4NV5A 2TRXA 3F6DA 2VAFA 3VK9A 1ERTA 3EMXA 1NW2A 4FH8A 4ZB9A 3KP8A 4O92A 4TVEA 5A34B 1J9BA 4PTSA 3TJFA 3VWUA 4I8BA 2DJ2A 4G0LA 1MEKA 3DXBA 4GXZA 2EC4A 4MZWA 1AAZA 4PURA 1M0UA 1Z5YE 2LNSA 3EINA 1YQ1A 4HSCX 2EIQA 3GYKA 1GSUA 3CRUA 1SJIA 2V32A 3VURA 4KB3A 2OT3A 4KE3A 19GSA 4KNDA 6GSSA 4K6XA 4POLA 3F4RA 2CQ9A 2BTOT 2BMXA 1SK1A 3D6IA 3L0HA 1F3BA 1OC9A 3GMFA 4Z2UA 1G7OA 1ZYNA 4ZL9A 5AN1A 1GUKA 1B9YC 1BEDA 3I9V2 3O6TA 2DKHA 2I81A 1PRXA 2C3NA 4YQVA 4F03A 2EIOA 3HVNA 1U87A 1XW9A 5D8IA 2C4JA 4NWYA 4BVYA 2JU5A 3D22A 3FZAA 2DJ0A 4QL7A 4NHWA 3UBKA 4K0GA 3KEBA 2NDOA 3ZL5A 4ISDA 2GSQA 2B7JA 2H1BA 2K9FA 4TXOB 1A2LA 5ECSA 1ACVA 1HNAA 1MTCA 3ERGA 2H6XA 4BPYA 4KSOA 1GLQA 2MMNA 1SVOA 3HCZA 3C7MA 3I69A 1Z6NA 3C73A 4OFTA 1Z6MA 2QC7A 4XRAA 1U3IA 2YJ7A 3ZFLA 4JE1A 2GQMA 3QPMA 5KN2A 4XRDA 3EPTA 1A2MA 3PH9A 1X0RA 3QOUA 1GTUA 3HJOA 2VM2A 2HFDA 4ID0A 2A2PA 4O32A 5KEJA 2VLVA 1PFOA 3F3QA 3IRAA 2EFEA 1S3AA 5ECLB 3G7YA 3LXZA 8GSSA 2E2GA 4L5OA 3CBUA 3KJYA 1KNGA 3GKKA 2LJAA 3EU3A 2X8HA 5D9XA 2CZ2A 3MAKA 2H66A 2K8SA 1TU8A 3GL5A 1I1IP 5E59A 4BA7A 2IMDA 3C8EA 3ZVJA 2HRFA 1W4VA 3GRXA 3HVSA 5IMDA 6GSTA 2EFDA 3RHBA 3ZZXA 4HZ4A 4FYBA 1JLVA 1OAZA 2PVOC 3ED3A 4I2TA 3P90A 1SVMA 1FOHA 1XWCA 2M80A 3F6FA 1XWBA 2IMFA 2DIYA 4ILFA 1Y25A 5J40A 3RGBC 3GSSA 2DMLA 5JCWA 3VI7A 3CTGA 3ME7A 4DSQA 4P3YB 5G31A 5KOXA 3LEFA 4AJ7A 3LGCA 4EXJA 2N5FA 1TTZA 3FYGA 3TKPA 2R6KA 3HHVA 4POBA 4PX1A 4GQCA 1ON4A 2ALBA 2B5YA 2GS3A 4N0ZA 5AISA 2H6ZA 1K0CA 2A2RA 2DJ3A 1GNEA 1URMA 2X99A 4YKGA 2VM1A 4IW9A 2B1LA 2AAWA 4O5UA 3ISOA 2WS2A 2DLXA 3DMLA 3HJMA 3LWAA 1U6TA 3F63A 3DYRA 22GSA 2GZZA 1IYIA 3QAVA 5KN1A 1MD3A 2HZEA 2RUFA 3L78A 2E7PA 3ZITA 4ZIJA 1VF3A 1A8YA 1JZRA 3GKNA 5BMUA 3UL3A 2X8GA 5AIXA 4MPGA 2I9HA 1N25A 3R2QA 1YEWC 3EVIA 3Q6OA 2CVDA 2AYTA 5F05A 1A0RP 2MMAA 5DCHA 4MF7A 1MDIA 2VLTA 2A4HA 1H75A 2PVQA 5JWQB 1S3RA 3TU3B 5F8BA 4ACSA 2P0GA 3FKFA 1XVWA 2JZTA 4ML6A 4RQXA 1G6YA 3NOFA 3TRXA 2GTUA 1T00A 1CQGA 5ELGA 4GSNA 1A24A 2HLSA 1DE2A 4LL4B 4BIKA 1GSYA 3MWHA 4BL7A 4PQHA 1NHOA 1Z7RA 2MMOA 2H19A 2XPEA 3I43A 2WGRA 1YJ6A 1QQ2A 2LRTA 5JWRB 1SKRB 4JEDA 2B6MA 1WMJA 3G9BA 2H8LA 4X0XA 1EEMA 3D5JA 2H0HA 1TP9A 1E2YA 2LS5A 5FHIA 1O6JA 2V1MA 4WXTA 3IK7A 4EDZA 1JZDA 2L5LA 3LSZA 5IMAA 4MF5A 2O87A 4O5RA 4MDCA 3F9UA 3CSHA 2FWGA 4CY8A 1SK0A 4G9HA 2CVBA 2FWEA 3ZVJD 3GH9A 3M8NA 5A34A 2K18A 2O85A 3Q18A 3N5OA 4AGSA 4DVCA 4RQRA 2N5BA 4KW6A 2C0GA 4ECJA 3WGDA 2QSIA 2YWNA 2YWOA 4MCUA 1WOUA 2LTKA 2H0IA 2K6VA 3G7IA 3EU4A 2WB9A 2H72A 2YV7A 2YZUA 1T4ZA 3KD0A 3PPUA 4TR0A 3GV1A 3GFKA 2WRTA 1GSEA 3H1NA 1O81A 4YAPA 5EVOA 3TJJA 1UVZA 3GKMA 2V6OA 4CY6A 1XZOA 4KCAA 2LKUA 5CYYA 1TRUA 2L6DA 1SJ6A 5BMUB 1AIUA 3BD2A 3US3A 2WVZA 2C8UA 4WBJA 3KMNA 1GSSA 1VF4A 2FNOA 4O7HA 1Y1UA 1ERUA 1O73A 2YWIA 4FQUA 2RM5A 1JZOA 3A2XA 2KLXA 3UVHA 2XBIA 3KTBA 4ZL7A 4K2XA 1SENA 2FWHA 4Z2TA 2DSAA 3TKSE 2NPBA 1K3YA 3P7XA 2H30A 4EC0A 2HE3A 2YNXA 2J9HA 1EV9A 3CWGA 3L4NA 1FW1A 4TXOA 3KH9A 2AJQB 4V2NA 1G6WA 3FW2A 4PI0C 1BG5A 1QGVA 5G5FA 2WCIA 4TR4A 2B5XA 4AJ6A 3KGKA 2R0GA 3TDGA 4F82A 4BL7B 2YOIA 5DAKA 3EE2A 2G2QA 2VLUA 4PQIA 2L4QA 3L9UA 3F3RA 1KBNA 3Q19A 3DWVA 2YPMA 1MD4A 5IIZA 4KAEA 2VL2A 3F0IA 2KP2A 2VCVA 2K8VA 2LEGA 3IBHA 2GQKA 5EL8A 4MH3A 1DSBA 4TOPA 1R7HA 4KUNA 3UEMA 2H70A 2EFHA 5B7CA 2VD1A 2FWFA 1SYRA 2IMIA 4WF5A 4WKWA 5G1LA 1YEXA 4Z7XA 3GSTA 3C1SA 2XHFA 2DIZA 2HNLA 2OBKA 1PGTA 3QFBC 1F2EA 3LXTA 4AI6A 4IP6A 4V2LA 4TRXA 1BF5A 4KGIA 5IO2A 3UIWA 3RFRC 1ZL9A 2OACA 5CRHA 1TK5B 4MJBA 5LNKe 1K0OA 5DJMA 1ZYPA 1SU9A 4XS6A 1S4BP 2VUPA 3QMXA 2AV4A 3UAPA 1M3JA 5GSSA 3RPNA 4K5RA 4J56E 4POMA 4EE0A 5LD0A 4AKXB 2JZSA 2CA8A 3PINA 2DBCA 5B6MA 2KUCA 1T1VA 1VRSD 2LQOA 5ECOB 4YAVA 2P5RA 1F6MC 4EL1A 20GSA 1U88A 3I6AA 1XCCA 4MLYA 1OE8A 3CQFA 2H71A 1K0NA 3HVXA 3U5RE 2MZCA 2HSYA 1M2BA 4GRFA 3KXOA 1M2DA 2JADA 5IOXA 2IMEA 13GSA 1YEPA 3GHAA 3DKSA 7GSSA 2GDRA 3L9VA 5HFGA 1XPVA 2O7KA 2RLIA 2VL3A 3WGXA 2LSTA 4I97A 1B8XA 4KA0A 1S3DA 4H86A 4EIQA 3A2WA 3WD6A 2HRKB 3LG6A 1XFLA 2KOKA 5DAKB 3W6GA 4LMVA 5INYA 4MH2A 4LA1A 5HFIA 1GUHA 2ES7A 1V2AA 4KCEA 11GSA 3QDNA 2F8FA 3G7JA 5A5KA 5IO0A 1K0DA 4IHUA 2R5GA 2HYXA 2UV8G 4HQSA 2UZ8A 2PU9C 5E4WA 3R3EA 1TOFA 3FK8A 5JCUA 2QA2A 2A2SA 4JBBA 3HXSA 1RQMA 4F0CA 1F37A 1HNBA 2I4AA 3U6VA 2HSMA 3L9SA 3MDKA 2IPAA 1DBYA 4WF4A 3K8NA 1XBSA 1ILOA 2H74A 5A4VA 2FA8A 3EC3A 3SBCA 5J5NA 2IFQA 4JR4A 2C0FA 2RM6A 1H4OA 5DQSA 1PQNA 4GSSA 1V40A 5DCGA 2H1AA 2V6KA 4F0BA 1FVKA 3GURA 2YZHA 2YANA 2FGXA 3KP9A 1VF1A 4FIWA 2NTOA 3IOSA 5H5SA 5J4VA 4F2IA 5A4WA 4EF0A 5CP1A 4YQUA 5B6NA 3DVWA 5JWOB 3LORA 2GZPA 4KSMA 3IXRA 4ZB8A 3JCML 1FHEA 3HYPA 3GX8A 1A0FA 4BWQA 4USSA 3LYPA 4E8EA 3F4SA 4POKA 3J7Yb 1NSWA 5ECIB 4ZBDA 3CRTA 4KH7A 1EP8A 2ZNMA 4NV2A 3FY7A 4GSTA 1SK2A 2M46A 4IGJA 2NVLA 1QMVA 2OJLA 4JZQA 16GSA 5J4UA 2VCWA 3LQ7A 5A4UA 2V41A 2WW1A 4IQAA 3VPQA 2IL3A 5LCZA 1OC3A 4N30A 3FR3A 1YVLA 2NBSA 4MA9A 2WDUA 4XCSA 4GTUA 5L71A 1TXUA 1CQHA 2Z9SA 4A5PA 2R37A 2LV3A 3MSZA 3ZREA 3IDVA 3M3MA 2FLSA 3APOA 2PBJA 2WULA 4I6XA 1XVQA 4BVXA 1AC1A 1GTAA 1PN0A 4NAXA 2RIIA 3A3TA 4ZXGA 3UVTA 2ZCTA 2OE0A 5GSTA 2C0DA 1TK8B 2ZUPA 3WYWA 4ECCA 2L57A 1A8LA 3E0UA 5G30A 1T7PB 1GWCA 3GH6A 4JRRA 5CNWA 4GLTA 4RI6A 2L6CA 2WZSA 3FR6A 1HQOA 3M1GA 4D73A 1R4WA 2VL2C 5J9CA 2CZ3A 2HI7A 2OE1A 4K9ZA 2GQLA 2PWJA 2VO4A 5BRTA 3IHGA 1FO5A 4ZL8A 2YWMA 1XOAA 2F3MA 2YN1A 3F8UA 4LMWA 2HSMB 5IQYA 3VWWA 4EUYA 4OFMA 1ZMAA 2WVYA 4Q5FA 1V57A 1XW6A 2B3SA 2VCXA 1R26A 1X5EA 2IFQB 5HR0A 3VI5A 1PA3A 5H5QA 1PKWA 1UC7A 2H73A 4TR1A 4Q5RA 1EWXA 3CSIA 4K1FA 3M9JA 1WJKA 1K3LA 3W8SA 5A5HA 2CAQA 5ECKB 3GKXA 1M9AA 2HT9A 5IPHA 6GSUA 5IMFA 1TRWA 1SL2B 4WEYA 5D96A 1B4PA 4NPBA 4PNFA 1WWJA 3UBLA 2L4CA 3ZIVA 2CX3A 3QR6A 2VOCA 5IMZA 3ME8A 1GSFA 1PKZA 2FY6A 2H1GA 3D4TA 1SJZA 3A5WA 4MK3A 4AKGA 3FEUA 3TKSA 3ZIJA 1T8EB 4LLRA 2DC5A 1OKTA 5CREA 1GTBA 4G0IA 2ON7A 5AIVA 4G10A 2F51A 3TGZA 1BG1A 1ZGNA 2WW0A 5JCGA 4MJAA 3BCIA 5IMCA 3HKRA 2QGVA 1WP0A 4KDYA 2HSNB 4OWYA 1YKAA 2R0PA 1X9MB 3OR5A 4CDOA 4N3ZA 4GCIA 3TRPA 1M7TA 1N2AA 1GRXA 3HY2A 1XWGA 4ICYA 1TRSA 1UN2A 1B9XC 3IAM2 3TJGA 4TR3A 4L0UA 4HU7A 1X5DA 4PUFC 1B48A 1GH2A 2R0CA 2R3XA 2HSHA 4V1Ap 5GAPD 2GT5A 4HOJA 4BVXB 2A4VA 1HD2A 4PXOA 4MABA 3ZRDA 3EURA 3M9KA 1SL0B 3IE3A 3H93A 4PUAA 3P2AA 2DJJA 4KX4A 2MMZA 4HDEA 3FMWA 3HJPA 3UOMA 1AXDA 4E68A 2H6YA 3EYTA 1TI3A 5IMVA 3ERFA 1ZYQB 4D73B 2C80A 1AQVA 1KEBA 2LJKA 5KOWA 5EY6A 4K5SA 2OADA 2O8VB 5ELAA 9GSSA 3TJBA 1GULA 3VWVA 2CV4A 4QQ7A 1VF2A 1O8XA 1SVLA 3ERWA 4YQMA 1E6BA 1M2AA 1O7UA 1XOBA 4RUVA 2JZRA 4QMKA 5D9VA 1G7EA 3UMAA 5GAND 3Q74A 3CHXC 4MMMA 2KP1A 3TUEA 3CYNA 1TK0B 1THXA 1YF0A 2XC2A 5ABRA 2HRKA 4TR1B 3UARA 1EEJA 1GP1A 3H8QA 4GWRA 3KMOA 1PMTA 1R5AA 1EZKA 1ST9A 10GSA 5A5HB 4XTSA 3HVVA 4KDXA 3FZ5A 3IV4A 4HZ2A 2FUG2 3LJRA 4X1UA 5J41A 1QXHA 3QCPA 1GSQA 4HUAA 6GSYA 3DGQA 1T4YA 2OE3A 3O3TA 3NZNA 4G01A 2PGTA 1M9BA 2IWTA 5B8BA 1FB0A 3D21A 4J2FA 4WR5A 1TXXA 2E0QA 4F9ZA 4IS0A 4Z2RA 1DE1A 3SWLA 1BAYA 4DSRA 2WVXB 3IHQA 3BJ5A 3CTFA 1WE0A 3F4TA 4K8MA 5AGYA 1XWAA 1XG8A 3HDCA 2H76A 3GL3A 2VD0A 4JR6A 5IPGA 4IKHA 3E3EA 4O5QA 3QFAC 3GTUA 1JZWA 1I9DA 4AF2A 2XPDA 4Q5NA 1YKCA 1FVJA 4IJIA 4HS1A 4N0VA 1GSDA 1PN9A 3DIEA 3O76A 4OFNA 2IJYA 5CRWA 2N5AA 1ERVA 4FYUA 4KF9A 4X4JA 5B8AA 2GSRA 3UJ1A 2B7KA 5HQPA 2CX4A 5DJLA 2LNTA 1W89A 1JFUA 5CO3A 2VCZA 5HR1A 2I3YA 4IN0A 5DDLA 2IN3A 3A5IA 3DEXA 1USBA 1LU4A 1GNWA 1PSQA 1EOHA 1UA5A 2FD3A 1YZXA 2C1YA 5DALA 5HFKA 2GT6A 1XXUA 3TKQA 4ZILA 4OO4A 3TB2A 4OMVA 2GGTA 1XW5A 2YV9A 4HJMA 4ECBA 1K0MA 2OBIA 4TKYA 4ULXA 3ZYWA 1Z7PA 4XS1A 3AY8A 3H79A 1WPIA 4DSSB 3KM6A 3RAZA 5ECRB 3P8WA 2BJXA 1ZOFA 4K7NA 4TW5A 4L5LA 3DRNA 1EGOA 4MPFA 1A23A 2FCHA 4AKHA 3GNJA 5ENUA 1IYHA 2M72A 4MZCA 5J3RA 2R2JA 1O8WA 3FZ9A 2CAIA 3FRCA 1FG4A 2HZFA 3FHKA 2L5OA 2LRNA 4IELA 1EP7A 1ERWA 18GSA 4HU9A 2VL9A 4WBRD 2MYGA 1AW9A 1PX7A 4PNGA 2YP6A 2IIYA 3H4KA 1YDKA 4OCFA 4W66A 2J23A 1YY7A 3HZ8A 3QAWA 2OA7A 4YKFA 1TKDB 2OKAA 1R5PA 5ID2A 1Q4JA 2VCQA 1Z3EA 4V2MA 3FZ4A 1OE7A 12GSA 2PMTA 3TKSC 4GDFA 4IVFA 5KN3A 2H1DA 3KZQA 1TDIA 2G0FA 1J0FA 4ML1A 3QAGA 4YH2A 2ON5A 3A2VA 3MYDA 1SD8A 3GTUB 5DBQA 3BCKA 1BJXA 1Y6EA 2YCDA 4PQ1A 4OCEA 1SD9A 5CRGA 5C00A 3BOAA 4L0WA 3LFLA 4TXVA 2PERA 3D4MA 3GUSA 6GSVA 4HQZA 6GSXA 3S9FA 4GF0A 3TJKA 1XWKA 1JLWA 3RDWA 2QKEA 2E2MA 6GSWA 1QUWA 5ECQB 3IPZA 4MZBA 2WW3A 5DALB 1V58A 1LJRA 1C72A 2C3TA 2WJUA 1S3CA 1JHBA 3KIJA 2LRCA 1EGRA 1PL1A 1WRYA 5HR3A 4HI7A 1TW9A 1M3IA 5GZZB 1GL8A 3IC8A 1GUMA 2TIRA 4AJ8A 5CAXA 3GIXA 2HSNA 4ZBBA 1OC9B 3QD9A 4NXIA 4MJCA 1K0AA 2GSSA 4ECIA 3TOUA 5IM9A 4FYCA 2PUKC 1F3AA 2C0EA 4X43A 1BYEA 4N11A 2HRNA 2WZ9A 2PPTA 2AHEA 3WGEA 1G0TA 1V9WA 4BVYB 1TI1A 1Q98A 3RBTA 2B1KA 3CXGA 5ECNB 1ABAA 4WETA 5A1NA 2MBTA 2JSYA 4K7OA 2X49A 1SL1B 4KDUA 3VPTA 2YJHA 2JL4A 1B4QA 4IBPA 4OD7A 5EPFA 3RHCA 1TJDA 1KTEA 4MF6A 2DKIA 3NIVA 5G2ZA 2HQTA 2VIMA 1PL2A 1ZZYA 1EV4A 3M0FA 1TU7A 3ZMKA 3HMJG 5COHA 1K0BA
chains in the Genus database with same CATH topology
5F07A 3BBYA 1J08A 5ID2B 2DMMA 4MJEA 2WFCA 3KCMA 4BWSA 2AB6A 2VCTA 3MNGA 1N8JA 2H01A 2L59A 5FWGA 3VLNA 2FHEA 3HA9A 1HNCA 2O5VA 1SYXA 1YF1A 3IAS2 1DUGA 1ML6A 4K7IA 2GVPA 3PR8A 3VWXA 1OC8A 4LL1B 1MDKA 4NHZA 2MBSA 3RPPA 3C1RA 1OVNA 3APSA 4IP1A 4EVMA 5J47A 4ZBAA 3N9JA 4XS4A 3IC4A 2GSTA 5D93A 3GX0A 3WT2A 5DVBA 1OKDA 4E8HA 1ZCPA 4NMUA 5F0GA 4K2DA 1O85A 5D73A 1Z9HA 3APQA 2F8AA 3E9JB 3LYKA 3WT1A 3J7Yk 1PX6A 4GQFA 3IA1A 2QA1A 1QFNA 4RI7A 5CRDA 5J4YA 4HJ2A 3C71A 1RK4A 3ZTLA 5J9BA 4TN8A 4IJ3A 3V1WA 4I5QA 5KN0A 1EOGA 1LBKA 4Q5QA 2R4VA 4JU5A 2CT6A 2XBQA 1M99A 3HZ4A 3MIXA 5G5EA 2D2ZA 4IQ1A 4XIHA 1GLPA 5G1KA 2X4AA 5D9TA 3TKRA 4DEJA 2HRAA 4PGTA 1XIYA 1X9WB 4HEA2 3W8JA 1X5CA 4MP4A 4G2EA 4OO5A 3IK9A 2FA4A 1F9MA 1THOA 2RUEA 3DD3A 4V1Ag 4EO3A 2GZYA 5A1NB 1I5GA 3VFIA 4K0NA 4AKIA 3EWLA 4MNNA 3ZLPA 5DQYA 5HR2A 2LJRA 3DVXA 2PN8A 2VKZG 3LW9A 1NM3A 2HZEB 3KTLA 1K3OA 2GLRA 1GTIA 3GA4A 2B5EA 3KH7A 4QL9A 5ECHB 4FO5A 3ZFBA 3TOTA 2X8CA 1HYUA 3TRQA 4N10A 4ZB7A 1VGLA 2EIRA 1MDJA 4DSSA 1SKWB 4J57E 4ZB6A 1WIKA 4EKZA 1FOVA 2C3QA 1QK8A 2EFCA 1AQWA 2P5QA 1A2JA 1AUCA 1FB6A 3CSJA 4G19A 1BX9A 4G0KA 3TCOA 4XHMA 1V98A 4EDYA 3CMIA 2H75A 5FT3A 2H1LA 1ZYEA 3D0ZA 2IMKA 3PGTA 4XS4B 2DJ1A 2O89A 2F9SA 5F06A 5ECPB 1AQXA 1U3AA 2DJKA 4I2UA 4EIPA 1TRVA 3HD5A 1PD21 2AUVA 1BQ7A 2V2GA 1OYJA 4CHSA 4L8EA 3GN3A 5C04A 3IR4A 2P31A 14GSA 17GSA 4WR4A 2JACA 3FR9A 1FAAA 3ZMLA 1SKSB 2HXKA 1X9SB 2I1UA 5ECMB 1T3BA 2JSZA 2LQQA 3EMPA 1RW1A 4CW9A 1NHYA 2X64A 2CVKA 5H5RA 2KHPA 2TRCP 5D9WA 2REMA 2H0GA 2LUSA 5IOWA 4NV5A 2TRXA 3F6DA 2VAFA 3VK9A 1ERTA 3EMXA 1NW2A 4FH8A 4ZB9A 3KP8A 4O92A 4TVEA 5A34B 1J9BA 4PTSA 3TJFA 3VWUA 4I8BA 2DJ2A 4G0LA 1MEKA 3DXBA 4GXZA 2EC4A 4MZWA 1AAZA 4PURA 1M0UA 1Z5YE 2LNSA 3EINA 1YQ1A 2EIQA 3GYKA 1GSUA 3CRUA 1SJIA 2V32A 3VURA 4KB3A 2OT3A 4KE3A 19GSA 4KNDA 6GSSA 4K6XA 4POLA 3F4RA 2CQ9A 2BTOT 2BMXA 1SK1A 3D6IA 3L0HA 1F3BA 1OC9A 3GMFA 4Z2UA 1G7OA 1ZYNA 4ZL9A 5AN1A 1GUKA 1B9YC 1BEDA 3I9V2 3O6TA 2DKHA 2I81A 1PRXA 2C3NA 4YQVA 4F03A 2EIOA 1U87A 1XW9A 5D8IA 2C4JA 4NWYA 4BVYA 2JU5A 3D22A 3FZAA 2DJ0A 4QL7A 4NHWA 3UBKA 4K0GA 3KEBA 2NDOA 3ZL5A 4ISDA 2GSQA 2B7JA 2H1BA 2K9FA 4TXOB 1A2LA 5ECSA 1ACVA 1HNAA 1MTCA 3ERGA 2H6XA 4BPYA 4KSOA 1GLQA 2MMNA 1SVOA 3HCZA 3C7MA 3I69A 1Z6NA 3C73A 4OFTA 1Z6MA 2QC7A 4XRAA 1U3IA 2YJ7A 3ZFLA 4JE1A 2GQMA 3QPMA 5KN2A 4XRDA 3EPTA 1A2MA 3PH9A 1X0RA 3QOUA 1GTUA 3HJOA 2VM2A 2HFDA 4ID0A 2A2PA 4O32A 5KEJA 2VLVA 3F3QA 3IRAA 2EFEA 1S3AA 5ECLB 3G7YA 3LXZA 8GSSA 2E2GA 4L5OA 3CBUA 3KJYA 1KNGA 3GKKA 2LJAA 3EU3A 2X8HA 5D9XA 2CZ2A 3MAKA 2H66A 2K8SA 1TU8A 3GL5A 5E59A 4BA7A 2IMDA 3C8EA 3ZVJA 2HRFA 1W4VA 3GRXA 3HVSA 5IMDA 6GSTA 2EFDA 3RHBA 3ZZXA 4HZ4A 4FYBA 1JLVA 1OAZA 2PVOC 3ED3A 4I2TA 3P90A 1SVMA 1FOHA 1XWCA 2M80A 3F6FA 1XWBA 2IMFA 2DIYA 4ILFA 1Y25A 5J40A 3GSSA 2DMLA 5JCWA 3VI7A 3CTGA 3ME7A 4DSQA 4P3YB 5G31A 5KOXA 3LEFA 4AJ7A 3LGCA 4EXJA 2N5FA 1TTZA 3FYGA 3TKPA 2R6KA 3HHVA 4POBA 4PX1A 4GQCA 1ON4A 2ALBA 2B5YA 2GS3A 4N0ZA 5AISA 2H6ZA 1K0CA 2A2RA 2DJ3A 1GNEA 1URMA 2X99A 4YKGA 2VM1A 4IW9A 2B1LA 2AAWA 4O5UA 3ISOA 2WS2A 2DLXA 3DMLA 3HJMA 3LWAA 1U6TA 3F63A 3DYRA 22GSA 2GZZA 1IYIA 3QAVA 5KN1A 1MD3A 2HZEA 2RUFA 3L78A 2E7PA 3ZITA 4ZIJA 1VF3A 1A8YA 1JZRA 3GKNA 5BMUA 3UL3A 2X8GA 5AIXA 4MPGA 2I9HA 1N25A 3R2QA 3EVIA 3Q6OA 2CVDA 2AYTA 5F05A 1A0RP 2MMAA 5DCHA 4MF7A 1MDIA 2VLTA 2A4HA 1H75A 2PVQA 5JWQB 3TU3B 5F8BA 4ACSA 2P0GA 3FKFA 1XVWA 2JZTA 4ML6A 4RQXA 1G6YA 3NOFA 3TRXA 2GTUA 1T00A 1CQGA 5ELGA 4GSNA 1A24A 2HLSA 1DE2A 4LL4B 1GSYA 3MWHA 4BL7A 4PQHA 1NHOA 1Z7RA 2MMOA 2H19A 2XPEA 3I43A 2WGRA 1YJ6A 1QQ2A 2LRTA 5JWRB 1SKRB 4JEDA 2B6MA 1WMJA 3G9BA 2H8LA 4X0XA 1EEMA 3D5JA 2H0HA 1TP9A 1E2YA 2LS5A 5FHIA 1O6JA 2V1MA 4WXTA 3IK7A 4EDZA 1JZDA 2L5LA 3LSZA 5IMAA 4MF5A 2O87A 4O5RA 4MDCA 3F9UA 3CSHA 2FWGA 4CY8A 1SK0A 4G9HA 2CVBA 2FWEA 3ZVJD 3GH9A 3M8NA 5A34A 2K18A 2O85A 3Q18A 3N5OA 4AGSA 4DVCA 4RQRA 2N5BA 4KW6A 2C0GA 4ECJA 3WGDA 2QSIA 2YWNA 2YWOA 4MCUA 1WOUA 2LTKA 2H0IA 2K6VA 3G7IA 3EU4A 2WB9A 2H72A 2YV7A 2YZUA 1T4ZA 3KD0A 3PPUA 4TR0A 3GV1A 3GFKA 2WRTA 1GSEA 3H1NA 1O81A 4YAPA 5EVOA 3TJJA 1UVZA 3GKMA 2V6OA 4CY6A 1XZOA 4KCAA 2LKUA 5CYYA 1TRUA 2L6DA 1SJ6A 5BMUB 1AIUA 3BD2A 3US3A 2C8UA 4WBJA 3KMNA 1GSSA 1VF4A 2FNOA 4O7HA 1Y1UA 1ERUA 1O73A 2YWIA 4FQUA 2RM5A 1JZOA 3A2XA 2KLXA 3UVHA 2XBIA 3KTBA 4ZL7A 4K2XA 1SENA 2FWHA 4Z2TA 2DSAA 3TKSE 2NPBA 1K3YA 3P7XA 2H30A 4EC0A 2HE3A 2YNXA 2J9HA 1EV9A 3CWGA 3L4NA 1FW1A 4TXOA 3KH9A 2AJQB 4V2NA 1G6WA 3FW2A 1BG5A 1QGVA 5G5FA 2WCIA 4TR4A 2B5XA 4AJ6A 3KGKA 2R0GA 3TDGA 4F82A 4BL7B 2YOIA 5DAKA 3EE2A 2G2QA 2VLUA 4PQIA 2L4QA 3L9UA 3F3RA 1KBNA 3Q19A 3DWVA 2YPMA 1MD4A 5IIZA 4KAEA 2VL2A 3F0IA 2KP2A 2VCVA 2K8VA 2LEGA 3IBHA 2GQKA 5EL8A 4MH3A 1DSBA 4TOPA 1R7HA 4KUNA 3UEMA 2H70A 2EFHA 5B7CA 2VD1A 2FWFA 1SYRA 2IMIA 4WF5A 4WKWA 5G1LA 1YEXA 4Z7XA 3GSTA 3C1SA 2XHFA 2DIZA 2HNLA 2OBKA 1PGTA 3QFBC 1F2EA 3LXTA 4AI6A 4IP6A 4V2LA 4TRXA 1BF5A 4KGIA 5IO2A 3UIWA 1ZL9A 2OACA 5CRHA 1TK5B 4MJBA 5LNKe 1K0OA 5DJMA 1ZYPA 1SU9A 4XS6A 2VUPA 3QMXA 2AV4A 3UAPA 5GSSA 3RPNA 4K5RA 4J56E 4POMA 4EE0A 5LD0A 4AKXB 2JZSA 2CA8A 3PINA 2DBCA 5B6MA 2KUCA 1T1VA 1VRSD 2LQOA 5ECOB 4YAVA 2P5RA 1F6MC 4EL1A 20GSA 1U88A 3I6AA 1XCCA 4MLYA 1OE8A 2H71A 1K0NA 3HVXA 3U5RE 2MZCA 2HSYA 1M2BA 4GRFA 3KXOA 1M2DA 2JADA 5IOXA 2IMEA 13GSA 1YEPA 3GHAA 3DKSA 7GSSA 2GDRA 3L9VA 5HFGA 1XPVA 2O7KA 2RLIA 2VL3A 3WGXA 2LSTA 4I97A 1B8XA 4KA0A 1S3DA 4H86A 4EIQA 3A2WA 3WD6A 2HRKB 3LG6A 1XFLA 2KOKA 5DAKB 3W6GA 4LMVA 5INYA 4MH2A 4LA1A 5HFIA 1GUHA 2ES7A 1V2AA 4KCEA 11GSA 3QDNA 2F8FA 3G7JA 5A5KA 5IO0A 1K0DA 4IHUA 2R5GA 2HYXA 2UV8G 4HQSA 2UZ8A 2PU9C 5E4WA 3R3EA 1TOFA 3FK8A 5JCUA 2QA2A 2A2SA 4JBBA 3HXSA 1RQMA 4F0CA 1F37A 1HNBA 2I4AA 3U6VA 2HSMA 3L9SA 3MDKA 2IPAA 1DBYA 4WF4A 3K8NA 1XBSA 1ILOA 2H74A 5A4VA 2FA8A 3EC3A 3SBCA 5J5NA 2IFQA 4JR4A 2C0FA 2RM6A 1H4OA 5DQSA 1PQNA 4GSSA 1V40A 5DCGA 2H1AA 2V6KA 4F0BA 1FVKA 3GURA 2YZHA 2YANA 2FGXA 3KP9A 1VF1A 4FIWA 2NTOA 3IOSA 5H5SA 5J4VA 4F2IA 5A4WA 4EF0A 5CP1A 4YQUA 5B6NA 3DVWA 5JWOB 3LORA 2GZPA 4KSMA 3IXRA 4ZB8A 3JCML 1FHEA 3HYPA 3GX8A 1A0FA 4BWQA 4USSA 3LYPA 4E8EA 3F4SA 4POKA 3J7Yb 1NSWA 5ECIB 4ZBDA 3CRTA 4KH7A 1EP8A 2ZNMA 4NV2A 3FY7A 4GSTA 1SK2A 2M46A 4IGJA 2NVLA 1QMVA 2OJLA 4JZQA 16GSA 5J4UA 2VCWA 3LQ7A 5A4UA 2V41A 4IQAA 3VPQA 2IL3A 5LCZA 1OC3A 4N30A 3FR3A 1YVLA 2NBSA 4MA9A 2WDUA 4XCSA 4GTUA 5L71A 1TXUA 1CQHA 2Z9SA 4A5PA 2R37A 2LV3A 3MSZA 3ZREA 3IDVA 3M3MA 2FLSA 3APOA 2PBJA 2WULA 4I6XA 1XVQA 4BVXA 1AC1A 1GTAA 1PN0A 4NAXA 2RIIA 3A3TA 4ZXGA 3UVTA 2ZCTA 2OE0A 5GSTA 2C0DA 1TK8B 2ZUPA 3WYWA 4ECCA 2L57A 1A8LA 3E0UA 5G30A 1T7PB 1GWCA 3GH6A 4JRRA 5CNWA 4GLTA 4RI6A 2L6CA 3FR6A 1HQOA 3M1GA 4D73A 1R4WA 2VL2C 5J9CA 2CZ3A 2HI7A 2OE1A 4K9ZA 2GQLA 2PWJA 2VO4A 5BRTA 3IHGA 1FO5A 4ZL8A 2YWMA 1XOAA 2F3MA 2YN1A 3F8UA 4LMWA 2HSMB 5IQYA 3VWWA 4EUYA 4OFMA 1ZMAA 4Q5FA 1V57A 1XW6A 2B3SA 2VCXA 1R26A 1X5EA 2IFQB 5HR0A 3VI5A 1PA3A 5H5QA 1PKWA 1UC7A 2H73A 4TR1A 4Q5RA 1EWXA 3CSIA 4K1FA 3M9JA 1WJKA 1K3LA 3W8SA 5A5HA 2CAQA 5ECKB 3GKXA 1M9AA 2HT9A 5IPHA 6GSUA 5IMFA 1TRWA 1SL2B 4WEYA 5D96A 1B4PA 4NPBA 4PNFA 1WWJA 3UBLA 2L4CA 3ZIVA 2CX3A 3QR6A 2VOCA 5IMZA 3ME8A 1GSFA 1PKZA 2FY6A 2H1GA 3D4TA 1SJZA 3A5WA 4MK3A 4AKGA 3FEUA 3TKSA 3ZIJA 1T8EB 4LLRA 2DC5A 1OKTA 5CREA 1GTBA 4G0IA 2ON7A 5AIVA 4G10A 2F51A 3TGZA 1BG1A 1ZGNA 5JCGA 4MJAA 3BCIA 5IMCA 3HKRA 2QGVA 1WP0A 4KDYA 2HSNB 4OWYA 1YKAA 2R0PA 1X9MB 3OR5A 4CDOA 4N3ZA 4GCIA 3TRPA 1M7TA 1N2AA 1GRXA 3HY2A 1XWGA 4ICYA 1TRSA 1UN2A 1B9XC 3IAM2 3TJGA 4TR3A 4L0UA 4HU7A 1X5DA 4PUFC 1B48A 1GH2A 2R0CA 2R3XA 2HSHA 4V1Ap 5GAPD 2GT5A 4HOJA 4BVXB 2A4VA 1HD2A 4PXOA 4MABA 3ZRDA 3EURA 3M9KA 1SL0B 3IE3A 3H93A 4PUAA 3P2AA 2DJJA 4KX4A 2MMZA 4HDEA 3FMWA 3HJPA 3UOMA 1AXDA 4E68A 2H6YA 3EYTA 1TI3A 5IMVA 3ERFA 1ZYQB 4D73B 2C80A 1AQVA 1KEBA 2LJKA 5KOWA 5EY6A 4K5SA 2OADA 2O8VB 5ELAA 9GSSA 3TJBA 1GULA 3VWVA 2CV4A 4QQ7A 1VF2A 1O8XA 1SVLA 3ERWA 4YQMA 1E6BA 1M2AA 1O7UA 1XOBA 4RUVA 2JZRA 4QMKA 5D9VA 1G7EA 3UMAA 5GAND 3Q74A 4MMMA 2KP1A 3TUEA 3CYNA 1TK0B 1THXA 1YF0A 2XC2A 5ABRA 2HRKA 4TR1B 3UARA 1EEJA 1GP1A 3H8QA 4GWRA 3KMOA 1PMTA 1R5AA 1EZKA 1ST9A 10GSA 5A5HB 4XTSA 3HVVA 4KDXA 3FZ5A 3IV4A 4HZ2A 2FUG2 3LJRA 4X1UA 5J41A 1QXHA 3QCPA 1GSQA 4HUAA 6GSYA 3DGQA 1T4YA 2OE3A 3O3TA 3NZNA 4G01A 2PGTA 1M9BA 2IWTA 5B8BA 1FB0A 3D21A 4J2FA 4WR5A 1TXXA 2E0QA 4F9ZA 4IS0A 4Z2RA 1DE1A 3SWLA 1BAYA 4DSRA 3IHQA 3BJ5A 3CTFA 1WE0A 3F4TA 4K8MA 5AGYA 1XWAA 3HDCA 2H76A 3GL3A 2VD0A 4JR6A 5IPGA 4IKHA 3E3EA 4O5QA 3QFAC 3GTUA 1JZWA 1I9DA 4AF2A 2XPDA 4Q5NA 1YKCA 1FVJA 4IJIA 4HS1A 4N0VA 1GSDA 1PN9A 3DIEA 3O76A 4OFNA 2IJYA 5CRWA 2N5AA 1ERVA 4FYUA 4KF9A 4X4JA 5B8AA 2GSRA 3UJ1A 2B7KA 5HQPA 2CX4A 5DJLA 2LNTA 1W89A 1JFUA 5CO3A 2VCZA 5HR1A 2I3YA 4IN0A 5DDLA 2IN3A 3A5IA 3DEXA 1USBA 1LU4A 1GNWA 1PSQA 1EOHA 1UA5A 2FD3A 1YZXA 2C1YA 5DALA 5HFKA 2GT6A 1XXUA 3TKQA 4ZILA 4OO4A 3TB2A 4OMVA 2GGTA 1XW5A 2YV9A 4HJMA 4ECBA 1K0MA 2OBIA 4TKYA 4ULXA 3ZYWA 1Z7PA 4XS1A 3AY8A 3H79A 1WPIA 4DSSB 3KM6A 3RAZA 5ECRB 3P8WA 2BJXA 1ZOFA 4K7NA 4TW5A 4L5LA 3DRNA 1EGOA 4MPFA 1A23A 2FCHA 4AKHA 3GNJA 5ENUA 1IYHA 2M72A 4MZCA 5J3RA 2R2JA 1O8WA 3FZ9A 2CAIA 3FRCA 1FG4A 2HZFA 3FHKA 2L5OA 2LRNA 4IELA 1EP7A 1ERWA 18GSA 4HU9A 2VL9A 4WBRD 2MYGA 1AW9A 1PX7A 4PNGA 2YP6A 2IIYA 3H4KA 1YDKA 4OCFA 4W66A 2J23A 1YY7A 3HZ8A 3QAWA 2OA7A 4YKFA 1TKDB 2OKAA 1R5PA 5ID2A 1Q4JA 2VCQA 1Z3EA 4V2MA 3FZ4A 1OE7A 12GSA 2PMTA 3TKSC 4GDFA 4IVFA 5KN3A 2H1DA 3KZQA 1TDIA 2G0FA 1J0FA 4ML1A 3QAGA 4YH2A 2ON5A 3A2VA 3MYDA 1SD8A 3GTUB 5DBQA 3BCKA 1BJXA 1Y6EA 2YCDA 4PQ1A 4OCEA 1SD9A 5CRGA 5C00A 3BOAA 4L0WA 3LFLA 4TXVA 2PERA 3D4MA 3GUSA 6GSVA 4HQZA 6GSXA 3S9FA 4GF0A 3TJKA 1XWKA 1JLWA 3RDWA 2QKEA 2E2MA 6GSWA 1QUWA 5ECQB 3IPZA 4MZBA 5DALB 1V58A 1LJRA 1C72A 2C3TA 2WJUA 1S3CA 1JHBA 3KIJA 2LRCA 1EGRA 1PL1A 1WRYA 5HR3A 4HI7A 1TW9A 1GL8A 5GZZB 3IC8A 1GUMA 2TIRA 4AJ8A 5CAXA 3GIXA 2HSNA 4ZBBA 1OC9B 3QD9A 4NXIA 4MJCA 1K0AA 2GSSA 4ECIA 3TOUA 5IM9A 4FYCA 2PUKC 1F3AA 2C0EA 4X43A 1BYEA 4N11A 2HRNA 2WZ9A 2PPTA 2AHEA 3WGEA 1G0TA 1V9WA 4BVYB 1TI1A 1Q98A 3RBTA 2B1KA 3CXGA 5ECNB 1ABAA 4WETA 5A1NA 2MBTA 2JSYA 4K7OA 2X49A 1SL1B 4KDUA 3VPTA 2YJHA 2JL4A 1B4QA 4IBPA 4OD7A 5EPFA 3RHCA 1TJDA 1KTEA 4MF6A 2DKIA 3NIVA 5G2ZA 2HQTA 2VIMA 1PL2A 1ZZYA 1EV4A 3M0FA 1TU7A 3ZMKA 3HMJG 5COHA 1K0BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5F07 A;  3BBY A;  1J08 A;  5ID2 B;  2DMM A;  4MJE A;  2WFC A;  3KCM A;  4BWS A;  2AB6 A;  2VCT A;  3MNG A;  1N8J A;  2H01 A;  2L59 A;  5FWG A;  3VLN A;  2FHE A;  3HA9 A;  1HNC A;  1SYX A;  1YF1 A;  3IAS 2;  1DUG A;  1ML6 A;  4K7I A;  2GVP A;  3PR8 A;  3VWX A;  1OC8 A;  4LL1 B;  1MDK A;  4NHZ A;  2MBS A;  3RPP A;  3C1R A;  1OVN A;  3APS A;  4IP1 A;  4EVM A;  4ZBA A;  3N9J A;  4XS4 A;  3IC4 A;  2GST A;  5D93 A;  3GX0 A;  3WT2 A;  5DVB A;  1OKD A;  4E8H A;  1ZCP A;  4NMU A;  5F0G A;  4K2D A;  1O85 A;  5D73 A;  1Z9H A;  3APQ A;  2F8A A;  3E9J B;  3LYK A;  3WT1 A;  3J7Y k;  1PX6 A;  4GQF A;  3IA1 A;  1QFN A;  4RI7 A;  5CRD A;  4HJ2 A;  3C71 A;  1RK4 A;  3ZTL A;  5J9B A;  4TN8 A;  4IJ3 A;  3V1W A;  4I5Q A;  5KN0 A;  1EOG A;  1LBK A;  4Q5Q A;  2R4V A;  4JU5 A;  2CT6 A;  2XBQ A;  1M99 A;  3HZ4 A;  5G5E A;  2D2Z A;  4IQ1 A;  4XIH A;  1GLP A;  5G1K A;  5D9T A;  3TKR A;  4DEJ A;  2HRA A;  4PGT A;  1XIY A;  1X9W B;  4HEA 2;  3W8J A;  1X5C A;  4MP4 A;  4G2E A;  4OO5 A;  3IK9 A;  2FA4 A;  1F9M A;  1THO A;  2RUE A;  3DD3 A;  4V1A g;  4EO3 A;  2GZY A;  1I5G A;  3VFI A;  4K0N A;  3EWL A;  3ZLP A;  5DQY A;  5HR2 A;  2LJR A;  3DVX A;  2PN8 A;  1NM3 A;  2HZE B;  3KTL A;  1K3O A;  2GLR A;  1GTI A;  3GA4 A;  2B5E A;  3KH7 A;  4QL9 A;  5ECH B;  4FO5 A;  3ZFB A;  3TOT A;  2X8C A;  1HYU A;  3TRQ A;  4N10 A;  1VGL A;  2EIR A;  1MDJ A;  4DSS A;  1SKW B;  4J57 E;  4ZB6 A;  1WIK A;  4EKZ A;  1FOV A;  2C3Q A;  1QK8 A;  1AQW A;  2P5Q A;  1A2J A;  1AUC A;  1FB6 A;  3CSJ A;  4G19 A;  1BX9 A;  4G0K A;  3TCO A;  4XHM A;  1V98 A;  4EDY A;  3CMI A;  2H75 A;  5FT3 A;  1ZYE A;  3D0Z A;  2IMK A;  3PGT A;  4XS4 B;  2DJ1 A;  2O89 A;  2F9S A;  5F06 A;  5ECP B;  1AQX A;  1U3A A;  2DJK A;  4I2U A;  1TRV A;  3HD5 A;  1PD2 1;  2AUV A;  1BQ7 A;  2V2G A;  1OYJ A;  4CHS A;  4L8E A;  3GN3 A;  5C04 A;  3IR4 A;  2P31 A;  14GS A;  17GS A;  4WR4 A;  2JAC A;  3FR9 A;  1FAA A;  3ZML A;  1SKS B;  2HXK A;  1X9S B;  2I1U A;  5ECM B;  1T3B A;  2JSZ A;  2LQQ A;  3EMP A;  1RW1 A;  4CW9 A;  1NHY A;  2X64 A;  2CVK A;  5H5R A;  2KHP A;  2TRC P;  5D9W A;  2REM A;  2H0G A;  2LUS A;  5IOW A;  4NV5 A;  2TRX A;  3F6D A;  2VAF A;  3VK9 A;  1ERT A;  3EMX A;  1NW2 A;  4FH8 A;  4ZB9 A;  3KP8 A;  4O92 A;  4TVE A;  1J9B A;  4PTS A;  3TJF A;  3VWU A;  4I8B A;  2DJ2 A;  4G0L A;  1MEK A;  3DXB A;  4GXZ A;  2EC4 A;  4MZW A;  1AAZ A;  4PUR A;  1M0U A;  1Z5Y E;  2LNS A;  3EIN A;  1YQ1 A;  2EIQ A;  3GYK A;  1GSU A;  3CRU A;  1SJI A;  2V32 A;  3VUR A;  4KB3 A;  4KE3 A;  19GS A;  4KND A;  6GSS A;  4K6X A;  4POL A;  3F4R A;  2CQ9 A;  2BTO T;  2BMX A;  1SK1 A;  3D6I A;  3L0H A;  1F3B A;  1OC9 A;  3GMF A;  1G7O A;  4ZL9 A;  5AN1 A;  1GUK A;  1B9Y C;  1BED A;  3I9V 2;  3O6T A;  2I81 A;  1PRX A;  2C3N A;  4YQV A;  4F03 A;  2EIO A;  1U87 A;  1XW9 A;  5D8I A;  2C4J A;  4NWY A;  4BVY A;  2JU5 A;  3D22 A;  3FZA A;  2DJ0 A;  4QL7 A;  4NHW A;  3UBK A;  4K0G A;  3KEB A;  2NDO A;  3ZL5 A;  4ISD A;  2GSQ A;  2B7J A;  2H1B A;  2K9F A;  4TXO B;  1A2L A;  5ECS A;  1ACV A;  1HNA A;  1MTC A;  3ERG A;  2H6X A;  4BPY A;  4KSO A;  1GLQ A;  2MMN A;  3HCZ A;  3C7M A;  3I69 A;  1Z6N A;  3C73 A;  4OFT A;  1Z6M A;  2QC7 A;  4XRA A;  1U3I A;  2YJ7 A;  3ZFL A;  4JE1 A;  2GQM A;  3QPM A;  5KN2 A;  4XRD A;  1A2M A;  3PH9 A;  1X0R A;  3QOU A;  1GTU A;  3HJO A;  2VM2 A;  2HFD A;  4ID0 A;  4O32 A;  5KEJ A;  2VLV A;  3F3Q A;  3IRA A;  1S3A A;  5ECL B;  3G7Y A;  3LXZ A;  8GSS A;  2E2G A;  4L5O A;  3CBU A;  3KJY A;  1KNG A;  3GKK A;  2LJA A;  3EU3 A;  2X8H A;  5D9X A;  2CZ2 A;  3MAK A;  2H66 A;  2K8S A;  1TU8 A;  3GL5 A;  5E59 A;  4BA7 A;  2IMD A;  3C8E A;  3ZVJ A;  2HRF A;  1W4V A;  3GRX A;  3HVS A;  5IMD A;  6GST A;  3RHB A;  3ZZX A;  4HZ4 A;  4FYB A;  1JLV A;  1OAZ A;  2PVO C;  3ED3 A;  4I2T A;  3P90 A;  1XWC A;  2M80 A;  3F6F A;  1XWB A;  2IMF A;  2DIY A;  4ILF A;  1Y25 A;  3GSS A;  2DML A;  5JCW A;  3VI7 A;  3CTG A;  3ME7 A;  4DSQ A;  4P3Y B;  5G31 A;  3LEF A;  4AJ7 A;  3LGC A;  4EXJ A;  2N5F A;  1TTZ A;  3FYG A;  3TKP A;  2R6K A;  3HHV A;  4POB A;  4PX1 A;  4GQC A;  1ON4 A;  2ALB A;  2B5Y A;  2GS3 A;  4N0Z A;  5AIS A;  2H6Z A;  1K0C A;  2A2R A;  2DJ3 A;  1GNE A;  1URM A;  2X99 A;  2VM1 A;  4IW9 A;  2B1L A;  2AAW A;  3ISO A;  2WS2 A;  2DLX A;  3DML A;  3HJM A;  3LWA A;  1U6T A;  3F63 A;  3DYR A;  22GS A;  2GZZ A;  1IYI A;  3QAV A;  5KN1 A;  1MD3 A;  2HZE A;  2RUF A;  3L78 A;  2E7P A;  3ZIT A;  4ZIJ A;  1VF3 A;  1A8Y A;  1JZR A;  3GKN A;  5BMU A;  3UL3 A;  2X8G A;  5AIX A;  4MPG A;  2I9H A;  3R2Q A;  3EVI A;  3Q6O A;  2CVD A;  2AYT A;  5F05 A;  1A0R P;  2MMA A;  5DCH A;  4MF7 A;  1MDI A;  2VLT A;  1H75 A;  2PVQ A;  5JWQ B;  5F8B A;  4ACS A;  2P0G A;  3FKF A;  1XVW A;  2JZT A;  4ML6 A;  4RQX A;  1G6Y A;  3NOF A;  3TRX A;  2GTU A;  1T00 A;  1CQG A;  5ELG A;  4GSN A;  1A24 A;  2HLS A;  1DE2 A;  4LL4 B;  1GSY A;  3MWH A;  4BL7 A;  4PQH A;  1NHO A;  1Z7R A;  2MMO A;  2H19 A;  2XPE A;  3I43 A;  2WGR A;  1YJ6 A;  1QQ2 A;  2LRT A;  5JWR B;  1SKR B;  4JED A;  2B6M A;  1WMJ A;  3G9B A;  2H8L A;  4X0X A;  1EEM A;  3D5J A;  2H0H A;  1TP9 A;  1E2Y A;  2LS5 A;  5FHI A;  1O6J A;  2V1M A;  4WXT A;  3IK7 A;  4EDZ A;  1JZD A;  2L5L A;  3LSZ A;  5IMA A;  4MF5 A;  2O87 A;  4O5R A;  4MDC A;  3F9U A;  3CSH A;  2FWG A;  1SK0 A;  4G9H A;  2CVB A;  2FWE A;  3ZVJ D;  3GH9 A;  3M8N A;  2K18 A;  2O85 A;  3Q18 A;  3N5O A;  4AGS A;  4DVC A;  4RQR A;  2N5B A;  4KW6 A;  2C0G A;  4ECJ A;  3WGD A;  2QSI A;  2YWN A;  2YWO A;  4MCU A;  1WOU A;  2LTK A;  2H0I A;  2K6V A;  3G7I A;  3EU4 A;  2WB9 A;  2H72 A;  2YV7 A;  2YZU A;  1T4Z A;  3KD0 A;  3PPU A;  4TR0 A;  3GV1 A;  3GFK A;  2WRT A;  1GSE A;  3H1N A;  1O81 A;  4YAP A;  5EVO A;  3TJJ A;  1UVZ A;  3GKM A;  2V6O A;  1XZO A;  4KCA A;  2LKU A;  5CYY A;  1TRU A;  2L6D A;  1SJ6 A;  1AIU A;  3BD2 A;  3US3 A;  2C8U A;  4WBJ A;  3KMN A;  1GSS A;  1VF4 A;  2FNO A;  4O7H A;  1ERU A;  1O73 A;  2YWI A;  4FQU A;  2RM5 A;  1JZO A;  3A2X A;  2KLX A;  3UVH A;  2XBI A;  3KTB A;  4ZL7 A;  1SEN A;  2FWH A;  2DSA A;  3TKS E;  2NPB A;  1K3Y A;  3P7X A;  2H30 A;  4EC0 A;  2HE3 A;  2YNX A;  2J9H A;  1EV9 A;  3L4N A;  1FW1 A;  4TXO A;  3KH9 A;  2AJQ B;  4V2N A;  1G6W A;  3FW2 A;  1BG5 A;  1QGV A;  5G5F A;  2WCI A;  4TR4 A;  2B5X A;  4AJ6 A;  3KGK A;  3TDG A;  4F82 A;  4BL7 B;  2YOI A;  5DAK A;  3EE2 A;  2G2Q A;  2VLU A;  4PQI A;  2L4Q A;  3L9U A;  3F3R A;  1KBN A;  3Q19 A;  3DWV A;  2YPM A;  1MD4 A;  5IIZ A;  4KAE A;  2VL2 A;  3F0I A;  2KP2 A;  2VCV A;  2K8V A;  2LEG A;  3IBH A;  2GQK A;  5EL8 A;  4MH3 A;  1DSB A;  4TOP A;  1R7H A;  4KUN A;  3UEM A;  2H70 A;  5B7C A;  2VD1 A;  2FWF A;  1SYR A;  2IMI A;  4WF5 A;  4WKW A;  5G1L A;  1YEX A;  4Z7X A;  3GST A;  3C1S A;  2XHF A;  2DIZ A;  2HNL A;  2OBK A;  1PGT A;  3QFB C;  1F2E A;  3LXT A;  4IP6 A;  4V2L A;  4TRX A;  4KGI A;  5IO2 A;  3UIW A;  1ZL9 A;  2OAC A;  5CRH A;  1TK5 B;  4MJB A;  5LNK e;  1K0O A;  5DJM A;  1SU9 A;  4XS6 A;  2VUP A;  3QMX A;  2AV4 A;  3UAP A;  5GSS A;  3RPN A;  4J56 E;  4POM A;  4EE0 A;  5LD0 A;  2JZS A;  2CA8 A;  3PIN A;  2DBC A;  5B6M A;  2KUC A;  1T1V A;  1VRS D;  2LQO A;  5ECO B;  4YAV A;  2P5R A;  1F6M C;  4EL1 A;  20GS A;  1U88 A;  3I6A A;  1XCC A;  4MLY A;  1OE8 A;  2H71 A;  1K0N A;  3HVX A;  3U5R E;  2MZC A;  2HSY A;  1M2B A;  4GRF A;  3KXO A;  1M2D A;  2JAD A;  5IOX A;  2IME A;  13GS A;  1YEP A;  3GHA A;  3DKS A;  7GSS A;  2GDR A;  3L9V A;  5HFG A;  1XPV A;  2O7K A;  2RLI A;  2VL3 A;  3WGX A;  2LST A;  4I97 A;  1B8X A;  4KA0 A;  1S3D A;  4H86 A;  3A2W A;  3WD6 A;  2HRK B;  3LG6 A;  1XFL A;  2KOK A;  5DAK B;  3W6G A;  4LMV A;  5INY A;  4MH2 A;  4LA1 A;  5HFI A;  1GUH A;  2ES7 A;  1V2A A;  4KCE A;  11GS A;  3QDN A;  2F8F A;  3G7J A;  5A5K A;  5IO0 A;  1K0D A;  4IHU A;  2R5G A;  2HYX A;  4HQS A;  2UZ8 A;  2PU9 C;  5E4W A;  3R3E A;  1TOF A;  3FK8 A;  5JCU A;  2A2S A;  4JBB A;  3HXS A;  1RQM A;  4F0C A;  1F37 A;  1HNB A;  2I4A A;  3U6V A;  2HSM A;  3L9S A;  3MDK A;  2IPA A;  1DBY A;  4WF4 A;  3K8N A;  1XBS A;  1ILO A;  2H74 A;  5A4V A;  2FA8 A;  3EC3 A;  3SBC A;  5J5N A;  2IFQ A;  4JR4 A;  2C0F A;  2RM6 A;  1H4O A;  5DQS A;  1PQN A;  4GSS A;  1V40 A;  5DCG A;  2H1A A;  2V6K A;  4F0B A;  1FVK A;  3GUR A;  2YZH A;  2YAN A;  2FGX A;  3KP9 A;  1VF1 A;  4FIW A;  2NTO A;  3IOS A;  5H5S A;  4F2I A;  5A4W A;  4EF0 A;  5CP1 A;  4YQU A;  5B6N A;  3DVW A;  5JWO B;  3LOR A;  2GZP A;  4KSM A;  3IXR A;  4ZB8 A;  3JCM L;  1FHE A;  3HYP A;  3GX8 A;  1A0F A;  4BWQ A;  4USS A;  3LYP A;  4E8E A;  3F4S A;  4POK A;  3J7Y b;  1NSW A;  5ECI B;  4ZBD A;  3CRT A;  4KH7 A;  1EP8 A;  2ZNM A;  4NV2 A;  3FY7 A;  4GST A;  1SK2 A;  2M46 A;  4IGJ A;  2NVL A;  1QMV A;  2OJL A;  4JZQ A;  16GS A;  5J4U A;  2VCW A;  3LQ7 A;  5A4U A;  2V41 A;  4IQA A;  3VPQ A;  2IL3 A;  5LCZ A;  1OC3 A;  4N30 A;  3FR3 A;  2NBS A;  4MA9 A;  2WDU A;  4XCS A;  4GTU A;  5L71 A;  1CQH A;  2Z9S A;  2R37 A;  2LV3 A;  3MSZ A;  3ZRE A;  3IDV A;  3M3M A;  2FLS A;  3APO A;  2PBJ A;  2WUL A;  4I6X A;  1XVQ A;  4BVX A;  1AC1 A;  1GTA A;  4NAX A;  2RII A;  3A3T A;  4ZXG A;  3UVT A;  2ZCT A;  2OE0 A;  5GST A;  2C0D A;  1TK8 B;  2ZUP A;  3WYW A;  4ECC A;  2L57 A;  1A8L A;  3E0U A;  5G30 A;  1T7P B;  1GWC A;  3GH6 A;  4JRR A;  5CNW A;  4GLT A;  4RI6 A;  2L6C A;  3FR6 A;  1HQO A;  3M1G A;  4D73 A;  1R4W A;  2VL2 C;  5J9C A;  2CZ3 A;  2HI7 A;  2OE1 A;  4K9Z A;  2GQL A;  2PWJ A;  2VO4 A;  1FO5 A;  4ZL8 A;  2YWM A;  1XOA A;  2F3M A;  2YN1 A;  3F8U A;  4LMW A;  2HSM B;  5IQY A;  3VWW A;  4EUY A;  4OFM A;  1ZMA A;  4Q5F A;  1V57 A;  1XW6 A;  2B3S A;  2VCX A;  1R26 A;  1X5E A;  2IFQ B;  5HR0 A;  3VI5 A;  1PA3 A;  5H5Q A;  1PKW A;  1UC7 A;  2H73 A;  4TR1 A;  4Q5R A;  1EWX A;  3CSI A;  4K1F A;  3M9J A;  1WJK A;  1K3L A;  3W8S A;  2CAQ A;  5ECK B;  3GKX A;  1M9A A;  2HT9 A;  5IPH A;  6GSU A;  5IMF A;  1TRW A;  1SL2 B;  4WEY A;  5D96 A;  1B4P A;  4NPB A;  4PNF A;  1WWJ A;  3UBL A;  2L4C A;  3ZIV A;  2CX3 A;  3QR6 A;  2VOC A;  5IMZ A;  3ME8 A;  1GSF A;  1PKZ A;  2FY6 A;  2H1G A;  3D4T A;  1SJZ A;  3A5W A;  4MK3 A;  3FEU A;  3TKS A;  3ZIJ A;  1T8E B;  4LLR A;  2DC5 A;  1OKT A;  5CRE A;  1GTB A;  4G0I A;  2ON7 A;  5AIV A;  4G10 A;  2F51 A;  3TGZ A;  1ZGN A;  5JCG A;  4MJA A;  3BCI A;  5IMC A;  3HKR A;  2QGV A;  1WP0 A;  4KDY A;  2HSN B;  4OWY A;  1YKA A;  1X9M B;  3OR5 A;  4CDO A;  4GCI A;  3TRP A;  1M7T A;  1N2A A;  1GRX A;  3HY2 A;  1XWG A;  1TRS A;  1UN2 A;  1B9X C;  3IAM 2;  3TJG A;  4TR3 A;  4L0U A;  4HU7 A;  1X5D A;  4PUF C;  1B48 A;  1GH2 A;  2R3X A;  2HSH A;  4V1A p;  5GAP D;  2GT5 A;  4HOJ A;  4BVX B;  2A4V A;  1HD2 A;  4PXO A;  4MAB A;  3ZRD A;  3EUR A;  3M9K A;  1SL0 B;  3IE3 A;  3H93 A;  4PUA A;  3P2A A;  2DJJ A;  4KX4 A;  2MMZ A;  4HDE A;  3HJP A;  3UOM A;  1AXD A;  2H6Y A;  3EYT A;  1TI3 A;  5IMV A;  3ERF A;  1ZYQ B;  4D73 B;  2C80 A;  1AQV A;  1KEB A;  2LJK A;  5EY6 A;  2OAD A;  2O8V B;  5ELA A;  9GSS A;  3TJB A;  1GUL A;  3VWV A;  2CV4 A;  4QQ7 A;  1VF2 A;  1O8X A;  3ERW A;  4YQM A;  1E6B A;  1M2A A;  1O7U A;  1XOB A;  4RUV A;  2JZR A;  5D9V A;  1G7E A;  3UMA A;  5GAN D;  3Q74 A;  4MMM A;  2KP1 A;  3TUE A;  3CYN A;  1TK0 B;  1THX A;  1YF0 A;  2XC2 A;  5ABR A;  2HRK A;  4TR1 B;  3UAR A;  1EEJ A;  1GP1 A;  3H8Q A;  4GWR A;  3KMO A;  1PMT A;  1R5A A;  1EZK A;  1ST9 A;  10GS A;  4XTS A;  3HVV A;  4KDX A;  3FZ5 A;  3IV4 A;  4HZ2 A;  2FUG 2;  3LJR A;  4X1U A;  5J41 A;  1QXH A;  3QCP A;  1GSQ A;  4HUA A;  6GSY A;  3DGQ A;  1T4Y A;  2OE3 A;  3O3T A;  3NZN A;  2PGT A;  1M9B A;  2IWT A;  5B8B A;  1FB0 A;  3D21 A;  4J2F A;  4WR5 A;  1TXX A;  2E0Q A;  4F9Z A;  4IS0 A;  1DE1 A;  3SWL A;  1BAY A;  4DSR A;  3IHQ A;  3BJ5 A;  3CTF A;  1WE0 A;  3F4T A;  4K8M A;  5AGY A;  1XWA A;  3HDC A;  2H76 A;  3GL3 A;  2VD0 A;  4JR6 A;  5IPG A;  4IKH A;  3E3E A;  3QFA C;  3GTU A;  1JZW A;  1I9D A;  4AF2 A;  2XPD A;  4Q5N A;  1YKC A;  1FVJ A;  4IJI A;  4HS1 A;  4N0V A;  1GSD A;  1PN9 A;  3DIE A;  3O76 A;  4OFN A;  2IJY A;  5CRW A;  2N5A A;  1ERV A;  4FYU A;  4KF9 A;  5B8A A;  2GSR A;  3UJ1 A;  2B7K A;  5HQP A;  2CX4 A;  5DJL A;  2LNT A;  1W89 A;  1JFU A;  5CO3 A;  2VCZ A;  5HR1 A;  2I3Y A;  4IN0 A;  5DDL A;  2IN3 A;  3DEX A;  1USB A;  1LU4 A;  1GNW A;  1PSQ A;  1EOH A;  1UA5 A;  2FD3 A;  1YZX A;  2C1Y A;  5DAL A;  5HFK A;  2GT6 A;  1XXU A;  3TKQ A;  4ZIL A;  4OO4 A;  3TB2 A;  4OMV A;  2GGT A;  1XW5 A;  2YV9 A;  4HJM A;  4ECB A;  1K0M A;  2OBI A;  4TKY A;  4ULX A;  3ZYW A;  1Z7P A;  4XS1 A;  3AY8 A;  3H79 A;  1WPI A;  4DSS B;  3KM6 A;  3RAZ A;  5ECR B;  3P8W A;  2BJX A;  1ZOF A;  4K7N A;  4TW5 A;  4L5L A;  3DRN A;  1EGO A;  4MPF A;  1A23 A;  2FCH A;  3GNJ A;  5ENU A;  1IYH A;  2M72 A;  4MZC A;  5J3R A;  2R2J A;  1O8W A;  3FZ9 A;  2CAI A;  3FRC A;  1FG4 A;  2HZF A;  3FHK A;  2L5O A;  2LRN A;  4IEL A;  1EP7 A;  1ERW A;  18GS A;  4HU9 A;  2VL9 A;  4WBR D;  2MYG A;  1AW9 A;  1PX7 A;  4PNG A;  2YP6 A;  2IIY A;  3H4K A;  1YDK A;  4OCF A;  2J23 A;  1YY7 A;  3HZ8 A;  3QAW A;  2OA7 A;  1TKD B;  2OKA A;  1R5P A;  5ID2 A;  1Q4J A;  2VCQ A;  1Z3E A;  4V2M A;  3FZ4 A;  1OE7 A;  12GS A;  2PMT A;  3TKS C;  4IVF A;  5KN3 A;  2H1D A;  3KZQ A;  1TDI A;  2G0F A;  1J0F A;  4ML1 A;  3QAG A;  4YH2 A;  2ON5 A;  3A2V A;  1SD8 A;  3GTU B;  5DBQ A;  3BCK A;  1BJX A;  1Y6E A;  2YCD A;  4PQ1 A;  4OCE A;  1SD9 A;  5CRG A;  5C00 A;  3BOA A;  4L0W A;  3LFL A;  4TXV A;  2PER A;  3D4M A;  3GUS A;  6GSV A;  4HQZ A;  6GSX A;  3S9F A;  4GF0 A;  3TJK A;  1XWK A;  1JLW A;  3RDW A;  2QKE A;  2E2M A;  6GSW A;  1QUW A;  5ECQ B;  3IPZ A;  4MZB A;  5DAL B;  1V58 A;  1LJR A;  1C72 A;  2C3T A;  2WJU A;  1S3C A;  1JHB A;  3KIJ A;  2LRC A;  1EGR A;  1PL1 A;  1WRY A;  5HR3 A;  4HI7 A;  1TW9 A;  1GL8 A;  5GZZ B;  3IC8 A;  1GUM A;  2TIR A;  4AJ8 A;  5CAX A;  4ZBB A;  3GIX A;  1OC9 B;  3QD9 A;  4NXI A;  4MJC A;  1K0A A;  2GSS A;  4ECI A;  3TOU A;  5IM9 A;  4FYC A;  2PUK C;  1F3A A;  2C0E A;  4X43 A;  1BYE A;  4N11 A;  2HRN A;  2WZ9 A;  2PPT A;  2AHE A;  3WGE A;  1G0T A;  1V9W A;  4BVY B;  1TI1 A;  1Q98 A;  3RBT A;  2B1K A;  3CXG A;  5ECN B;  1ABA A;  4WET A;  2MBT A;  2JSY A;  4K7O A;  1SL1 B;  4KDU A;  3VPT A;  2YJH A;  2JL4 A;  1B4Q A;  4IBP A;  4OD7 A;  5EPF A;  3RHC A;  1TJD A;  1KTE A;  4MF6 A;  3NIV A;  5G2Z A;  2HQT A;  2VIM A;  1PL2 A;  1ZZY A;  1EV4 A;  3M0F A;  1TU7 A;  3ZMK A;  5COH A;  1K0B A; 
#chains in the Genus database with same CATH topology
 5F07 A;  3BBY A;  1J08 A;  5ID2 B;  2DMM A;  4MJE A;  2WFC A;  3KCM A;  4BWS A;  2AB6 A;  2VCT A;  3MNG A;  1N8J A;  2H01 A;  2L59 A;  5FWG A;  4PHZ C;  3VLN A;  2FHE A;  3HA9 A;  1HNC A;  2O5V A;  1SYX A;  1YF1 A;  3IAS 2;  1DUG A;  1ML6 A;  4K7I A;  2GVP A;  3PR8 A;  3VWX A;  1OC8 A;  4LL1 B;  1MDK A;  4NHZ A;  2MBS A;  3RPP A;  3C1R A;  1OVN A;  3APS A;  4IP1 A;  4EVM A;  5J47 A;  4ZBA A;  3N9J A;  4XS4 A;  3IC4 A;  2GST A;  5D93 A;  3GX0 A;  3WT2 A;  5DVB A;  1OKD A;  4E8H A;  1ZCP A;  4NMU A;  5F0G A;  4K2D A;  1O85 A;  5D73 A;  1Z9H A;  3APQ A;  2F8A A;  3E9J B;  3LYK A;  3WT1 A;  3J7Y k;  1PX6 A;  4GQF A;  3IA1 A;  2QA1 A;  1QFN A;  2WVX A;  4RI7 A;  5CRD A;  5J4Y A;  4HJ2 A;  2O36 A;  3C71 A;  1RK4 A;  3ZTL A;  5J9B A;  4TN8 A;  4IJ3 A;  3V1W A;  4I5Q A;  5KN0 A;  1EOG A;  1LBK A;  4Q5Q A;  2R4V A;  4JU5 A;  2CT6 A;  2XBQ A;  1M99 A;  3HZ4 A;  3MIX A;  5G5E A;  2D2Z A;  4IQ1 A;  4XIH A;  1GLP A;  5G1K A;  2X4A A;  5D9T A;  3TKR A;  4DEJ A;  2HRA A;  4PGT A;  1XIY A;  1X9W B;  4HEA 2;  3W8J A;  1X5C A;  4MP4 A;  4G2E A;  4OO5 A;  3IK9 A;  2FA4 A;  1F9M A;  1THO A;  2RUE A;  3DD3 A;  4V1A g;  4EO3 A;  2GZY A;  5A1N B;  1I5G A;  3VFI A;  4K0N A;  4AKI A;  3EWL A;  4MNN A;  3ZLP A;  5DQY A;  5HR2 A;  2LJR A;  3DVX A;  2PN8 A;  2VKZ G;  3LW9 A;  1NM3 A;  2HZE B;  3KTL A;  1K3O A;  2GLR A;  2WW2 A;  1GTI A;  3GA4 A;  2B5E A;  3KH7 A;  4QL9 A;  5ECH B;  4FO5 A;  3ZFB A;  3TOT A;  2X8C A;  1HYU A;  3TRQ A;  4N10 A;  4ZB7 A;  1VGL A;  2EIR A;  1MDJ A;  4DSS A;  1SKW B;  4J57 E;  4ZB6 A;  1WIK A;  4EKZ A;  2O3E A;  1FOV A;  2C3Q A;  1QK8 A;  2EFC A;  1AQW A;  2P5Q A;  1A2J A;  1AUC A;  1FB6 A;  3CSJ A;  4G19 A;  1BX9 A;  4G0K A;  3TCO A;  4XHM A;  1V98 A;  4EDY A;  3CMI A;  4PI2 C;  2H75 A;  5FT3 A;  2H1L A;  1ZYE A;  3D0Z A;  2IMK A;  3PGT A;  4XS4 B;  2DJ1 A;  2O89 A;  2F9S A;  5F06 A;  5ECP B;  1AQX A;  1U3A A;  2DJK A;  4I2U A;  4EIP A;  1TRV A;  3HD5 A;  1PD2 1;  2AUV A;  1BQ7 A;  2V2G A;  1OYJ A;  4CHS A;  4L8E A;  3GN3 A;  5C04 A;  3IR4 A;  2P31 A;  4FXY P;  14GS A;  17GS A;  4WR4 A;  2JAC A;  3FR9 A;  1FAA A;  3ZML A;  1SKS B;  2HXK A;  1X9S B;  2I1U A;  5ECM B;  1T3B A;  2JSZ A;  2LQQ A;  3EMP A;  1RW1 A;  4CW9 A;  1NHY A;  2X64 A;  2CVK A;  5H5R A;  2KHP A;  2TRC P;  5D9W A;  2REM A;  2H0G A;  2LUS A;  5IOW A;  4NV5 A;  2TRX A;  3F6D A;  2VAF A;  3VK9 A;  1ERT A;  3EMX A;  1NW2 A;  4FH8 A;  4ZB9 A;  3KP8 A;  4O92 A;  4TVE A;  5A34 B;  1J9B A;  4PTS A;  3TJF A;  3VWU A;  4I8B A;  2DJ2 A;  4G0L A;  1MEK A;  3DXB A;  4GXZ A;  2EC4 A;  4MZW A;  1AAZ A;  4PUR A;  1M0U A;  1Z5Y E;  2LNS A;  3EIN A;  1YQ1 A;  4HSC X;  2EIQ A;  3GYK A;  1GSU A;  3CRU A;  1SJI A;  2V32 A;  3VUR A;  4KB3 A;  2OT3 A;  4KE3 A;  19GS A;  4KND A;  6GSS A;  4K6X A;  4POL A;  3F4R A;  2CQ9 A;  2BTO T;  2BMX A;  1SK1 A;  3D6I A;  3L0H A;  1F3B A;  1OC9 A;  3GMF A;  4Z2U A;  1G7O A;  1ZYN A;  4ZL9 A;  5AN1 A;  1GUK A;  1B9Y C;  1BED A;  3I9V 2;  3O6T A;  2DKH A;  2I81 A;  1PRX A;  2C3N A;  4YQV A;  4F03 A;  2EIO A;  3HVN A;  1U87 A;  1XW9 A;  5D8I A;  2C4J A;  4NWY A;  4BVY A;  2JU5 A;  3D22 A;  3FZA A;  2DJ0 A;  4QL7 A;  4NHW A;  3UBK A;  4K0G A;  3KEB A;  2NDO A;  3ZL5 A;  4ISD A;  2GSQ A;  2B7J A;  2H1B A;  2K9F A;  4TXO B;  1A2L A;  5ECS A;  1ACV A;  1HNA A;  1MTC A;  3ERG A;  2H6X A;  4BPY A;  4KSO A;  1GLQ A;  2MMN A;  1SVO A;  3HCZ A;  3C7M A;  3I69 A;  1Z6N A;  3C73 A;  4OFT A;  1Z6M A;  2QC7 A;  4XRA A;  1U3I A;  2YJ7 A;  3ZFL A;  4JE1 A;  2GQM A;  3QPM A;  5KN2 A;  4XRD A;  3EPT A;  1A2M A;  3PH9 A;  1X0R A;  3QOU A;  1GTU A;  3HJO A;  2VM2 A;  2HFD A;  4ID0 A;  2A2P A;  4O32 A;  5KEJ A;  2VLV A;  1PFO A;  3F3Q A;  3IRA A;  2EFE A;  1S3A A;  5ECL B;  3G7Y A;  3LXZ A;  8GSS A;  2E2G A;  4L5O A;  3CBU A;  3KJY A;  1KNG A;  3GKK A;  2LJA A;  3EU3 A;  2X8H A;  5D9X A;  2CZ2 A;  3MAK A;  2H66 A;  2K8S A;  1TU8 A;  3GL5 A;  1I1I P;  5E59 A;  4BA7 A;  2IMD A;  3C8E A;  3ZVJ A;  2HRF A;  1W4V A;  3GRX A;  3HVS A;  5IMD A;  6GST A;  2EFD A;  3RHB A;  3ZZX A;  4HZ4 A;  4FYB A;  1JLV A;  1OAZ A;  2PVO C;  3ED3 A;  4I2T A;  3P90 A;  1SVM A;  1FOH A;  1XWC A;  2M80 A;  3F6F A;  1XWB A;  2IMF A;  2DIY A;  4ILF A;  1Y25 A;  5J40 A;  3RGB C;  3GSS A;  2DML A;  5JCW A;  3VI7 A;  3CTG A;  3ME7 A;  4DSQ A;  4P3Y B;  5G31 A;  5KOX A;  3LEF A;  4AJ7 A;  3LGC A;  4EXJ A;  2N5F A;  1TTZ A;  3FYG A;  3TKP A;  2R6K A;  3HHV A;  4POB A;  4PX1 A;  4GQC A;  1ON4 A;  2ALB A;  2B5Y A;  2GS3 A;  4N0Z A;  5AIS A;  2H6Z A;  1K0C A;  2A2R A;  2DJ3 A;  1GNE A;  1URM A;  2X99 A;  4YKG A;  2VM1 A;  4IW9 A;  2B1L A;  2AAW A;  4O5U A;  3ISO A;  2WS2 A;  2DLX A;  3DML A;  3HJM A;  3LWA A;  1U6T A;  3F63 A;  3DYR A;  22GS A;  2GZZ A;  1IYI A;  3QAV A;  5KN1 A;  1MD3 A;  2HZE A;  2RUF A;  3L78 A;  2E7P A;  3ZIT A;  4ZIJ A;  1VF3 A;  1A8Y A;  1JZR A;  3GKN A;  5BMU A;  3UL3 A;  2X8G A;  5AIX A;  4MPG A;  2I9H A;  1N25 A;  3R2Q A;  1YEW C;  3EVI A;  3Q6O A;  2CVD A;  2AYT A;  5F05 A;  1A0R P;  2MMA A;  5DCH A;  4MF7 A;  1MDI A;  2VLT A;  2A4H A;  1H75 A;  2PVQ A;  5JWQ B;  1S3R A;  3TU3 B;  5F8B A;  4ACS A;  2P0G A;  3FKF A;  1XVW A;  2JZT A;  4ML6 A;  4RQX A;  1G6Y A;  3NOF A;  3TRX A;  2GTU A;  1T00 A;  1CQG A;  5ELG A;  4GSN A;  1A24 A;  2HLS A;  1DE2 A;  4LL4 B;  4BIK A;  1GSY A;  3MWH A;  4BL7 A;  4PQH A;  1NHO A;  1Z7R A;  2MMO A;  2H19 A;  2XPE A;  3I43 A;  2WGR A;  1YJ6 A;  1QQ2 A;  2LRT A;  5JWR B;  1SKR B;  4JED A;  2B6M A;  1WMJ A;  3G9B A;  2H8L A;  4X0X A;  1EEM A;  3D5J A;  2H0H A;  1TP9 A;  1E2Y A;  2LS5 A;  5FHI A;  1O6J A;  2V1M A;  4WXT A;  3IK7 A;  4EDZ A;  1JZD A;  2L5L A;  3LSZ A;  5IMA A;  4MF5 A;  2O87 A;  4O5R A;  4MDC A;  3F9U A;  3CSH A;  2FWG A;  4CY8 A;  1SK0 A;  4G9H A;  2CVB A;  2FWE A;  3ZVJ D;  3GH9 A;  3M8N A;  5A34 A;  2K18 A;  2O85 A;  3Q18 A;  3N5O A;  4AGS A;  4DVC A;  4RQR A;  2N5B A;  4KW6 A;  2C0G A;  4ECJ A;  3WGD A;  2QSI A;  2YWN A;  2YWO A;  4MCU A;  1WOU A;  2LTK A;  2H0I A;  2K6V A;  3G7I A;  3EU4 A;  2WB9 A;  2H72 A;  2YV7 A;  2YZU A;  1T4Z A;  3KD0 A;  3PPU A;  4TR0 A;  3GV1 A;  3GFK A;  2WRT A;  1GSE A;  3H1N A;  1O81 A;  4YAP A;  5EVO A;  3TJJ A;  1UVZ A;  3GKM A;  2V6O A;  4CY6 A;  1XZO A;  4KCA A;  2LKU A;  5CYY A;  1TRU A;  2L6D A;  1SJ6 A;  5BMU B;  1AIU A;  3BD2 A;  3US3 A;  2WVZ A;  2C8U A;  4WBJ A;  3KMN A;  1GSS A;  1VF4 A;  2FNO A;  4O7H A;  1Y1U A;  1ERU A;  1O73 A;  2YWI A;  4FQU A;  2RM5 A;  1JZO A;  3A2X A;  2KLX A;  3UVH A;  2XBI A;  3KTB A;  4ZL7 A;  4K2X A;  1SEN A;  2FWH A;  4Z2T A;  2DSA A;  3TKS E;  2NPB A;  1K3Y A;  3P7X A;  2H30 A;  4EC0 A;  2HE3 A;  2YNX A;  2J9H A;  1EV9 A;  3CWG A;  3L4N A;  1FW1 A;  4TXO A;  3KH9 A;  2AJQ B;  4V2N A;  1G6W A;  3FW2 A;  4PI0 C;  1BG5 A;  1QGV A;  5G5F A;  2WCI A;  4TR4 A;  2B5X A;  4AJ6 A;  3KGK A;  2R0G A;  3TDG A;  4F82 A;  4BL7 B;  2YOI A;  5DAK A;  3EE2 A;  2G2Q A;  2VLU A;  4PQI A;  2L4Q A;  3L9U A;  3F3R A;  1KBN A;  3Q19 A;  3DWV A;  2YPM A;  1MD4 A;  5IIZ A;  4KAE A;  2VL2 A;  3F0I A;  2KP2 A;  2VCV A;  2K8V A;  2LEG A;  3IBH A;  2GQK A;  5EL8 A;  4MH3 A;  1DSB A;  4TOP A;  1R7H A;  4KUN A;  3UEM A;  2H70 A;  2EFH A;  5B7C A;  2VD1 A;  2FWF A;  1SYR A;  2IMI A;  4WF5 A;  4WKW A;  5G1L A;  1YEX A;  4Z7X A;  3GST A;  3C1S A;  2XHF A;  2DIZ A;  2HNL A;  2OBK A;  1PGT A;  3QFB C;  1F2E A;  3LXT A;  4AI6 A;  4IP6 A;  4V2L A;  4TRX A;  1BF5 A;  4KGI A;  5IO2 A;  3UIW A;  3RFR C;  1ZL9 A;  2OAC A;  5CRH A;  1TK5 B;  4MJB A;  5LNK e;  1K0O A;  5DJM A;  1ZYP A;  1SU9 A;  4XS6 A;  1S4B P;  2VUP A;  3QMX A;  2AV4 A;  3UAP A;  1M3J A;  5GSS A;  3RPN A;  4K5R A;  4J56 E;  4POM A;  4EE0 A;  5LD0 A;  4AKX B;  2JZS A;  2CA8 A;  3PIN A;  2DBC A;  5B6M A;  2KUC A;  1T1V A;  1VRS D;  2LQO A;  5ECO B;  4YAV A;  2P5R A;  1F6M C;  4EL1 A;  20GS A;  1U88 A;  3I6A A;  1XCC A;  4MLY A;  1OE8 A;  3CQF A;  2H71 A;  1K0N A;  3HVX A;  3U5R E;  2MZC A;  2HSY A;  1M2B A;  4GRF A;  3KXO A;  1M2D A;  2JAD A;  5IOX A;  2IME A;  13GS A;  1YEP A;  3GHA A;  3DKS A;  7GSS A;  2GDR A;  3L9V A;  5HFG A;  1XPV A;  2O7K A;  2RLI A;  2VL3 A;  3WGX A;  2LST A;  4I97 A;  1B8X A;  4KA0 A;  1S3D A;  4H86 A;  4EIQ A;  3A2W A;  3WD6 A;  2HRK B;  3LG6 A;  1XFL A;  2KOK A;  5DAK B;  3W6G A;  4LMV A;  5INY A;  4MH2 A;  4LA1 A;  5HFI A;  1GUH A;  2ES7 A;  1V2A A;  4KCE A;  11GS A;  3QDN A;  2F8F A;  3G7J A;  5A5K A;  5IO0 A;  1K0D A;  4IHU A;  2R5G A;  2HYX A;  2UV8 G;  4HQS A;  2UZ8 A;  2PU9 C;  5E4W A;  3R3E A;  1TOF A;  3FK8 A;  5JCU A;  2QA2 A;  2A2S A;  4JBB A;  3HXS A;  1RQM A;  4F0C A;  1F37 A;  1HNB A;  2I4A A;  3U6V A;  2HSM A;  3L9S A;  3MDK A;  2IPA A;  1DBY A;  4WF4 A;  3K8N A;  1XBS A;  1ILO A;  2H74 A;  5A4V A;  2FA8 A;  3EC3 A;  3SBC A;  5J5N A;  2IFQ A;  4JR4 A;  2C0F A;  2RM6 A;  1H4O A;  5DQS A;  1PQN A;  4GSS A;  1V40 A;  5DCG A;  2H1A A;  2V6K A;  4F0B A;  1FVK A;  3GUR A;  2YZH A;  2YAN A;  2FGX A;  3KP9 A;  1VF1 A;  4FIW A;  2NTO A;  3IOS A;  5H5S A;  5J4V A;  4F2I A;  5A4W A;  4EF0 A;  5CP1 A;  4YQU A;  5B6N A;  3DVW A;  5JWO B;  3LOR A;  2GZP A;  4KSM A;  3IXR A;  4ZB8 A;  3JCM L;  1FHE A;  3HYP A;  3GX8 A;  1A0F A;  4BWQ A;  4USS A;  3LYP A;  4E8E A;  3F4S A;  4POK A;  3J7Y b;  1NSW A;  5ECI B;  4ZBD A;  3CRT A;  4KH7 A;  1EP8 A;  2ZNM A;  4NV2 A;  3FY7 A;  4GST A;  1SK2 A;  2M46 A;  4IGJ A;  2NVL A;  1QMV A;  2OJL A;  4JZQ A;  16GS A;  5J4U A;  2VCW A;  3LQ7 A;  5A4U A;  2V41 A;  2WW1 A;  4IQA A;  3VPQ A;  2IL3 A;  5LCZ A;  1OC3 A;  4N30 A;  3FR3 A;  1YVL A;  2NBS A;  4MA9 A;  2WDU A;  4XCS A;  4GTU A;  5L71 A;  1TXU A;  1CQH A;  2Z9S A;  4A5P A;  2R37 A;  2LV3 A;  3MSZ A;  3ZRE A;  3IDV A;  3M3M A;  2FLS A;  3APO A;  2PBJ A;  2WUL A;  4I6X A;  1XVQ A;  4BVX A;  1AC1 A;  1GTA A;  1PN0 A;  4NAX A;  2RII A;  3A3T A;  4ZXG A;  3UVT A;  2ZCT A;  2OE0 A;  5GST A;  2C0D A;  1TK8 B;  2ZUP A;  3WYW A;  4ECC A;  2L57 A;  1A8L A;  3E0U A;  5G30 A;  1T7P B;  1GWC A;  3GH6 A;  4JRR A;  5CNW A;  4GLT A;  4RI6 A;  2L6C A;  2WZS A;  3FR6 A;  1HQO A;  3M1G A;  4D73 A;  1R4W A;  2VL2 C;  5J9C A;  2CZ3 A;  2HI7 A;  2OE1 A;  4K9Z A;  2GQL A;  2PWJ A;  2VO4 A;  5BRT A;  3IHG A;  1FO5 A;  4ZL8 A;  2YWM A;  1XOA A;  2F3M A;  2YN1 A;  3F8U A;  4LMW A;  2HSM B;  5IQY A;  3VWW A;  4EUY A;  4OFM A;  1ZMA A;  2WVY A;  4Q5F A;  1V57 A;  1XW6 A;  2B3S A;  2VCX A;  1R26 A;  1X5E A;  2IFQ B;  5HR0 A;  3VI5 A;  1PA3 A;  5H5Q A;  1PKW A;  1UC7 A;  2H73 A;  4TR1 A;  4Q5R A;  1EWX A;  3CSI A;  4K1F A;  3M9J A;  1WJK A;  1K3L A;  3W8S A;  5A5H A;  2CAQ A;  5ECK B;  3GKX A;  1M9A A;  2HT9 A;  5IPH A;  6GSU A;  5IMF A;  1TRW A;  1SL2 B;  4WEY A;  5D96 A;  1B4P A;  4NPB A;  4PNF A;  1WWJ A;  3UBL A;  2L4C A;  3ZIV A;  2CX3 A;  3QR6 A;  2VOC A;  5IMZ A;  3ME8 A;  1GSF A;  1PKZ A;  2FY6 A;  2H1G A;  3D4T A;  1SJZ A;  3A5W A;  4MK3 A;  4AKG A;  3FEU A;  3TKS A;  3ZIJ A;  1T8E B;  4LLR A;  2DC5 A;  1OKT A;  5CRE A;  1GTB A;  4G0I A;  2ON7 A;  5AIV A;  4G10 A;  2F51 A;  3TGZ A;  1BG1 A;  1ZGN A;  2WW0 A;  5JCG A;  4MJA A;  3BCI A;  5IMC A;  3HKR A;  2QGV A;  1WP0 A;  4KDY A;  2HSN B;  4OWY A;  1YKA A;  2R0P A;  1X9M B;  3OR5 A;  4CDO A;  4N3Z A;  4GCI A;  3TRP A;  1M7T A;  1N2A A;  1GRX A;  3HY2 A;  1XWG A;  4ICY A;  1TRS A;  1UN2 A;  1B9X C;  3IAM 2;  3TJG A;  4TR3 A;  4L0U A;  4HU7 A;  1X5D A;  4PUF C;  1B48 A;  1GH2 A;  2R0C A;  2R3X A;  2HSH A;  4V1A p;  5GAP D;  2GT5 A;  4HOJ A;  4BVX B;  2A4V A;  1HD2 A;  4PXO A;  4MAB A;  3ZRD A;  3EUR A;  3M9K A;  1SL0 B;  3IE3 A;  3H93 A;  4PUA A;  3P2A A;  2DJJ A;  4KX4 A;  2MMZ A;  4HDE A;  3FMW A;  3HJP A;  3UOM A;  1AXD A;  4E68 A;  2H6Y A;  3EYT A;  1TI3 A;  5IMV A;  3ERF A;  1ZYQ B;  4D73 B;  2C80 A;  1AQV A;  1KEB A;  2LJK A;  5KOW A;  5EY6 A;  4K5S A;  2OAD A;  2O8V B;  5ELA A;  9GSS A;  3TJB A;  1GUL A;  3VWV A;  2CV4 A;  4QQ7 A;  1VF2 A;  1O8X A;  1SVL A;  3ERW A;  4YQM A;  1E6B A;  1M2A A;  1O7U A;  1XOB A;  4RUV A;  2JZR A;  4QMK A;  5D9V A;  1G7E A;  3UMA A;  5GAN D;  3Q74 A;  3CHX C;  4MMM A;  2KP1 A;  3TUE A;  3CYN A;  1TK0 B;  1THX A;  1YF0 A;  2XC2 A;  5ABR A;  2HRK A;  4TR1 B;  3UAR A;  1EEJ A;  1GP1 A;  3H8Q A;  4GWR A;  3KMO A;  1PMT A;  1R5A A;  1EZK A;  1ST9 A;  10GS A;  5A5H B;  4XTS A;  3HVV A;  4KDX A;  3FZ5 A;  3IV4 A;  4HZ2 A;  2FUG 2;  3LJR A;  4X1U A;  5J41 A;  1QXH A;  3QCP A;  1GSQ A;  4HUA A;  6GSY A;  3DGQ A;  1T4Y A;  2OE3 A;  3O3T A;  3NZN A;  4G01 A;  2PGT A;  1M9B A;  2IWT A;  5B8B A;  1FB0 A;  3D21 A;  4J2F A;  4WR5 A;  1TXX A;  2E0Q A;  4F9Z A;  4IS0 A;  4Z2R A;  1DE1 A;  3SWL A;  1BAY A;  4DSR A;  2WVX B;  3IHQ A;  3BJ5 A;  3CTF A;  1WE0 A;  3F4T A;  4K8M A;  5AGY A;  1XWA A;  1XG8 A;  3HDC A;  2H76 A;  3GL3 A;  2VD0 A;  4JR6 A;  5IPG A;  4IKH A;  3E3E A;  4O5Q A;  3QFA C;  3GTU A;  1JZW A;  1I9D A;  4AF2 A;  2XPD A;  4Q5N A;  1YKC A;  1FVJ A;  4IJI A;  4HS1 A;  4N0V A;  1GSD A;  1PN9 A;  3DIE A;  3O76 A;  4OFN A;  2IJY A;  5CRW A;  2N5A A;  1ERV A;  4FYU A;  4KF9 A;  4X4J A;  5B8A A;  2GSR A;  3UJ1 A;  2B7K A;  5HQP A;  2CX4 A;  5DJL A;  2LNT A;  1W89 A;  1JFU A;  5CO3 A;  2VCZ A;  5HR1 A;  2I3Y A;  4IN0 A;  5DDL A;  2IN3 A;  3A5I A;  3DEX A;  1USB A;  1LU4 A;  1GNW A;  1PSQ A;  1EOH A;  1UA5 A;  2FD3 A;  1YZX A;  2C1Y A;  5DAL A;  5HFK A;  2GT6 A;  1XXU A;  3TKQ A;  4ZIL A;  4OO4 A;  3TB2 A;  4OMV A;  2GGT A;  1XW5 A;  2YV9 A;  4HJM A;  4ECB A;  1K0M A;  2OBI A;  4TKY A;  4ULX A;  3ZYW A;  1Z7P A;  4XS1 A;  3AY8 A;  3H79 A;  1WPI A;  4DSS B;  3KM6 A;  3RAZ A;  5ECR B;  3P8W A;  2BJX A;  1ZOF A;  4K7N A;  4TW5 A;  4L5L A;  3DRN A;  1EGO A;  4MPF A;  1A23 A;  2FCH A;  4AKH A;  3GNJ A;  5ENU A;  1IYH A;  2M72 A;  4MZC A;  5J3R A;  2R2J A;  1O8W A;  3FZ9 A;  2CAI A;  3FRC A;  1FG4 A;  2HZF A;  3FHK A;  2L5O A;  2LRN A;  4IEL A;  1EP7 A;  1ERW A;  18GS A;  4HU9 A;  2VL9 A;  4WBR D;  2MYG A;  1AW9 A;  1PX7 A;  4PNG A;  2YP6 A;  2IIY A;  3H4K A;  1YDK A;  4OCF A;  4W66 A;  2J23 A;  1YY7 A;  3HZ8 A;  3QAW A;  2OA7 A;  4YKF A;  1TKD B;  2OKA A;  1R5P A;  5ID2 A;  1Q4J A;  2VCQ A;  1Z3E A;  4V2M A;  3FZ4 A;  1OE7 A;  12GS A;  2PMT A;  3TKS C;  4GDF A;  4IVF A;  5KN3 A;  2H1D A;  3KZQ A;  1TDI A;  2G0F A;  1J0F A;  4ML1 A;  3QAG A;  4YH2 A;  2ON5 A;  3A2V A;  3MYD A;  1SD8 A;  3GTU B;  5DBQ A;  3BCK A;  1BJX A;  1Y6E A;  2YCD A;  4PQ1 A;  4OCE A;  1SD9 A;  5CRG A;  5C00 A;  3BOA A;  4L0W A;  3LFL A;  4TXV A;  2PER A;  3D4M A;  3GUS A;  6GSV A;  4HQZ A;  6GSX A;  3S9F A;  4GF0 A;  3TJK A;  1XWK A;  1JLW A;  3RDW A;  2QKE A;  2E2M A;  6GSW A;  1QUW A;  5ECQ B;  3IPZ A;  4MZB A;  2WW3 A;  5DAL B;  1V58 A;  1LJR A;  1C72 A;  2C3T A;  2WJU A;  1S3C A;  1JHB A;  3KIJ A;  2LRC A;  1EGR A;  1PL1 A;  1WRY A;  5HR3 A;  4HI7 A;  1TW9 A;  1M3I A;  5GZZ B;  1GL8 A;  3IC8 A;  1GUM A;  2TIR A;  4AJ8 A;  5CAX A;  3GIX A;  2HSN A;  4ZBB A;  1OC9 B;  3QD9 A;  4NXI A;  4MJC A;  1K0A A;  2GSS A;  4ECI A;  3TOU A;  5IM9 A;  4FYC A;  2PUK C;  1F3A A;  2C0E A;  4X43 A;  1BYE A;  4N11 A;  2HRN A;  2WZ9 A;  2PPT A;  2AHE A;  3WGE A;  1G0T A;  1V9W A;  4BVY B;  1TI1 A;  1Q98 A;  3RBT A;  2B1K A;  3CXG A;  5ECN B;  1ABA A;  4WET A;  5A1N A;  2MBT A;  2JSY A;  4K7O A;  2X49 A;  1SL1 B;  4KDU A;  3VPT A;  2YJH A;  2JL4 A;  1B4Q A;  4IBP A;  4OD7 A;  5EPF A;  3RHC A;  1TJD A;  1KTE A;  4MF6 A;  2DKI A;  3NIV A;  5G2Z A;  2HQT A;  2VIM A;  1PL2 A;  1ZZY A;  1EV4 A;  3M0F A;  1TU7 A;  3ZMK A;  3HMJ G;  5COH A;  1K0B A; 
#chains in the Genus database with same CATH homology
 5F07 A;  3BBY A;  1J08 A;  5ID2 B;  2DMM A;  4MJE A;  2WFC A;  3KCM A;  4BWS A;  2AB6 A;  2VCT A;  3MNG A;  1N8J A;  2H01 A;  2L59 A;  5FWG A;  3VLN A;  2FHE A;  3HA9 A;  1HNC A;  2O5V A;  1SYX A;  1YF1 A;  3IAS 2;  1DUG A;  1ML6 A;  4K7I A;  2GVP A;  3PR8 A;  3VWX A;  1OC8 A;  4LL1 B;  1MDK A;  4NHZ A;  2MBS A;  3RPP A;  3C1R A;  1OVN A;  3APS A;  4IP1 A;  4EVM A;  5J47 A;  4ZBA A;  3N9J A;  4XS4 A;  3IC4 A;  2GST A;  5D93 A;  3GX0 A;  3WT2 A;  5DVB A;  1OKD A;  4E8H A;  1ZCP A;  4NMU A;  5F0G A;  4K2D A;  1O85 A;  5D73 A;  1Z9H A;  3APQ A;  2F8A A;  3E9J B;  3LYK A;  3WT1 A;  3J7Y k;  1PX6 A;  4GQF A;  3IA1 A;  2QA1 A;  1QFN A;  4RI7 A;  5CRD A;  5J4Y A;  4HJ2 A;  3C71 A;  1RK4 A;  3ZTL A;  5J9B A;  4TN8 A;  4IJ3 A;  3V1W A;  4I5Q A;  5KN0 A;  1EOG A;  1LBK A;  4Q5Q A;  2R4V A;  4JU5 A;  2CT6 A;  2XBQ A;  1M99 A;  3HZ4 A;  3MIX A;  5G5E A;  2D2Z A;  4IQ1 A;  4XIH A;  1GLP A;  5G1K A;  2X4A A;  5D9T A;  3TKR A;  4DEJ A;  2HRA A;  4PGT A;  1XIY A;  1X9W B;  4HEA 2;  3W8J A;  1X5C A;  4MP4 A;  4G2E A;  4OO5 A;  3IK9 A;  2FA4 A;  1F9M A;  1THO A;  2RUE A;  3DD3 A;  4V1A g;  4EO3 A;  2GZY A;  5A1N B;  1I5G A;  3VFI A;  4K0N A;  4AKI A;  3EWL A;  4MNN A;  3ZLP A;  5DQY A;  5HR2 A;  2LJR A;  3DVX A;  2PN8 A;  2VKZ G;  3LW9 A;  1NM3 A;  2HZE B;  3KTL A;  1K3O A;  2GLR A;  1GTI A;  3GA4 A;  2B5E A;  3KH7 A;  4QL9 A;  5ECH B;  4FO5 A;  3ZFB A;  3TOT A;  2X8C A;  1HYU A;  3TRQ A;  4N10 A;  4ZB7 A;  1VGL A;  2EIR A;  1MDJ A;  4DSS A;  1SKW B;  4J57 E;  4ZB6 A;  1WIK A;  4EKZ A;  1FOV A;  2C3Q A;  1QK8 A;  2EFC A;  1AQW A;  2P5Q A;  1A2J A;  1AUC A;  1FB6 A;  3CSJ A;  4G19 A;  1BX9 A;  4G0K A;  3TCO A;  4XHM A;  1V98 A;  4EDY A;  3CMI A;  2H75 A;  5FT3 A;  2H1L A;  1ZYE A;  3D0Z A;  2IMK A;  3PGT A;  4XS4 B;  2DJ1 A;  2O89 A;  2F9S A;  5F06 A;  5ECP B;  1AQX A;  1U3A A;  2DJK A;  4I2U A;  4EIP A;  1TRV A;  3HD5 A;  1PD2 1;  2AUV A;  1BQ7 A;  2V2G A;  1OYJ A;  4CHS A;  4L8E A;  3GN3 A;  5C04 A;  3IR4 A;  2P31 A;  14GS A;  17GS A;  4WR4 A;  2JAC A;  3FR9 A;  1FAA A;  3ZML A;  1SKS B;  2HXK A;  1X9S B;  2I1U A;  5ECM B;  1T3B A;  2JSZ A;  2LQQ A;  3EMP A;  1RW1 A;  4CW9 A;  1NHY A;  2X64 A;  2CVK A;  5H5R A;  2KHP A;  2TRC P;  5D9W A;  2REM A;  2H0G A;  2LUS A;  5IOW A;  4NV5 A;  2TRX A;  3F6D A;  2VAF A;  3VK9 A;  1ERT A;  3EMX A;  1NW2 A;  4FH8 A;  4ZB9 A;  3KP8 A;  4O92 A;  4TVE A;  5A34 B;  1J9B A;  4PTS A;  3TJF A;  3VWU A;  4I8B A;  2DJ2 A;  4G0L A;  1MEK A;  3DXB A;  4GXZ A;  2EC4 A;  4MZW A;  1AAZ A;  4PUR A;  1M0U A;  1Z5Y E;  2LNS A;  3EIN A;  1YQ1 A;  2EIQ A;  3GYK A;  1GSU A;  3CRU A;  1SJI A;  2V32 A;  3VUR A;  4KB3 A;  2OT3 A;  4KE3 A;  19GS A;  4KND A;  6GSS A;  4K6X A;  4POL A;  3F4R A;  2CQ9 A;  2BTO T;  2BMX A;  1SK1 A;  3D6I A;  3L0H A;  1F3B A;  1OC9 A;  3GMF A;  4Z2U A;  1G7O A;  1ZYN A;  4ZL9 A;  5AN1 A;  1GUK A;  1B9Y C;  1BED A;  3I9V 2;  3O6T A;  2DKH A;  2I81 A;  1PRX A;  2C3N A;  4YQV A;  4F03 A;  2EIO A;  1U87 A;  1XW9 A;  5D8I A;  2C4J A;  4NWY A;  4BVY A;  2JU5 A;  3D22 A;  3FZA A;  2DJ0 A;  4QL7 A;  4NHW A;  3UBK A;  4K0G A;  3KEB A;  2NDO A;  3ZL5 A;  4ISD A;  2GSQ A;  2B7J A;  2H1B A;  2K9F A;  4TXO B;  1A2L A;  5ECS A;  1ACV A;  1HNA A;  1MTC A;  3ERG A;  2H6X A;  4BPY A;  4KSO A;  1GLQ A;  2MMN A;  1SVO A;  3HCZ A;  3C7M A;  3I69 A;  1Z6N A;  3C73 A;  4OFT A;  1Z6M A;  2QC7 A;  4XRA A;  1U3I A;  2YJ7 A;  3ZFL A;  4JE1 A;  2GQM A;  3QPM A;  5KN2 A;  4XRD A;  3EPT A;  1A2M A;  3PH9 A;  1X0R A;  3QOU A;  1GTU A;  3HJO A;  2VM2 A;  2HFD A;  4ID0 A;  2A2P A;  4O32 A;  5KEJ A;  2VLV A;  3F3Q A;  3IRA A;  2EFE A;  1S3A A;  5ECL B;  3G7Y A;  3LXZ A;  8GSS A;  2E2G A;  4L5O A;  3CBU A;  3KJY A;  1KNG A;  3GKK A;  2LJA A;  3EU3 A;  2X8H A;  5D9X A;  2CZ2 A;  3MAK A;  2H66 A;  2K8S A;  1TU8 A;  3GL5 A;  5E59 A;  4BA7 A;  2IMD A;  3C8E A;  3ZVJ A;  2HRF A;  1W4V A;  3GRX A;  3HVS A;  5IMD A;  6GST A;  2EFD A;  3RHB A;  3ZZX A;  4HZ4 A;  4FYB A;  1JLV A;  1OAZ A;  2PVO C;  3ED3 A;  4I2T A;  3P90 A;  1SVM A;  1FOH A;  1XWC A;  2M80 A;  3F6F A;  1XWB A;  2IMF A;  2DIY A;  4ILF A;  1Y25 A;  5J40 A;  3GSS A;  2DML A;  5JCW A;  3VI7 A;  3CTG A;  3ME7 A;  4DSQ A;  4P3Y B;  5G31 A;  5KOX A;  3LEF A;  4AJ7 A;  3LGC A;  4EXJ A;  2N5F A;  1TTZ A;  3FYG A;  3TKP A;  2R6K A;  3HHV A;  4POB A;  4PX1 A;  4GQC A;  1ON4 A;  2ALB A;  2B5Y A;  2GS3 A;  4N0Z A;  5AIS A;  2H6Z A;  1K0C A;  2A2R A;  2DJ3 A;  1GNE A;  1URM A;  2X99 A;  4YKG A;  2VM1 A;  4IW9 A;  2B1L A;  2AAW A;  4O5U A;  3ISO A;  2WS2 A;  2DLX A;  3DML A;  3HJM A;  3LWA A;  1U6T A;  3F63 A;  3DYR A;  22GS A;  2GZZ A;  1IYI A;  3QAV A;  5KN1 A;  1MD3 A;  2HZE A;  2RUF A;  3L78 A;  2E7P A;  3ZIT A;  4ZIJ A;  1VF3 A;  1A8Y A;  1JZR A;  3GKN A;  5BMU A;  3UL3 A;  2X8G A;  5AIX A;  4MPG A;  2I9H A;  1N25 A;  3R2Q A;  3EVI A;  3Q6O A;  2CVD A;  2AYT A;  5F05 A;  1A0R P;  2MMA A;  5DCH A;  4MF7 A;  1MDI A;  2VLT A;  2A4H A;  1H75 A;  2PVQ A;  5JWQ B;  3TU3 B;  5F8B A;  4ACS A;  2P0G A;  3FKF A;  1XVW A;  2JZT A;  4ML6 A;  4RQX A;  1G6Y A;  3NOF A;  3TRX A;  2GTU A;  1T00 A;  1CQG A;  5ELG A;  4GSN A;  1A24 A;  2HLS A;  1DE2 A;  4LL4 B;  1GSY A;  3MWH A;  4BL7 A;  4PQH A;  1NHO A;  1Z7R A;  2MMO A;  2H19 A;  2XPE A;  3I43 A;  2WGR A;  1YJ6 A;  1QQ2 A;  2LRT A;  5JWR B;  1SKR B;  4JED A;  2B6M A;  1WMJ A;  3G9B A;  2H8L A;  4X0X A;  1EEM A;  3D5J A;  2H0H A;  1TP9 A;  1E2Y A;  2LS5 A;  5FHI A;  1O6J A;  2V1M A;  4WXT A;  3IK7 A;  4EDZ A;  1JZD A;  2L5L A;  3LSZ A;  5IMA A;  4MF5 A;  2O87 A;  4O5R A;  4MDC A;  3F9U A;  3CSH A;  2FWG A;  4CY8 A;  1SK0 A;  4G9H A;  2CVB A;  2FWE A;  3ZVJ D;  3GH9 A;  3M8N A;  5A34 A;  2K18 A;  2O85 A;  3Q18 A;  3N5O A;  4AGS A;  4DVC A;  4RQR A;  2N5B A;  4KW6 A;  2C0G A;  4ECJ A;  3WGD A;  2QSI A;  2YWN A;  2YWO A;  4MCU A;  1WOU A;  2LTK A;  2H0I A;  2K6V A;  3G7I A;  3EU4 A;  2WB9 A;  2H72 A;  2YV7 A;  2YZU A;  1T4Z A;  3KD0 A;  3PPU A;  4TR0 A;  3GV1 A;  3GFK A;  2WRT A;  1GSE A;  3H1N A;  1O81 A;  4YAP A;  5EVO A;  3TJJ A;  1UVZ A;  3GKM A;  2V6O A;  4CY6 A;  1XZO A;  4KCA A;  2LKU A;  5CYY A;  1TRU A;  2L6D A;  1SJ6 A;  5BMU B;  1AIU A;  3BD2 A;  3US3 A;  2C8U A;  4WBJ A;  3KMN A;  1GSS A;  1VF4 A;  2FNO A;  4O7H A;  1Y1U A;  1ERU A;  1O73 A;  2YWI A;  4FQU A;  2RM5 A;  1JZO A;  3A2X A;  2KLX A;  3UVH A;  2XBI A;  3KTB A;  4ZL7 A;  4K2X A;  1SEN A;  2FWH A;  4Z2T A;  2DSA A;  3TKS E;  2NPB A;  1K3Y A;  3P7X A;  2H30 A;  4EC0 A;  2HE3 A;  2YNX A;  2J9H A;  1EV9 A;  3CWG A;  3L4N A;  1FW1 A;  4TXO A;  3KH9 A;  2AJQ B;  4V2N A;  1G6W A;  3FW2 A;  1BG5 A;  1QGV A;  5G5F A;  2WCI A;  4TR4 A;  2B5X A;  4AJ6 A;  3KGK A;  2R0G A;  3TDG A;  4F82 A;  4BL7 B;  2YOI A;  5DAK A;  3EE2 A;  2G2Q A;  2VLU A;  4PQI A;  2L4Q A;  3L9U A;  3F3R A;  1KBN A;  3Q19 A;  3DWV A;  2YPM A;  1MD4 A;  5IIZ A;  4KAE A;  2VL2 A;  3F0I A;  2KP2 A;  2VCV A;  2K8V A;  2LEG A;  3IBH A;  2GQK A;  5EL8 A;  4MH3 A;  1DSB A;  4TOP A;  1R7H A;  4KUN A;  3UEM A;  2H70 A;  2EFH A;  5B7C A;  2VD1 A;  2FWF A;  1SYR A;  2IMI A;  4WF5 A;  4WKW A;  5G1L A;  1YEX A;  4Z7X A;  3GST A;  3C1S A;  2XHF A;  2DIZ A;  2HNL A;  2OBK A;  1PGT A;  3QFB C;  1F2E A;  3LXT A;  4AI6 A;  4IP6 A;  4V2L A;  4TRX A;  1BF5 A;  4KGI A;  5IO2 A;  3UIW A;  1ZL9 A;  2OAC A;  5CRH A;  1TK5 B;  4MJB A;  5LNK e;  1K0O A;  5DJM A;  1ZYP A;  1SU9 A;  4XS6 A;  2VUP A;  3QMX A;  2AV4 A;  3UAP A;  5GSS A;  3RPN A;  4K5R A;  4J56 E;  4POM A;  4EE0 A;  5LD0 A;  4AKX B;  2JZS A;  2CA8 A;  3PIN A;  2DBC A;  5B6M A;  2KUC A;  1T1V A;  1VRS D;  2LQO A;  5ECO B;  4YAV A;  2P5R A;  1F6M C;  4EL1 A;  20GS A;  1U88 A;  3I6A A;  1XCC A;  4MLY A;  1OE8 A;  2H71 A;  1K0N A;  3HVX A;  3U5R E;  2MZC A;  2HSY A;  1M2B A;  4GRF A;  3KXO A;  1M2D A;  2JAD A;  5IOX A;  2IME A;  13GS A;  1YEP A;  3GHA A;  3DKS A;  7GSS A;  2GDR A;  3L9V A;  5HFG A;  1XPV A;  2O7K A;  2RLI A;  2VL3 A;  3WGX A;  2LST A;  4I97 A;  1B8X A;  4KA0 A;  1S3D A;  4H86 A;  4EIQ A;  3A2W A;  3WD6 A;  2HRK B;  3LG6 A;  1XFL A;  2KOK A;  5DAK B;  3W6G A;  4LMV A;  5INY A;  4MH2 A;  4LA1 A;  5HFI A;  1GUH A;  2ES7 A;  1V2A A;  4KCE A;  11GS A;  3QDN A;  2F8F A;  3G7J A;  5A5K A;  5IO0 A;  1K0D A;  4IHU A;  2R5G A;  2HYX A;  2UV8 G;  4HQS A;  2UZ8 A;  2PU9 C;  5E4W A;  3R3E A;  1TOF A;  3FK8 A;  5JCU A;  2QA2 A;  2A2S A;  4JBB A;  3HXS A;  1RQM A;  4F0C A;  1F37 A;  1HNB A;  2I4A A;  3U6V A;  2HSM A;  3L9S A;  3MDK A;  2IPA A;  1DBY A;  4WF4 A;  3K8N A;  1XBS A;  1ILO A;  2H74 A;  5A4V A;  2FA8 A;  3EC3 A;  3SBC A;  5J5N A;  2IFQ A;  4JR4 A;  2C0F A;  2RM6 A;  1H4O A;  5DQS A;  1PQN A;  4GSS A;  1V40 A;  5DCG A;  2H1A A;  2V6K A;  4F0B A;  1FVK A;  3GUR A;  2YZH A;  2YAN A;  2FGX A;  3KP9 A;  1VF1 A;  4FIW A;  2NTO A;  3IOS A;  5H5S A;  5J4V A;  4F2I A;  5A4W A;  4EF0 A;  5CP1 A;  4YQU A;  5B6N A;  3DVW A;  5JWO B;  3LOR A;  2GZP A;  4KSM A;  3IXR A;  4ZB8 A;  3JCM L;  1FHE A;  3HYP A;  3GX8 A;  1A0F A;  4BWQ A;  4USS A;  3LYP A;  4E8E A;  3F4S A;  4POK A;  3J7Y b;  1NSW A;  5ECI B;  4ZBD A;  3CRT A;  4KH7 A;  1EP8 A;  2ZNM A;  4NV2 A;  3FY7 A;  4GST A;  1SK2 A;  2M46 A;  4IGJ A;  2NVL A;  1QMV A;  2OJL A;  4JZQ A;  16GS A;  5J4U A;  2VCW A;  3LQ7 A;  5A4U A;  2V41 A;  4IQA A;  3VPQ A;  2IL3 A;  5LCZ A;  1OC3 A;  4N30 A;  3FR3 A;  1YVL A;  2NBS A;  4MA9 A;  2WDU A;  4XCS A;  4GTU A;  5L71 A;  1TXU A;  1CQH A;  2Z9S A;  4A5P A;  2R37 A;  2LV3 A;  3MSZ A;  3ZRE A;  3IDV A;  3M3M A;  2FLS A;  3APO A;  2PBJ A;  2WUL A;  4I6X A;  1XVQ A;  4BVX A;  1AC1 A;  1GTA A;  1PN0 A;  4NAX A;  2RII A;  3A3T A;  4ZXG A;  3UVT A;  2ZCT A;  2OE0 A;  5GST A;  2C0D A;  1TK8 B;  2ZUP A;  3WYW A;  4ECC A;  2L57 A;  1A8L A;  3E0U A;  5G30 A;  1T7P B;  1GWC A;  3GH6 A;  4JRR A;  5CNW A;  4GLT A;  4RI6 A;  2L6C A;  3FR6 A;  1HQO A;  3M1G A;  4D73 A;  1R4W A;  2VL2 C;  5J9C A;  2CZ3 A;  2HI7 A;  2OE1 A;  4K9Z A;  2GQL A;  2PWJ A;  2VO4 A;  5BRT A;  3IHG A;  1FO5 A;  4ZL8 A;  2YWM A;  1XOA A;  2F3M A;  2YN1 A;  3F8U A;  4LMW A;  2HSM B;  5IQY A;  3VWW A;  4EUY A;  4OFM A;  1ZMA A;  4Q5F A;  1V57 A;  1XW6 A;  2B3S A;  2VCX A;  1R26 A;  1X5E A;  2IFQ B;  5HR0 A;  3VI5 A;  1PA3 A;  5H5Q A;  1PKW A;  1UC7 A;  2H73 A;  4TR1 A;  4Q5R A;  1EWX A;  3CSI A;  4K1F A;  3M9J A;  1WJK A;  1K3L A;  3W8S A;  5A5H A;  2CAQ A;  5ECK B;  3GKX A;  1M9A A;  2HT9 A;  5IPH A;  6GSU A;  5IMF A;  1TRW A;  1SL2 B;  4WEY A;  5D96 A;  1B4P A;  4NPB A;  4PNF A;  1WWJ A;  3UBL A;  2L4C A;  3ZIV A;  2CX3 A;  3QR6 A;  2VOC A;  5IMZ A;  3ME8 A;  1GSF A;  1PKZ A;  2FY6 A;  2H1G A;  3D4T A;  1SJZ A;  3A5W A;  4MK3 A;  4AKG A;  3FEU A;  3TKS A;  3ZIJ A;  1T8E B;  4LLR A;  2DC5 A;  1OKT A;  5CRE A;  1GTB A;  4G0I A;  2ON7 A;  5AIV A;  4G10 A;  2F51 A;  3TGZ A;  1BG1 A;  1ZGN A;  5JCG A;  4MJA A;  3BCI A;  5IMC A;  3HKR A;  2QGV A;  1WP0 A;  4KDY A;  2HSN B;  4OWY A;  1YKA A;  2R0P A;  1X9M B;  3OR5 A;  4CDO A;  4N3Z A;  4GCI A;  3TRP A;  1M7T A;  1N2A A;  1GRX A;  3HY2 A;  1XWG A;  4ICY A;  1TRS A;  1UN2 A;  1B9X C;  3IAM 2;  3TJG A;  4TR3 A;  4L0U A;  4HU7 A;  1X5D A;  4PUF C;  1B48 A;  1GH2 A;  2R0C A;  2R3X A;  2HSH A;  4V1A p;  5GAP D;  2GT5 A;  4HOJ A;  4BVX B;  2A4V A;  1HD2 A;  4PXO A;  4MAB A;  3ZRD A;  3EUR A;  3M9K A;  1SL0 B;  3IE3 A;  3H93 A;  4PUA A;  3P2A A;  2DJJ A;  4KX4 A;  2MMZ A;  4HDE A;  3FMW A;  3HJP A;  3UOM A;  1AXD A;  4E68 A;  2H6Y A;  3EYT A;  1TI3 A;  5IMV A;  3ERF A;  1ZYQ B;  4D73 B;  2C80 A;  1AQV A;  1KEB A;  2LJK A;  5KOW A;  5EY6 A;  4K5S A;  2OAD A;  2O8V B;  5ELA A;  9GSS A;  3TJB A;  1GUL A;  3VWV A;  2CV4 A;  4QQ7 A;  1VF2 A;  1O8X A;  1SVL A;  3ERW A;  4YQM A;  1E6B A;  1M2A A;  1O7U A;  1XOB A;  4RUV A;  2JZR A;  4QMK A;  5D9V A;  1G7E A;  3UMA A;  5GAN D;  3Q74 A;  4MMM A;  2KP1 A;  3TUE A;  3CYN A;  1TK0 B;  1THX A;  1YF0 A;  2XC2 A;  5ABR A;  2HRK A;  4TR1 B;  3UAR A;  1EEJ A;  1GP1 A;  3H8Q A;  4GWR A;  3KMO A;  1PMT A;  1R5A A;  1EZK A;  1ST9 A;  10GS A;  5A5H B;  4XTS A;  3HVV A;  4KDX A;  3FZ5 A;  3IV4 A;  4HZ2 A;  2FUG 2;  3LJR A;  4X1U A;  5J41 A;  1QXH A;  3QCP A;  1GSQ A;  4HUA A;  6GSY A;  3DGQ A;  1T4Y A;  2OE3 A;  3O3T A;  3NZN A;  4G01 A;  2PGT A;  1M9B A;  2IWT A;  5B8B A;  1FB0 A;  3D21 A;  4J2F A;  4WR5 A;  1TXX A;  2E0Q A;  4F9Z A;  4IS0 A;  4Z2R A;  1DE1 A;  3SWL A;  1BAY A;  4DSR A;  3IHQ A;  3BJ5 A;  3CTF A;  1WE0 A;  3F4T A;  4K8M A;  5AGY A;  1XWA A;  3HDC A;  2H76 A;  3GL3 A;  2VD0 A;  4JR6 A;  5IPG A;  4IKH A;  3E3E A;  4O5Q A;  3QFA C;  3GTU A;  1JZW A;  1I9D A;  4AF2 A;  2XPD A;  4Q5N A;  1YKC A;  1FVJ A;  4IJI A;  4HS1 A;  4N0V A;  1GSD A;  1PN9 A;  3DIE A;  3O76 A;  4OFN A;  2IJY A;  5CRW A;  2N5A A;  1ERV A;  4FYU A;  4KF9 A;  4X4J A;  5B8A A;  2GSR A;  3UJ1 A;  2B7K A;  5HQP A;  2CX4 A;  5DJL A;  2LNT A;  1W89 A;  1JFU A;  5CO3 A;  2VCZ A;  5HR1 A;  2I3Y A;  4IN0 A;  5DDL A;  2IN3 A;  3A5I A;  3DEX A;  1USB A;  1LU4 A;  1GNW A;  1PSQ A;  1EOH A;  1UA5 A;  2FD3 A;  1YZX A;  2C1Y A;  5DAL A;  5HFK A;  2GT6 A;  1XXU A;  3TKQ A;  4ZIL A;  4OO4 A;  3TB2 A;  4OMV A;  2GGT A;  1XW5 A;  2YV9 A;  4HJM A;  4ECB A;  1K0M A;  2OBI A;  4TKY A;  4ULX A;  3ZYW A;  1Z7P A;  4XS1 A;  3AY8 A;  3H79 A;  1WPI A;  4DSS B;  3KM6 A;  3RAZ A;  5ECR B;  3P8W A;  2BJX A;  1ZOF A;  4K7N A;  4TW5 A;  4L5L A;  3DRN A;  1EGO A;  4MPF A;  1A23 A;  2FCH A;  4AKH A;  3GNJ A;  5ENU A;  1IYH A;  2M72 A;  4MZC A;  5J3R A;  2R2J A;  1O8W A;  3FZ9 A;  2CAI A;  3FRC A;  1FG4 A;  2HZF A;  3FHK A;  2L5O A;  2LRN A;  4IEL A;  1EP7 A;  1ERW A;  18GS A;  4HU9 A;  2VL9 A;  4WBR D;  2MYG A;  1AW9 A;  1PX7 A;  4PNG A;  2YP6 A;  2IIY A;  3H4K A;  1YDK A;  4OCF A;  4W66 A;  2J23 A;  1YY7 A;  3HZ8 A;  3QAW A;  2OA7 A;  4YKF A;  1TKD B;  2OKA A;  1R5P A;  5ID2 A;  1Q4J A;  2VCQ A;  1Z3E A;  4V2M A;  3FZ4 A;  1OE7 A;  12GS A;  2PMT A;  3TKS C;  4GDF A;  4IVF A;  5KN3 A;  2H1D A;  3KZQ A;  1TDI A;  2G0F A;  1J0F A;  4ML1 A;  3QAG A;  4YH2 A;  2ON5 A;  3A2V A;  3MYD A;  1SD8 A;  3GTU B;  5DBQ A;  3BCK A;  1BJX A;  1Y6E A;  2YCD A;  4PQ1 A;  4OCE A;  1SD9 A;  5CRG A;  5C00 A;  3BOA A;  4L0W A;  3LFL A;  4TXV A;  2PER A;  3D4M A;  3GUS A;  6GSV A;  4HQZ A;  6GSX A;  3S9F A;  4GF0 A;  3TJK A;  1XWK A;  1JLW A;  3RDW A;  2QKE A;  2E2M A;  6GSW A;  1QUW A;  5ECQ B;  3IPZ A;  4MZB A;  5DAL B;  1V58 A;  1LJR A;  1C72 A;  2C3T A;  2WJU A;  1S3C A;  1JHB A;  3KIJ A;  2LRC A;  1EGR A;  1PL1 A;  1WRY A;  5HR3 A;  4HI7 A;  1TW9 A;  1GL8 A;  5GZZ B;  3IC8 A;  1GUM A;  2TIR A;  4AJ8 A;  5CAX A;  3GIX A;  2HSN A;  4ZBB A;  1OC9 B;  3QD9 A;  4NXI A;  4MJC A;  1K0A A;  2GSS A;  4ECI A;  3TOU A;  5IM9 A;  4FYC A;  2PUK C;  1F3A A;  2C0E A;  4X43 A;  1BYE A;  4N11 A;  2HRN A;  2WZ9 A;  2PPT A;  2AHE A;  3WGE A;  1G0T A;  1V9W A;  4BVY B;  1TI1 A;  1Q98 A;  3RBT A;  2B1K A;  3CXG A;  5ECN B;  1ABA A;  4WET A;  5A1N A;  2MBT A;  2JSY A;  4K7O A;  2X49 A;  1SL1 B;  4KDU A;  3VPT A;  2YJH A;  2JL4 A;  1B4Q A;  4IBP A;  4OD7 A;  5EPF A;  3RHC A;  1TJD A;  1KTE A;  4MF6 A;  2DKI A;  3NIV A;  5G2Z A;  2HQT A;  2VIM A;  1PL2 A;  1ZZY A;  1EV4 A;  3M0F A;  1TU7 A;  3ZMK A;  3HMJ G;  5COH A;  1K0B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...